2NWNA

New pharmacophore for serine protease inhibition revealed by crystal structure of human urokinase-type plasminogen activator complexed with a cyclic peptidyl inhibitor, upain-1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
246
structure length
240
Chain Sequence
IIGGEFTTIENQPWFAAIYRRSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSALAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Plasminogen activator, urokinase
publication title Structural basis of specificity of a peptidyl urokinase inhibitor, upain-1
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 240
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nwnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nwnA01
4ABEA 4XSKU 3S9BA 1VGCB 1W0YH 2FMJA 1AFEH 3U8RH 3F9EA 4TPIZ 4ZAEA 4KTSA 4QT8C 3RXGA 1ABIH 1AB9B 2H6MA 1YPGH 1TRYA 2ZDAH 2F3CE 4CR9A 2VIVA 2QY0B 3RMNH 1SFIA 1P10A 3SU2A 1TIOA 1MD8A 1C5NH 2LPRA 1CE5A 1G2MA 1GL0E 2BTCE 2B7DH 4CBOA 1C1PA 4OS6A 1GHYH 1TMBH 1O0DH 2PSXA 3D65E 3SUEA 1PPGE 3GCTG 3RXCA 1FQ3A 3PMAB 3MYWA 1YLCA 1K2I1 3RXUA 1GBEA 2VVUA 2ZGHA 3H5CB 3RU4D 3EA7A 1TLDA 3VB3A 5CMXH 2WUBA 3UIRA 5JBTA 2ZCKP 1HXEH 1EAWA 1L1JA 1A1RA 2G81E 3NWUA 4DW2U 2FODA 5DO4H 4Q80A 1A3EH 1TPAE 3RXPA 3ZVEA 4CH8B 2ZU1A 2EI6A 3ZZDA 3A84A 2QAAA 3A85A 1O3AA 4Y0YE 3RLWH 1GI5A 2XXLA 1ELCA 3RU4T 1Y3VA 3GDUA 1C1UH 1MBQA 1C1VH 1EPTC 1TQ7B 1DSUA 3TK9A 3ZZCA 2Y82A 5HXFA 1NY22 1HRTH 4K60A 2AYWA 2AGEX 1CGHA 1IQHA 2B8OH 3ELAH 1D3TB 1PPZA 2OC7A 2BD5A 1DPOA 3MU4A 3KF2A 4THNH 1P8VC 3KEEA 3UQOA 3E0NB 1EAIA 2YOLA 3LPRA 3R3GB 4Q7ZA 3EA8A 4MPXA 3MMGA 1GI9B 2FDAA 1JOUB 1RTLA 1O5EH 5GJ4B 4M7GA 3BTHE 1GHBF 2XBYA 1KYNA 1O5BB 1OPHB 3HK6B 1O33A 1TPPA 2ZGCA 1GMDF 1C4Y2 4ZXYH 2VWOA 3LGTA 1ZSKA 1K28D 1O3KA 4INLA 1GJ9B 3SJ9A 5C67A 4BAQB 1EPTB 5C1YA 4E06H 4TY6A 2RDLA 2WV5A 5J4SA 5DP9A 3P95A 1INCA 1MTNC 1ZJKA 2WPHS 2R3UA 1Z6EA 2BD2A 1J17T 1P04A 2ANWA 3BV9B 3PO1B 1OWEA 3FP7E 5F8TA 2Z3CA 3U1IB 4UONA 1O2OA 4LXBH 3SU3A 1HAZB 3A88A 1H9IE 3BTKE 2P59A 1N6XA 2ZFQH 4NIWA 4D8NA 4ABGA 1DX5M 1GI1A 1GHZA 1Y59T 1ELBA 1WAYB 1O3NA 1BITA 2FLRH 3DHKH 2CF8H 1O2GH 2Z9IA 2ZZUH 3KQBA 1SQOA 2P3UB 1O2RA 1BBRK 1D4PB 4MPVA 1YF4A 2ZHFH 4IW4E 2GCHG 1YYY1 2A0QB 4O3TA 5GCHG 4VGCC 4D9RA 3RXJA 1FV9A 3NK8A 3HK3B 1O3GA 1MKXH 2BLOA 1MTNB 2FM2A 2OC1A 2PWXA 1V2UT 1ZGVA 2Y5HA 1ANCA 5T6FA 2FOCA 4B75A 2D2DA 1ZTJA 2BY6X 3MH7A 5E2OA 1MTWA 4WF8A 1EASA 1TFXA 1PPBH 2VGCB 3DA9B 5EODA 2XC0A 1EJMA 1QNJA 2BQ6B 5LGOA 4LZ1H 3P8FA 1K9OE 1UVOA 3JZ1B 2UUYA 4JZDH 1EATA 1AWFH 5F03A 2A2XH 2P94A 1S83A 1GMHF 1VITF 5EQQA 1P01A 1AIXH 5C5NA 5DKMA 3SNDA 1Q31A 1C2DA 1SSXA 2STAE 3SGQE 1BA8B 1GBLA 1TOMH 3F9HA 5FX5A 1GJBB 3A80A 1ZHPA 3A83A 1SQTA 2ZPSA 3GDSA 6GCHF 4JMYA 4VGCB 2Y5FA 3MU5A 1SQAA 3U9AH 4H6TA 1FONA 4WH6A 3SUGA 8ESTE 3Q3XA 3SJKA 3TGJE 1O36A 2EC9H 1V2WT 2SGAA 2ODPA 1PQ5A 3RXDA 3FAOA 1WV7H 2A1DB 1QGFA 3TU7H 1DLKB 1BRCE 2O9QA 3QLPH 3F1SB 3VFEA 1YPJH 4YO9A 3GY2A 5GPIB 4MTBA 3ATMA 3U8OH 3B23B 3ZVFA 4K8BA 1AUTC 1V2NT 1FLEE 3GY3A 2GDEH 1C2KA 3O8DA 1O2XA 5L6NH 2J9NA 1O2NA 2PKAA 4TPYA 1T4UH 1A0LA 3RM2H 4K1SA 1YPHC 1U6QA 2BB4A 2V6NA 2BX3A 1MTSA 3PMHB 2C90B 2XBVA 3SJ8A 3HGPA 1QL9A 3ATIA 1C5XB 2J2UA 1YPLH 4YT6H 5DP4A 3ZVGA 3TVJB 1O2UA 2OCVB 2A45B 2W3KA 4WMEA 3SU4A 3ODFA 3TJUA 1V2VT 1O5FH 4X2VA 3DFJA 3SI4H 2Z94A 1F7ZA 1DWCH 1BBRE 2OC8A 1SBWA 2O8UA 2F9OA 3O8RA 1C1SA 1TOCB 1DDJA 1TNIA 1DS2E 5A8ZA 1LTOA 3ZV8A 3FP8E 2ZFPH 3SNEA 1GI0A 4A5TS 4ESTE 1RFNA 2K1QA 1Y5AT 2P8OC 1JWTA 1SGDE 2FIRH 5FXLA 1ZLRA 2ZDKA 5TCCA 1YP9A 1D6RA 1K1MA 1ELAA 5FPYA 2BD8A 2OP9A 4FUDA 2RCEA 1MU6B 4K1EA 1NRRH 1LPKB 4I8LA 2TGTA 1QBVH 2BD9A 2H5DA 3SV9A 1NU9A 1GVLA 2R9PA 2ZGXH 1FY5A 4ZHAA 1LQEA 2ZU4A 1TGSZ 2CN0H 4Q7XA 2XYAA 3D23A 3E16B 2Z9JA 1ELGA 3PYHA 1P2QA 1ZR0A 1GVZA 4ZHLU 4BANB 4A1TA 2SGFE 4BTTB 4Q2KA 4X8UH 2Q6FA 3SUDA 2Z3DA 4F49A 1BTXA 2P8OB 1T8MA 1WSSH 2ZDNA 1C4V2 1FI8A 1O32A 5DK1A 1WU1A 3SGBE 1XXDA 4INHA 1P03A 5C2ZA 2PUXB 2QXHA 2FOAA 5AFYH 2BQWB 5ETXA 1UK4A 1LMWB 2PUQH 5BPEA 3T28A 1EKBB 2Y81A 4Y8ZA 4Y8YA 1GBBA 1GBMA 3RXRA 1KLJH 1O30A 2AMQA 1ACBE 2VVCA 3HATH 1P06A 2GMTC 3UUZA 3VPKA 2DUCA 3ZVAA 1V2JT 1JIMA 1IQJA 3MNBA 5F8XA 5LPRA 3MTYA 1O2YA 1P05A 1SGCA 3HPTB 1P2IA 2ZKSA 4YLQH 4ZHMU 3RU4E 2FS8A 3C27B 3BG4C 4WXVA 3SHCH 1DSTA 5F6MA 3OY5U 1BUIA 3UR6A 1VR1H 2GCTC 2TGDA 4AB8A 2FZZA 3TIUA 2PR3A 2PKSC 3UOPA 3SNBA 2BOHB 4MNXA 3E0PB 2ANMH 3QTVH 2VNTA 4CHAB 5AFZH 3RXOA 2BDGA 3ZZ3A 1C2JA 1S0RA 1FDPA 3TJOA 3BIVH 2ZCHP 1UTJA 2F9BH 2QCYA 5T3HA 4X8TH 2BDIA 3PMBB 1HFDA 1V2OT 1FPCH 4MVNA 1IQFA 2ZI2H 2XBXA 2D1JA 5A2MH 2FO9A 1GG6C 2R0KA 1KLIH 2ASUB 2GZ9A 1A5GH 1EX3A 1H8IH 1L2EA 4H4FA 4ZXXH 1FAKH 5ESTE 4ISHH 2SNVA 1MH0A 1KTSB 2ZFTA 3QUMP 1LHGH 1XUIA 3M7UA 4Q7YA 5EW1H 2QF3A 5GXPA 1AZ8A 2AS9A 1SGYE 2EA3A 1P02A 5TJXA 3TNSA 4LK4A 5ESBA 1GBDA 3ZZBA 2PKSB 2HALA 1P2KA 2BDHA 5EOKA 1C1RA 4CBNA 3GY8A 3T27A 1FUJA 3NCLA 4HTCH 4AX9H 1C2MA 4X2YA 3OU0A 2THFB 2ALPA 3K2UA 5F8ZA 4NIYA 1ARBA 5A8XA 1F0SA 1EB1H 1PPCE 1AVWA 1GG6B 1WQSA 1F0TA 1EJNA 2ZIQH 1KDQA 2FOFA 4DURA 1NT1A 3BTDE 3QTOH 1IOEA 1S6HA 4D9QA 1C9TA 3PB1E 3SN8A 3LIWA 2WPIS 1TALA 1MKWH 