2NWNA

New pharmacophore for serine protease inhibition revealed by crystal structure of human urokinase-type plasminogen activator complexed with a cyclic peptidyl inhibitor, upain-1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
246
structure length
240
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSALAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasminogen activator, urokinase
publication title Structural basis of specificity of a peptidyl urokinase inhibitor, upain-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 240
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nwnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nwnA01
1G3BA 2EI6A 3PMHB 1O35A 1O34A 4DVAU 1P05A 1HAGE 1UCYH 5GJ4B 4WXVA 3GCNA 3RM2H 1MTVA 3UOUA 4ABGA 1MBMA 4AFUA 3SJ8A 2ZCLP 1O2VA 1QIXB 4MPUA 2C8WB 3SUGA 3ESTA 3D62A 3E3TA 6CHAC 2XWAA 1H8DH 3E8LA 2PSYA 3HKJB 2SGQE 3RUOA 4FUCA 4FU7A 5T6GA 1GI3A 2J9NA 1M9UA 3KQEA 1G2LA 2BD5A 3H5CB 5CHAB 1GHBF 1TPSA 1TB6H 4I7YH 4MG3A 4UFEH 2RA3A 1O33A 4AYVB 4GVUA 4B76A 2AGGX 1D6WA 1BQYA 1HAIH 3MFJA 1HBTH 1TX8A 2ZDMA 2ZFFH 2ZWLH 1BMLA 4I31A 4DT7B 2ZC9H 5EGMA 1V2MT 3LGTA 1D3DB 4GLYA 1BMAA 1O2NA 1H4WA 1IQHA 4NZQA 3QGNB 3D65E 5DO4H 2G55A 4UE7H 1TABE 1G9IE 3A84A 3DA9B 1C5QA 2VH6A 4WF8A 3M5MA 4JZDH 1HYLA 4UONA 3LGIA 1FAXA 3RM0H 4INHA 1TRYA 2FOMB 1XUIA 3BV9B 1QJ6B 2ZGHA 2TGAA 1TBQH 2BQ7B 1FN6A 1O3PB 3EQ0H 4X2VA 5E0JA 3P8NA 3MH7A 2ZEBA 1UTQA 1BTZA 4NIWA 3KL6A 4NIVA 1YYY1 1HAVA 2G51A 1AZ8A 1JBUH 1C2MA 2PUQH 2ZQ2A 3S0NA 3RXMA 1PJPA 2O8UA 1TFXA 1LHFH 5B6OA 1L1GA 2HVXA 4Z6AH 5EXLA 5JB8S 1TMTH 4ZUHA 1HLTH 1Z8RA 4ZXXH 3TK5A 1GBIA 3BIUH 1G32B 4XFQA 1UCYK 3A8BA 5IYTA 1Y3XA 3B23B 1AHTH 1O3AA 3LPRA 4WMEA 1NRRH 2UWLA 1BRBE 3MH4A 2BVRH 1BOQA 2QF0A 2VGCB 3ZYEA 1O3OA 2Q6GA 5JPMH 2FYQA 1O32A 4ZKOU 3U8RH 4LZ4B 3M7QA 4K1TA 5BPEA 3UR6A 3WY8A 1S84A 1B5GH 4I8GA 4FVBA 1DLKB 4Q7ZA 4ZKNU 1A0JA 1W13U 3Q3KA 2SNVA 1BBRK 1TPPA 4JMYA 3ELAH 5JYIA 2H9EH 2BD2A 4MNWA 1MCTA 2CGAA 2Q1JA 1PPFE 3TITA 2AFQB 1DSTA 1RGQA 5EW1H 4ZHLU 1S0RA 3QLPH 2VVVA 3Q3YA 1J17T 2FOEA 1P12E 3BG4B 4JZFH 2WPLS 4ZAEA 1AFQB 2A5IA 1GG6C 2FESH 5FCKA 1DY8A 1XVOA 1ZMNA 