2NWNA

New pharmacophore for serine protease inhibition revealed by crystal structure of human urokinase-type plasminogen activator complexed with a cyclic peptidyl inhibitor, upain-1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
246
structure length
240
Chain Sequence
IIGGEFTTIENQPWFAAIYRRSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSALAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasminogen activator, urokinase
publication title Structural basis of specificity of a peptidyl urokinase inhibitor, upain-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 240
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nwnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nwnA01
1OPHB 2XC5A 3E90B 2BLQA 1BTXA 1MZDA 3W95A 5CE1A 3Q76A 2BY7X 2A7CA 1ZGIA 1HXEH 3E1XB 2Z3CA 1EPTA 1Y8TA 4I32A 4MQAA 1SL3A 3S9CA 1P9SA 1SI5H 3L6PA 1BBRK 4BXWA 4MNVA 5EOKA 1HYLA 2HPQH 5E8EH 1GL0E 1C1SA 3SO3A 1EQ9A 1K1MA 2IJOB 2VNTA 2QF0A 1UCYE 1TBQH 1OSSA 2XRCA 1SC8U 1T8OA 1A3BH 2ODPA 2Z9GA 3IG6B 3ZV8A 1WUNH 3EYDA 1TX8A 1F0SA 3UY9A 2ZZUH 2GZ9A 1W13U 3T25A 1G3CA 2BOKA 8GCHF 1TPAE 2FOEA 4FUGA 2G51A 3RXTA 2UWLA 4YLUA 1GJ4H 1CGJE 4BTIB 1V2JT 1P2OA 1IQIA 1N8OC 1O3FA 2PLXA 4INHA 4AZ2B 1O3GA 4WXIA 2Q6DA 2FDAA 1EJNA 1O2LA 4X1QU 2OC8A 1GI8B 3O8CA 1HFDA 2GCTB 1GI3A 2FM2A 1UTKA 3QDZB 1PPZA 2J9NA 1C5YB 4BANB 1C5PA 2ZU2A 1TQ0B 4O9VA 2O9QA 3A84A 3AASA 1C2IA 3LC5A 3RC4A 3T2NA 1P2QA 2BMGB 2FOHA 1SGIB 1AFQC 1DITH 1Z6EA 4YOGA 2W5EA 3P8OA 5GJ4B 2J34A 2QF3A 5FX6A 2OINA 1GJ9B 2D1JA 1THRH 2BHGA 1SGFA 2QIQA 1RGQA 1YPEH 4B1TA 4FUBA 4NIVA 5EW1H 2ZIQH 4O03A 1RTLA 1ZHRA 3SV9A 3B23B 4FU7A 1DDJA 2VH6A 1FZZA 5DGJA 1F2SE 1PPFE 1O2WA 3FP6E 2ZFPH 2XCFA 2R9PA 1B5GH 1GHAG 1P05A 2G5VA 2XWAA 4AYYB 3VPKA 1AE8H 4U30A 2Z9KA 2BVRH 4CREA 4QT8C 1C1UH 1WTHD 1Z71A 1O35A 2A4GA 2CXVA 4IN1A 1T8NA 2D2DA 1OYQA 4BAOB 3O8RA 4OS6A 1GHWH 1EPTB 5ESBA 2VIQA 3EE0B 4AB8A 1UTQA 4FUHA 1QNJA 3W94A 1O3JA 1UVUH 4CRFA 4FU9A 1GBHA 3BV9B 1GI4A 2FYQA 2PUXB 1O3HA 3SV8A 1C5SA 1H8IH 2XBYA 1IQLA 1MH0A 1HIAA 2BD7A 4JZDH 4JMYA 1F7ZA 1VGCC 2ZU3A 1W8BH 1C2HA 2A1DB 1OOKB 1T7CA 2C93B 1O2SA 3NPSA 1P3CA 3ZVEA 1J16A 3CENA 2FLBH 2ZU4A 2BY8X 1BBRH 4Y7AA 2AS9A 3RXBA 2BD2A 4K8BA 4A7IB 1NTPA 5C20A 3L33A 1KY9A 4WJG2 1MU8B 3UOPA 1ZJDA 1HXFH 1DLKB 1SHHB 3RXLA 2HPPH 1XKBC 3STJA 3SHCH 1NROH 1SQAA 5L6NH 2ZHDA 4CRAA 4WY3A 1S85A 1RS0A 3TK6A 3SHAH 2SGFE 1Y5AT 4ABGA 1ELCA 1PFXC 1NFWA 3ELAH 3K6ZA 3VB7A 1G3BA 1LCYA 1U6QA 1V2OT 2UUKB 1GHAF 1NRNH 1F0RA 3PV4A 1UK4A 1GJBB 2CHAB 3FANA 1DX5M 2C90B 1TX6A 2RA3A 1ZRKA 1W14U 3SJOA 1MKWK 4KP0A 1W10U 5EXLA 2ZI2H 3KN2A 1O39A 1O30A 1AWFH 1SHYA 2ZDVH 4LK4A 1OS8A 1NC6A 1VCPA 3QLPH 1RIWB 4K2YA 4AFSA 4E06H 3SV6A 5EG4A 1AWHB 1HCGA 3LGYA 1O0DH 3NKKA 4U2WA 1TPPA 3RXCA 5GPIB 1K1IA 1TOCB 2A7JA 3DUXH 1TBZH 2CV3A 4YT7H 1BJUA 4F49A 3TJUA 3ZZ9A 2CF9H 4MPWA 2BTCE 4ZXYH 3DD2H 2R3UA 1EZXC 5I46H 1AZ8A 3Q3XA 5L2ZH 4B2AA 1Z8IB 2KAIA 1O3AA 5EPNA 1T8LA 2BX4A 2ANWA 3SJKA 3RXDA 1EJMA 1L4DA 1MMJN 3LJOA 3VB6A 3F1SB 1MTWA 3BG8A 2VIOA 1EB1H 2XC4A 1YP9A 4UFGH 5GIBA 1CHOG 3SNDA 2GV6A 3SJ8A 3UPEA 3M7QA 4HFPB 1C1PA 1FPHH 4AN7A 1V2KT 4E7RG 2BDIA 1FNIA 5LPFA 1KTTB 1GMCG 2W7SA 1ANEA 3QZRA 2Z7FE 3F9EA 1HIAB 1GJ7B 1ZTKA 1RJXB 5FCRA 1O2PA 1C5LH 3A89A 4I8KA 1HLTH 4X8VH 3GCTG 2LPRA 1PYTD 2JH0D 3MO9A 1P8VC 2GCTC 4OGYA 3U69H 2BDYA 3WY8A 1FY8E 2QYIA 1O3BA 1LPGB 2OTVA 2P8OB 3LH1A 4X6MA 1MTUA 1EP5A 2Y5GA 1Z6JH 1LPZB 1C2LA 3LC3A 2WV5A 2O8WA 4ABFA 2TBSA 2QN5T 4OS7A 3RXAA 1C1NA 2ZF0H 1ZRBA 2ZECA 2G4TA 1H9LB 1OX1A 1QBNA 1S0QA 2BQ7B 2JH6D 1J17T 1E35B 3AVZA 2BZ6H 3V7TA 2ALVA 2F83A 4INKA 1SGCA 2FO9A 5A0BA 2Y7XA 2O8MA 3U1IB 1X7AC 4CRDA 4NZQA 4IC5A 1ABJH 1CHOF 1E37B 4X0WU 2ZPRA 3HGPA 4I33A 3ZYEA 4I8LA 3SNCA 2ZGXH 1GMCF 1V2NT 3MNXA 1H9IE 3PWCA 3FFGA 2A31A 3SOSA 2FLRH 5LPEA 2BLVA 1EPTC 1BTUA 4FUEA 3AW1A 3GCTF 1MKWH 1GBFA 1O2TA 1QB1A 1XUJA 3GOVB 2FPZA 3T26A 4B2BA 1BRCE 1LVYA 3OX7U 1ESTA 2KAIB 1TPOA 1P02A 1IAUA 2IOTA 1A0LA 4X1RU 1QA7A 2GD4B 2Y82A 1MTNC 3FZZA 2F9VA 2M5TA 2QXHA 3QTOH 3ZZ6A 4HTCH 1RTFB 3KQBA 2LNCA 2XBWA 1A7SA 2FX6A 3SJIA 1AMHA 1BB0B 1RXPA 1FI8A 1ID5H 3ODFA 3RXFA 3EA7A 2P3TB 2C8ZB 2G52A 4H6SB 1ZPZA 1YGCH 2BQWB 1TBRH 5FPSA 2AGIX 4JK6A 1GBDA 1V2LT 3E3TA 1QJ7B 3RXGA 2PKAA 2RA0A 4WWYA 4ISNA 3GY8A 4X1SU 8ESTE 1CT4E 1AKSB 1TNGA 1INCA 1XKAC 1GG6C 2CHAC 3UWJH 1G2MA 2V3HH 1YPGH 4D7FA 1P11E 1O2XA 5EW2H 1AI8H 3FAOA 2BD4A 5FBIA 5IYTA 2UWOA 3RXKA 1K9OE 3P6ZB 1O32A 1VZQH 1O31A 2DE8A 3TGJE 1HJAC 1HAVA 1D3PB 2A2QH 1L1JA 1DT2A 1RIWC 4Y71A 3MU0A 4ABJA 3PYHA 2PSXA 3DFJA 1DE7H 1EP6A 1OWEA 2WPJS 1C5UA 1CT0E 2A5KA 2NU3E 2UUJB 1A1RA 1MQ5A 1SB1H 5F8XA 1UJ1A 1S81A 3B8JA 4X6OA 3I78A 5TCCA 2JKHA 1V2VT 4INLA 1GHVH 3ATMA 3BEUA 2BD5A 3RLYH 3TK5A 3LGUA 4Y10E 4GHTA 1V2ST 1AFQB 2R2MB 5EGMA 4WH8A 2GP9B 1C5MD 3Q3YA 1GI1A 1FONA 1UTMA 3TLOA 3SGAE 1O2KA 1B0EA 1CBWB 1P06A 2ZFSA 3LT3A 3PTNA 3A7YA 4YZUA 3VGCB 3TH4H 2RDLA 3BTGE 1DVAH 4CHAB 2BXUH 1FQ3A 2OC1A 3PB1E 1ZSLA 1YBWA 3QN7A 2GV7A 1F92A 1A5GH 2C8WB 1PPHE 1O3IA 2ZDLA 2VB0A 3PMBB 1QL7A 3MH7A 3PWBA 4WMFA 3U1JB 2ZGJA 3STIA 4DGJA 4LZ1H 1GHYH 2HGTH 1EZUC 