3VGCB 1GWAA 1SGEE 1GHAG 1YM0A 1K1IA 3M7QA 3P92A 4HZHA 4O97A 4UFFH 2SGDE 1H4WA 1OWDA 1DANH 2UWLA 2XWBI 4XBDA 2ZDLA 1LHFH 3GYLB 3S0NA 1GJ4H 5DP7A 1ZPZA 3S7KB 4DG4A 3F68H 2ALVA 2ZPQA 1TB6H 1J9CH 1V2KT 1QL8A 1Z7KA 1SHYA 5SGAE 4AYYB 4JYVH 1S6FA 2AMPA 1G2LA 1LQDB 3VB5A 3KN2A 1O3IA 2F91A 2QN5T 4O3UA 1GGDB 1GJAB 1FN6A 1P2MA 1QHRB 1SGRE 3A8CA 1ANEA 1LVBA 3M3VA 4I7YH 5EXNA 1UTOA 1GDNA 1C2FA 2ZDVH 3A8BA 3ENSB 1AFQC 3Q3KA 1QBNA 1QBOA 2SFAA 3BTFE 4OGYA 1SOZA 4NWLA 2XC5A 1MBMA 2G55A 2VB0A 3VXEH 1O3BA 1SGFA 3AW1A 1ZRKA 5B6OA 3V13A 1E38B 2WV4A 2R0LA 1ZGIA 1VJAU 4X6NA 2A5IA 3T26A 2VIPA 1O2TA 4FUEA 2TRMA 2HVXA 1AUJA 1JMOH 3UTUH 1HAXB 1QRWA 4A1XA 1HLTH 2D8WA 1V6DA 2EI8A 3M37A 1ZOMA 2OBQA 2A31A 5L2ZH 2G5VA 1EZXC 3ATKA 2ZNKH 4B2CA 2C8ZB 2XNIA 2JH0D 2TGPZ 2OXSA 4K3JA 1BB0B 1C5TA 3A7TA 4GCHG 3TK5A 5GDSH 1A2CH 1WQVH 4YZUA 5AF9H 1DXPA 4YOIA 3LT3A 2GV6A 3OX7U 2HNTE 1H9HE 2FYQA 1YPEH 2VVVA 2ULLA 3U8TH 5DP6A 1B0FA 1CO7E 3UREA 3RLYH 4TYDA 1NTPA 1V2ST 4FVBA 4J2YB 1K21H 1FPHH 4NFFA 1KY9A 2PGQB 1C1NA 1AZZA 3MU0A 4RKJB 1OP2A 2VIDA 4A92A 1HAVA 1WBGB 2BLQA 1ETSH 1GJ8B 2UWOA 3VB7A 2CMYA 1HAGE 2ZPRA 1ZHRA 1SGPE 4IC6A 2P95A 1C1MA 1T32A 2BLVA 2VIOA 2BDBA 1NPMA 3LC5A 5GCHF 2AMDA 1TRNA 2Y7XA 1C5SA 2I6SA 8GCHF 2R3YA 1BTPA 1NFWA 1AE8H 3ZZAA 1EZQA 1BJVA 2OINA 2FP7B 1YKTA 1NRSH 2QGRA 1LHDH 4BTUB 1ANBA 5C3NA 3ATLA 1NU7B 1C2EA 4OS4A 1SMFE 1TABE 1ESBA 1HPGA 1TBZH 2FX4A 1FIZA 4BAHB 1EP5A 4I33A 4D76A 3P8NA 2ZTXA 2F9PA 1HAIH 1W7GH 1GMCF 4I8GA 4NA9H 4O03A 4AFUA 5C20A 2A4RA 4BXWA 3SW2B 1HV7A 3FVFB 6CHAC 3BF6H 1V2TT 1LHEH 2A32A 3RM0H 1O39A 1O2HA 3M5MA 2TIOA 3SQEE 1UTMA 4FVDA 7GCHF 2I6QA 1O2JA 2IOTA 1SVPA 2FYRA 3FZZA 2QIQA 3UWJH 1DM4B 3GYMA 3DD2H 1T7CA 5IDKA 1CT2E 1BBRH 2C3SA 1W10U 1QA7A 4OS2A 3M35A 1EB2A 4X6OA 3SOSA 3T29A 1ZYOA 2HPQH 1FY8E 1KSNA 4CREA 2NU0E 3STIA 4KP0A 1TNHA 1SG8B 1UHBA 2UUJB 2G4UA 3TK6A 1TBQH 2FOBA 5DP5A 1E35B 2RG3A 3MH5A 2ZFRH 3SV6A 4Y71A 1O34A 1BRUP 2ZHQH 3V0XA 2KAIA 3KCGH 2CJIA 1RTFB 5JYIA 1DITH 2VINA 1HDTH 3A7XA 1AKSB 1XVMA 2NU4E 6CHAB 4R8TB 5L30H 1D9IA 1HIAB 1C1QA 1A0JA 1DT2A 5EXLA 3A8AA 3K6ZA 1YBWA 1IQNA 4JZIA 1DY8A 1RS0A 1BZXE 1YGCH 5BRRE 1TE0A 4JZ1A 2J38A 3RXFA 1QY6A 1MAYA 1QJ7B 5LPEA 1F5RA 1MZDA 4ZH8A 4X2WA 1HNEE 2R2WU 4WY3A 4TWYA 4SGAE 1YPKH 2FS9A 1UMAH 3KHVA 3E8LA 3UOUA 1WCZA 4GPGA 5FBEA 1GBFA 1FMGA 1UCYK 5DGJA 4DIIH 1SGFG 4KTCA 1NFYA 2WUCA 2UUKB 1GBJA 5T6GA 3A8DA 1KXDA 1OXGA 1PYTC 3LDXH 1JIRA 1GDUA 1BT7A 2G4TA 1O38A 2CGAA 1QIXB 4ZKRU 2F9NA 3ZVCA 1T31A 3OTJE 3AAVA 4ISNA 2H9HA 3BEUA 1H8DH 2NWNA 2AIQA 5FPTA 5I46H 3UNQA 5JPMH 1WUNH 1Y5BT 3NKKA 4AYVB 2ZEBA 3SJIA 1TPSA 1X7AC 3ZYEA 4BAKB 3M5LA 1LCYA 2XWAA 4X1PU 1FZZA 4YOJA 3OY6U 1V2RT 3MNXA 3TPIZ 3LJJA 1BDAA 1P2JA 4UD9H 1TX7A 3SQHE 2ZU3A 1GI2A 3GICB 2A5KA 2XTTB 2OTVA 3U1JB 4NCYA 3ZZ5A 1GHBG 1TNGA 4MPUA 1GBTA 3UFAA 1BRBE 2XCNA 1BTHH 1O5CB 1D6WA 1Y8TA 1CHOF 1VCQA 2A4OA 3RXAA 1W8BH 3A81A 1PQ8A 3BTTE 2OUAA 1PYTD 4WJG2 1QRXA 1EPTA 1XUJA 1P2OA 3ZZ6A 3A7YA 3V12A 3LU9B 3UQVA 1GI4A 1SLXB 3BSQA 1THPB 3P17H 3S9CA 1O37A 1O3FA 2B0FA 5CE1A 1OX1A 5A0AE 4LZ4B 1T4VH 2C4FH 3Q3YA 2ZU5A 2BVRH 3BTGE 1AO5A 2PLXA 2GX4A 1G36A 5E0HA 1W14U 4FUHA 2GD4B 1L4DA 3MO3A 2FTLE 1RD3B 4XOJA 5E8EH 2OBOA 3PTNA 2O8MA 2VWNA 1AY6H 5EG4A 3K65B 2XC4A 3SO3A 1KXAA 5GIBA 4LOYH 4FU7A 1K1JA 3AW0A 4OS5A 1RIWC 3QGNB 2XRCA 4J1YA 3A86A 2OQUA 4WXIA 3M36A 1DE7H 4X6MA 3TGKE 1UCYE 1LVOA 4K1TA 1AGJA 3NZIA 4X1RU 3LGIA 4Y6DA 3TH4H 2SGEE 1XVOA 3O8BA 3A89A 3UNSA 1KLTA 2EEKA 1HUTH 2GDDA 1SPJA 4YTAA 2A7JA 3NUMA 4I8JA 2AGGX 1W2KH 3GCHC 2IJOB 1AVXA 1XX9A 1HXFH 5HMAA 1F0UA 3RXEA 1GMHG 4AG2A 1VITG 4BOHA 3EA9A 5T6DA 1O3PB 2ZFFH 1ELFA 1V2QT 1OSSA 3F9GA 5AHGH 1GCTC 3RXMA 6GCHG 5HM9A 1O31A 4GSOA 2P3TB 1O3LA 1QR3E 1D3PB 1CHGA 4Z0KA 3SNAA 4A1VA 4BTIB 1J8AA 1Y3WA 3C1KA 8KME2 1OWKA 1ARCA 2VWLA 1BTYA 1ESAA 4OS1A 1O2KA 2TBSA 2F9UA 4I32A 5A09A 1Z1JA 1AHTH 3SV8A 1O3CA 3B9FH 2XW9A 3MOCA 4H42U 1S5SA 1G37A 3GCHB 1HCGA 3CENA 1O3EA 5TCAA 3UNRA 4NGAH 2C93B 5EQSA 2GGVB 1DWEH 1OWHA 1QJ1B 4JK5A 3VB4A 4XBCA 1KTTB 4B73A 2F83A 4K5ZA 1FNIA 3GCOA 2AIPA 5HYOA 5PTPA 3MWIU 2PW8H 1HAHH 1P57B 2FOEA 1GHAF 4AFZA 1A4WH 1GBKA 1F0RA 1HAYB 1LPGB 2HPPH 3QZRA 1S0QA 1GJ5H 1QL7A 1THSH 3E1XB 4WH8A 1GI8B 1ZSLA 1TGNA 4YT7H 1SLVB 3GY6A 1GJDB 2H9EH 4CR5A 2PFEA 1Y3XA 4IN2A 4NIVA 3ZZ8A 1BTWA 1PPEE 1GBAA 2P3FH 1T8OA 1GHXH 1RXPA 1O2MA 1GI7B 1GL1A 2ANKH 2CHAC 1BMAA 1TX6A 2BM2A 1O2VA 2FOHA 2J92A 1UVSH 2RA0A 2CF9H 2GMTB 2VIWA 3JZ2B 1GHWH 4AGKA 1FAXA 2JETC 1VJ9U 3A7ZA 3DUXH 4B1TA 4NIXA 3RXSA 2ESTE 3I29A 3SBKA 1CGIE 3A87A 3BG8A 3G01A 1L1GA 2SGQE 2OC0A 5C1XA 1TRMA 3MO6A 4NSVA 1OP8A 1JRSA 2Z9GA 3BG4B 3SZNA 4DIHH 2WPKS 5JBBS 4CRBA 1DUAA 2GZ7A 2GCTB 1B0EA 2VIQA 4Y11E 4CRFA 1MUEB 1T8NA 4Y10E 1SL3A 2Z9KA 1C4U2 1EOLA 3A7VA 2AH4X 1C2IA 4O9VA 4I31A 1OKXA 2HLCA 2ZU2A 1O3DA 1UK2A 1NS3A 1YCPK 2CHAB 1GBCA 1CGJE 2IN2A 1ZRBA 2V3OH 2QF0A 4Y0ZE 1HB0B 1GBIA 3L33A 1BQYA 3E3TA 4AB9A 1QRZA 1P11E 3RP2A 2RA3A 2AERH 2DE9A 1O2QA 2Q6DA 4GHQA 5DG6A 1AD8H 2BXTH 1PQAA 2A7CA 1W0ZU 3SU6A 1S81A 1GHVH 1BMLA 5ABWA 1H1BA 1OS8A 2BZAA 4KGAA 1QB1A 2V0BA 1F92A 1IHSH 1HGTH 1TONA 4IN1A 4AORA 