1ESTA 2H2ZA 4ISNA 4D76A 4AB9A 2OP9A 4JK6A 5EG4A 1LHGH 2VINA 1QL9A 2THFB 3VGCB 3STIA 1GJCB 1P8VC 5EQRA 3SW2B 3RXRA 1FLEE 2O8LA 2SGDE 1AO5A 2I6SA 4DURA 2BY5X 1SLWB 3ZVAA 1E37B 4NFFA 3SNAA 1GDUA 4YO9A 4SGAE 2VIPA 4YT7H 4X6PA 1V2LT 3GCTF 4Y10E 3LGWA 2Z7FE 3SNBA 1BIOA 1L1JA 4B73A 1OX1A 4F49A 4IC6A 1CT0E 7ESTE 1AMHA 1C5WB 1CA0C 3BG8A 2XYAA 1GJ8B 4ISOA 4WH6A 3UNSA 2FX4A 2W3IA 4BAMB 1HAXB 3QN7A 1T32A 1ZTJA 1C5UA 4YOJA 1C5SA 1NTPA 1JXPA 1UK3A 1AUTC 1JRSA 1FY4A 3GY5A 2Y7ZA 3VXFH 1NC6A 1C2LA 2PFEA 1YPHC 1NESE 3DHKH 2XBXA 4ZMAH 4AG1A 3NZIA 1QQ4A 1SGFA 4INKA 2YNBA 3M37A 1DOJA 5E8EH 2B5TB 2BDBA 1QFKH 5FX5A 1DT2A 3TPIZ 1O2TA 2ZFPH 3LH3A 3SJ9A 1UK4A 1WQSA 1K1IA 1O3CA 2GV6A 5JDUB 3RXSA 5EXMA 1BTYA 1TGCA 1AVXA 3GYLB 3SNDA 1ELEE 2ZDNA 5A8YA 1N8OC 1GBDA 1QCPA 3M36A 3SQEE 1O2PA 3RLWH 2GGVB 1K28D 4UD9H 2A5AA 1C2EA 2ZIQH 3ZVCA 2Q6FA 4KGAA 1BHXB 4TY7A 2WPKS 2A0QB 3BTHE 1W7GH 1UVPA 1W10U 1LTOA 3KNXA 1IQLA 1P2QA 1PPEE 2IPHA 1BTHH 3IG6B 1UMAH 2ZDAH 4NSYA 3RXKA 1HRTH 2BOHB 1W0YH 2GDDA 3A80A 5A09A 1FDPA 3P95A 1Y3YA 1OYQA 2BDGA 4MLFB 4ASHA 5EQQA 2HGTH 2GZ7A 1PQ5A 1SC8U 2OC0A 2Z6BD 1ZYOA 1IHTH 2FOBA 3KIDU 1LPGB 1NRNH 3BIVH 4ESTE 4UFGH 1YBWA 5HGGA 1NFUA 4K69A 2ZCKP 1DWBH 1UO6A 2PKSB 4MQAA 1O5BB 1AIXH 2FI3E 1SG8B 1W0ZU 1Y5UT 4XBDA 4BANB 4TPIZ 1EKBB 3MNBA 3RC5A 3LC3A 1ARBA 1NFYA 1O2WA 1F5KU 4YLQH 3MWIU 5EXNA 2OQUA 1B0FA 2HALA 3FZDA 4FUGA 1MQ6A 1HXEH 1AWFH 5CMXH 1C4U2 1OWEA 1PYTC 1GI4A 1XM1A 2R2MB 4LOYH 3SV7A 5FX6A 1DX5M 3ZVEA 1INCA 3PV4A 1HPGA 1UCYE 2B7DH 2NU4E 2VWOA 1KIGH 3MHWU 5ESBA 4ZKSU 2EC9H 3LOXA 1BZXE 1C1MA 1QRWA 3PTNA 1GI8B 2AERH 5ESTE 1VR1H 3MNXA 4JCNA 2AIPA 2VVCA 2AH4X 1ABIH 1QL8A 1ESAA 1EB1H 1N6XA 1KDQA 1TX7A 3SOSA 1S83A 1CGHA 1D6RA 3GCHB 4FU9A 2C8ZB 1O3FA 1G36A 3GDUA 1UVUH 2XC0A 3M3VA 2R0KA 4O9VA 1CHGA 2F9BH 3M5NA 1NFWA 1Z6EA 1ACBE 2CJIA 3FP7E 2ZTXA 2A4GA 2BLQA 3SI3H 2F9UA 1GJ9B 3SUEA 1P9SA 2DUCA 1GHVH 4FUJA 4HI3A 1DVAH 1F0SA 1LHCH 1LMWB 3GDVA 1FY8E 3SN8A 1W12U 3A7ZA 2ANKH 4ISLA 1K9OE 2KAIA 4J2YB 3F9FA 4X8VH 5GPIB 1O3MA 2P94A 2ULLA 3TGIE 4ABDA 1O39A 1LVBA 1SGRE 2BLWA 2HOBA 1TA6A 3UTUH 1A3BH 1C5RA 3BTWE 1GJ6A 1O2KA 1O5EH 4JZIA 4CREA 2G00A 3SHAH 1LCYA 