3M7UA 2B9LA 1AUJA 1O34A 1MKXK 1HAOH 1RFNA 3MNBA 4NWLA 4YTAA 5CMXH 1WBGB 2OD3B 4ISIH 2P8OC 3RXIA 5FHTA 4GUXA 1YCPK 1SGEE 2WPKS 1ZGVA 4K5ZA 1C2MA 2A32A 2GX4A 4U32A 3KQCA 3A8AA 3TH2H 3GCHB 2ZGBH 1S6HA 2VWNA 2ZO3H 3TU7H 4YO9A 1SMFE 2CJIA 5CHAC 2PR3A 1V2WT 1QR3E 1ZSJA 1TGBA 1K22H 2FXRA 5JBTA 1QBVH 1YPLH 4MPXA 3A8CA 1XUIA 1K1OA 1JRTA 1ELDE 3S7KB 1QY6A 3U8RH 5GXPA 2EEKA 4AGJA 1BRAA 2WINI 2A7HA 2R0KA 3LJJA 4XOJA 4CR9A 1Q31A 1HDTH 2V6NA 4MG3A 1FV9A 2XWBI 3SQEE 5HM9A 1J15A 1C2EA 3A7ZA 1SLVB 1O2OA 2BLWA 3ESTA 4I7YH 1O5BB 1MBQA 1BHXB 1ZMNA 4X1NU 1UVTH 3RXMA 4SGBE 1SFQB 3U98H 9LPRA 1WV7H 2I6SA 1GJAB 2PV9B 4DT7B 1G3DA 2ALPA 2OC7A 5DP9A 1KDQB 2ZHFH 3TITA 1ZPCA 4U01A 4X2XA 4Z0KA 3BTKE 3OY6U 2R2WU 4X8SH 3OYPA 3MNCA 1ARCA 1FIZA 1YPKH 3BTME 3A88A 4IS5A 2C8XB 1OWHA 3AAUA 1QURH 1SGDE 1TYNA 4ZXXH 1MZAA 4CR5A 4NG9H 1D4PB 6LPRA 2ZTXA 4ZKSU 2DUCA 3KCGH 1VCQA 1AD8H 1SLUB 4I8GA 1ELFA 1O5FH 1ACBE 2F9OA 2NU0E 3M35A 1BT7A 1XM1A 2BDCA 3F9GA 1S84A 3I29A 3BEIB 4Y7BA 4ISHH 1FY4A 1N1LA 1H4WA 2ZGHA 1SSXA 2GDEH 1NRSH 1SLXB 1XMNB 2VWMA 2BDAA 2CMYA 1AQ7A 1TQ7B 5DO4H 4XSKU 4ZAEA 3SBKA 2BOHB 4H4FA 1TRMA 5IDKA 2TRMA 3RXRA 3PMHB 3LKWA 1G3EA 5PTPA 3MYWA 1SG8B 3E6PH 4A1TA 1BUIA 1D3QB 1MKXH 2BDHA 1S0RA 3PTBA 4NFEA 1GGDB 4BXSA 1GDQA 1S5SA 2VINA 3A7XA 4NIXA 2VVCA 5K0HA 1GCDA 1WSSH 3V3MA 4TYDA 4UEHH 1YCPH 1KXCA 3ATKA 4ZROA 3EA8A 1BMAA 1DANH 2FODA 5LPRA 1GI7B 3MU5A 1CQQA 4I31A 1EOJA 2PHBA 3ATLA 3F68H 1G32B 1SGQE 4HGCA 4BAKB 2FMJA 3NXPA 3P70B 2UWPA 3DHKH 1B7XB 1SQOA 4YOIA 1CO7E 3MH4A 9ESTA 2GZ7A 4ISOA 1NRRH 3UR6A 4TY7A 1SVPA 1TRNA 1O33A 1GBIA 4TPIZ 4K3JA 4IC6A 3HKJB 3TPIZ 5J4QA 3MH6A 3ZZ4A 4KKDA 2BD8A 1CBWC 1P2IA 1ELBA 3VGCC 4B74A 2F3CE 1ABIH 1BMMH 5EXNA 2ZCKP 4CHAC 4DOQA 1K1JA 1A3EH 4JZEH 1EXFA 1J8AA 3H5CB 1XXFA 2FOGA 5C5NA 3HPTB 3S9AA 3F9FA 3RXHA 4HZHA 1BTHH 1XUKA 2R3YA 3UQVA 3RM2H 2WYJA 1DOJA 1UK2A 2CN0H 3SV2H 4B71A 1DLEA 5H4IB 3LOXA 3UR9A 1FDPA 1GVKB 1NFYA 1HAXB 4GHQA 4XDEA 3B9FH 3EAJA 2R0LA 3MU8A 4RN6A 1QQUA 3SNBA 4E05H 5L2YH 1DWCH 2FI4E 1P04A 4DY7B 1WAYB 3GCHC 3A81A 4ABIA 1ORFA 2W26A 2ZA5A 1ZOMA 2ZQ2A 2AERH 2VIVA 2TGDA 3A7VA 4Q7ZA 5EU8A 3PO1B 1ZPBA 1QRWA 3GYMA 3Q77A 4AG1A 1PQ5A 3GY6A 4BAHB 1HAGE 3ODDA 3FVFB 3GY4A 1MTNB 4ESTE 2Y5FA 1N6XA 3PLBA 1UTLM 2A2XH 1Z1IA 5HXFA 4CBOA 1XX9A 5GWZA 1D3DB 1PQ8A 5DP7A 2TGAA 1TNKA 3ZVAA 2Z9JA 3UUZA 1GBJA 4X6NA 5DP5A 1G30B 4NIWA 7ESTE 2FTMA 2HALA 1GDUA 1UCYK 5BRRE 2A0QB 3QWCH 2G00A 2Z3EA 5DPAA 3A83A 3NZIA 1GG6B 1O5CB 2SGDE 1KLIH 2CGAA 2V3OH 5FCKA 3MHWU 4XBDA 3MWIU 2Q1JA 2HNTF 4GCHG 2HLCA 3UNQA 1IQEA 4AORA 4THNH 3DFLA 3PROA 2ZPSA 1QFKH 1HJAB 4JYTA 7LPRA 1CA0C 2F9UA 3KQDA 1Y5UT 3GY7A 3ZZCA 4NA7A 3ZZ7A 1N6YA 1J14A 5GDSH 2A5AA 1O2MA 1AE5A 1E34B 4FUCA 1QL9A 2QA9E 2AFQB 3SQHE 4IN2A 1HAIH 3GCNA 3T27A 4ISLA 1LKBA 2F9BH 1O3LA 2EC9H 1AB9B 1AHTH 2OBOA 2WPLS 1V2UT 1G9IE 1MTVA 2BD3A 2PKSB 1QA0A 2FS8A 1F5RA 2WPHS 5E0HA 1H8DH 5DKMA 3AAVA 2WUCA 1ZTLA 2HNTE 1MAXA 4BNRA 1W7GH 2XBVA 1L4ZA 1TMUH 1HAHH 2P16A 2SNWA 2BY6X 1KXAA 1NT1A 2THFB 3QGNB 1EUFA 3SV7A 2ZFTA 1SGYE 3SW2B 3MFJA 4E7NA 1WCZA 1XUFA 5DJ7A 5HMAA 1TIOA 2QC2A 1ELGA 1GGDC 1KXBA 2VIPA 3GY3A 3S7HB 2PGQB 2J95A 1LQDB 1LVMA 3EDXB 2O8TA 4UFDH 4GCHF 2SGPE 1ZTJA 5JB8S 1AVXA 1FXYA 2BVXH 4AOQA 1HJ9A 1QRXA 1AKSA 4DIHH 1IQNA 2ILNA 2PWXA 1C4U2 3FP7E 4XBCA 5A0CA 5C1YA 3SUGA 1C5VA 1SPJA 1T4VH 1BRBE 1TALA 3E91A 4TWWA 1CU1A 1LVBA 4H42U 5K7RA 1C5NH 2ZEBA 5CHAB 1FAKH 1PQAA 4DW2U 2GCHG 1BA8B 2Q6FA 3SN8A 5LGOA 3HK3B 1DXPA 1C9PA 1O2QA 3UREA 1GBKA 1CHGA 2H2ZA 1XVMA 3URDA 1BJVA 2ZDKA 1ZR0A 8LPRA 2QV1A 1FN8A 1TE0A 5ETXA 3BF6H 1BTYA 1W7XH 3E0PB 4NSYA 2ZKSA 2SNVA 1BHXF 4Y0ZE 1ANDA 1ESBA 1FN6A 1UCYH 1GBAA 4MVNA 1ESAA 2ZC9H 4O97A 5A8XA 1DUAA 1P01A 2F91A 1KXFA 3A7TA 1WQSA 1WYKA 1JIRA 3BTFE 4KTSA 2V0BA 5E0GA 1WQVH 4AYVB 1AZZA 2V35A 1DWBH 1H1BA 1GI5A 3A82A 2BZAA 3RXSA 4CH2B 1GHBG 1C5QA 3SNEA 1DXWA 1H9HE 5A8YA 2HRVA 3P95A 5DP6A 3QTVH 1BTPA 1W0ZU 2BXTH 1QRZA 1T31A 1VITG 5FPTA 1ETTH 2VIDA 1HBTH 1GBLA 3PO1C 4X2WA 1A46H 4MNWA 1A5IA 2PGBB 5C1UA 2VVVA 3D49H 3QX5H 2G5NA 3S9BA 2SGAA 4PROA 1VR1H 4ABHA 2H6MA 4FU8A 3RC6A 4WF8A 3AW0A 1A0JA 1GWAA 2GT8A 2GCHF 1AVWA 1BIOA 2ZPQA 3V0XA 4M7GA 4XE4A 1CGIE 4K60A 4DG4A 1DY9A 1SR5C 1MD7A 4MNYA 2GMTB 3SNAA 3ZV9A 4Y76A 3RU4E 1QHRB 3CP7A 5E0JA 2GZ8A 1WOFA 1TLDA 1TGSZ 3RXVA 3CS7A 4NFFA 5LH8A 1O3MA 4Q2KA 2NWNA 1GJ8B 2FZZA 2GT7A 2I6QA 2NU4E 3MI4A 1BCUH 1PQ7A 3PLKA 1GHBF 2H1UA 4YLQH 1C2FA 1D6WA 3TJNA 3SI3H 3SU4A 4K1SA 4IGDA 1O2ZA 1VITF 3IITA 1O3PB 2ZFRH 3ZVDA 1NO9H 1KLJH 1QBOA 1BTZA 1P3EA 1V3XA 3SU6A 4FUJA 1ZMJA 2FOAA 1KDQA 3HGNA 2A4OA 1UMAH 1P2MA 2OBQA 2PTNA 3SI4H 1O2UA 1O2VA 3A80A 1YCPM 5C3NA 1AB9C 1TNIA 1P09A 1NZQH 1OXGA 2Z6BD 1OP2A 2PKSC 5EQSA 3M37A 3HKIB 2H5CA 4Y79A 4Z6AH 1EB2A 1NESE 4R0IA 2G81E 4DJZB 1AN1E 2SFAA 3D23A 4WMDA 4WH6A 5BPEA 1OP8A 1OWJA 2H5DA 5DK1A 3RXEA 2P59A 3LIWA 1IQHA 3GISB 5TJXA 2ZQ1A 3MU4A 1NRQH 2QXJA 1EZSC 3A86A 5JB9S 4JK5A 5T6DA 1Y59T 3TNTA 1P57B 3DT0H 1DWDH 3TIUA 5EXMA 3BTQE 4FVBA 4AX9H 5JBBS 5F8ZA 1YLCA 1ZSKA 3KQEA 3SU5A 3RXUA 2YNBA 2SGQE 1KLTA 3LPRA 3FP8E 5DP8A 1PPCE 3RXOA 5E2PA 3RMMH 4Y11E 2P95A 1CE5A 4I8HA 