1O2IA 2A2QH 2Q1JA 1BRAA 3LGWA 3P70B 3GY7A 1NRQH 2ANYA 2TGAA 1T8LA 2R2MB 1P9SA 3Q76A 4U01A 4XBBA 2DE8A 1ORFA 3R0FA 1NRNH 1TNJA 3GCTF 4U2WA 3ZZ9A 5C5OA 1AVGH 4AG1A 4A6LA 1XUGA 2Z3EA 3UWIA 2W5EA 3GCNA 3K9XB 1TNLA 2PV9B 2PTNA 4JYTA 5IYTA 3AAUA 1C9PA 1C5MD 1HAOH 2QXIA 4XDEA 4OS7A 1S82A 4B74A 5FAHA 3CP7A 3TNTA 1EP6A 5A0BA 1HBTH 3QZQA 4IS5A 3F6UH 1IQLA 1Y5UT 4U30A 3GY5A 1LVMA 3IWMA 1BIOA 1F5KU 1D3DB 1A5IA 1XKAC 1MTVA 1PQ7A 1TX8A 1WYKA 3I77A 4BNRA 1M9UA 3M61U 1B5GH 1J16A 3QWCH 2HOBA 2WPLS 3A82A 1EXFA 1LKAA 2Y5GA 5DP8A 2GT8A 3MFJA 1VZQH 2V35A 3DT0H 3LC3A 5JB8S 4ABFA 2FI5E 3PM3A 2C8XB 3QGJA 2BZ6H 4JYUH 5CHAC 3KGPA 2ZP0H 2NU3E 4ZUHA 1UTKA 3MO9A 3TJNA 1O2SA 4HGCA 4UFEH 4DOQA 4XE4A 4SGBE 1GJ6A 1QA0A 3CS0A 4Y79A 1KXFA 1AFQB 1NRPH 3M5NA 2FI4E 4ABAA 4E7RG 1W11U 1TMTH 4FUGA 2W7SA 1P3CA 1PFXC 3SU0A 2BD4A 3OSYA 3S7HB 1EZSC 1DWDH 2QYIA 3HKIB 1BHXF 2BDAA 4KTUA 1TMUH 1ZMNA 1NFXA 4ABBA 4INKA 4MG3A 1C5UA 2BYAX 2P93A 1LDTT 3ZZ4A 4DT7B 1N8OC 3K6YA 1K1LA 2V3HH 1O5AB 9ESTA 1C2GA 3ZV9A 3NXPA 3MNCA 2FX6A 4ABIA 3UPEA 2H2ZA 5EGMA 3QX5H 1FY4A 3SV2H 3MNSA 1L4ZA 1BJUA 3LJOA 2QC2A 3M7TA 4FUFA 2PSYA 2WYGA 4CRAA 5FCKA 1LVYA 2BQ7B 3DFLA 3HKJB 3RXQA 2ZC9H 1EOJA 1N1LA 4K69A 4IC5A 3RUOA 1TQ0B 2FLBH 1RRKA 1C5OH 1ELVA 3RC4A 1CSOE 1GJ7B 2WPJS 4ZKOU 1QB9A 3P8GA 3AVZA 2GCHF 3T2NA 1C5WB 2HRVA 3SUFA 3BTWE 4NA8A 2IPHA 1CA0C 4MPWA 3U98H 1BMNH 1XUFA 1QCPA 2BOKA 1N8OB 1RJXB 5FX6A 1AE5A 3LOXA 1MZAA 3F9FA 4UDWH 3T5FH 1E0FD 3MH4A 1K22H 4HFPB 3OYPA 2XBWA 4WWYA 1KXCA 2J94A 5EQRA 1SOTA 1TGBA 1GI6A 1QFKH 3PLKA 4IMQA 2O8TA 1YPHE 5DPAA 1Z8IB 1Q2WA 2Z7FE 3QN7A 4D7FA 3FFGA 1P09A 1CU1A 1XKBC 1LPZB 1A0HB 3AASA 1F2SE 4AFSA 1UVPA 4U32A 4X1QU 1G3DA 2JH5D 5EW2H 1ETRH 1E36B 4ISOA 1TWXB 1JXPA 2Z6BD 1O3MA 1KIGH 1CA0B 2FOMB 1C5RA 1S84A 1B7XB 4FXGH 4I8HA 3T25A 3PO1C 1MMJN 1OWIA 2LNCA 3UY9A 3ITIA 2ZDMA 2PGBB 3KQCA 3KIDU 3QK1A 2QXJA 2D26C 1SHHB 1QTFA 3URCA 1ANDA 1A7SA 3WY8A 1IQMA 1SLUB 4ISLA 3RC5A 3SV7A 3D62A 2H5CA 1C5PA 1GJCB 4Y7BA 1MCTA 4AOQA 1DUEA 1LKBA 4E7NA 4YM9A 1EJAA 1CBWC 3O8CA 4K8YA 1ELDE 1KXEA 4ZROA 2OLGA 2G8TA 1SI5H 2PKAB 3S9AA 1TYNA 3LH3A 1UCYH 1ZHMA 1SC8U 5HGGA 1TGCA 1VCWA 3N7OA 3STJA 2AFQB 4ABJA 2QA9E 2BY8X 1V2LT 5LPFA 4Y7AA 2W3IA 3BEFB 4MQAA 2ZHEH 1YC0A 2VH0A 1O5DH 2VU8E 4X0WU 1L0ZA 3URDA 4BAMB 2VGCC 3ZZ7A 3L6PA 3H7TA 3PTBA 2Y80A 3SHAH 3TJVA 1GBHA 1NO9H 1EAUA 1JRTA 2CV3A 1NZQH 1DY9A 2STBE 3IITA 3SU5A 1TBRH 2UUFB 5EPYA 2HWLB 2Y7ZA 1CBWB 4AN7A 2BMGB 1VITH 3P8OA 5C1UA 4B71A 1SR5C 1SGTA 1O2WA 1GPZA 1C5YB 1O2PA 2W7UA 3A7WA 2BD3A 4MDSA 1E37B 1E34B 2BY7X 2YNBA 5J4QA 1SGQE 3LH1A 8GCHG 1O5GH 1G9IE 4GLYA 1V2PT 2O8LA 4IGDA 1CVWH 1PPFE 5A8YA 4WVPE 2ODYB 1OYQA 2GP9B 1THRH 2GT7A 2HNTC 2UWPA 3SNCA 1Y3UA 1DLEA 1BOQA 4MLFB 1QQUA 1RGQA 3KQDA 2J95A 1UVTH 1DXWA 1IQKA 2Z9LA 4ISIH 2CXVA 2ZTZA 2A4QA 4ZKSU 2J34A 3BTME 1ESTA 4DJZB 1GMCG 3KL6A 2WINI 2BHGA 2FXRA 1MKXK 2AEIH 3GISB 3D49H 4AGJA 3GOVB 5LH8A 3SU1A 1O3OA 1IQEA 1Q3XA 1BTUA 7GCHG 1G30B 5JDUB 1GMDG 2W26A 4I8KA 1C2HA 3HGNA 2ILNA 1MQ6A 3SORA 2BVSH 3W95A 3MH6A 2ZQ1A 5E2PA 1OP0A 2FESH 1ETTH 4CRDA 3MU1A 1AMHA 3V7TA 4E05H 3I78A 7KMEH 2NU2E 2C8WB 2B5TB 2BXUH 2ZFSA 3KNXA 6ESTA 2ZGJA 2ZQ2A 1J14A 1DICA 4F4OC 4AFQA 1V2MT 4X8SH 1KXBA 3W94A 7ESTE 1XMNB 1W12U 2BY5X 3RMOH 4NZQA 4DGJA 4NSYA 1OWJA 1AKSA 2F9VA 4JK6A 1HJ9A 4K2YA 4RSPA 1HIAA 1O2ZA 1IHTH 2ODQA 3IG6B 5FPSA 4WMDA 1NESE 5EPNA 2J4IA 1AWHB 3EE0B 1OOKB 1W7XH 2VWMA 1DOJA 4D7GA 1NROH 1C5LH 3PV4A 3RXVA 1UTQA 3EAJA 1EUFA 2VH6A 1MCVA 1PPHE 2WPMS 4A7IB 1FXYA 2M5TA 4FU8A 3Q00A 3KQEA 4KELA 4ZMAH 4DVAU 2FI3E 4YOGA 2GKVE 5H4IB 1TPOA 1BCUH 1C5QA 3RXIA 3PMJA 2GTBA 1DFPA 2HGTH 2BY9X 1ZMJA 1O3JA 2G00A 1MTUA 3QDZB 1ZJDA 1WTHD 1NFUA 1YCPM 1CA8B 1IQIA 2XCFA 1K1NA 1ZTKA 4NA7A 3RC6A 4B2BA 1GDQA 1TGTA 1ABJH 2ZECA 3LGYA 2AGIX 4NFEA 1RIWB 3VB6A 2JKHA 1NM6A 3PROA 5JBCS 1AN1E 1K1OA 2ZHWH 2ZF0H 4UEHH 1CQQA 5E0JA 1G3EA 3RMMH 1O2LA 1EZUC 2SNWA 3H7OA 4JZEH 1P2NA 3ATWA 2GZ8A 2ZCLP 1AU8A 3RXKA 3TGIE 1C1TA 1KDQB 2NU1E 4TY7A 5I25A 4DCDA 1GI3A 1BHXB 4Y8XA 3S69A 3TH3H 3TITA 2Y6TA 5GWZA 1CHOG 4MNVA 5DP3A 1WOFA 3T62A 3BN9A 1ZMLA 1P9UA 5AVDA 1GCTB 1L1NA 1SGIB 3LONA 1GVKB 2H1UA 3PLBA 4CHAC 2SGPE 4X2XA 5A0CA 3BTQE 1V3XA 1P12E 1XUKA 4UFGH 3SJOA 3ESTA 4FUBA 5L2YH 1WTGH 3BIUH 4FUCA 7LPRA 2ZO3H 2A7HA 2FOGA 3SGAE 5HM2A 9LPRA 5G4BA 4R0IA 3FANA 4GAWA 1XXFA 2G51A 2QXGA 2VJ1A 3RXHA 4DY7B 1ZPBA 2A5AA 3MI4A 3U69H 1HJ8A 5E0GA 5JBAS 1Z71A 1UTPA 1XUHA 1PJPA 4NWKA 1Z1IA 1H9LB 1QJ6B 1HYLA 1Z8JB 1YCPH 1JBUH 3B8JA 2FWWA 1UTLM 3RDZA 1C5VA 1GCDA 2BD7A 2G52A 2TPIZ 1A5HA 2G5NA 3P6ZB 3VXFH 4KKDA 4B76A 1UK3A 1IAUA 1C1WH 4HI3A 3ZVBA 4RN6A 3LGVA 1YPMH 6LPRA 4XFQA 2GV7A 1G3CA 1ZSJA 5K7RA 4YLUA 1C2LA 1MAXA 2FPZA 3ZYDA 8LPRA 3NPSA 5JB9S 1DVAH 1W13U 1ZZZA 1FJSA 3PLPA 3UR9A 1SGNE 1UO6A 4WMFA 1FN8A 3BTEE 2ZWLH 3GDVA 3LGUA 5EU8A 1SFQB 2B9LA 2BVXH 3GY4A 3VGCC 1Z8RA 1O35A 1AI8H 1YLDA 3V3MA 2EI7A 2HNTF 1F5LA 1EAXA 1SB1H 3EYDA 4CRCA 4GCHF 4ABDA 2JETB 4CH2B 1ZPCA 1G3BA 3VEQB 2P16A 3ODDA 1ELTA 4FUIA 3E91A 2YNAA 4UFDH 2A4GA 3BEIB 2FEQH 4YESB 1NC6A 4IBLH 1GGDC 4CRGA 3EQ0H 1BMMH 4X6PA 5FCRA 1LO6A 1UJ1A 3M5OA 1A3BH 2GVFA 