2R3UA 1O2JA 1DANH 1YPJH 1Z8IB 2XXLA 1T4UH 3MI4A 3BTQE 4FUFA 2VWLA 1RIWB 1KTTB 1F0TA 5E2PA 1QGFA 1O2IA 3A87A 4MDSA 1KYNA 3A81A 2ZU4A 5TJXA 3QX5H 5DJ7A 3SBKA 1WV7H 4K1EA 3RMLH 2FOHA 1ZZZA 4K2YA 4ABFA 1PFXC 4A1XA 4IW4E 1AE5A 1ZPCA 2FOAA 2SFAA 3TLOA 2FS8A 1LO6A 2FO9A 2FLRH 3JZ2B 2QC2A 1KXBA 2A7JA 4XOJA 1OP8A 3L33A 2FOGA 1T8MA 1P9UA 2FI5E 2FMJA 2OLGA 1O5AB 2G4UA 1ANDA 1HJ9A 3K6ZA 2F9PA 1XUKA 4FXGH 4BOHA 1GGDB 2Y82A 3UOPA 1UTMA 3GY4A 1P02A 2ZGXH 2STBE 1V6DA 5CE1A 2WPMS 5LPRA 1IQEA 1C5NH 1G3EA 3RXJA 2ASUB 1THSH 1G3DA 1EJNA 2HPQH 1ELAA 3BEIB 2ZHDA 4RKOB 2OUAA 3QGJA 1SGIB 1MTNC 1OKXA 1EPTB 1TNKA 1UTLM 4GHQA 5I46H 3A8CA 1GBMA 3AW0A 4XSKU 3O8DA 1N1LA 2QXJA 5GDSH 5C5NA 1ETTH 3C1KA 5EPNA 1NU9A 1P2OA 3RXUA 3H7TA 1HJ8A 3ZZ3A 4X6MA 4AN7A 2BD9A 1C2KA 2VWNA 2B0FA 1LVYA 4X2YA 2TPIZ 2G81E 4JYTA 4B71A 3AASA 3K2UA 4U2WA 3ZZBA 4AFSA 1QY6A 4HZHA 2ZGJA 1AKSB 1DY9A 1Q3XA 2Y5FA 1DWDH 4NGAH 1MH0A 4F4OC 5C3NA 3RC4A 2PTCE 1T4VH 3MH6A 1A0LA 5IDKA 3PLPA 4KKDA 1MTWA 1K2I1 5HMAA 3ENSB 2D2DA 1TGTA 1O3BA 1V2QT 2OBOA 3NWUA 4O3UA 3SQHE 1V2RT 1E36B 3FANA 1O3NA 1GHBG 9LPRA 4CHAB 1E0FD 2D1JA 2ZTZA 3W95A 1O2MA 2A4OA 4YOIA 3ODFA 3DFJA 1AVWA 3ITIA 4K60A 1C5LH 2BTCE 3RXGA 5L30H 1CO7E 1S82A 1KXDA 2OD3B 1OSSA 4MPWA 4NA9H 5SGAE 2FZZA 4ZXYH 1KXCA 3PMJA 2VIVA 3TNTA 3VPKA 1GBFA 1DLEA 2JETB 3SORA 3MO9A 1BRAA 2BXTH 2HLCA 2ZU1A 4I8HA 2OC8A 1AU8A 4X8SH 3KQDA 3ZZ5A 4X6OA 7LPRA 3TK9A 3SU0A 3PWBA 4NWLA 1AB9B 1VCWA 2NU3E 1AN1E 1HJAB 1MTSA 2FI4E 2JH5D 1CGIE 1TA2A 2BHGA 4Y71A 2AS9A 4XE4A 2Z9LA 3ZZ8A 1FJSA 1GJ4H 5LGOA 5JB9S 1EZQA 1F92A 3RXFA 2GCTC 5C1UA 1DE7H 1AE8H 2C8XB 4XDEA 2XC5A 3EA9A 1O3DA 1SGQE 4NSVA 3STJA 1DITH 2AMPA 1K1MA 1TALA 2UUYA 3TIUA 5J4QA 5K7RA 2AGEX 1NT1A 5DP5A 2BDIA 3BF6H 4Y76A 1RTFB 4MNVA 1FNIA 2NU1E 4CBNA 3SJOA 2BYAX 1IQGA 1CA8B 1BBRH 3AAUA 3TGJE 2ANWA 3QO6A 3TJVA 2ZPSA 3LU9B 1T8NA 3A83A 4CH8B 2BZAA 1WAYB 1MZAA 1UK2A 1GL0E 2FP7B 5FBIA 2TBSA 3MO3A 2TGTA 2PGBB 1RRKA 4YLUA 2RA0A 1ETSH 2WUCA 2XCNA 3LIWA 3SJIA 2Z9KA 5DP9A 2P8OB 4ISIH 4D7GA 3KQCA 3MMGA 1B7XB 1Q31A 1TNLA 3RXAA 1CE5A 3W94A 1YLDA 4LXBH 4Q80A 3HPTB 3F6UH 3LJOA 2CV3A 5EW2H 1GI1A 4XBCA 4GAWA 1BTPA 3BTKE 2GKVE 4H42U 3A89A 