1Z8JB 4DIIH 1Y3XA 2WV4A 2TPIZ 1DPOA 1MTSA 4X6PA 1CSOE 5A2MH 1O38A 2VWLA 3RM0H 1IQGA 3RLWH 1QL8A 1C1MA 1SGFG 1UVPA 4JYUH 3GY2A 1LHCH 4IW4E 4Y8YA 1G2LA 2ESTE 2QAAA 2OQUA 1GVZA 3GY5A 3L3TA 1A4WH 3SU1A 3SGBE 4RKOB 1JBUH 1YF4A 2AIQA 3H7TA 3TJVA 1DSUA 1F5LA 4YESB 2NU1E 2EA3A 1GI9B 4ZKOU 1W0YH 2ZWLH 4FUDA 5AFYH 1ZJKA 3MNSA 1TMBH 3BEFB 4IMZA 2OCVB 2DE9A 1BDAA 2XC0A 1E36B 1S83A 2BM2A 2STAE 3SU0A 5FXLA 3QZQA 1JMOH 2F9NA 3KGPA 3ZZDA 4FXGH 4MPUA 4D7GA 1TGCA 3M36A 4NIYA 5JYIA 1HAYB 1CT2E 2D26C 2C3SA 4XBBA 1C4V2 2FOBA 3R0FA 1T8MA 2FIRH 2ZFQH 3T62A 1CA0B 4MTBA 3VB5A 2B8OH 2UUYA 3T28A 1C5ZB 3VEQB 3LGVA 4OS5A 2GVFA 1P9UA 1TB6H 4R8TB 2A5IA 1LDTT 1ZMLA 1IOEA 2ANKH 1D3TB 3NCLA 1EAWA 1ZYOA 3DA9B 3SUFA 2PUQH 1TOMH 1W3CA 3C1KA 4AFUA 3MO6A 1GJ6A 1UTOA 1BMLA 1O2NA 2GMTC 4KGAA 1TPSA 2J38A 1TA2A 4K1TA 5HYOA 1C2KA 4D8NA 4AFQA 5I25A 3QK1A 5C5OA 1UHBA 2JH5D 4KTUA 2H9HA 1ANCA 1ETRH 5A0AE 1WTGH 3KL6A 3LGWA 5ABWA 1O2JA 1FUJA 3E8LA 3OTJE 5SGAE 3TGIE 2G55A 2W3IA 1G36A 4TPYA 4ZKNU 2HNTC 1NU9A 1DICA 6ESTA 3VB3A 1ANBA 1Z1JA 1Y3YA 5DP3A 5FPYA 1IHTH 1TGTA 1G37A 1E38B 4CRBA 3RU4T 3U8OH 2ZDAH 1GBCA 3LONA 2VJ1A 3BIUH 1K28D 1S82A 3VFEA 5AF9H 4CRCA 3NK8A 3VXFH 2BQ6B 4TY6A 3UOUA 4FUIA 3ZZ3A 2P3UB 3P17H 4O3TA 5F8TA 1GCTC 2EI8A 1Z8RA 1AUTC 3GDUA 3PMJA 1EAIA 2OP9A 2WUBA 2J4IA 2BX3A 1JXPA 1NS3A 4UD9H 3ITIA 1O3NA 2HVXA 2OLGA 2ZG0H 1YPHC 2ZHQH 3M61U 4BTTB 1IQJA 1QJ6B 2Y5HA 1KTSB 1VJAU 1BMNH 1XUGA 2FOFA 4DCDA 2SGEE 1NFUA 4J2YB 4KELA 3RMNH 3KNXA 1PYTC 1EKBB 1XVOA 2ODQA 4JZFH 1O2GH 2P3FH 3KF2A 5TCAA 1SGRE 1W12U 3UNRA 1W11U 1LHFH 2TIOA 1RTKA 3BTHE 2ZP0H 3ZZAA 1GDNA 1C5XB 2H9EH 2QY0B 4B75A 1C9TA 1P2NA 1V2PT 2FOCA 2BY5X 4A92A 1Q2WA 3NWUA 2XYAA 1C1OA 1EAUA 4YM9A 5JDUB 3S0NA 2FX4A 1V2RT 1E0FD 2FYRA 5AVDA 1GBMA 5HGGA 4GAWA 1LHGH 3T29A 4AG2A 4X2VA 4D9RA 1QGFA 5J4SA 1P2JA 1IQKA 3K9XB 1DSTA 1BQYA 1HJ8A 1L2EA 5DG6A 1TNJA 1TFXA 1C1TA 2QXIA 1K1LA 1VJ9U 5EPYA 3NUMA 1BZXE 4Y0YE 3TGKE 3RXJA 2K1QA 1UHBB 3D65E 4Q7YA 4NWKA 4LZ4B 3JZ1B 2AGEX 3A85A 4LOYH 4NSVA 4GVUA 3UFAA 1OWKA 1O2HA 2NU2E 1GHXH 3I77A 1MCVA 1EAXA 1FY3A 1SOTA 4YOJA 4ABDA 4UE7H 1ARBA 3LU9B 3BG4B 1BTWA 4ZHMU 1AO5A 2B0FA 1C5RA 1V2TT 1XXDA 1O5GH 1T32A 2FI5E 2VGCC 2VH0A 2WPIS 1NN6A 3R3GB 5F03A 3LGIA 4Y8XA 3RXPA 4ZMAH 1GMHG 3EGKH 1A5HA 1VITH 1FY1A 2FTLE 1GJDB 5A8ZA 1YPJH 4MNXA 2CF8H 2PSYA 1JWTA 1QB9A 4GLYA 5JBCS 1HRTH 1HGTH 1DFPA 3PMAB 4H6TA 1L1NA 3RMOH 3CS0A 4ZH8A 1HNEE 1FPCH 8KME2 1BITA 1THPB 5L30H 4B73A 1O3DA 1TNHA 2QCYA 3UTUH 2ZHWH 1PPBH 2HOBA 3P92A 2C8YB 2G4UA 3BTDE 1D6RA 5EODA 1MAYA 1NRPH 3MTYA 2XNIA 1QQ4A 4IBLH 2XTTB 4JZIA 4OS1A 2F9PA 5FBEA 4D76A 1EASA 2ZU5A 4NA8A 3UNSA 2A4RA 1UO6A 1JIMA 1OWDA 2XXLA 3ZVGA 2O8LA 1MU6B 2B7DH 4A6LA 2GKVE 2FP7B 1F0UA 4ABAA 1J9CH 1LHDH 4ABBA 2BDBA 4HI3A 2JETB 4SGAE 1XUHA 2OXSA 3MO3A 1LMWB 5EQRA 3A7WA 4UDWH 3IWMA 4GPGA 2O8UA 5C1XA 1SBWA 1HV7A 1HUTH 1O36A 7GCHG 2AGGX 3E0NB 3MH5A 1GMHF 2W3KA 4KTCA 1OWIA 4K8YA 1SOZA 3FZDA 4ZKRU 2ZTZA 2ANYA 2XBXA 3RMLH 1L0ZA 2ASUB 3ZVCA 3ENSB 4JYVH 1AIXH 3PM3A 2FOMB 4OGXA 1T4UH 1IHSH 3K65B 1GJ5H 3V12A 1QTFA 1VCWA 3MMGA 1O5EH 1EJAA 1YPHE 4WXVA 6CHAB 5DP4A 4VGCB 1W2KH 5ESTE 1SFIA 2ZCLP 3LGTA 4ASHA 4O3UA 1GBBA 1YC0A 2PTCE 4ZHLU 1UTNA 1NPMA 2BLOA 2D8WA 3RC5A 4OS2A 1TNLA 1S6FA 3BIVH 1O2YA 1P12E 4LXBH 1L1GA 2OUAA 2ODYB 3OSYA 5GCHG 3QO6A 4A1XA 3OY5U 1HPGA 2Y80A 1V6DA 3M5MA 1V2MT 1K1NA 4A1VA 1SGNE 1BOQA 3M5LA 7GCHF 4CRGA 1MUEB 4ABEA 1SGTA 1NU7B 1YYY1 3QGJA 1O2IA 1O5DH 2B5TB 5AFZH 1SQTA 4Q7XA 3T5FH 3QUMP 1OP0A 1K21H 3JZ2B 3A87A 1NM6A 3ZZBA 4BTUB 3ZVFA 4X8UH 1FMGA 1DM4B 3TNSA 2Z9LA 5A09A 1A2CH 1TWXB 4NA9H 4NGAH 3M3TA 1Y3UA 2A45B 3M5OA 4Y6DA 5T3HA 1FIWA 1CA8B 4DURA 4XFQA 3SORA 1UVSH 3RP2A 2BY9X 1LPKB 1SGPE 4MPVA 3KHVA 2FS9A 2GGVB 2WPMS 3UWIA 4WMEA 3BTEE 1GL1A 1Z8GA 2FEQH 5FX5A 2AEIH 5T6GA 1ZLRA 2H9TH 1AVGH 3S69A 2P94A 3Q3KA 2AMQA 3GDSA 3GDVA 1O3EA 4MLFB 2QXGA 1ELVA 3ZZ5A 2AYWA 2J2UA 4IMQA 1GHZA 4FUFA 2C4FH 3P8NA 2ZNKH 2BDGA 2VVUA 4ZHAA 5GCHF 4UONA 1TAWA 1TMTH 2ZCHP 2GTBA 2BB4A 3BG4C 3RUOA 2EI7A 1BRUP 1EZQA 3M3SA 3TVJB 3LH3A 1AU8A 4FVDA 4WVPE 3SZNA 1IQMA 2XCNA 3RU4D 4JCNA 3N7OA 2ZHEH 2FI3E 3EA9A 5E2OA 1C1RA 1GMDG 4Q80A 4DVAU 1LO6A 1LKAA 1QB6A 1F5KU 4B76A 4I8JA 1YPMH 3KIDU 1FY5A 4K69A 2Q6GA 3SGQE 3SJ9A 1HAPH 1TA6A 4OS4A 3E16B 1GI2A 1AGJA 1EX3A 3ATWA 4JZ1A 1Y3VA 3V13A 1P0SH 1OYTH 1LTOA 3H7OA 3GCOA 1TONA 1FLEE 1O3OA 1ZHMA 2A4QA 2VU8E 1UTPA 1ZZZA 2FWWA 3EQ0H 1C2DA 1CGHA 1EOLA 2YOLA 4CBNA 3A8DA 2Y7ZA 2PFEA 1A0HB 1LVOA 5JBAS 1QJ1B 1TGNA 3RXQA 3F6UH 1OKXA 1YM0A 4TWYA 5HM2A 4B2CA 1GI0A 2YNAA 1O5AB 1GCTB 4X8TH 1NY22 2ZGCA 1RRKA 1N8OB 3HK6B 1JOUB 1C1VH 1AFEH 1C5OH 2AH4X 3ZVBA 2JETC 1LQEA 1RD3B 3O8BA 1KXEA 4X2YA 1IQFA 2AMDA 3SUDA 2P93A 3Q00A 2G8TA 2VIWA 3ZZ8A 1EATA 4YT6H 2Y81A 1GMDF 4Y8ZA 1O3CA 2Z94A 5AHGH 4BAMB 1A61H 1BBRE 3ZYDA 2AIPA 3U9AH 4CH8B 1DUEA 3P8GA 1C2GA 2IPHA 1ELAA 1GVLA 6GCHG 3F9HA 5F6MA 4UFEH 1UVOA 1B0FA 1MCTA 1K2I1 1DS2E 2TGTA 4RKJB 3A8BA 3URCA 5G4BA 1Y3WA 1Q3XA 2ZDMA 3RDZA 2ANMH 2Y6TA 1GI6A 1C4Y2 3TH3H 6CHAC 3U8TH 4VGCC 1NFXA 3VXEH 2HWLB 3HATH 1FAXA 1QCPA 2AMPA 1TABE 4GSOA 1ELEE 2W7UA 3SU3A 3ATIA 1TX7A 1GBEA 