2ZA5A 5EXMA 1HAVB 2C8YB 4H6SB 1ZTLA 4ABHA 3EDXB 4GHTA 4NG9H 1D3QB 3E90B 1AQ7A 1QB6A 1HAPH 2BX4A 4X1SU 4BXSA 1UVUH 1BTZA 1G32B 1P3EA 5FBIA 3RXLA 3FZDA 1FY3A 3E6PH 5K0HA 2BLWA 3SI3H 4MNWA 1EQ9A 4MNYA 4Y76A 1LHCH 4TWWA 3PWBA 1K1PA 4AZ2B 3LKWA 2ZGBH 3RXTA 3Q77A 2OQ5A 2OD3B 4NZLA 4ZKNU 3RMLH 1ID5H 4GVUA 5FHTA 1P0SH 1MKWK 3MHWU 3M3SA 1VCPA 2ZG0H 1RTKA 1ELEE 2ZTYA 4IMZA 2BDCA 2FTMA 1A46H 1N6YA 1SLWB 1Y3YA 2BDYA 1NN6A 1TA6A 5DJ7A 3M3TA 3FP6E 1QQ4A 3TLOA 1FY1A 2ZHDA 3L3TA 1HJAC 2PTCE 1A61H 1XM1A 4JZFH 1VGCC 3MU8A 4PROA 4UE7H 1AB9C 1IQGA 1MU8B 2QV1A 4X8VH 1MD7A 3PWCA 4OGXA 4Z6AH 4X1NU 1CT4E 1QURH 2Q6GA 2PHBA 1TAWA 3ZVDA 4BAOB 4FU9A 4ASHA 4RKOB 1FIWA 1C1OA 2H9TH 3QO6A 1Z8GA 3TH2H 3RXBA 1O3HA 4GUXA 1Z6JH 1UTNA 1TNKA 1UHBB 1S85A 1TA2A 1J15A 2WYJA 1MQ5A 1W3CA 1DWBH 4B2AA 2JH6D 3CS7A 1C5ZB 2O8WA 3EGKH 2KAIB 4JCNA 1CT0E 4FUJA 5CHAB 1HJAB 1OYTH
chains in the Genus database with same CATH superfamily
4ABEA 4XSKU 3S9BA 1VGCB 1W0YH 2FMJA 1AFEH 3U8RH 3F9EA 4TPIZ 4ZAEA 4KTSA 4QT8C 3RXGA 1ABIH 1AB9B 2H6MA 1YPGH 1TRYA 2ZDAH 2QE7D 2F3CE 4CR9A 2VIVA 2QY0B 3RMNH 1SFIA 1P10A 3SU2A 1TIOA 1MD8A 1C5NH 2LPRA 1CE5A 1G2MA 1GL0E 2BTCE 2B7DH 4CBOA 1C1PA 4OS6A 1GHYH 1TMBH 1O0DH 2PSXA 3D65E 3SUEA 1PPGE 3GCTG 3RXCA 1FQ3A 3PMAB 3MYWA 1YLCA 1K2I1 3RXUA 2XNDD 1GBEA 2VVUA 3WWBA 2ZGHA 3H5CB 3RU4D 3EA7A 1TLDA 3VB3A 5CMXH 1WDIA 2WUBA 3UIRA 5JBTA 2ZCKP 1HXEH 1EAWA 1L1JA 1A1RA 2G81E 3NWUA 4DW2U 2FODA 5DO4H 4Q80A 1A3EH 1TPAE 3RXPA 3ZVEA 4CH8B 2ZU1A 2EI6A 3ZZDA 3A84A 1OHHD 2QAAA 3A85A 1O3AA 4Y0YE 3RLWH 1GI5A 2XXLA 1ELCA 3RU4T 1Y3VA 3GDUA 1C1UH 1MBQA 1C1VH 1EPTC 1TQ7B 1DSUA 3TK9A 3ZZCA 2Y82A 5HXFA 1NY22 1HRTH 4K60A 2AYWA 2AGEX 1CGHA 1IQHA 2B8OH 3ELAH 1D3TB 1PPZA 2OC7A 2BD5A 1DPOA 3MU4A 3KF2A 4THNH 5EIYA 1P8VC 3KEEA 3UQOA 2HLDD 3E0NB 1EAIA 2YOLA 3LPRA 3R3GB 4Q7ZA 3EA8A 4MPXA 3MMGA 1GI9B 2FDAA 1JOUB 1RTLA 1O5EH 5GJ4B 4M7GA 3BTHE 1GHBF 2XBYA 1KYNA 1O5BB 1OPHB 3HK6B 1O33A 4Q63A 1TPPA 2ZGCA 1GMDF 1C4Y2 4ZXYH 2VWOA 3LGTA 1ZSKA 1K28D 1O3KA 4INLA 1GJ9B 3SJ9A 5C67A 4BAQB 1EPTB 5C1YA 4E06H 4TY6A 2RDLA 2WV5A 5J4SA 5DP9A 3P95A 2QF5A 1INCA 1MTNC 1ZJKA 2WPHS 2R3UA 1Z6EA 2BD2A 1J17T 1P04A 2ANWA 3BV9B 3N7EA 3PO1B 1OWEA 3FP7E 4XD7D 5F8TA 2Z3CA 3U1IB 4UONA 1O2OA 4LXBH 3SU3A 1HAZB 3A88A 1H9IE 3BTKE 2P59A 1N6XA 2ZFQH 4NIWA 4D8NA 4ABGA 1DX5M 1GI1A 1GHZA 1Y59T 1ELBA 1WAYB 3U28C 1O3NA 1BITA 2FLRH 3SZEA 3DHKH 2CF8H 1O2GH 2Z9IA 2ZZUH 3KQBA 5EJLA 1SQOA 2P3UB 1O2RA 1BBRK 1D4PB 4MPVA 1YF4A 2JDID 2ZHFH 4IW4E 2GCHG 1YYY1 2A0QB 3W1EA 4O3TA 5GCHG 4VGCC 4D9RA 3RXJA 1FV9A 3NK8A 3HK3B 2IPQX 1O3GA 1MKXH 2BLOA 1MTNB 2FM2A 2OC1A 2PWXA 1V2UT 1ZGVA 2Y5HA 1ANCA 5T6FA 2FOCA 4B75A 2D2DA 1ZTJA 2BY6X 3MH7A 5E2OA 1MTWA 4WF8A 1EASA 1TFXA 1PPBH 2VGCB 3DA9B 5EODA 2XC0A 1EJMA 1QNJA 2BQ6B 5LGOA 4LZ1H 3P8FA 1K9OE 1UVOA 3JZ1B 2UUYA 4JZDH 1EATA 1AWFH 5F03A 2A2XH 2P94A 1S83A 1GMHF 1VITF 3DCLA 5EQQA 1P01A 1AIXH 5C5NA 5DKMA 3SNDA 1Q31A 1C2DA 1SSXA 2STAE 5GNDA 3SGQE 1BA8B 1GBLA 1TOMH 3F9HA 5FX5A 1GJBB 3A80A 1ZHPA 2EY4C 1SQTA 2ZPSA 3A83A 3GDSA 6GCHF 4JMYA 4VGCB 3H09A 2Y5FA 3MU5A 1SQAA 3U9AH 4H6TA 1FONA 4WH6A 3SUGA 8ESTE 3Q3XA 3SJKA 3TGJE 1O36A 2EC9H 1V2WT 2SGAA 2ODPA 1PQ5A 3RXDA 3FAOA 1WV7H 2A1DB 1QGFA 3TU7H 1DLKB 1BRCE 2O9QA 3QLPH 3F1SB 3VFEA 1YPJH 4YO9A 4ACBA 3GY2A 5GPIB 4MTBA 3ATMA 3U8OH 3B23B 3ZVFA 4K8BA 1AUTC 1V2NT 1FLEE 3GY3A 2GDEH 1C2KA 3O8DA 1O2XA 5L6NH 2J9NA 1O2NA 2PKAA 4TPYA 1T4UH 1A0LA 3RM2H 4K1SA 1YPHC 1U6QA 2BB4A 2V6NA 2BX3A 1MTSA 3PMHB 4ZCNA 2C90B 4RI0A 2XBVA 3SJ8A 3HGPA 1QL9A 3ATIA 1C5XB 2J2UA 1YPLH 4YT6H 5DP4A 3ZVGA 3TVJB 1O2UA 2OCVB 2A45B 2W3KA 4WMEA 3SU4A 3ODFA 3TJUA 1V2VT 1O5FH 4X2VA 3DFJA 1W0JD 2Z94A 1W0KD 3SI4H 5C0TA 1F7ZA 1DWCH 1BBRE 2OC8A 1SBWA 2O8UA 2F9OA 3O8RA 1C1SA 1TOCB 1DDJA 1TNIA 1DS2E 5A8ZA 1LTOA 3ZV8A 3FP8E 2ZFPH 3SNEA 1GI0A 4A5TS 4ESTE 1RFNA 2K1QA 1Y5AT 2P8OC 1JWTA 1SGDE 2FIRH 5FXLA 1ZLRA 2ZDKA 5TCCA 1YP9A 1D6RA 1K1MA 1ELAA 5FPYA 2BD8A 2OP9A 4FUDA 2RCEA 1MU6B 4K1EA 1NRRH 1LPKB 4I8LA 2TGTA 1QBVH 2BD9A 2H5DA 3SV9A 1NU9A 1GVLA 2R9PA 2ZGXH 3FN8A 1FY5A 4ZHAA 1LQEA 2ZU4A 1TGSZ 2CN0H 4Q7XA 2XYAA 3D23A 3E16B 2Z9JA 1ELGA 3PYHA 1P2QA 1ZR0A 1GVZA 4ZHLU 3DSOA 4BANB 4A1TA 2SGFE 4BTTB 4Q2KA 4X8UH 2Q6FA 3SUDA 2QF4A 2Z3DA 3KYGA 4F49A 1BTXA 1T8MA 2P8OB 1WSSH 2ZDNA 2JJ1D 1C4V2 1FI8A 1O32A 5DK1A 1WU1A 3SGBE 1XXDA 4INHA 1P03A 5C2ZA 2PUXB 2QXHA 2FOAA 5AFYH 2BQWB 5ETXA 1UK4A 1LMWB 2PUQH 5BPEA 3T28A 1EKBB 2Y81A 4Y8ZA 4Y8YA 1GBBA 1GBMA 3RXRA 1KLJH 1O30A 2AMQA 1ACBE 2VVCA 3HATH 1P06A 2JIZD 2GMTC 3UUZA 3VPKA 2DUCA 3ZVAA 1V2JT 1JIMA 1IQJA 2J5UA 3MNBA 5F8XA 5LPRA 3MTYA 1O2YA 1P05A 1SGCA 3HPTB 1P2IA 2ZKSA 4YLQH 4ZHMU 3RU4E 2CK3D 2FS8A 3C27B 3BG4C 4WXVA 3SHCH 1DSTA 5F6MA 3OY5U 1BUIA 3UR6A 1VR1H 2GCTC 2TGDA 4AB8A 2FZZA 3TIUA 2PR3A 2PKSC 3UOPA 3SNBA 2BOHB 4MNXA 3E0PB 2ANMH 3QTVH 2VNTA 4CHAB 5AFZH 3RXOA 2BDGA 3ZZ3A 1C2JA 1S0RA 1FDPA 3TJOA 3BIVH 2ZCHP 1UTJA 2F9BH 2QCYA 5T3HA 4X8TH 2BDIA 3PMBB 1HFDA 1V2OT 1FPCH 4MVNA 1IQFA 2ZI2H 2XBXA 2D1JA 5A2MH 2FO9A 1GG6C 2R0KA 1KLIH 2ASUB 2GZ9A 1A5GH 1EX3A 1H8IH 1L2EA 4H4FA 4ZXXH 1FAKH 5ESTE 4ISHH 2SNVA 1MH0A 1KTSB 2ZFTA 3QUMP 