1J9CH 1SPJA 4FUIA 4U32A 1ZRKA 5AF9H 3V3MA 1TE0A 2F91A 1D4PB 1S5SA 1MUEB 1P09A 1TRNA 2SGEE 4X8UH 4CRGA 1P0SH 3PROA 1O37A 1GCTC 1G2MA 4IN2A 1NM6A 1XMNB 3RP2A 3IITA 3EAJA 1P01A 4E06H 3LDXH 4ZH8A 2ZPRA 3M7TA 4MPXA 1EASA 2ZGBH 1HIAB 1ZHRA 3PLKA 2XBYA 4D9RA 1W8BH 4BAQB 3BN9A 2QXHA 1C1PA 1Z1JA 3RC6A 3A7XA 4DIIH 1UTKA 2GT8A 3SU6A 2A7HA 2XBVA 2R2WU 3GCTG 2LNCA 3DT0H 2J4IA 5G4BA 3GY7A 1BJUA 5LH8A 1PQ8A 1WCZA 1ZGVA 3PO1B 1EJMA 1SGFG 3RXPA 3QTOH 1ZR0A 1IQMA 3UIRA 2W7SA 1E38B 2JKHA 4FVDA 2EI7A 1U6QA 4U01A 1OXGA 3UWIA 4RKJB 2CHAB 1DUAA 2PGQB 4OS5A 1E35B 1L4ZA 3P8OA 1PYTD 1OWIA 1YGCH 2IJOB 1P11E 3KGPA 3UWJH 3LH1A 1V2ST 5DGJA 1GL1A 1TQ0B 1TNJA 4LK4A 1Q2WA 1O2QA 1EB2A 1TNGA 1C5YB 2H5CA 1L4DA 1VCQA 4FUDA 4KTUA 1GGDC 2P16A 2FXRA 2BDHA 1MU8B 2HRVA 4VGCB 3T29A 1ID5H 2ESTE 7GCHF 2XBWA 1Y59T 1UTPA 2A1DB 1DPOA 1BITA 1CBWB 2ALVA 2ZO3H 2C3SA 4X2WA 3ZZ6A 2ZPQA 3SGBE 1P2NA 1FUJA 1VGCC 1EPTC 2HPPH 3HK3B 1SOZA 4CRBA 5A0AE 1FI8A 4Y0YE 2GZ8A 8KME2 9ESTA 2V3HH 3GOVB 4BNRA 3D23A 3V7TA 3ZZCA 4FUEA 1PPGE 2AYWA 2FYRA 1V2WT 1O2RA 2TRMA 4YM9A 2STAE 1GDQA 1TGNA 1GHZA 3PYHA 2ODQA 3T5FH 4A1VA 1C4V2 3DD2H 5PTPA 2VB0A 5EPYA 1GDNA 2P93A 1HAPH 1OWJA 2SGAA 4YT6H 1C2IA 2GT7A 3SGQE 1GPZA 3RXLA 1KLIH 1O2GH 1GBCA 1EP6A 1F2SE 4NIYA 5T3HA 1J16A 1O3EA 3RMMH 1XVMA 1ZSKA 1ELBA 3UREA 5AFYH 1V3XA 1EAXA 2J92A 5LPFA 1AZZA 2Q6DA 2LPRA 1GVZA 2CN0H 1HGTH 3CENA 1Y3VA 3GISB 1ZPBA 4Y11E 3M7UA 3NKKA 4CHAC 3ATWA 4NA7A 1S85A 3BEFB 3SJKA 1FAKH 1V2KT 3DFLA 3L6PA 1SGDE 2BQWB 3K9XB 2O8MA 2Y5GA 2QXIA 2GZ9A 3NUMA 2ZECA 5C67A 1KXEA 1W7XH 1J15A 2O9QA 1SGYE 5FBEA 3SV8A 2PKAB 4D7FA 2C90B 4CBOA 3SO3A 1IQIA 1P04A 4Y79A 2JETC 1SHYA 3TU7H 4Y6DA 5F8ZA 1HAZB 3SV2H 1O30A 2FWWA 1O2UA 1BTUA 3E6PH 4AYYB 1S81A 3LONA 1QRXA 3SUDA 2BY6X 2BY9X 4CH2B 1ANCA 1SGTA 4WVPE 3O8RA 1DS2E 1TPOA 3GY3A 1TOCB 2A2XH 3ZZ4A 1FZZA 1SGEE 3GYMA 2WV5A 1DFPA 2SNWA 1C5OH 1C5TA 4I33A 8GCHG 3RU4D 1B0EA 3RXTA 3PTBA 1ETRH 2BD3A 3I77A 1A46H 4J1YA 3ATKA 2PLXA 4ABIA 4THNH 1H9IE 1CVWH 1C2HA 1ZHMA 4ZHMU 5DP4A 1Z6JH 2R3YA 4FUBA 1P2IA 1OS8A 5CHAC 2JH6D 6ESTA 3O8BA 1SOTA 1EXFA 2PHBA 4GCHF 3A7YA 1CHOF 1LQDB 1T8OA 1LQEA 2GVFA 4PROA 1DDJA 1O3HA 3CS7A 5E2OA 