1MQ6A 3GICB 1P10A 2FESH 2ZFFH 1GPZA 2J94A 3BN9A 1K1PA 7KMEH 2STBE 3G01A 3K6YA 1Z7KA 2IN2A 2BVSH 1UTJA 3LDXH 3MOCA 1F0TA 1PJPA 3KEEA 3C27B 4ZUHA 2ZTYA 1C1WH 2J92A 5C67A 1PPGE 3OU0A 2QGRA 1YKTA 3SU2A 4AFZA 2OC0A 1KXDA 1C5WB 4X1PU 2PKAB 4NCYA 3MU1A 1C2JA 2ZU1A 1C5TA 1VGCB 2ZDNA 3BTTE 3BTWE 3K2UA 1MD8A 3VB4A 1MBMA 1LHEH 1JRSA 4F4OC 1KIGH 2VGCB 5C2ZA 3PLPA 2XW9A 6GCHF 2WYGA 1FJSA 3P8FA 3M7TA 1CVWH 2RG3A 1V2QT 3TK9A 3UIRA 3BSQA 2OQ5A 2VWOA 3UQOA 1HAVB 4J1YA 1KSNA 3GYLB 1P2KA 3M5NA 4K1EA 1HB0B 5EQQA 2TGPZ 1QIXB 4RSPA 2ULLA 1C1QA 2BYAX 2Z3DA 1AY6H 1WU1A 1Y5BT 3TJOA 8GCHG 2RCEA 4AB9A 2Z9IA 1GBTA 1THSH 1HAZB 2PW8H 1DY8A 1PPEE 4BOHA 5B6OA 4MDSA 1ZHPA 1SLWB 2BD9A 4D9QA 1DWEH 1ETSH 3O8DA 1KYNA 1TRYA 1UK3A 1O2RA 4A5TS 2GDDA 1M9UA 5JPMH 1O37A 4UFFH 1ELTA 1P03A 3D62A 2UUFB 1O3KA 5FAHA 5T6FA 1D9IA 1GJCB 3SUEA 4BAQB 1YLDA 4AGKA 3M3VA 2EI6A 4NZLA
chains in the Genus database with same CATH superfamily
1OPHB 2XC5A 3E90B 2BLQA 1BTXA 1MZDA 3W95A 3WWFA 5CE1A 3Q76A 2BY7X 2A7CA 1ZGIA 1HXEH 3E1XB 2Z3CA 1EPTA 1Y8TA 4FOUC 4I32A 1SL3A 4MQAA 3S9CA 1P9SA 1SI5H 3L6PA 1BBRK 4BXWA 4MNVA 5EOKA 1HYLA 2HPQH 5E8EH 1GL0E 1C1SA 3SO3A 1EQ9A 1K1MA 2IJOB 2VNTA 2QF0A 1UCYE 1TBQH 1OSSA 2XRCA 1SC8U 1T8OA 5CHBA 1A3BH 2ODPA 2Z9GA 3IG6B 3ZV8A 1WUNH 3EYDA 2J98A 1TX8A 1F0SA 3UY9A 2ZZUH 2GZ9A 1W13U 3N99A 3T25A 1G3CA 2BOKA 8GCHF 1TPAE 2FOEA 4FUGA 5HIZA 2G51A 3RXTA 2UWLA 4YLUA 1GJ4H 1CGJE 4BTIB 1V2JT 1P2OA 1IQIA 1N8OC 1O3FA 2PLXA 4INHA 4AZ2B 1O3GA 4WXIA 2Q6DA 1WXRA 2FDAA 1EJNA 1NBME 1O2LA 4X1QU 2OC8A 1GI8B 3O8CA 1HFDA 2GCTB 1GI3A 2FM2A 1UTKA 3QDZB 1PPZA 2J9NA 1C5YB 4BANB 1C5PA 2ZU2A 1TQ0B 4O9VA 2O9QA 3A84A 3AASA 1C2IA 3LC5A 3RC4A 3T2NA 1P2QA 2BMGB 2FOHA 1SGIB 3F2HA 1AFQC 1DITH 1Z6EA 2AHME 4YOGA 2W5EA 3P8OA 5GJ4B 2J34A 2QF3A 5FX6A 2OINA 1GJ9B 2D1JA 1THRH 2BHGA 1SGFA 2QIQA 1RGQA 1YPEH 4B1TA 4FUBA 4NIVA 5EW1H 2ZIQH 4O03A 1RTLA 1ZHRA 3SV9A 3B23B 4FU7A 1DDJA 4I86A 2VH6A 4B6EA 1FZZA 5DGJA 1F2SE 1PPFE 1O2WA 3FP6E 2ZFPH 2XCFA 2R9PA 1B5GH 1GHAG 1P05A 2G5VA 2XWAA 4AYYB 3VPKA 1AE8H 4U30A 2Z9KA 2BVRH 4CREA 4QT8C 1C1UH 1WTHD 1VKYA 1Z71A 1O35A 2A4GA 2CXVA 4IN1A 1T8NA 2D2DA 1OYQA 1EFRD 4BAOB 3O8RA 4OS6A 1GHWH 1EPTB 5ESBA 3MQKC 2VIQA 3EE0B 4AB8A 1UTQA 4FUHA 1QNJA 3W94A 1O3JA 1UVUH 4CRFA 4FU9A 1GBHA 3BV9B 1GI4A 2FYQA 2PUXB 1O3HA 3SV8A 1C5SA 1H8IH 2XBYA 1IQLA 1MH0A 1HIAA 2BD7A 4JZDH 4JMYA 1F7ZA 1VGCC 2ZU3A 1W8BH 1C2HA 2A1DB 1OOKB 1T7CA 2C93B 1O2SA 3NPSA 1P3CA 3ZVEA 1J16A 3CENA 2FLBH 2ZU4A 2BY8X 1BBRH 4Y7AA 2AS9A 3RXBA 2BD2A 4K8BA 4A7IB 1NTPA 5C20A 3L33A 1KY9A 4WJG2 1MU8B 3UOPA 1ZJDA 3PV2A 1HXFH 1DLKB 1SHHB 3RXLA 2HPPH 1XKBC 3STJA 3SHCH 1NROH 1SQAA 5L6NH 2ZHDA 4CRAA 4WY3A 1S85A 1RS0A 3TK6A 3SHAH 2SGFE 1Y5AT 4ABGA 1ELCA 1PFXC 1NFWA 3ELAH 3K6ZA 3VB7A 1G3BA 1LCYA 1U6QA 1V2OT 2UUKB 1GHAF 1NRNH 1F0RA 3PV4A 1UK4A 1GJBB 2CHAB 5EJLA 3FANA 1DX5M 2C90B 1TX6A 2RA3A 1ZRKA 1W14U 3SJOA 1MKWK 3GS9A 4KP0A 1W10U 5EXLA 2ZI2H 3KN2A 1O39A 1O30A 1AWFH 1SHYA 2ZDVH 4LK4A 1OS8A 1NC6A 1VCPA 3QLPH 1RIWB 4K2YA 4AFSA 4E06H 3SV6A 5EG4A 1AWHB 1HCGA 3LGYA 1O0DH 3NKKA 4U2WA 1TPPA 3RXCA 5GPIB 1YY3A 1K1IA 1TOCB 2A7JA 3DUXH 1TBZH 2CV3A 4YT7H 1BJUA 4F49A 3TJUA 3ZZ9A 2CF9H 2JJ2D 4MPWA 2JJ1D 2BTCE 4ZXYH 3DD2H 2R3UA 1EZXC 5I46H 1AZ8A 3Q3XA 5L2ZH 4B2AA 1Z8IB 2KAIA 1O3AA 2XNDD 1T8LA 5EPNA 2BX4A 3PRDA 2ANWA 3SJKA 3RXDA 1EJMA 1L4DA 1MMJN 3LJOA 3VB6A 3F1SB 1MTWA 3BG8A 2VIOA 1EB1H 2XC4A 1YP9A 3FO8D 4UFGH 5GIBA 1CHOG 3SNDA 2GV6A 3SJ8A 3UPEA 3M7QA 4HFPB 1C1PA 1FPHH 4AN7A 1V2KT 4E7RG 2BDIA 1FNIA 5LPFA 1KTTB 1GMCG 2W7SA 1ANEA 3QZRA 2Z7FE 3F9EA 1HIAB 1GJ7B 1ZTKA 1RJXB 4DT4A 5FCRA 1O2PA 1C5LH 3A89A 4I8KA 1HLTH 4X8VH 3GCTG 2LPRA 1PYTD 2JH0D 3MO9A 1P8VC 2GCTC 4OGYA 2M2AA 3U69H 2BDYA 3WY8A 1FY8E 2QYIA 1O3BA 1LPGB 2OTVA 2P8OB 1BMFD 3LH1A 4X6MA 1MTUA 1EP5A 2Y5GA 1Z6JH 1LPZB 1C2LA 3LC3A 2WV5A 2O8WA 4ABFA 2TBSA 4ACAA 2QN5T 4OS7A 3RXAA 1C1NA 2ZF0H 1ZRBA 2F43B 2ZECA 2G4TA 1H9LB 1OX1A 1QBNA 1S0QA 2BQ7B 2JH6D 1J17T 1E35B 3AVZA 2BZ6H 1K0HA 3V7TA 2ALVA 2F83A 4INKA 1W0JD 1SGCA 2FO9A 5A0BA 2Y7XA 2O8MA 3U1IB 1X7AC 4CRDA 4NZQA 4IC5A 1ABJH 1CHOF 1E37B 4X0WU 2ZPRA 3HGPA 4I33A 3ZYEA 4I8LA 3SNCA 2ZGXH 1GMCF 1V2NT 3MNXA 1H9IE 3PWCA 3FFGA 2A31A 3SOSA 2FLRH 5LPEA 2BLVA 1EPTC 1BTUA 4FUEA 3AW1A 3GCTF 1MKWH 1GBFA 1O2TA 1QB1A 1XUJA 3GOVB 2FPZA 3T26A 4B2BA 1BRCE 1LVYA 3OX7U 1ESTA 2KAIB 1TPOA 1P02A 1IAUA 2IOTA 1A0LA 4X1RU 1QA7A 2GD4B 2Y82A 3DSGA 1MTNC 3FZZA 2F9VA 2M5TA 2QXHA 3QTOH 2YMSB 3ZZ6A 4HTCH 1RTFB 3KQBA 2LNCA 2XBWA 1A7SA 2FX6A 3SJIA 1AMHA 1BB0B 1RXPA 1FI8A 1ID5H 3ODFA 3RXFA 3EA7A 2P3TB 2C8ZB 1H8HD 2G52A 3PV5A 4H6SB 1ZPZA 1YGCH 2BQWB 1TBRH 3F2GA 5FPSA 2AGIX 4JK6A 1GBDA 1V2LT 3E3TA 1QJ7B 3RXGA 2PKAA 2RA0A 4WWYA 4ISNA 3GY8A 4X1SU 8ESTE 1CT4E 1AKSB 3F2FA 1TNGA 1INCA 1XKAC 1GG6C 2CHAC 3UWJH 1G2MA 2V3HH 1YPGH 4D7FA 1P11E 1O2XA 5EW2H 1AI8H 3FAOA 2BD4A 5FBIA 5IYTA 2UWOA 3RXKA 1K9OE 3P6ZB 1O32A 1VZQH 1O31A 2DE8A 3TGJE 1HJAC 1HAVA 1D3PB 2A2QH 5HIYA 1L1JA 1DT2A 1RIWC 4Y71A 3MU0A 4ABJA 3PYHA 2PSXA 3DFJA 1DE7H 1EP6A 1OWEA 2WPJS 1C5UA 1CT0E 2A5KA 2NU3E 2UUJB 1A1RA 1MQ5A 1SB1H 5F8XA 1UJ1A 1S81A 3B8JA 4X6OA 3I78A 