1LHGH 1XUIA 3M7UA 4Q7YA 5EW1H 2QF3A 1NBMD 5GXPA 1AZ8A 2AS9A 1SGYE 2EA3A 1P02A 5TJXA 3TNSA 4LK4A 5ESBA 1GBDA 3ZZBA 2PKSB 2HALA 1P2KA 2BDHA 5EOKA 1C1RA 4CBNA 3GY8A 3T27A 1FUJA 3NCLA 1K0HA 4HTCH 1H8HD 4AX9H 1C2MA 4ACAA 4RT1A 4X2YA 3OU0A 2THFB 2ALPA 1MABB 3K2UA 5F8ZA 4NIYA 1ARBA 5A8XA 1F0SA 5KEDA 4B6EA 1EB1H 1PPCE 1AVWA 1GG6B 1WQSA 1F0TA 1EJNA 2ZIQH 1KDQA 2FOFA 4DURA 1NT1A 3BTDE 3QTOH 1IOEA 1S6HA 4D9QA 1C9TA 3PB1E 3SN8A 3GS9A 5KECA 3LIWA 2WPIS 1TALA 5EJ1A 1MKWH 3VGCB 1GWAA 1SGEE 1GHAG 1YM0A 1K1IA 3M7QA 3P92A 4HZHA 4O97A 4UFFH 2SGDE 1H4WA 1OWDA 1DANH 3FO8D 2UWLA 2XWBI 4XBDA 2ZDLA 1LHFH 3GYLB 3NRLA 3S0NA 1GJ4H 5DP7A 1ZPZA 3S7KB 4DG4A 4I86A 3F68H 2ALVA 2ZPQA 5CHBA 1TB6H 1J9CH 1V2KT 1EFRD 1QL8A 1Z7KA 1SHYA 5SGAE 2V3MA 4AYYB 4JYVH 1S6FA 2AMPA 1G2LA 3ZIAD 1LQDB 3VB5A 3KN2A 1O3IA 2F91A 2QN5T 4O3UA 1GGDB 3AK5A 1GJAB 1FN6A 1P2MA 1QHRB 1SGRE 3A8CA 1ANEA 1LVBA 3M3VA 5FL7D 3UAIC 4I7YH 5EXNA 1UTOA 1GDNA 1C2FA 2ZDVH 3A8BA 3ENSB 2VBCA 1AFQC 3Q3KA 1QBNA 1QBOA 2SFAA 3BTFE 4OGYA 1SOZA 4NWLA 4RT0A 2XC5A 1MBMA 2G55A 2VB0A 3VXEH 1O3BA 1SGFA 3AW1A 1ZRKA 5B6OA 3V13A 1E38B 2WV4A 3SYJA 2R0LA 1ZGIA 1VJAU 4X6NA 2A5IA 3F2GA 3T26A 2VIPA 1O2TA 4FUEA 2TRMA 2HVXA 1AUJA 1JMOH 4M9FA 3UTUH 1HAXB 1QRWA 4A1XA 1HLTH 2D8WA 1V6DA 2EI8A 3M37A 1ZOMA 2OBQA 2A31A 5L2ZH 2G5VA 1EZXC 3ATKA 2ZNKH 4B2CA 2C8ZB 2XNIA 2JH0D 2TGPZ 2OXSA 4K3JA 1BB0B 1C5TA 3A7TA 4GCHG 3TK5A 5GDSH 1A2CH 1WQVH 4YZUA 5AF9H 1DXPA 4YOIA 3LT3A 2GV6A 3OX7U 2HNTE 1H9HE 2FYQA 1YPEH 2VVVA 2ULLA 3U8TH 5DP6A 1B0FA 1CO7E 3PV5A 3UREA 3RLYH 4TYDA 1NTPA 1V2ST 4FVBA 4J2YB 1K21H 1FPHH 4NFFA 1KY9A 2PGQB 1C1NA 1AZZA 3MU0A 4RKJB 1OP2A 2VIDA 4A92A 1HAVA 2L74A 1WBGB 2BLQA 1ETSH 1GJ8B 2UWOA 3VB7A 2CMYA 1HAGE 2EQNA 2ZPRA 1ZHRA 4OM9A 1SGPE 4IC6A 2P95A 1FX0B 1C1MA 1T32A 2BLVA 2VIOA 2BDBA 1NPMA 3LC5A 5GCHF 2AMDA 1TRNA 2J98B 2Y7XA 1C5SA 2I6SA 8GCHF 2R3YA 1BTPA 1NFWA 1AE8H 4TT3D 3ZZAA 1EZQA 1BJVA 2OINA 2FP7B 1YKTA 1NRSH 1KMHB 2QGRA 1LHDH 4BTUB 1ANBA 3EE7A 5C3NA 3ATLA 1NU7B 1C2EA 4OS4A 1SMFE 1TABE 1ESBA 1HPGA 1TBZH 2FX4A 1FIZA 4BAHB 1EP5A 4F55A 4I33A 4D76A 3P8NA 2ZTXA 1E79D 2F9PA 1HAIH 1W7GH 1GMCF 4I8GA 4NA9H 4O03A 4AFUA 5C20A 2A4RA 4BXWA 3SW2B 1HV7A 3FVFB 6CHAC 3BF6H 1V2TT 1LHEH 2A32A 3RM0H 1O39A 1O2HA 3M5MA 2TIOA 3SQEE 1UTMA 4FVDA 7GCHF 2I6QA 1O2JA 2IOTA 1SVPA 2FYRA 3FZZA 2QIQA 3UWJH 1DM4B 3GYMA 3DD2H 1T7CA 5IDKA 1CT2E 1BBRH 2C3SA 1W10U 1QA7A 3FOAA 3M35A 4OS2A 1EB2A 4X6OA 3SOSA 3T29A 1ZYOA 2HPQH 1FY8E 1KSNA 4CREA 2NU0E 3STIA 4KP0A 1TNHA 1SG8B 1UHBA 2UUJB 2G4UA 3TK6A 1TBQH 2FOBA 5DP5A 1E35B 2RG3A 3MH5A 2ZFRH 3SV6A 4Y71A 1O34A 1BRUP 2ZHQH 3V0XA 2KAIA 3KCGH 2CJIA 1RTFB 5JYIA 1DITH 2VINA 1HDTH 3A7XA 1AKSB 1XVMA 2NU4E 6CHAB 4R8TB 5L30H 1D9IA 1HIAB 1VKYA 1C1QA 1A0JA 1DT2A 5EXLA 3A8AA 3K6ZA 1YBWA 1IQNA 4JZIA 1DY8A 1RS0A 1BZXE 1YGCH 5BRRE 1TE0A 4JZ1A 2J38A 3RXFA 1QY6A 4FETA 1MAYA 1QJ7B 5LPEA 1F5RA 1MZDA 4ZH8A 4X2WA 1HNEE 2R2WU 4WY3A 4TWYA 4SGAE 1YPKH 2FS9A 1UMAH 3KHVA 3E8LA 3UOUA 1WCZA 4GPGA 5FBEA 1GBFA 1FMGA 1UCYK 5DGJA 4DIIH 1SGFG 4KTCA 1NFYA 2WUCA 2UUKB 3WWFA 1GBJA 5T6GA 3A8DA 1KXDA 1OXGA 1PYTC 3LDXH 1JIRA 1GDUA 1BT7A 2G4TA 1O38A 2CGAA 1QIXB 4ZKRU 2F9NA 4F48B 3ZVCA 1T31A 3OTJE 3AAVA 4ISNA 2H9HA 3BEUA 1H8DH 2NWNA 2AIQA 5FPTA 5I46H 3UNQA 5JPMH 1WUNH 1Y5BT 3NKKA 4AYVB 2ZEBA 3SJIA 1TPSA 1X7AC 1NBME 3ZYEA 4BAKB 3M5LA 3VG8A 1LCYA 2XWAA 4X1PU 1FZZA 5HIYA 4YOJA 3OY6U 1V2RT 3MNXA 3TPIZ 3LJJA 1BDAA 1P2JA 3DSPA 4FOUC 4UD9H 1TX7A 3SQHE 2ZU3A 1GI2A 3DSGA 3GICB 2A5KA 1QZ8A 2XTTB 2OTVA 3U1JB 4NCYA 2L6OA 3ZZ5A 2KZ4A 1GHBG 1TNGA 4MPUA 1GBTA 3UFAA 1BRBE 2XCNA 1BTHH 1O5CB 1D6WA 1Y8TA 1CHOF 1VCQA 2A4OA 3RXAA 1W8BH 3A81A 1PQ8A 3BTTE 2OUAA 1PYTD 4WJG2 1QRXA 2KR7A 1EPTA 1XUJA 1P2OA 3ZZ6A 4P00A 3A7YA 3V12A 3LU9B 3UQVA 1GI4A 1SLXB 3BSQA 1THPB 3P17H 3S9CA 1O37A 1O3FA 2B0FA 5CE1A 1OX1A 5A0AE 4LZ4B 1T4VH 2C4FH 3Q3YA 2KCYA 2ZU5A 2BVRH 3BTGE 1AO5A 3CNRA 2PLXA 2GX4A 4AC9A 3PRBA 1G36A 5E0HA 1W14U 4FUHA 2GD4B 1L4DA 3MO3A 2FTLE 1RD3B 4XOJA 5E8EH 2OBOA 3PTNA 2O8MA 2VWNA 1AY6H 5EG4A 3K65B 2XC4A 3SO3A 5C17A 1KXAA 5GIBA 4LOYH 4FU7A 1K1JA 3AW0A 4OS5A 1E1QD 1RIWC 3QGNB 2XRCA 4J1YA 1SKYE 3A86A 2OQUA 4WXIA 3M36A 1DE7H 4X6MA 3TGKE 1UCYE 1LVOA 4ASUD 4K1TA 1AGJA 3NZIA 4X1RU 3LGIA 4Y6DA 3TH4H 2SGEE 1XVOA 3O8BA 3A89A 3UNSA 1KLTA 2EEKA 1HUTH 2GDDA 1SPJA 4YTAA 1COWD 2GJGA 2A7JA 3NUMA 4I8JA 2AGGX 1W2KH 3GCHC 2IJOB 1AVXA 1XX9A 1HXFH 2WPDD 5HMAA 1F0UA 3RXEA 1GMHG 4AG2A 1VITG 4B6FA 4BOHA 3EA9A 5T6DA 1O3PB 2ZFFH 1ELFA 1V2QT 1OSSA 3F9GA 5AHGH 1GCTC 3RXMA 6GCHG 5HM9A 1O31A 4GSOA 2P3TB 1O3LA 1QR3E 1D3PB 1CHGA 4Z0KA 3SNAA 4A1VA 4BTIB 1J8AA 1Y3WA 3C1KA 2PP6A 8KME2 1OWKA 1ARCA 2VWLA 1BTYA 1ESAA 4OS1A 1O2KA 2TBSA 2F9UA 4I32A 5A09A 4P02A 1Z1JA 1AHTH 3SV8A 1O3CA 3B9FH 2XW9A 3MOCA 4H42U 1S5SA 1G37A 3GCHB 1S6LA 1HCGA 3CENA 1O3EA 5TCAA 3UNRA 4NGAH 2C93B 5EQSA 2GGVB 1DWEH 1OWHA 1QJ1B 4JK5A 3VB4A 4XBCA 1KTTB 4B73A 2F83A 4K5ZA 1FNIA 3GCOA 2AIPA 5HYOA 5PTPA 3MWIU 2PW8H 1HAHH 1P57B 2FOEA 1GHAF 2XOKD 4AFZA 1A4WH 4TSFD 1GBKA 1F0RA 1HAYB 1LPGB 2HPPH 3QZRA 1S0QA 1BMFD 1GJ5H 1QL7A 1THSH 3E1XB 4WH8A 3WW7A 1GI8B 1SQRA 1ZSLA 1TGNA 4YT7H 