3TJUA 1FV9A 2ZDLA 2I6QA 1H8IH 3A7TA 2P3TB 1WTHD 1MCVA 5GXPA 2A4RA 3KHVA 2WPHS 2CF8H 1P06A 4B1TA 4UDWH 2ZG0H 1Z8JB 2QN5T 1GBKA 1XUGA 3VXEH 2ZU5A 2A4QA 3RLYH 3F9HA 1WSSH 1KXAA 1YCPM 1CGJE 3U69H 3HGPA 1F0UA 1AWHB 4CRAA 3ZZ7A 3MYWA 4GUXA 2P8OC 3QUMP 4XBBA 1WUNH 4AOQA 2UUJB 2NU0E 2FEQH 1O3JA 1XUHA 4R0IA 3RXEA 3AVZA 1A5IA 3R0FA 4ISHH 2FOFA 2GD4B 1KLTA 1ZPZA 1T7CA 2ZDVH 1AGJA 1K1PA 1O3LA 1F7ZA 2VWMA 2WINI 4YESB 8GCHF 1NS3A 5AFZH 1O2ZA 1BBRE 2ANMH 1A7SA 1FY3A 2FTMA 2Y80A 1HUTH 2BY8X 4KTCA 1RXPA 2ZI2H 2QXGA 1YF4A 3EE0B 1W14U 1TPAE 2G4TA 3TK6A 4UFFH 3GICB 1C5ZB 1GBAA 1MD7A 4JZEH 1NO9H 2V3OH 1LKBA 2XW9A 1BT7A 2ZHFH 4OS2A 1JWTA 1FY5A 2W26A 1C5PA 1KTSB 2ZFTA 3MNCA 2BD4A 1RD3B 1QJ1B 4X1RU 1EAUA 3Q3XA 4IC5A 2BD7A 2M5TA 1VCPA 5TCCA 1SL3A 3S9CA 1SLXB 8ESTE 5L6NH 2VGCC 4WJG2 2FOCA 3EA7A 1GMCF 3G01A 1QBVH 1EZUC 1HXFH 4TWWA 4K5ZA 4MNYA 1TBRH 5GCHF 4B74A 4INLA 1TONA 1EUFA 4ABHA 1YPHE 3S7KB 2PR3A 2OBQA 2BMGB 3PO1C 4K3JA 1SBWA 3A88A 3ZVGA 4MNXA 2OC1A 4IBLH 3O8CA 1GBEA 2BDAA 2BQ6B 3P8GA 4QT8C 5HM9A 5EQSA 2H6MA 1C1TA 1J8AA 4WXIA 3ATMA 3ZVFA 2IN2A 2SGPE 2Z9GA 1RS0A 2GV7A 4OS6A 1P2JA 1J14A 1C2DA 3OY6U 1QHRB 3BG4C 4Y8XA 2BVXH 5T6FA 1P2KA 1DWCH 1YPKH 1O2OA 1K22H 1AFQC 1PPHE 3UQOA 3MNSA 2QIQA 5FXLA 3B8JA 2V6NA 4CRDA 1GG6B 2BXUH 1EATA 1AFEH 1YM0A 3VGCC 2P3UB 4VGCC 1C1RA 1P10A 1UHBA 3S9AA 3ATIA 3VB7A 2QYIA 2ANYA 1MKWH 2ZTYA 1C1QA 1THRH 1TIOA 1C5XB 2J34A 1TYNA 4K8BA 5K0HA 2OTVA 4UEHH 3EYDA 1LVMA 2FTLE 4ABAA 1T31A 4WH8A 4BTUB 2OCVB 3RMNH 4AGJA 2UUKB 2ZZUH 1F5RA 2BOKA 4TYDA 3HKIB 4WMDA 4ABEA 4BXSA 1V2NT 1QB9A 3BEUA 2R9PA 3M3SA 1EZXC 1EP5A 1SFQB 4B75A 4OGXA 1CA0B 2XRCA 1KSNA 1RFNA 4BXWA 5A0BA 1RTLA 1DXWA 1H9HE 1HAOH 1H1BA 1H9LB 3M61U 1BMNH 1BRUP 1XX9A 1TX6A 1W11U 4RN6A 4BAOB 1GJDB 3OY5U 4DJZB 1TNIA 2ALPA 3LC5A 2AEIH 1V2UT 3MU0A 1SVPA 2ZA5A 3VFEA 5JBBS 5FAHA 1GMDF 1T8LA 3OSYA 1O2HA 2EI8A 3SGAE 1GBTA 4B2AA 2CXVA 2O8WA 1O5FH 3VB3A 3KQBA 3RXBA 1BTWA 3RMOH 3KN2A 3OYPA 4ABBA 4DW2U 1SQOA 1UVTH 1EPTA 2W5EA 1N8OB 2RCEA 2GX4A 3GY2A 1ANEA 2F3CE 5FPTA 2Z9JA 5A0CA 3V13A 4HFPB 1A1RA 2VIDA 3FAOA 3ZZ9A 3DUXH 1A0HB 3MU4A 4X6NA 3ZZDA 3UPEA 4A1TA 1LPKB 1UTNA 1GJAB 1EX3A 1ZMJA 4HGCA 2O8TA 