5TCCA 2JKHA 1V2VT 2L6OA 4INLA 1GHVH 3ATMA 5DN6D 3BEUA 2BD5A 3RLYH 3TK5A 3LGUA 4Y10E 4GHTA 1V2ST 1AFQB 2R2MB 5EGMA 4WH8A 2WPDD 2GP9B 1C5MD 3Q3YA 1GI1A 1FONA 1UTMA 3TLOA 3SGAE 1O2KA 1B0EA 1CBWB 1P06A 2ZFSA 3LT3A 3PTNA 3A7YA 4YZUA 3VGCB 3TH4H 2RDLA 3BTGE 1DVAH 4CHAB 2BXUH 1FQ3A 1S6LA 2OC1A 3PB1E 1ZSLA 1YBWA 3QN7A 2GV7A 1F92A 1A5GH 2C8WB 1PPHE 1O3IA 2ZDLA 2VB0A 3PMBB 1QL7A 3MH7A 3PWBA 4WMFA 3U1JB 2ZGJA 3STIA 4DGJA 4LZ1H 1GHYH 2HGTH 2KZ4A 1EZUC 3M7UA 2B9LA 1AUJA 1O34A 1MKXK 1E1RD 1RFNA 3MNBA 4NWLA 4YTAA 5CMXH 1HAOH 1WBGB 2OD3B 4ISIH 2P8OC 3AK5A 3RXIA 5FHTA 4GUXA 1YCPK 1SGEE 2VBCA 2WPKS 1ZGVA 4K5ZA 1C2MA 2A32A 2K0QA 2GX4A 4U32A 3KQCA 3A8AA 3TH2H 3GCHB 2ZGBH 1S6HA 2VWNA 2ZO3H 3TU7H 4YO9A 1SMFE 2CJIA 5CHAC 2PR3A 1V2WT 1QR3E 1ZSJA 1TGBA 2RFKC 1K22H 2FXRA 5JBTA 1QBVH 1YPLH 4MPXA 3A8CA 1XUIA 1K1OA 1JRTA 1ELDE 3S7KB 1QY6A 3U8RH 5GXPA 2EEKA 4AGJA 1BRAA 2WINI 2A7HA 2R0KA 3LJJA 4XOJA 4CR9A 1Q31A 1HDTH 2V6NA 4MG3A 1FV9A 2XWBI 3SQEE 5HM9A 1J15A 1C2EA 3A7ZA 1SLVB 1O2OA 2BLWA 3ESTA 4I7YH 1O5BB 1MBQA 1BHXB 1ZMNA 4X1NU 1UVTH 3DSOA 3RXMA 4SGBE 1SFQB 3U98H 9LPRA 1WV7H 2I6SA 1GJAB 2PV9B 4DT7B 1G3DA 2ALPA 2OC7A 5DP9A 1KDQB 2ZHFH 3TITA 1ZPCA 4U01A 4X2XA 4Z0KA 1MABB 3BTKE 3OY6U 2R2WU 4X8SH 3OYPA 3MNCA 1ARCA 2J5UA 1FIZA 1YPKH 3BTME 3A88A 4IS5A 2C8XB 1OWHA 3AAUA 1QURH 1SGDE 1TYNA 4ZXXH 1MZAA 4CR5A 2YMSC 4NG9H 1D4PB 6LPRA 2ZTXA 4ZKSU 2DUCA 3F3BA 3KCGH 1VCQA 4P00A 1AD8H 1SLUB 4I8GA 1ELFA 1O5FH 1ACBE 2F9OA 2NU0E 3M35A 1BT7A 1XM1A 2BDCA 3F9GA 1S84A 3I29A 3BEIB 4Y7BA 4ISHH 1FY4A 1N1LA 1H4WA 2ZGHA 1SSXA 2GDEH 1NRSH 1SLXB 1XMNB 2VWMA 2BDAA 2CMYA 1AQ7A 1TQ7B 5DO4H 4XSKU 4ZAEA 3SBKA 2BOHB 4H4FA 1TRMA 5IDKA 2TRMA 4ZCNA 3RXRA 3PMHB 3LKWA 1G3EA 5PTPA 3MYWA 1SG8B 3E6PH 4A1TA 1BUIA 1D3QB 1MKXH 2BDHA 1S0RA 3PTBA 4NFEA 1GGDB 1OHHD 4BXSA 1COWD 1GDQA 1NBMD 1S5SA 2VINA 3A7XA 4NIXA 2VVCA 5K0HA 1GCDA 1WSSH 3V3MA 4TYDA 4UEHH 1YCPH 1KXCA 3ATKA 4ZROA 3EA8A 1BMAA 1DANH 2FODA 5LPRA 1GI7B 4Q63A 3MU5A 1CQQA 4I31A 1EOJA 2PHBA 3ATLA 3F68H 1G32B 1SGQE 4HGCA 4BAKB 2FMJA 3NXPA 3P70B 2UWPA 3DHKH 1B7XB 1SQOA 4YOIA 1CO7E 2WHXA 3MH4A 2GZ7A 4ISOA 9ESTA 1NRRH 3UR6A 4TY7A 1SVPA 1TRNA 1O33A 1GBIA 4TPIZ 4K3JA 4IC6A 3HKJB 3TPIZ 5J4QA 3MH6A 3ZZ4A 4KKDA 2BD8A 1CBWC 1P2IA 1ELBA 3VGCC 4B74A 2F3CE 1ABIH 2EY4C 1BMMH 5EXNA 2ZCKP 4CHAC 4DOQA 1K1JA 1A3EH 4JZEH 2RDEA 1EXFA 1J8AA 3H5CB 1XXFA 2FOGA 4ACBA 5C5NA 3HPTB 3S9AA 3F9FA 3RXHA 4HZHA 1BTHH 1XUKA 2R3YA 3UQVA 2GJGA 3RM2H 5KECA 2WYJA 1DOJA 1UK2A 3OEHD 2CN0H 4M9FA 3SV2H 1YLNA 4B71A 1DLEA 5H4IB 3LOXA 3UR9A 1FDPA 1GVKB 1NFYA 1HAXB 4GHQA 4XDEA 3B9FH 3EAJA 2R0LA 3MU8A 4RN6A 1QQUA 3SNBA 4E05H 5L2YH 1DWCH 2FI4E 1P04A 4DY7B 1WAYB 3GCHC 3A81A 4ABIA 1ORFA 2W26A 2ZA5A 1ZOMA 2ZQ2A 2AERH 2VIVA 2TGDA 3A7VA 4Q7ZA 5EU8A 3PO1B 1ZPBA 1QRWA 3GYMA 3Q77A 3U28C 4AG1A 1PQ5A 3GY6A 4BAHB 1HAGE 3ODDA 3FVFB 3GY4A 1MTNB 4ESTE 2Y5FA 1N6XA 3PLBA 3OEED 1UTLM 2A2XH 1Z1IA 5HXFA 5C0UA 1XX9A 4CBOA 5GWZA 1D3DB 1PQ8A 5DP7A 2TGAA 1TNKA 3ZVAA 2Z9JA 3UUZA 1GBJA 4X6NA 5DP5A 1G30B 4NIWA 7ESTE 2FTMA 2HALA 1GDUA 1UCYK 5BRRE 2A0QB 3QWCH 2G00A 2Z3EA 5DPAA 3A83A 3NZIA 1GG6B 1O5CB 2SGDE 1KLIH 2CGAA 2V3OH 5FCKA 3MHWU 4XBDA 3FKSD 3MWIU 2Q1JA 2HNTF 4GCHG 2HLCA 3UNQA 1IQEA 4AORA 2LP6A 4THNH 3DFLA 3PROA 2ZPSA 1QFKH 1HJAB 4JYTA 7LPRA 1CA0C 2F9UA 3KQDA 1Y5UT 3GY7A 3ZZCA 4NA7A 3ZZ7A 1N6YA 1J14A 5GDSH 2A5AA 2QE7D 1O2MA 1AE5A 1E34B 4FUCA 1QL9A 2QA9E 2AFQB 3SQHE 4IN2A 1HAIH 3GCNA 3T27A 4ISLA 1LKBA 2F9BH 1O3LA 2EC9H 1AB9B 1AHTH 2OBOA 2WPLS 1V2UT 1G9IE 1MTVA 2BD3A 2PKSB 1QA0A 2FS8A 1F5RA 2WPHS 5E0HA 1H8DH 5DKMA 3AAVA 2WUCA 1ZTLA 2HNTE 1MAXA 4BNRA 1W7GH 2XBVA 1L4ZA 1TMUH 1HAHH 2P16A 5DSFA 2SNWA 2BY6X 1KXAA 1NT1A 2THFB 3QGNB 1EUFA 3SV7A 2ZFTA 1SGYE 3SW2B 3MFJA 4E7NA 1WCZA 1XUFA 5DJ7A 5HMAA 1TIOA 2QC2A 1ELGA 1GGDC 1KXBA 2VIPA 3GY3A 3S7HB 2PGQB 2J95A 1LQDB 1LVMA 3EDXB 2O8TA 4UFDH 4GCHF 5C94A 2SGPE 1ZTJA 5JB8S 1AVXA 1FXYA 2BVXH 4AOQA 1HJ9A 1QRXA 1AKSA 4DIHH 1IQNA 2ILNA 2PWXA 1C4U2 3FP7E 4XBCA 4RT1A 5A0CA 5C1YA 3SUGA 1C5VA 1SPJA 1T4VH 1BRBE 1TALA 3E91A 4TWWA 1CU1A 1LVBA 4H42U 5K7RA 1C5NH 2ZEBA 5CHAB 1FAKH 1PQAA 4DW2U 2GCHG 1BA8B 2Q6FA 3SN8A 5LGOA 3HK3B 1DXPA 1C9PA 1O2QA 3UREA 1GBKA 1CHGA 2H2ZA 1XVMA 3URDA 1BJVA 2ZDKA 1ZR0A 8LPRA 2QV1A 1FN8A 1TE0A 5ETXA 3BF6H 1BTYA 1W7XH 3E0PB 4NSYA 2ZKSA 2SNVA 1BHXF 4Y0ZE 1ANDA 1ESBA 1FN6A 1UCYH 1GBAA 4MVNA 1ESAA 2ZC9H 4O97A 5A8XA 1DUAA 1P01A 2F91A 1KXFA 3A7TA 1WQSA 1WYKA 1JIRA 3BTFE 4KTSA 2V0BA 5E0GA 1WQVH 4AYVB 1AZZA 2V35A 1DWBH 1H1BA 1GI5A 3A82A 2BZAA 3RXSA 4CH2B 2JDID 1GHBG 1C5QA 3SNEA 1DXWA 1H9HE 5A8YA 2HRVA 3P95A 2KFWA 5DP6A 3QTVH 1BTPA 1W0ZU 2BXTH 1QRZA 1T31A 1VITG 5FPTA 1ETTH 2K8IA 2VIDA 1HBTH 1GBLA 3PO1C 4X2WA 1A46H 4MNWA 1A5IA 2PGBB 5C1UA 2VVVA 3D49H 3QX5H 2G5NA 3S9BA 2SGAA 4PROA 1VR1H 4ABHA 2H6MA 4FU8A 3RC6A 4WF8A 3AW0A 1A0JA 1GWAA 2GT8A 2GCHF 1AVWA 1BIOA 2ZPQA 3V0XA 4M7GA 4XE4A 1CGIE 3OTPA 1QZ8A 4K60A 4DG4A 1DY9A 1SR5C 1MD7A 4MNYA 2GMTB 3SNAA 3ZV9A 4Y76A 3RU4E 1QHRB 3CP7A 5E0JA 2GZ8A 1WOFA 1TLDA 1TGSZ 3RXVA 3CS7A 4NFFA 5LH8A 1O3MA 4Q2KA 2NWNA 1GJ8B 2FZZA 2GT7A 2I6QA 2NU4E 3MI4A 1BCUH 1PQ7A 3PLKA 1GHBF 