1SLVB 3GY6A 1GJDB 2H9EH 4CR5A 2PFEA 1Y3XA 4IN2A 4NIVA 3ZZ8A 1BTWA 1PPEE 1GBAA 2P3FH 1T8OA 3OFND 1GHXH 1RXPA 1O2MA 1GI7B 1GL1A 2ANKH 2CHAC 1BMAA 1TX6A 2BM2A 2KFWA 3KQ5A 1O2VA 2FOHA 2J92A 1UVSH 2RA0A 2CF9H 2GMTB 2VIWA 3JZ2B 1GHWH 4AGKA 1FAXA 2JETC 1VJ9U 3A7ZA 3DUXH 4B1TA 4NIXA 3RXSA 2ESTE 3I29A 3OTPA 3SBKA 5DSFA 1CGIE 3A87A 3BG8A 3G01A 1L1GA 2SGQE 2OC0A 5C1XA 1TRMA 3MO6A 4NSVA 1OP8A 1JRSA 2Z9GA 3BG4B 3SZNA 4DIHH 2WPKS 5JBBS 4CRBA 1DUAA 2GZ7A 2GCTB 1B0EA 2VIQA 4Y11E 4CRFA 1MUEB 1T8NA 4Y10E 1SL3A 2Z9KA 5T1VA 1C4U2 1EOLA 3A7VA 2AH4X 1C2IA 4O9VA 4I31A 1OKXA 2HLCA 2ZU2A 1O3DA 1UK2A 1NS3A 1YCPK 2CHAB 1GBCA 1CGJE 2IN2A 1ZRBA 2V3OH 2QF0A 4Y0ZE 1HB0B 1GBIA 3L33A 1BQYA 3E3TA 4AB9A 5C0UA 1QRZA 2KX4A 1P11E 3RP2A 2RA3A 2AERH 2DE9A 1O2QA 3PRDA 2Q6DA 4GHQA 5DG6A 2V7QD 1AD8H 2BXTH 1PQAA 2A7CA 1W0ZU 3SU6A 1S81A 1GHVH 1BMLA 5ABWA 1H1BA 1OS8A 2BZAA 4KGAA 1QB1A 2V0BA 1F92A 1IHSH 1HGTH 1TONA 4IN1A 4AORA 1WXRA 1O2IA 2A2QH 2Q1JA 1BRAA 3LGWA 3P70B 3GY7A 1NRQH 2ANYA 2TGAA 1T8LA 2R2MB 1P9SA 3Q76A 4U01A 4XBBA 2DE8A 1ORFA 3R0FA 1NRNH 1TNJA 3GCTF 4U2WA 3ZZ9A 5C5OA 1AVGH 4AG1A 4A6LA 1XUGA 2Z3EA 3UWIA 2W5EA 3GCNA 3K9XB 1TNLA 2PV9B 2W6ID 2PTNA 4JYTA 5IYTA 3F2HA 2KCAA 3AAUA 1C9PA 1C5MD 1HAOH 2QXIA 4XDEA 4OS7A 1S82A 4B74A 5FAHA 3CP7A 3TNTA 1EP6A 5A0BA 1HBTH 3QZQA 4IS5A 3F6UH 1IQLA 1Y5UT 4U30A 3GY5A 1LVMA 3IWMA 1BIOA 1F5KU 1D3DB 1A5IA 1XKAC 1MTVA 1PQ7A 1TX8A 1WYKA 3I77A 4BNRA 1M9UA 3M61U 1B5GH 1J16A 3QWCH 2HOBA 2WPLS 3A82A 1EXFA 1LKAA 2Y5GA 5DP8A 2GT8A 3OE7D 3MFJA 1VZQH 2V35A 3DT0H 3LC3A 5JB8S 4ABFA 2FI5E 3PM3A 2C8XB 3F0OA 3QGJA 2BZ6H 4JYUH 2LELA 5CHAC 5CDFE 3KGPA 2ZP0H 2WHXA 2NU3E 4ZUHA 1UTKA 3MO9A 3TJNA 1O2SA 4HGCA 4UFEH 4DOQA 4XE4A 4SGBE 1GJ6A 1QA0A 3CS0A 4Y79A 1KXFA 1AFQB 1NRPH 3M5NA 2FI4E 4ABAA 4E7RG 1W11U 1TMTH 4FUGA 2W7SA 1P3CA 1PFXC 3SU0A 2BD4A 3OSYA 3S7HB 1EZSC 1DWDH 2QYIA 3HKIB 1BHXF 2BDAA 3OEHD 4KTUA 1TMUH 1ZMNA 1NFXA 4ABBA 4HG6A 4INKA 4MG3A 1C5UA 2BYAX 2P93A 1LDTT 3ZZ4A 4DT7B 1N8OC 3K6YA 1K1LA 2V3HH 1O5AB 9ESTA 1C2GA 3ZV9A 3NXPA 3MNCA 2FX6A 4ABIA 3UPEA 2H2ZA 5EGMA 3QX5H 1FY4A 3SV2H 3MNSA 1L4ZA 1BJUA 3LJOA 2QC2A 3M7TA 4FUFA 2PSYA 2WYGA 4CRAA 5FCKA 1LVYA 2BQ7B 3DFLA 3HKJB 3RXQA 2ZC9H 1EOJA 1N1LA 4K69A 4IC5A 3RUOA 1TQ0B 2FLBH 1RRKA 1C5OH 1ELVA 3RC4A 1CSOE 1GJ7B 2WPJS 4ZKOU 1QB9A 3P8GA 3AVZA 5F53A 2GCHF 3T2NA 1C5WB 2HRVA 3FKSD 3BTWE 3SUFA 4NA8A 2IPHA 1CA0C 4MPWA 3U98H 1BMNH 1XUFA 1QCPA 2BOKA 1N8OB 1RJXB 2YMSC 5FX6A 1AE5A 3LOXA 1MZAA 4DT4A 3F9FA 4UDWH 3T5FH 1E0FD 3MH4A 1K22H 4HFPB 1UW7A 3OYPA 2XBWA 4WWYA 1KXCA 2J94A 5EQRA 1SOTA 1TGBA 1GI6A 1QFKH 2RFKC 3PLKA 4IMQA 2O8TA 1YPHE 5DPAA 1Z8IB 1Q2WA 2Z7FE 3QN7A 4D7FA 3FFGA 1P09A 1CU1A 1XKBC 1LPZB 1A0HB 3AASA 1F2SE 4AFSA 1UVPA 4U32A 4X1QU 1G3DA 2JH5D 5EW2H 1ETRH 1E36B 4ISOA 1TWXB 1JXPA 2Z6BD 1O3MA 1KIGH 1CA0B 2FOMB 1C5RA 1S84A 1B7XB 4FXGH 4I8HA 3T25A 3PO1C 1MMJN 1OWIA 2LNCA 2YMSB 3UY9A 3ITIA 2ZDMA 2PGBB 3KQCA 3KIDU 3QK1A 2QXJA 2D26C 1SHHB 1QTFA 3URCA 1ANDA 1A7SA 3WY8A 1IQMA 1SLUB 4ISLA 3RC5A 3SV7A 3D62A 2M2AA 2H5CA 2YMSD 1C5PA 1GJCB 4Y7BA 1MCTA 4AOQA 1DUEA 1LKBA 4E7NA 4YM9A 1EJAA 1CBWC 3O8CA 4K8YA 1ELDE 1KXEA 4ZROA 2OLGA 2G8TA 1SI5H 2PKAB 3S9AA 1TYNA 3LH3A 1UCYH 1ZHMA 5HKKD 1SC8U 5HGGA 1TGCA 1VCWA 3N7OA 3STJA 2AFQB 4ABJA 2QA9E 1E1RD 2BY8X 1V2LT 5LPFA 4Y7AA 3F3BA 2W3IA 3BEFB 4MQAA 2ZHEH 1YC0A 2VH0A 1O5DH 2VU8E 4X0WU 1L0ZA 2KCOA 3URDA 3N99A 4BAMB 2VGCC 3ZZ7A 3OEED 3L6PA 3H7TA 3PTBA 2Y80A 3SHAH 3TJVA 1GBHA 1NO9H 1EAUA 1JRTA 2CV3A 1NZQH 1DY9A 1YY3A 2STBE 3IITA 3SU5A 1TBRH 5HIZA 2UUFB 5EPYA 2HWLB 2Y7ZA 1CBWB 4AN7A 2BMGB 1VITH 3P8OA 5C1UA 4B71A 1SR5C 1SGTA 2WSSD 1O2WA 1GPZA 1C5YB 1O2PA 2W7UA 3A7WA 2BD3A 4MDSA 1E37B 1E34B 2BY7X 2YNBA 5J4QA 1SGQE 3LH1A 2J98A 8GCHG 1O5GH 1G9IE 4GLYA 1V2PT 2O8LA 4IGDA 1CVWH 1PPFE 5A8YA 2RDEA 4WVPE 2ODYB 1OYQA 3KYFA 2GP9B 1THRH 2GT7A 2F43B 3PV2A 3MQKC 2HNTC 2UWPA 3SNCA 1Y3UA 1DLEA 1BOQA 4MLFB 1QQUA 1RGQA 3KQDA 2J95A 1UVTH 1DXWA 1IQKA 2Z9LA 4ISIH 2CXVA 2ZTZA 2A4QA 4ZKSU 2J34A 3BTME 1ESTA 4DJZB 1GMCG 3KL6A 5B6LA 2WINI 2BHGA 2FXRA 1MKXK 2AEIH 3GISB 3D49H 4AGJA 3GOVB 5LH8A 3SU1A 1O3OA 1IQEA 1Q3XA 1BTUA 7GCHG 1G30B 5JDUB 1GMDG 2W26A 2OK5A 4I8KA 1C2HA 3HGNA 2ILNA 1MQ6A 3SORA 2BVSH 3W95A 3MH6A 2ZQ1A 5E2PA 1OP0A 2FESH 1ETTH 4CRDA 3MU1A 1AMHA 2JJ2D 3V7TA 4E05H 3I78A 7KMEH 2NU2E 2C8WB 2B5TB 2BXUH 2ZFSA 3KNXA 6ESTA 2ZGJA 2ZQ2A 1J14A 1DICA 4F4OC 4AFQA 1V2MT 4X8SH 1KXBA 3W94A 7ESTE 1XMNB 1W12U 2BY5X 3RMOH 4NZQA 4DGJA 4NSYA 1OWJA 1AKSA 2F9VA 4JK6A 1HJ9A 4K2YA 4RSPA 1HIAA 1O2ZA 1YLNA 1IHTH 2ODQA 3IG6B 5FPSA 4WMDA 1NESE 5EPNA 2J4IA 1AWHB 3EE0B 1OOKB 1W7XH 2VWMA 1DOJA 4D7GA 1NROH 1C5LH 3PV4A 4YXWD 3RXVA 1UTQA 3EAJA 1EUFA 2VH6A 1MCVA 1PPHE 2WPMS 4A7IB 1FXYA 2M5TA 3N7DA 4FU8A 3Q00A 3KQEA 4KELA 4ZMAH 4DVAU 2FI3E 4YOGA 2GKVE 5H4IB 1TPOA 1BCUH 1C5QA 3RXIA 3PMJA 4Z1MD 2GTBA 1DFPA 2HGTH 2BY9X 1ZMJA 1O3JA 2G00A 1MTUA 5EJZA 3QDZB 1ZJDA 1WTHD 1NFUA 1YCPM 1CA8B 1IQIA 2XCFA 5DN6D 1K1NA 1ZTKA 4NA7A 3RC6A 4B2BA 1GDQA 1TGTA 1ABJH 2ZECA 3LGYA 2AGIX 4NFEA 1RIWB 3VB6A 2JKHA 2WV9A 1NM6A 3PROA 5JBCS 1AN1E 3F2FA 1K1OA 2ZHWH 2ZF0H 4UEHH 1CQQA 5E0JA 1G3EA 