4ZROA 1ELTA 2AGIX 2ZFSA 1OWKA 4MPVA 1MBQA 1OYTH 1MKWK 1YPGH 3NK8A 3ZVDA 1ELGA 3T2NA 3U1JB 2H1UA 1GHXH 3A86A 1Z71A 1TWXB 2XTTB 4AZ2B 4AB8A 4A92A 1Y3WA 1A61H 5I25A 1YLCA 1D9IA 1AKSA 4WY3A 1XXFA 3SV6A 4IMQA 2F9NA 1HAVB 3ZV8A 5C20A 2A5KA 2PKSC 1ZJDA 3MU1A 2A31A 1Y8TA 1E34B 2OQ5A 1Z1IA 2QA9E 1PQAA 1V2TT 1MAXA 1XUJA 2J2UA 4RSPA 2AMQA 4E05H 1L0ZA 1NRSH 2FIRH 1RJXB 1VITH 5DG6A 2BY7X 2FDAA 3F68H 4I8JA 1IQKA 2ODYB 2PW8H 2ZFQH 1TAWA 1KXFA 4AG2A 3UFAA 3FZZA 1ZGIA 2H9HA 2ZP0H 5EODA 3UQVA 1NROH 2FM2A 1CT4E 2OC7A 2BLOA 3NXPA 3FP8E 1GI5A 3HATH 2XNIA 2WYJA 1Z7KA 1ZSJA 1BJVA 2GTBA 3RXOA 1EAWA 1EOJA 3MU5A 2BD8A 3VB5A 1MD8A 1DSUA 3GCOA 1V2PT 5GIBA 2ZQ1A 5DP3A 3GCHC 1K1LA 3BTDE 4K8YA 2HNTC 2G8TA 2YNAA 4JYUH 1PQ7A 3T27A 4X2XA 1GCDA 1UTOA 3Q00A 1SQAA 1ORFA 3NCLA 3GDSA 1SHHB 4OGYA 3SUFA 4KP0A 2XC4A 2WV4A 3QWCH 1GHAG 3HK6B 1P57B 2Z94A 2BX4A 2V35A 4AFQA 4H6SB 1G3CA 5C1XA 3RU4E 3MTYA 3M3TA 2GMTB 2TIOA 3EGKH 5A8ZA 2QCYA 3K65B 1ZTKA 2BZ6H 1GBBA 2VVUA 1O2XA 1FQ3A 1K21H 2A7CA 3LGUA 4O03A 7GCHG 1IQJA 2IOTA 2XWBI 2Y5HA 4KELA 1AVGH 1O2LA 3F1SB 1O38A 3M35A 1FONA 4GPGA 1IQFA 1LHDH 3TH4H 4D8NA 1LKAA 3E1XB 3Q77A 1EQ9A 3P6ZB 2OXSA 1RIWC 1XXDA 3RXCA 1P3EA 5F03A 5HXFA 1GHWH 1GWAA 2ODPA 1NPMA 3SZNA 1CU1A 3E90B 6LPRA 4U30A 4ZHAA 2WYGA 3S69A 4DGJA 1CSOE 1XKBC 2BDCA 2R0LA 4OS7A 4BAKB 2AIQA 2ZU3A 2G52A 4X1QU 1QNJA 1GHAF 1GJ5H 3T28A 3MOCA 3ZZAA 2F9OA 2ZF0H 1P03A 3UY9A 1N6YA 4Q7XA 4OS1A 4NCYA 3SI4H 3QDZB 5E0HA 1IHSH 2BVSH 5ETXA 4NA8A 1VZQH 5JBCS 2FS9A 4AORA 1BDAA 3MU8A 4M7GA 1GVKB 1CT2E 4GHTA 3E0PB 3SHCH 5C5OA 2BM2A 1O0DH 1NU7B 1SSXA 2WPJS 1C9TA 1DICA 4HTCH 3OTJE 3TVJB 1AY6H 5EU8A 2Y7XA 1HIAA 3U8OH 1ZSLA 1HNEE 1TRMA 1NZQH 4BTTB 4UFDH 1GI6A 1O2SA 2AMDA 3SNEA 1X7AC 1ZJKA 3V0XA 1MTNB 1V2OT 3CS0A 3U98H 1SI5H 1YC0A 2CMYA 1JMOH 1MAYA 1KY9A 4DOQA 3L3TA 2PUXB 1K1OA 1A2CH 2H9TH 3TJNA 1D3PB 1TNHA 2B9LA 2PWXA 2ZHQH 5DP8A 3UUZA 1D3QB 3S7HB 3RDZA 3BTFE 1ESBA 1O2YA 4Q7YA 2P3FH 1EZSC 1DUEA 1ANBA 3KCGH 4X1PU 4X1NU 1NY22 1C2FA 4YOGA 2NU2E 1ZMLA 2ZHEH 3QTVH 3ZVBA 2VH0A 4NZLA 2EA3A 1ZTLA 1YPLH 2CF9H 1S0QA 2NWNA 3LKWA 4IMZA 3I29A 3B9FH 1G37A 5J4SA 1G30B 1MQ5A 3HGNA 3A8DA 1C1NA 1WTGH 1FY1A 4MTBA 