2H1UA 4YLQH 1C2FA 1D6WA 3TJNA 3SI3H 3SU4A 4K1SA 4IGDA 1O2ZA 1VITF 3IITA 4F55A 3ZIAD 3N7EA 1O3PB 2ZFRH 3ZVDA 1NO9H 1KLJH 1QBOA 1BTZA 5F53A 1P3EA 1V3XA 3SU6A 4FUJA 1ZMJA 2FOAA 1KDQA 3HGNA 2A4OA 1UMAH 1P2MA 2OBQA 2PTNA 3SI4H 2HVYB 1O2UA 1O2VA 3A80A 3H09A 1YCPM 1SKYE 5C3NA 1AB9C 1TNIA 2WV9A 4P02A 1P09A 1NZQH 1OXGA 2Z6BD 1OP2A 4B6FA 2PKSC 5EQSA 3M37A 5FL7D 3HKIB 2H5CA 4Y79A 4Z6AH 1EB2A 1NESE 4R0IA 2G81E 4DJZB 1AN1E 2SFAA 3D23A 4WMDA 4WH6A 5BPEA 1OP8A 1OWJA 2H5DA 5DK1A 3RXEA 2P59A 3LIWA 1IQHA 3GISB 5TJXA 3F0PA 2ZQ1A 3MU4A 2IJD1 1NRQH 2QXJA 1EZSC 3A86A 5JB9S 4JK5A 5T6DA 1Y59T 3TNTA 1P57B 3DT0H 2KM0A 1DWDH 3TIUA 5EXMA 3BTQE 4FVBA 4AX9H 5KGOA 5JBBS 5F8ZA 1YLCA 1ZSKA 3KQEA 3SU5A 3RXUA 2YNBA 2SGQE 1KLTA 2PP6A 3LPRA 3FP8E 5DP8A 1PPCE 3RXOA 4Z1MD 5E2PA 3RMMH 2F4LA 4Y11E 2P95A 3OFND 1CE5A 5B6LA 4I8HA 1Z8JB 4DIIH 3EE7A 1Y3XA 3OE7D 2WV4A 2TPIZ 1DPOA 1MTSA 4X6PA 1CSOE 5A2MH 1O38A 2VWLA 2XOKD 3RM0H 1IQGA 3RLWH 1QL8A 1C1MA 1SGFG 1UVPA 4JYUH 3GY2A 1LHCH 4IW4E 4Y8YA 1G2LA 2ESTE 2QAAA 2OQUA 1GVZA 3GY5A 3CNRA 3L3TA 1A4WH 3SU1A 3SGBE 4RKOB 1JBUH 1YF4A 2AIQA 3H7TA 3TJVA 1DSUA 1F5LA 4YESB 2NU1E 2EA3A 1GI9B 4ZKOU 1W0YH 2ZWLH 4FUDA 5AFYH 1ZJKA 3MNSA 1TMBH 3BEFB 2QF4A 4IMZA 2OCVB 2DE9A 1BDAA 2XC0A 1E36B 1S83A 2BM2A 2STAE 3SU0A 5FXLA 3QZQA 1JMOH 2F9NA 3KGPA 3ZZDA 4FXGH 5KEDA 4MPUA 4D7GA 1TGCA 3M36A 2V3MA 4NIYA 4F48B 5JYIA 3SZEA 1HAYB 1CT2E 2D26C 2C3SA 4XBBA 1C4V2 2FOBA 3R0FA 1T8MA 2FIRH 2ZFQH 3T62A 1CA0B 4MTBA 3VB5A 2B8OH 2UUYA 3T28A 1C5ZB 3VEQB 3LGVA 4OS5A 2GVFA 1P9UA 1TB6H 4R8TB 2A5IA 1LDTT 1ZMLA 1IOEA 2ANKH 1D3TB 3NCLA 1EAWA 1ZYOA 3DA9B 3SUFA 2PUQH 3WW7A 1TOMH 1W3CA 2J97A 3C1KA 4AFUA 3MO6A 1GJ6A 1UTOA 1BMLA 1O2NA 2GMTC 4KGAA 1TPSA 3F0OA 2J38A 1TA2A 4K1TA 5HYOA 1C2KA 4D8NA 4AFQA 5I25A 3QK1A 5C5OA 3SYJA 1UHBA 2JH5D 4KTUA 2H9HA 2V7QD 1ANCA 1ETRH 5A0AE 2WSSD 1WTGH 3KL6A 3LGWA 5ABWA 1O2JA 1FUJA 4OM9A 3E8LA 3OTJE 5SGAE 3TGIE 2G55A 2W3IA 1G36A 4TPYA 4ZKNU 2HNTC 1NU9A 1DICA 6ESTA 3VB3A 1ANBA 1Z1JA 1Y3YA 5DP3A 5FPYA 1IHTH 1TGTA 1G37A 1E38B 4CRBA 3RU4T 4TT3D 3U8OH 2ZDAH 1GBCA 3LONA 2VJ1A 3BIUH 1K28D 1S82A 3VFEA 5AF9H 4CRCA 3NK8A 3VXFH 2BQ6B 4TY6A 3UOUA 4FUIA 3ZZ3A 2P3UB 3P17H 4O3TA 4ASUD 5F8TA 1GCTC 2EI8A 1Z8RA 1AUTC 3GDUA 3PMJA 1EAIA 2OP9A 2WUBA 2J4IA 2BX3A 1JXPA 1NS3A 3KQ5A 4UD9H 3ITIA 1O3NA 2HVXA 2OLGA 2ZG0H 1YPHC 2ZHQH 3M61U 4BTTB 1IQJA 1QJ6B 2Y5HA 1KTSB 1VJAU 1BMNH 1XUGA 2FOFA 4DCDA 2SGEE 5HKKD 1W0KD 1NFUA 4J2YB 4KELA 3RMNH 3KNXA 1PYTC 1EKBB 1XVOA 2ODQA 4JZFH 1O2GH 2P3FH 3KF2A 5TCAA 1SGRE 1W12U 3UNRA 1W11U 2JIZD 1LHFH 2TIOA 1RTKA 3BTHE 2ZP0H 3ZZAA 1GDNA 1C5XB 2H9EH 2QY0B 4B75A 1C9TA 1P2NA 1V2PT 2FOCA 2BY5X 4A92A 1Q2WA 3NWUA 2XYAA 1C1OA 1EAUA 4YM9A 5JDUB 3S0NA 2FX4A 1V2RT 1E0FD 2FYRA 5AVDA 1GBMA 5HGGA 4GAWA 1LHGH 3T29A 4AG2A 4X2VA 1FX0B 4D9RA 1QGFA 5J4SA 1P2JA 1IQKA 3K9XB 1DSTA 1BQYA 1HJ8A 1L2EA 5DG6A 1TNJA 1TFXA 1C1TA 2QXIA 1K1LA 1VJ9U 5EPYA 3NUMA 1BZXE 4Y0YE 3TGKE 1H8ED 3RXJA 2K1QA 1UHBB 3D65E 4Q7YA 4NWKA 4LZ4B 3JZ1B 2AGEX 3A85A 4LOYH 4NSVA 4GVUA 3UFAA 1OWKA 1O2HA 2NU2E 5C0TA 1GHXH 3I77A 1MCVA 1EAXA 1FY3A 1SOTA 4YOJA 4ABDA 4UE7H 1ARBA 3LU9B 3BG4B 1BTWA 4ZHMU 1AO5A 2B0FA 1C5RA 1V2TT 1XXDA 1O5GH 1T32A 2FI5E 2VGCC 2VH0A 2WPIS 1NN6A 3R3GB 5F03A 3LGIA 2J98B 4Y8XA 3RXPA 4ZMAH 1GMHG 3EGKH 1A5HA 1VITH 1FY1A 2FTLE 4XRNA 1GJDB 5A8ZA 1YPJH 2YMSD 4MNXA 2CF8H 2PSYA 1JWTA 1QB9A 4GLYA 5JBCS 1HRTH 1HGTH 5CDFE 1DFPA 3PMAB 4H6TA 1L1NA 3RMOH 2W6JD 3CS0A 4ZH8A 1HNEE 1FPCH 8KME2 1BITA 1THPB 5L30H 4B73A 1O3DA 1TNHA 2QCYA 3UTUH 2ZHWH 1PPBH 5EJ1A 2HOBA 3P92A 3VG8A 2C8YB 2QF5A 2G4UA 3BTDE 1D6RA 5EODA 1MAYA 1NRPH 3MTYA 2XNIA 1QQ4A 4IBLH 2XTTB 4JZIA 4OS1A 2F9PA 5FBEA 4D76A 1EASA 2ZU5A 4NA8A 3UNSA 2A4RA 1UO6A 1JIMA 1OWDA 2XXLA 3ZVGA 2O8LA 1MU6B 2B7DH 4A6LA 2GKVE 2FP7B 1F0UA 4ABAA 1J9CH 1LHDH 4ABBA 2BDBA 4HI3A 2JETB 4SGAE 1XUHA 2OXSA 3MO3A 1LMWB 5EQRA 3A7WA 4UDWH 3IWMA 4GPGA 2O8UA 5C1XA 1SBWA 1HV7A 1HUTH 1O36A 7GCHG 2AGGX 2KX4A 3E0NB 3MH5A 1GMHF 2W3KA 4KTCA 1OWIA 4K8YA 1SOZA 3FZDA 4ZKRU 2ZTZA 3DSPA 3W1EA 2ANYA 4AC9A 2XBXA 3RMLH 1L0ZA 2ASUB 5GNDA 3ZVCA 3ENSB 4JYVH 1AIXH 3PM3A 2FOMB 4OGXA 2L74A 1T4UH 1IHSH 3K65B 1GJ5H 3V12A 1QTFA 1VCWA 3MMGA 1O5EH 1EJAA 1YPHE 4WXVA 6CHAB 5DP4A 4VGCB 1W2KH 5ESTE 3UAIC 4Q4LA 1SFIA 2ZCLP 3LGTA 4ASHA 2KCYA 4O3UA 1GBBA 1YC0A 2PTCE 3FOAA 4ZHLU 2KCAA 1UTNA 1NPMA 2BLOA 2D8WA 3RC5A 4OS2A 1SQRA 1TNLA 1S6FA 3BIVH 1O2YA 1P12E 4LXBH 1L1GA 2OUAA 2ODYB 3OSYA 5GCHG 3QO6A 4A1XA 3OY5U 1HPGA 2Y80A 1V6DA 3M5MA 1V2MT 1K1NA 4A1VA 1SGNE 1BOQA 3M5LA 7GCHF 4CRGA 1MUEB 4ABEA 1SGTA 1NU7B 1YYY1 3QGJA 5C17A 1O2IA 1O5DH 2B5TB 5AFZH 4XD7D 1SQTA 4Q7XA 3T5FH 3QUMP 1OP0A 1K21H 3JZ2B 3A87A 1NM6A 3ZZBA 4BTUB 3ZVFA 4X8UH 1FMGA 2KCOA 1DM4B 3N7DA 3TNSA 2Z9LA 5A09A 1A2CH 1TWXB 4NA9H 4NGAH 3M3TA 1Y3UA 2A45B 3M5OA 4Y6DA 5T3HA 1FIWA 1CA8B 2IPQX 4DURA 4YXWD 4XFQA 3SORA 1UVSH 3RP2A 3UB0A 1WDIA 2BY9X 1LPKB 1SGPE 4MPVA 3KHVA 2FS9A 2GGVB 2WPMS 3UWIA 4WMEA 3BTEE 1GL1A 1Z8GA 2FEQH 5FX5A 2AEIH 5T6GA 1ZLRA 2H9TH 1AVGH 3S69A 3DCLA 2P94A 3Q3KA 2AMQA 3GDSA 3GDVA 1O3EA 4MLFB 2QXGA 1ELVA 3ZZ5A 3PRBA 2AYWA 2J2UA 4IMQA 1GHZA 4FUFA 2C4FH 