3RMMH 1O2LA 1EZUC 2SNWA 3H7OA 4JZEH 1P2NA 2WZQA 3ATWA 2GZ8A 2ZCLP 1AU8A 3RXKA 3TGIE 1C1TA 1KDQB 2NU1E 4TY7A 5I25A 3OAAD 4DCDA 1GI3A 1BHXB 4Y8XA 3S69A 3TH3H 3TITA 2Y6TA 5GWZA 2K8IA 1CHOG 4MNVA 5DP3A 1WOFA 3T62A 3BN9A 1ZMLA 1P9UA 5AVDA 4Q4LA 1GCTB 1L1NA 1SGIB 1H8ED 3LONA 1GVKB 2H1UA 3PLBA 4CHAC 2SGPE 4X2XA 5A0CA 3BTQE 1V3XA 1P12E 1XUKA 4UFGH 3SJOA 3ESTA 4FUBA 5L2YH 1WTGH 3BIUH 4FUCA 7LPRA 2ZO3H 2A7HA 2IJD1 2FOGA 3SGAE 5HM2A 9LPRA 5G4BA 4R0IA 3FANA 4GAWA 1XXFA 2G51A 2QXGA 2VJ1A 3RXHA 4DY7B 1ZPBA 2A5AA 3MI4A 3U69H 1HJ8A 5E0GA 5JBAS 1Z71A 1UTPA 1XUHA 1PJPA 4NWKA 1Z1IA 1H9LB 1QJ6B 1HYLA 1Z8JB 1YCPH 1JBUH 3B8JA 2FWWA 1UTLM 3RDZA 1C5VA 1GCDA 2BD7A 2G52A 2TPIZ 2W6JD 1A5HA 2G5NA 3P6ZB 3VXFH 4KKDA 4B76A 1UK3A 1IAUA 1C1WH 4HI3A 3ZVBA 4RN6A 3LGVA 1YPMH 6LPRA 4XFQA 2GV7A 1G3CA 1ZSJA 5K7RA 4YLUA 1C2LA 1MAXA 2FPZA 3ZYDA 2KCPA 8LPRA 3NPSA 5JB9S 1DVAH 1W13U 1ZZZA 1FJSA 3PLPA 3UR9A 1SGNE 1UO6A 4WMFA 1FN8A 3BTEE 2ZWLH 3GDVA 3LGUA 5EU8A 1SFQB 2B9LA 2BVXH 3GY4A 3VGCC 5KGOA 1Z8RA 1O35A 1AI8H 1YLDA 3V3MA 2EI7A 2HNTF 1F5LA 1EAXA 1SB1H 3EYDA 2K0QA 4GCHF 4CRCA 4ABDA 2JETB 4CH2B 2J97A 1ZPCA 1G3BA 3VEQB 2P16A 3ODDA 1ELTA 4FUIA 3E91A 3UB0A 2YNAA 4UFDH 2A4GA 2KM0A 3BEIB 2FEQH 4YESB 1NC6A 4IBLH 1GGDC 4CRGA 3EQ0H 1BMMH 4X6PA 5FCRA 1LO6A 1UJ1A 3M5OA 1A3BH 2GVFA 2ZA5A 5EXMA 1HAVB 2C8YB 4H6SB 1ZTLA 2F4LA 4ABHA 3EDXB 4GHTA 4NG9H 1D3QB 3E90B 1AQ7A 2LP6A 1QB6A 1HAPH 2BX4A 4X1SU 4BXSA 1UVUH 1BTZA 1G32B 1P3EA 5FBIA 3RXLA 3FZDA 1FY3A 3E6PH 5K0HA 2BLWA 3SI3H 4MNWA 1EQ9A 4MNYA 4Y76A 1LHCH 4TWWA 3PWBA 1K1PA 4AZ2B 3LKWA 2ZGBH 3RXTA 3Q77A 2OQ5A 5C94A 2OD3B 4NZLA 4ZKNU 3RMLH 1ID5H 4GVUA 5FHTA 1P0SH 1MKWK 3MHWU 3M3SA 1YWUA 1VCPA 3F0PA 2ZG0H 1RTKA 1ELEE 2ZTYA 4IMZA 2AHME 2BDCA 2FTMA 1A46H 1N6YA 1SLWB 1Y3YA 2BDYA 1NN6A 1TA6A 5DJ7A 3M3TA 3FP6E 1QQ4A 3TLOA 1FY1A 2ZHDA 3L3TA 2HVYB 1HJAC 2PTCE 1A61H 1XM1A 4JZFH 1VGCC 3MU8A 4PROA 4UE7H 5IK2D 1AB9C 1IQGA 1MU8B 2QV1A 4X8VH 1MD7A 3PWCA 4OGXA 4Z6AH 4X1NU 1CT4E 1QURH 2Q6GA 2PHBA 1TAWA 3ZVDA 4BAOB 4FU9A 4ASHA 4XRNA 4RKOB 1FIWA 1C1OA 2H9TH 3QO6A 1Z8GA 3TH2H 3RXBA 1O3HA 4GUXA 1Z6JH 1UTNA 1TNKA 1UHBB 1S85A 1TA2A 1J15A 2WYJA 1MQ5A 1W3CA 1DWBH 4B2AA 2JH6D 3CS7A 1C5ZB 2O8WA 3EGKH 2KAIB 4JCNA 1CT0E 4FUJA 5CHAB 1HJAB 1OYTH
chains in the Genus database with same CATH topology
4ABEA 4XSKU 3S9BA 1VGCB 1W0YH 2FMJA 1AFEH 3U8RH 3F9EA 4TPIZ 4ZAEA 4KTSA 4QT8C 3RXGA 1ABIH 1AB9B 2H6MA 1YPGH 1TRYA 2ZDAH 2F3CE 4CR9A 2VIVA 2QY0B 3RMNH 1SFIA 1P10A 3SU2A 1TIOA 1MD8A 1C5NH 2LPRA 1CE5A 1G2MA 1GL0E 2BTCE 2B7DH 4CBOA 1C1PA 4OS6A 1GHYH 1TMBH 1O0DH 2PSXA 3D65E 3SUEA 1PPGE 3GCTG 3RXCA 1FQ3A 3PMAB 3MYWA 1YLCA 1K2I1 3RXUA 1GBEA 2VVUA 2ZGHA 3H5CB 3RU4D 3EA7A 1TLDA 3VB3A 5CMXH 2WUBA 3UIRA 5JBTA 2ZCKP 1HXEH 1EAWA 1L1JA 1A1RA 2G81E 3NWUA 4DW2U 2FODA 5DO4H 4Q80A 1A3EH 1TPAE 3RXPA 3ZVEA 4CH8B 2ZU1A 2EI6A 3ZZDA 3A84A 2QAAA 3A85A 1O3AA 4Y0YE 3RLWH 1GI5A 2XXLA 1ELCA 3RU4T 1Y3VA 3GDUA 1C1UH 1MBQA 1C1VH 1EPTC 1TQ7B 1DSUA 3TK9A 3ZZCA 2Y82A 5HXFA 1NY22 1HRTH 4K60A 2AYWA 2AGEX 1CGHA 1IQHA 2B8OH 3ELAH 1D3TB 1PPZA 2OC7A 2BD5A 1DPOA 3MU4A 3KF2A 4THNH 1P8VC 3KEEA 3UQOA 3E0NB 1EAIA 2YOLA 3LPRA 3R3GB 4Q7ZA 3EA8A 4MPXA 3MMGA 1GI9B 2FDAA 1JOUB 1RTLA 1O5EH 5GJ4B 4M7GA 3BTHE 1GHBF 2XBYA 1KYNA 1O5BB 1OPHB 3HK6B 1O33A 1TPPA 2ZGCA 1GMDF 1C4Y2 4ZXYH 2VWOA 3LGTA 1ZSKA 1K28D 1O3KA 4INLA 1GJ9B 3SJ9A 5C67A 4BAQB 1EPTB 5C1YA 4E06H 4TY6A 2RDLA 2WV5A 5J4SA 5DP9A 3P95A 1INCA 1MTNC 1ZJKA 2WPHS 2R3UA 1Z6EA 2BD2A 1J17T 1P04A 2ANWA 3BV9B 3PO1B 1OWEA 3FP7E 5F8TA 2Z3CA 3U1IB 4UONA 1O2OA 4LXBH 3SU3A 1HAZB 3A88A 1H9IE 3BTKE 2P59A 1N6XA 2ZFQH 4NIWA 4D8NA 4ABGA 1DX5M 1GI1A 1GHZA 1Y59T 1ELBA 1WAYB 1O3NA 1BITA 2FLRH 3DHKH 2CF8H 1O2GH 2Z9IA 2ZZUH 3KQBA 1SQOA 2P3UB 1O2RA 1BBRK 1D4PB 4MPVA 1YF4A 2ZHFH 4IW4E 2GCHG 1YYY1 2A0QB 4O3TA 5GCHG 4VGCC 4D9RA 3RXJA 1FV9A 3NK8A 3HK3B 1O3GA 1MKXH 2BLOA 1MTNB 2FM2A 2OC1A 2PWXA 1V2UT 1ZGVA 2Y5HA 1ANCA 5T6FA 2FOCA 4B75A 2D2DA 1ZTJA 2BY6X 3MH7A 5E2OA 1MTWA 4WF8A 1EASA 1TFXA 1PPBH 2VGCB 3DA9B 5EODA 2XC0A 1EJMA 1QNJA 2BQ6B 5LGOA 4LZ1H 3P8FA 1K9OE 1UVOA 3JZ1B 2UUYA 4JZDH 1EATA 1AWFH 5F03A 2A2XH 2P94A 1S83A 1GMHF 1VITF 5EQQA 1P01A 1AIXH 5C5NA 5DKMA 3SNDA 1Q31A 1C2DA 1SSXA 2STAE 3SGQE 1BA8B 1GBLA 1TOMH 3F9HA 5FX5A 1GJBB 3A80A 1ZHPA 3A83A 1SQTA 2ZPSA 3GDSA 6GCHF 4JMYA 4VGCB 2Y5FA 3MU5A 1SQAA 3U9AH 4H6TA 1FONA 4WH6A 3SUGA 8ESTE 3Q3XA 3SJKA 3TGJE 1O36A 2EC9H 1V2WT 2SGAA 2ODPA 1PQ5A 3RXDA 3FAOA 1WV7H 2A1DB 1QGFA 3TU7H 1DLKB 1BRCE 2O9QA 3QLPH 3F1SB 3VFEA 1YPJH 4YO9A 3GY2A 5GPIB 4MTBA 3ATMA 3U8OH 3B23B 3ZVFA 4K8BA 1AUTC 1V2NT 1FLEE 3GY3A 2GDEH 1C2KA 3O8DA 1O2XA 5L6NH 2J9NA 1O2NA 2PKAA 4TPYA 1T4UH 1A0LA 3RM2H 4K1SA 1YPHC 1U6QA 2BB4A 2V6NA 2BX3A 1MTSA 3PMHB 2C90B 2XBVA 3SJ8A 3HGPA 1QL9A 3ATIA 1C5XB 2J2UA 1YPLH 4YT6H 5DP4A 3ZVGA 3TVJB 1O2UA 2OCVB 2A45B 2W3KA 4WMEA 3SU4A 3ODFA 3TJUA 1V2VT 1O5FH 4X2VA 3DFJA 3SI4H 2Z94A 1F7ZA 1DWCH 1BBRE 2OC8A 1SBWA 2O8UA 2F9OA 3O8RA 1C1SA 1TOCB 1DDJA 1TNIA 1DS2E 5A8ZA 1LTOA 3ZV8A 3FP8E 2ZFPH 3SNEA 1GI0A 4A5TS 4ESTE 1RFNA 2K1QA 1Y5AT 2P8OC 1JWTA 1SGDE 2FIRH 5FXLA 1ZLRA 2ZDKA 5TCCA 1YP9A 1D6RA 