1JIRA 1W2KH 1EJAA 4KTSA 5BRRE 1OOKB 3JZ1B 3ATLA 3RXDA 1ELCA 2DE9A 1O5DH 5F6MA 3LT3A 1ZRBA 3U1IB 6GCHG 1QA0A 2GCHG 1GI2A 3KEEA 5FHTA 1AI8H 2K1QA 1AQ7A 1PPBH 1W3CA 4GCHG 2PV9B 1CHOG 4I8LA 2ZHWH 1GI9B 3QZRA 2VIOA 4BTIB 3LGVA 1K1JA 2BB4A 4K1SA 2C93B 5JBTA 5F8TA 1SR5C 2HNTE 3GY8A 1TQ7B 3LGYA 3Q76A 1OWHA 1C5MD 1MZDA 1TGSZ 3BTME 1HAHH 4CRCA 1GJ7B 3FP6E 1TOMH 1AUJA 2J95A 1FIWA 2OINA 5HM2A 2QF3A 3ZYDA 1AB9C 3TGKE 1HJAC 2UWOA 1O31A 1L1NA 1Y5BT 2SGFE 3LJJA 3SU2A 1ELFA 1SGCA 1RTKA 3OU0A 4JYVH 1IAUA 1JOUB 2A2QH 1KDQB 5GWZA 2BDYA 3PLBA 2D26C 1WOFA 1FPCH 3UR9A 1A5HA 1BHXF 3AW1A 1AD8H 7KMEH 3V12A 2VU8E 3M5LA 2ILNA 2GCTB 5FCRA 6CHAB 1D3TB 2ZFRH 3SU3A 4CR9A 1C1SA 1LHEH 2ZGCA 5C1YA 1LDTT 2RDLA 6GCHF 1QL7A 1YP9A 4TY6A 1MTUA 2GCHF 1C5VA 1L2EA 1TLDA 3D49H 1BTXA 4Z0KA 2WUBA 3P92A 3F9GA 1F0RA 2KAIB 1HCGA 4NG9H 3EDXB 3I78A 1QBOA 2BX3A 1LVOA 2ZCHP 5ABWA 3RXHA 1Y5AT 3F9EA 3N7OA 1O3IA 1HDTH 2G5VA 2PTNA 3A7VA 4GSOA 5DP7A 5F8XA 4B2BA 1DM4B 1GMCG 1A5GH 2J38A 4X8TH 2PKAA 1FMGA 1UTJA 1HV7A 1CQQA 1YPEH 2DE8A 1QTFA 1BRCE 5GCHG 1A3EH 3QK1A 1GHYH 2Z3CA 1ELVA 4Y7BA 2FLBH 4ZKRU 2FX6A 1QJ7B 4Y8YA 1QR3E 3CP7A 4O3TA 1C1VH 1XUFA 2Z9IA 4WWYA 1PPCE 1ARCA 1C1OA 1SB1H 1JRTA 1TBZH 1GBLA 4E7RG 2EEKA 1NRQH 1C2GA 2ZKSA 3A85A 3FVFB 3E0NB 3K6YA 4Y7AA 4DIHH 1C4Y2 3URDA 1SMFE 5JBAS 1EOLA 1V2JT 2TGPZ 2VIQA 2F83A 4LZ1H 4AX9H 3U9AH 2P59A 4B2CA 2JH0D 3AAVA 4FUHA 4O97A 1WYKA 3H7OA 3RXQA 1ZOMA 2FODA 3MO6A 2Y6TA 2QAAA 1QURH 2GMTC 1TMUH 1UVSH 5EOKA 1F5LA 4I8KA 1GCTB 4X1SU 3IWMA 1XKAC 3OX7U 4JK5A 2HNTF 3SU1A 4A7IB 2UWPA 4DCDA 3UNRA 1QRZA 2Z3EA 5LPEA 4Y0ZE 5DK1A 2Y81A 2YOLA 3VB6A 1K1NA 4TPYA 1FPHH 2QY0B 5H4IB 3U8TH 1UHBB 1OP2A 1THPB 1S6FA 5L2ZH 1OP0A 1OWDA 1QBNA 1ZLRA 3P8FA 3VB4A 1QA7A 5DKMA 1LPZB 1WQVH 5L2YH 1YCPH 4A5TS 4Q2KA 5A8XA 1GI0A 3PMBB 1C1UH 2CHAC 5AVDA 2B8OH 2XCFA 4WMFA 3PM3A 1HAYB 4CRFA 1UJ1A 1IOEA 1VITG 2WPIS 1FN8A 3C27B 3MH5A 3PWCA 3RXVA 1DXPA 1WU1A 4NFEA 1SGPE 5DP6A 1C2JA 1GVLA 3SNCA 3SU4A 2V0BA 2UUFB 4AFZA 2PSXA 3UNQA 4A6LA 3FFGA 4BAHB 4CR5A 1C1WH 4H4FA 1MU6B 1YPMH 3BTTE 4YZUA 3URCA 3T62A 3TJOA 1GMDG 1O3GA 1NFXA 1GBJA 1MKXH 1O5GH 3EA8A 5TCAA 1DWEH 3ODDA 1MMJN 1O3KA 4IGDA 1VJAU 