3P8NA 2ZNKH 2BDGA 2VVUA 4ZHAA 2W6ID 5GCHF 4UONA 1TAWA 1TMTH 2ZCHP 2GTBA 2BB4A 3BG4C 3RUOA 2EI7A 1BRUP 1EZQA 3M3SA 3TVJB 3LH3A 1AU8A 4FVDA 4WVPE 3SZNA 1IQMA 2XCNA 3RU4D 4JCNA 3N7OA 2ZHEH 2FI3E 3EA9A 5E2OA 1C1RA 1GMDG 4Q80A 4DVAU 1LO6A 1LKAA 1QB6A 1F5KU 4B76A 3KYFA 4I8JA 1YPMH 3KIDU 1FY5A 4K69A 2Q6GA 3SGQE 3SJ9A 1HAPH 1TA6A 4OS4A 3E16B 1GI2A 1AGJA 1EX3A 2KR7A 3ATWA 3NRLA 1Y3VA 4JZ1A 3V13A 1P0SH 1OYTH 1LTOA 4RT0A 2CK3D 3H7OA 3GCOA 5T1VA 1TONA 4RI0A 1FLEE 1O3OA 1ZHMA 2A4QA 4FETA 2VU8E 1UTPA 1ZZZA 2FWWA 5IK2D 3EQ0H 1C2DA 1CGHA 1EOLA 2YOLA 4TSFD 4CBNA 3A8DA 2Y7ZA 2PFEA 1A0HB 1LVOA 5JBAS 1QJ1B 1TGNA 3RXQA 3F6UH 1OKXA 1YM0A 4TWYA 5HM2A 4B2CA 1GI0A 2YNAA 1O5AB 1GCTB 4X8TH 4HG6A 1NY22 2ZGCA 1RRKA 1N8OB 3HK6B 1JOUB 1C1VH 1AFEH 1C5OH 2AH4X 3ZVBA 2JETC 1LQEA 1RD3B 3O8BA 1KXEA 4X2YA 1IQFA 2AMDA 3SUDA 2P93A 3Q00A 2G8TA 2VIWA 3ZZ8A 1EATA 4YT6H 2Y81A 1GMDF 4Y8ZA 1O3CA 2Z94A 5AHGH 4BAMB 1A61H 1BBRE 3ZYDA 2AIPA 3U9AH 4CH8B 1DUEA 3P8GA 1C2GA 2IPHA 1ELAA 1GVLA 6GCHG 3F9HA 5F6MA 4UFEH 1UVOA 1B0FA 1MCTA 1K2I1 1DS2E 2TGTA 4RKJB 3A8BA 3URCA 5G4BA 1Y3WA 1Q3XA 2ZDMA 3RDZA 2ANMH 2Y6TA 1UW7A 1GI6A 1C4Y2 3TH3H 6CHAC 3U8TH 4VGCC 1NFXA 3VXEH 2HWLB 3WWBA 3HATH 1FAXA 1QCPA 2AMPA 1TABE 4GSOA 1ELEE 2W7UA 3SU3A 3ATIA 1TX7A 1GBEA 1KMHB 1MQ6A 3GICB 1P10A 2FESH 2ZFFH 1GPZA 2J94A 3BN9A 1K1PA 7KMEH 2STBE 3G01A 3K6YA 1Z7KA 2HLDD 2IN2A 2BVSH 1UTJA 3LDXH 3MOCA 1F0TA 1PJPA 3KEEA 3C27B 4ZUHA 2ZTYA 1C1WH 2J92A 5C67A 1PPGE 3OU0A 2QGRA 1YKTA 3SU2A 4AFZA 3FN8A 2OC0A 1KXDA 1C5WB 4X1PU 2PKAB 4NCYA 3MU1A 1C2JA 2ZU1A 1C5TA 1VGCB 2ZDNA 3BTTE 3BTWE 3K2UA 1MD8A 3VB4A 1MBMA 1LHEH 2OK5A 1JRSA 4F4OC 1KIGH 2VGCB 5C2ZA 3PLPA 2XW9A 6GCHF 5EJZA 2WYGA 1FJSA 3P8FA 3M7TA 1CVWH 1E1QD 2RG3A 1V2QT 3TK9A 5EIYA 3UIRA 3BSQA 2OQ5A 2VWOA 3KYGA 3UQOA 1HAVB 4J1YA 1KSNA 3GYLB 1P2KA 3M5NA 4K1EA 1HB0B 5EQQA 2TGPZ 1QIXB 4RSPA 2ULLA 1C1QA 2BYAX 2Z3DA 1AY6H 1WU1A 1Y5BT 1YWUA 3TJOA 8GCHG 2RCEA 4AB9A 2Z9IA 1GBTA 1THSH 1HAZB 2PW8H 1DY8A 1PPEE 4BOHA 5B6OA 4MDSA 1ZHPA 1SLWB 2BD9A 4D9QA 1DWEH 1E79D 2WZQA 1ETSH 2LELA 1KYNA 1TRYA 1UK3A 1O2RA 3O8DA 4A5TS 2GDDA 1M9UA 2KCPA 5JPMH 1O37A 4UFFH 1ELTA 2EQNA 3OAAD 1P03A 3D62A 2UUFB 1O3KA 5FAHA 5T6FA 1D9IA 1GJCB 3SUEA 4BAQB 1YLDA 4AGKA 3M3VA 2EI6A 4NZLA
chains in the Genus database with same CATH topology
1OPHB 2XC5A 3E90B 2BLQA 1BTXA 1MZDA 3W95A 5CE1A 3Q76A 2BY7X 2A7CA 1ZGIA 1HXEH 3E1XB 2Z3CA 1EPTA 1Y8TA 4I32A 4MQAA 1SL3A 3S9CA 1P9SA 1SI5H 3L6PA 1BBRK 4BXWA 4MNVA 5EOKA 1HYLA 2HPQH 5E8EH 1GL0E 1C1SA 3SO3A 1EQ9A 1K1MA 2IJOB 2VNTA 2QF0A 1UCYE 1TBQH 1OSSA 2XRCA 1SC8U 1T8OA 1A3BH 2ODPA 2Z9GA 3IG6B 3ZV8A 1WUNH 3EYDA 1TX8A 1F0SA 3UY9A 2ZZUH 2GZ9A 1W13U 3T25A 1G3CA 2BOKA 8GCHF 1TPAE 2FOEA 4FUGA 2G51A 3RXTA 2UWLA 4YLUA 1GJ4H 1CGJE 4BTIB 1V2JT 1P2OA 1IQIA 1N8OC 1O3FA 2PLXA 4INHA 4AZ2B 1O3GA 4WXIA 2Q6DA 2FDAA 1EJNA 1O2LA 4X1QU 2OC8A 1GI8B 3O8CA 1HFDA 2GCTB 1GI3A 2FM2A 1UTKA 3QDZB 1PPZA 2J9NA 1C5YB 4BANB 1C5PA 2ZU2A 1TQ0B 4O9VA 2O9QA 3A84A 3AASA 1C2IA 3LC5A 3RC4A 3T2NA 1P2QA 2BMGB 2FOHA 1SGIB 1AFQC 1DITH 1Z6EA 4YOGA 2W5EA 3P8OA 5GJ4B 2J34A 2QF3A 5FX6A 2OINA 1GJ9B 2D1JA 1THRH 2BHGA 1SGFA 2QIQA 1RGQA 1YPEH 4B1TA 4FUBA 4NIVA 5EW1H 2ZIQH 4O03A 1RTLA 1ZHRA 3SV9A 3B23B 4FU7A 1DDJA 2VH6A 1FZZA 5DGJA 1F2SE 1PPFE 1O2WA 3FP6E 2ZFPH 2XCFA 2R9PA 1B5GH 1GHAG 1P05A 2G5VA 2XWAA 4AYYB 3VPKA 1AE8H 4U30A 2Z9KA 2BVRH 4CREA 4QT8C 1C1UH 1WTHD 1Z71A 1O35A 2A4GA 2CXVA 4IN1A 1T8NA 2D2DA 1OYQA 4BAOB 3O8RA 4OS6A 1GHWH 1EPTB 5ESBA 2VIQA 3EE0B 4AB8A 1UTQA 4FUHA 1QNJA 3W94A 1O3JA 1UVUH 4CRFA 4FU9A 1GBHA 3BV9B 1GI4A 2FYQA 2PUXB 1O3HA 3SV8A 1C5SA 1H8IH 2XBYA 1IQLA 1MH0A 1HIAA 2BD7A 4JZDH 4JMYA 1F7ZA 1VGCC 2ZU3A 1W8BH 1C2HA 2A1DB 1OOKB 1T7CA 2C93B 1O2SA 3NPSA 1P3CA 3ZVEA 1J16A 3CENA 2FLBH 2ZU4A 2BY8X 1BBRH 4Y7AA 2AS9A 3RXBA 2BD2A 4K8BA 4A7IB 1NTPA 5C20A 3L33A 1KY9A 4WJG2 1MU8B 3UOPA 1ZJDA 1HXFH 1DLKB 1SHHB 3RXLA 2HPPH 1XKBC 3STJA 3SHCH 1NROH 1SQAA 5L6NH 2ZHDA 4CRAA 4WY3A 1S85A 1RS0A 3TK6A 3SHAH 2SGFE 1Y5AT 4ABGA 1ELCA 1PFXC 1NFWA 3ELAH 3K6ZA 3VB7A 1G3BA 1LCYA 1U6QA 1V2OT 2UUKB 1GHAF 1NRNH 1F0RA 3PV4A 1UK4A 1GJBB 2CHAB 3FANA 1DX5M 2C90B 1TX6A 2RA3A 1ZRKA 1W14U 3SJOA 1MKWK 4KP0A 1W10U 5EXLA 2ZI2H 3KN2A 1O39A 1O30A 1AWFH 1SHYA 2ZDVH 4LK4A 1OS8A 1NC6A 1VCPA 3QLPH 1RIWB 4K2YA 4AFSA 4E06H 3SV6A 5EG4A 1AWHB 1HCGA 3LGYA 1O0DH 3NKKA 4U2WA 1TPPA 3RXCA 5GPIB 1K1IA 1TOCB 2A7JA 3DUXH 1TBZH 2CV3A 4YT7H 1BJUA 4F49A 3TJUA 3ZZ9A 2CF9H 4MPWA 2BTCE 4ZXYH 3DD2H 2R3UA 1EZXC 5I46H 1AZ8A 3Q3XA 5L2ZH 4B2AA 1Z8IB 2KAIA 1O3AA 5EPNA 1T8LA 2BX4A 2ANWA 3SJKA 3RXDA 1EJMA 1L4DA 1MMJN 3LJOA 3VB6A 3F1SB 1MTWA 3BG8A 2VIOA 1EB1H 2XC4A 1YP9A 4UFGH 5GIBA 1CHOG 3SNDA 2GV6A 3SJ8A 3UPEA 3M7QA 4HFPB 1C1PA 1FPHH 4AN7A 1V2KT 4E7RG 2BDIA 1FNIA 5LPFA 1KTTB 1GMCG 2W7SA 1ANEA 3QZRA 2Z7FE 3F9EA 1HIAB 1GJ7B 1ZTKA 1RJXB 5FCRA 1O2PA 1C5LH 3A89A 4I8KA 1HLTH 4X8VH 3GCTG 2LPRA 1PYTD 2JH0D 3MO9A 1P8VC 2GCTC 4OGYA 3U69H 2BDYA 3WY8A 1FY8E 2QYIA 1O3BA 1LPGB 2OTVA 2P8OB 3LH1A 4X6MA 1MTUA 1EP5A 2Y5GA 1Z6JH 1LPZB 1C2LA 3LC3A 2WV5A 2O8WA 4ABFA 2TBSA 2QN5T 4OS7A 3RXAA 1C1NA 2ZF0H 1ZRBA 2ZECA 2G4TA 1H9LB 