1K1MA 1ELAA 5FPYA 2BD8A 2OP9A 4FUDA 2RCEA 1MU6B 4K1EA 1NRRH 1LPKB 4I8LA 2TGTA 1QBVH 2BD9A 2H5DA 3SV9A 1NU9A 1GVLA 2R9PA 2ZGXH 1FY5A 4ZHAA 1LQEA 2ZU4A 1TGSZ 2CN0H 4Q7XA 2XYAA 3D23A 3E16B 2Z9JA 1ELGA 3PYHA 1P2QA 1ZR0A 1GVZA 4ZHLU 4BANB 4A1TA 2SGFE 4BTTB 4Q2KA 4X8UH 2Q6FA 3SUDA 2Z3DA 4F49A 1BTXA 2P8OB 1T8MA 1WSSH 2ZDNA 1C4V2 1FI8A 1O32A 5DK1A 1WU1A 3SGBE 1XXDA 4INHA 1P03A 5C2ZA 2PUXB 2QXHA 2FOAA 5AFYH 2BQWB 5ETXA 1UK4A 1LMWB 2PUQH 5BPEA 3T28A 1EKBB 2Y81A 4Y8ZA 4Y8YA 1GBBA 1GBMA 3RXRA 1KLJH 1O30A 2AMQA 1ACBE 2VVCA 3HATH 1P06A 2GMTC 3UUZA 3VPKA 2DUCA 3ZVAA 1V2JT 1JIMA 1IQJA 3MNBA 5F8XA 5LPRA 3MTYA 1O2YA 1P05A 1SGCA 3HPTB 1P2IA 2ZKSA 4YLQH 4ZHMU 3RU4E 2FS8A 3C27B 3BG4C 4WXVA 3SHCH 1DSTA 5F6MA 3OY5U 1BUIA 3UR6A 1VR1H 2GCTC 2TGDA 4AB8A 2FZZA 3TIUA 2PR3A 2PKSC 3UOPA 3SNBA 2BOHB 4MNXA 3E0PB 2ANMH 3QTVH 2VNTA 4CHAB 5AFZH 3RXOA 2BDGA 3ZZ3A 1C2JA 1S0RA 1FDPA 3TJOA 3BIVH 2ZCHP 1UTJA 2F9BH 2QCYA 5T3HA 4X8TH 2BDIA 3PMBB 1HFDA 1V2OT 1FPCH 4MVNA 1IQFA 2ZI2H 2XBXA 2D1JA 5A2MH 2FO9A 1GG6C 2R0KA 1KLIH 2ASUB 2GZ9A 1A5GH 1EX3A 1H8IH 1L2EA 4H4FA 4ZXXH 1FAKH 5ESTE 4ISHH 2SNVA 1MH0A 1KTSB 2ZFTA 3QUMP 1LHGH 1XUIA 3M7UA 4Q7YA 5EW1H 2QF3A 5GXPA 1AZ8A 2AS9A 1SGYE 2EA3A 1P02A 5TJXA 3TNSA 4LK4A 5ESBA 1GBDA 3ZZBA 2PKSB 2HALA 1P2KA 2BDHA 5EOKA 1C1RA 4CBNA 3GY8A 3T27A 1FUJA 3NCLA 4HTCH 4AX9H 1C2MA 4X2YA 3OU0A 2THFB 2ALPA 3K2UA 5F8ZA 4NIYA 1ARBA 5A8XA 1F0SA 1EB1H 1PPCE 1AVWA 1GG6B 1WQSA 1F0TA 1EJNA 2ZIQH 1KDQA 2FOFA 4DURA 1NT1A 3BTDE 3QTOH 1IOEA 1S6HA 4D9QA 1C9TA 3PB1E 3SN8A 3LIWA 2WPIS 1TALA 1MKWH 3VGCB 1GWAA 1SGEE 1GHAG 1YM0A 1K1IA 3M7QA 3P92A 4HZHA 4O97A 4UFFH 2SGDE 1H4WA 1OWDA 1DANH 2UWLA 2XWBI 4XBDA 2ZDLA 1LHFH 3GYLB 3S0NA 1GJ4H 5DP7A 1ZPZA 3S7KB 4DG4A 3F68H 2ALVA 2ZPQA 1TB6H 1J9CH 1V2KT 1QL8A 1Z7KA 1SHYA 5SGAE 4AYYB 4JYVH 1S6FA 2AMPA 1G2LA 1LQDB 3VB5A 3KN2A 1O3IA 2F91A 2QN5T 4O3UA 1GGDB 1GJAB 1FN6A 1P2MA 1QHRB 1SGRE 3A8CA 1ANEA 1LVBA 3M3VA 4I7YH 5EXNA 1UTOA 1GDNA 1C2FA 2ZDVH 3A8BA 3ENSB 1AFQC 3Q3KA 1QBNA 1QBOA 2SFAA 3BTFE 4OGYA 1SOZA 4NWLA 2XC5A 1MBMA 2G55A 2VB0A 3VXEH 1O3BA 1SGFA 3AW1A 1ZRKA 5B6OA 3V13A 1E38B 2WV4A 2R0LA 1ZGIA 1VJAU 4X6NA 2A5IA 3T26A 2VIPA 1O2TA 4FUEA 2TRMA 2HVXA 1AUJA 1JMOH 3UTUH 1HAXB 1QRWA 4A1XA 1HLTH 2D8WA 1V6DA 2EI8A 3M37A 1ZOMA 2OBQA 2A31A 5L2ZH 2G5VA 1EZXC 3ATKA 2ZNKH 4B2CA 2C8ZB 2XNIA 2JH0D 2TGPZ 2OXSA 4K3JA 1BB0B 1C5TA 3A7TA 4GCHG 3TK5A 5GDSH 1A2CH 1WQVH 4YZUA 5AF9H 1DXPA 4YOIA 3LT3A 2GV6A 3OX7U 2HNTE 1H9HE 2FYQA 1YPEH 2VVVA 2ULLA 3U8TH 5DP6A 1B0FA 1CO7E 3UREA 3RLYH 4TYDA 1NTPA 1V2ST 4FVBA 4J2YB 1K21H 1FPHH 4NFFA 1KY9A 2PGQB 1C1NA 1AZZA 3MU0A 4RKJB 1OP2A 2VIDA 4A92A 1HAVA 1WBGB 2BLQA 1ETSH 1GJ8B 2UWOA 3VB7A 2CMYA 1HAGE 2ZPRA 1ZHRA 1SGPE 4IC6A 2P95A 1C1MA 1T32A 2BLVA 2VIOA 2BDBA 1NPMA 3LC5A 5GCHF 2AMDA 1TRNA 2Y7XA 1C5SA 2I6SA 8GCHF 2R3YA 1BTPA 1NFWA 1AE8H 3ZZAA 1EZQA 1BJVA 2OINA 2FP7B 1YKTA 1NRSH 2QGRA 1LHDH 4BTUB 1ANBA 5C3NA 3ATLA 1NU7B 1C2EA 4OS4A 1SMFE 1TABE 1ESBA 1HPGA 1TBZH 2FX4A 1FIZA 4BAHB 1EP5A 4I33A 4D76A 3P8NA 2ZTXA 2F9PA 1HAIH 1W7GH 1GMCF 4I8GA 4NA9H 4O03A 4AFUA 5C20A 2A4RA 4BXWA 3SW2B 1HV7A 3FVFB 6CHAC 3BF6H 1V2TT 1LHEH 2A32A 3RM0H 1O39A 1O2HA 3M5MA 2TIOA 3SQEE 1UTMA 4FVDA 7GCHF 2I6QA 1O2JA 2IOTA 1SVPA 2FYRA 3FZZA 2QIQA 3UWJH 1DM4B 3GYMA 3DD2H 1T7CA 5IDKA 1CT2E 1BBRH 2C3SA 1W10U 1QA7A 4OS2A 3M35A 1EB2A 4X6OA 3SOSA 3T29A 1ZYOA 2HPQH 1FY8E 1KSNA 4CREA 2NU0E 3STIA 4KP0A 1TNHA 1SG8B 1UHBA 2UUJB 2G4UA 3TK6A 1TBQH 2FOBA 5DP5A 1E35B 2RG3A 3MH5A 2ZFRH 3SV6A 4Y71A 1O34A 1BRUP 2ZHQH 3V0XA 2KAIA 3KCGH 2CJIA 1RTFB 5JYIA 1DITH 2VINA 1HDTH 3A7XA 1AKSB 1XVMA 2NU4E 6CHAB 4R8TB 5L30H 1D9IA 1HIAB 1C1QA 1A0JA 1DT2A 5EXLA 3A8AA 3K6ZA 1YBWA 1IQNA 4JZIA 1DY8A 1RS0A 1BZXE 1YGCH 5BRRE 1TE0A 4JZ1A 2J38A 3RXFA 1QY6A 1MAYA 1QJ7B 5LPEA 1F5RA 1MZDA 4ZH8A 4X2WA 1HNEE 2R2WU 4WY3A 4TWYA 4SGAE 1YPKH 2FS9A 1UMAH 3KHVA 3E8LA 3UOUA 1WCZA 4GPGA 5FBEA 1GBFA 1FMGA 1UCYK 5DGJA 4DIIH 1SGFG 4KTCA 1NFYA 2WUCA 2UUKB 1GBJA 5T6GA 3A8DA 1KXDA 1OXGA 1PYTC 3LDXH 1JIRA 1GDUA 1BT7A 2G4TA 1O38A 2CGAA 1QIXB 4ZKRU 2F9NA 3ZVCA 1T31A 3OTJE 3AAVA 4ISNA 2H9HA 3BEUA 1H8DH 2NWNA 2AIQA 5FPTA 5I46H 3UNQA 5JPMH 1WUNH 1Y5BT 3NKKA 4AYVB 2ZEBA 3SJIA 1TPSA 1X7AC 3ZYEA 4BAKB 3M5LA 1LCYA 2XWAA 4X1PU 1FZZA 4YOJA 3OY6U 1V2RT 3MNXA 3TPIZ 3LJJA 1BDAA 1P2JA 4UD9H 1TX7A 3SQHE 2ZU3A 1GI2A 3GICB 2A5KA 2XTTB 2OTVA 3U1JB 4NCYA 3ZZ5A 1GHBG 1TNGA 4MPUA 1GBTA 3UFAA 1BRBE 2XCNA 1BTHH 1O5CB 1D6WA 1Y8TA 1CHOF 1VCQA 2A4OA 3RXAA 1W8BH 3A81A 1PQ8A 3BTTE 2OUAA 1PYTD 4WJG2 1QRXA 1EPTA 1XUJA 1P2OA 3ZZ6A 3A7YA 3V12A 3LU9B 3UQVA 1GI4A 1SLXB 3BSQA 1THPB 3P17H 3S9CA 1O37A 1O3FA 2B0FA 5CE1A 1OX1A 5A0AE 4LZ4B 1T4VH 2C4FH 3Q3YA 2ZU5A 2BVRH 3BTGE 1AO5A 2PLXA 2GX4A 1G36A 5E0HA 1W14U 4FUHA 2GD4B 1L4DA 3MO3A 2FTLE 1RD3B 4XOJA 5E8EH 2OBOA 3PTNA 2O8MA 2VWNA 1AY6H 5EG4A 3K65B 2XC4A 3SO3A 1KXAA 5GIBA 4LOYH 4FU7A 1K1JA 3AW0A 4OS5A 1RIWC 3QGNB 2XRCA 4J1YA 3A86A 2OQUA 4WXIA 3M36A 1DE7H 4X6MA 3TGKE 1UCYE 1LVOA 4K1TA 1AGJA 3NZIA 4X1RU 3LGIA 4Y6DA 3TH4H 2SGEE 1XVOA 3O8BA 3A89A 3UNSA 1KLTA 2EEKA 1HUTH 2GDDA 1SPJA 4YTAA 2A7JA 3NUMA 4I8JA 2AGGX 1W2KH 3GCHC