1OX1A 1QBNA 1S0QA 2BQ7B 2JH6D 1J17T 1E35B 3AVZA 2BZ6H 3V7TA 2ALVA 2F83A 4INKA 1SGCA 2FO9A 5A0BA 2Y7XA 2O8MA 3U1IB 1X7AC 4CRDA 4NZQA 4IC5A 1ABJH 1CHOF 1E37B 4X0WU 2ZPRA 3HGPA 4I33A 3ZYEA 4I8LA 3SNCA 2ZGXH 1GMCF 1V2NT 3MNXA 1H9IE 3PWCA 3FFGA 2A31A 3SOSA 2FLRH 5LPEA 2BLVA 1EPTC 1BTUA 4FUEA 3AW1A 3GCTF 1MKWH 1GBFA 1O2TA 1QB1A 1XUJA 3GOVB 2FPZA 3T26A 4B2BA 1BRCE 1LVYA 3OX7U 1ESTA 2KAIB 1TPOA 1P02A 1IAUA 2IOTA 1A0LA 4X1RU 1QA7A 2GD4B 2Y82A 1MTNC 3FZZA 2F9VA 2M5TA 2QXHA 3QTOH 3ZZ6A 4HTCH 1RTFB 3KQBA 2LNCA 2XBWA 1A7SA 2FX6A 3SJIA 1AMHA 1BB0B 1RXPA 1FI8A 1ID5H 3ODFA 3RXFA 3EA7A 2P3TB 2C8ZB 2G52A 4H6SB 1ZPZA 1YGCH 2BQWB 1TBRH 5FPSA 2AGIX 4JK6A 1GBDA 1V2LT 3E3TA 1QJ7B 3RXGA 2PKAA 2RA0A 4WWYA 4ISNA 3GY8A 4X1SU 8ESTE 1CT4E 1AKSB 1TNGA 1INCA 1XKAC 1GG6C 2CHAC 3UWJH 1G2MA 2V3HH 1YPGH 4D7FA 1P11E 1O2XA 5EW2H 1AI8H 3FAOA 2BD4A 5FBIA 5IYTA 2UWOA 3RXKA 1K9OE 3P6ZB 1O32A 1VZQH 1O31A 2DE8A 3TGJE 1HJAC 1HAVA 1D3PB 2A2QH 1L1JA 1DT2A 1RIWC 4Y71A 3MU0A 4ABJA 3PYHA 2PSXA 3DFJA 1DE7H 1EP6A 1OWEA 2WPJS 1C5UA 1CT0E 2A5KA 2NU3E 2UUJB 1A1RA 1MQ5A 1SB1H 5F8XA 1UJ1A 1S81A 3B8JA 4X6OA 3I78A 5TCCA 2JKHA 1V2VT 4INLA 1GHVH 3ATMA 3BEUA 2BD5A 3RLYH 3TK5A 3LGUA 4Y10E 4GHTA 1V2ST 1AFQB 2R2MB 5EGMA 4WH8A 2GP9B 1C5MD 3Q3YA 1GI1A 1FONA 1UTMA 3TLOA 3SGAE 1O2KA 1B0EA 1CBWB 1P06A 2ZFSA 3LT3A 3PTNA 3A7YA 4YZUA 3VGCB 3TH4H 2RDLA 3BTGE 1DVAH 4CHAB 2BXUH 1FQ3A 2OC1A 3PB1E 1ZSLA 1YBWA 3QN7A 2GV7A 1F92A 1A5GH 2C8WB 1PPHE 1O3IA 2ZDLA 2VB0A 3PMBB 1QL7A 3MH7A 3PWBA 4WMFA 3U1JB 2ZGJA 3STIA 4DGJA 4LZ1H 1GHYH 2HGTH 1EZUC 3M7UA 2B9LA 1AUJA 1O34A 1MKXK 1HAOH 1RFNA 3MNBA 4NWLA 4YTAA 5CMXH 1WBGB 2OD3B 4ISIH 2P8OC 3RXIA 5FHTA 4GUXA 1YCPK 1SGEE 2WPKS 1ZGVA 4K5ZA 1C2MA 2A32A 2GX4A 4U32A 3KQCA 3A8AA 3TH2H 3GCHB 2ZGBH 1S6HA 2VWNA 2ZO3H 3TU7H 4YO9A 1SMFE 2CJIA 5CHAC 2PR3A 1V2WT 1QR3E 1ZSJA 1TGBA 1K22H 2FXRA 5JBTA 1QBVH 1YPLH 4MPXA 3A8CA 1XUIA 1K1OA 1JRTA 1ELDE 3S7KB 1QY6A 3U8RH 5GXPA 2EEKA 4AGJA 1BRAA 2WINI 2A7HA 2R0KA 3LJJA 4XOJA 4CR9A 1Q31A 1HDTH 2V6NA 4MG3A 1FV9A 2XWBI 3SQEE 5HM9A 1J15A 1C2EA 3A7ZA 1SLVB 1O2OA 2BLWA 3ESTA 4I7YH 1O5BB 1MBQA 1BHXB 1ZMNA 4X1NU 1UVTH 3RXMA 4SGBE 1SFQB 3U98H 9LPRA 1WV7H 2I6SA 1GJAB 2PV9B 4DT7B 1G3DA 2ALPA 2OC7A 5DP9A 1KDQB 2ZHFH 3TITA 1ZPCA 4U01A 4X2XA 4Z0KA 3BTKE 3OY6U 2R2WU 4X8SH 3OYPA 3MNCA 1ARCA 1FIZA 1YPKH 3BTME 3A88A 4IS5A 2C8XB 1OWHA 3AAUA 1QURH 1SGDE 1TYNA 4ZXXH 1MZAA 4CR5A 4NG9H 1D4PB 6LPRA 2ZTXA 4ZKSU 2DUCA 3KCGH 1VCQA 1AD8H 1SLUB 4I8GA 1ELFA 1O5FH 1ACBE 2F9OA 2NU0E 3M35A 1BT7A 1XM1A 2BDCA 3F9GA 1S84A 3I29A 3BEIB 4Y7BA 4ISHH 1FY4A 1N1LA 1H4WA 2ZGHA 1SSXA 2GDEH 1NRSH 1SLXB 1XMNB 2VWMA 2BDAA 2CMYA 1AQ7A 1TQ7B 5DO4H 4XSKU 4ZAEA 3SBKA 2BOHB 4H4FA 1TRMA 5IDKA 2TRMA 3RXRA 3PMHB 3LKWA 1G3EA 5PTPA 3MYWA 1SG8B 3E6PH 4A1TA 1BUIA 1D3QB 1MKXH 2BDHA 1S0RA 3PTBA 4NFEA 1GGDB 4BXSA 1GDQA 1S5SA 2VINA 3A7XA 4NIXA 2VVCA 5K0HA 1GCDA 1WSSH 3V3MA 4TYDA 4UEHH 1YCPH 1KXCA 3ATKA 4ZROA 3EA8A 1BMAA 1DANH 2FODA 5LPRA 1GI7B 3MU5A 1CQQA 4I31A 1EOJA 2PHBA 3ATLA 3F68H 1G32B 1SGQE 4HGCA 4BAKB 2FMJA 3NXPA 3P70B 2UWPA 3DHKH 1B7XB 1SQOA 4YOIA 1CO7E 3MH4A 9ESTA 2GZ7A 4ISOA 1NRRH 3UR6A 4TY7A 1SVPA 1TRNA 1O33A 1GBIA 4TPIZ 4K3JA 4IC6A 3HKJB 3TPIZ 5J4QA 3MH6A 3ZZ4A 4KKDA 2BD8A 1CBWC 1P2IA 1ELBA 3VGCC 4B74A 2F3CE 1ABIH 1BMMH 5EXNA 2ZCKP 4CHAC 4DOQA 1K1JA 1A3EH 4JZEH 1EXFA 1J8AA 3H5CB 1XXFA 2FOGA 5C5NA 3HPTB 3S9AA 3F9FA 3RXHA 4HZHA 1BTHH 1XUKA 2R3YA 3UQVA 3RM2H 2WYJA 1DOJA 1UK2A 2CN0H 3SV2H 4B71A 1DLEA 5H4IB 3LOXA 3UR9A 1FDPA 1GVKB 1NFYA 1HAXB 4GHQA 4XDEA 3B9FH 3EAJA 2R0LA 3MU8A 4RN6A 1QQUA 3SNBA 4E05H 5L2YH 1DWCH 2FI4E 1P04A 4DY7B 1WAYB 3GCHC 3A81A 4ABIA 1ORFA 2W26A 2ZA5A 1ZOMA 2ZQ2A 2AERH 2VIVA 2TGDA 3A7VA 4Q7ZA 5EU8A 3PO1B 1ZPBA 1QRWA 3GYMA 3Q77A 4AG1A 1PQ5A 3GY6A 4BAHB 1HAGE 3ODDA 3FVFB 3GY4A 1MTNB 4ESTE 2Y5FA 1N6XA 3PLBA 1UTLM 2A2XH 1Z1IA 5HXFA 4CBOA 1XX9A 5GWZA 1D3DB 1PQ8A 5DP7A 2TGAA 1TNKA 3ZVAA 2Z9JA 3UUZA 1GBJA 4X6NA 5DP5A 1G30B 4NIWA 7ESTE 2FTMA 2HALA 1GDUA 1UCYK 5BRRE 2A0QB 3QWCH 2G00A 2Z3EA 5DPAA 3A83A 3NZIA 1GG6B 1O5CB 2SGDE 1KLIH 2CGAA 2V3OH 5FCKA 3MHWU 4XBDA 3MWIU 2Q1JA 2HNTF 4GCHG 2HLCA 3UNQA 1IQEA 4AORA 4THNH 3DFLA 3PROA 2ZPSA 1QFKH 1HJAB 4JYTA 7LPRA 1CA0C 2F9UA 3KQDA 1Y5UT 3GY7A 3ZZCA 4NA7A 3ZZ7A 1N6YA 1J14A 5GDSH 2A5AA 1O2MA 1AE5A 1E34B 4FUCA 1QL9A 2QA9E 2AFQB 3SQHE 4IN2A 1HAIH 3GCNA 3T27A 4ISLA 1LKBA 2F9BH 1O3LA 2EC9H 1AB9B 1AHTH 2OBOA 2WPLS 1V2UT 1G9IE 1MTVA 2BD3A 2PKSB 1QA0A 2FS8A 1F5RA 2WPHS 5E0HA 1H8DH 5DKMA 3AAVA 2WUCA 1ZTLA 2HNTE 1MAXA 4BNRA 1W7GH 2XBVA 1L4ZA 1TMUH 1HAHH 2P16A 2SNWA 2BY6X 1KXAA 1NT1A 2THFB 3QGNB 1EUFA 3SV7A 2ZFTA 1SGYE 3SW2B 3MFJA 4E7NA 1WCZA 1XUFA 5DJ7A 5HMAA 1TIOA 2QC2A 1ELGA 1GGDC 1KXBA 2VIPA 3GY3A 3S7HB 2PGQB 2J95A 1LQDB 1LVMA 3EDXB 2O8TA 4UFDH 4GCHF 2SGPE 1ZTJA 5JB8S 1AVXA 1FXYA 2BVXH 4AOQA 1HJ9A 1QRXA 1AKSA 4DIHH 1IQNA 2ILNA 2PWXA 1C4U2 3FP7E 4XBCA 5A0CA 5C1YA 3SUGA 1C5VA 1SPJA 1T4VH 1BRBE 1TALA 3E91A 4TWWA 1CU1A 1LVBA 4H42U 5K7RA 1C5NH 2ZEBA 5CHAB 1FAKH 1PQAA 4DW2U 2GCHG 1BA8B 2Q6FA 3SN8A 5LGOA 3HK3B 1DXPA 1C9PA 1O2QA 3UREA 1GBKA 1CHGA 2H2ZA 1XVMA 3URDA 1BJVA 2ZDKA 1ZR0A