1BMMH 1S6HA 1CBWC 5E0GA 4YTAA 3RXIA 4ABJA 3BTGE 4JZ1A 4AGKA 1IQNA 2C4FH 1ELDE 1VJ9U 2Z3DA 2QV1A 1ZHPA 3A82A 4IN1A 2QGRA 3TH3H 2J94A 3BSQA 2W7UA 4TWYA 1VGCB 1P3CA 4E7NA 2VNTA 5FPYA 4H6TA 1GI7B 1GMHG 1TMBH 2HWLB 4NWKA 8LPRA 3A8AA 2ZU2A 2P95A 1NN6A 2C8YB 3ZV9A 1ABJH 2A45B 1C9PA 1VITF 4DY7B 1O36A 1NRPH 2G5NA 4IS5A 5C2ZA 4X0WU 4D9QA 1QB1A 1SLUB 2BLVA 1FIZA 1QB6A 2ZDKA 1SGNE 1GJBB 2RG3A 1BA8B 3R3GB 1HB0B 3T26A 2FPZA 4Y8ZA 3BTEE 1FXYA 5FPSA 3RU4T 1SFIA 1QQUA 3NPSA 1V2VT 1EAIA 1BUIA 1YCPK 5DPAA 2H5DA 3M5OA 3P17H 5T6DA 2A32A 3TNSA 1WBGB 2VJ1A 5AHGH 1Y3UA 1Z8GA 2TGDA 1JIMA 1O5CB 1OPHB 1TGBA 4SGBE 3QZQA 1SQTA 1GBHA 1BCUH 3E91A 4NIXA 1UVOA 3P70B 1SLVB 4I32A 3GY6A 4OS4A 2GDEH 1HFDA 5A2MH 2GP9B 3S9BA 1PPZA 3SV9A 3KF2A 1KLJH 2D8WA 1GMHF 1A4WH 4MVNA 4DG4A 1YKTA 3PB1E 3A7WA 5HYOA 2VIWA 2F9VA 3PMAB 3VEQB 1MKXK 2ZNKH 1BB0B 1P2MA 3TH2H 4R8TB 3T25A 3E16B 3SU5A 2W3KA 4FU8A
chains in the Genus database with same CATH superfamily
1G3BA 2EI6A 3PMHB 1O35A 1O34A 4DVAU 1P05A 3UAIC 1HAGE 1UCYH 5GJ4B 4WXVA 3GCNA 3RM2H 1MTVA 3UOUA 4ABGA 1MBMA 1K0HA 4AFUA 3SJ8A 2ZCLP 1O2VA 1QIXB 4MPUA 2C8WB 3SUGA 3ESTA 3D62A 3E3TA 6CHAC 2XWAA 1H8DH 3E8LA 2PSYA 3HKJB 2SGQE 3RUOA 4FUCA 4FU7A 5T6GA 1E1QD 1GI3A 2J9NA 1M9UA 3KQEA 1G2LA 2BD5A 3H5CB 5CHAB 1GHBF 1TPSA 1TB6H 4I7YH 4MG3A 4UFEH 2RA3A 1O33A 4AYVB 4GVUA 4B76A 2AGGX 1D6WA 1BQYA 1HAIH 3MFJA 1HBTH 1TX8A 2ZDMA 2ZFFH 2ZWLH 1BMLA 4I31A 4DT7B 2ZC9H 5EGMA 1V2MT 3LGTA 1D3DB 4GLYA 1BMAA 1O2NA 1H4WA 1IQHA 4NZQA 3QGNB 3D65E 5DO4H 2G55A 4UE7H 1TABE 1G9IE 3A84A 3DA9B 1C5QA 2VH6A 4WF8A 3M5MA 4JZDH 1HYLA 4UONA 3LGIA 1FAXA 3RM0H 4INHA 1TRYA 2FOMB 1XUIA 3BV9B 1QJ6B 2ZGHA 2TGAA 1TBQH 2BQ7B 1FN6A 1O3PB 3EQ0H 4X2VA 5E0JA 3P8NA 3MH7A 2ZEBA 1UTQA 1BTZA 4NIWA 2QF5A 3KL6A 4NIVA 1SKYE 1YYY1 1HAVA 2G51A 1AZ8A 1JBUH 1C2MA 2PUQH 2ZQ2A 3S0NA 3RXMA 1PJPA 2O8UA 1TFXA 1LHFH 5B6OA 2GJGA 1L1GA 2HVXA 4Z6AH 5EXLA 5JB8S 1TMTH 4ZUHA 1HLTH 1Z8RA 4ZXXH 5KGOA 3TK5A 1GBIA 3BIUH 1G32B 4XFQA 1UCYK 3A8BA 5IYTA 1Y3XA 3B23B 1AHTH 1O3AA 3LPRA 4WMEA 1NRRH 2UWLA 1BRBE 3MH4A 2BVRH 1BOQA 2QF0A 2VGCB 3ZYEA 1O3OA 2Q6GA 4YXWD 5JPMH 2FYQA 1O32A 4ZKOU 3DSPA 3U8RH 4LZ4B 3M7QA 4K1TA 5BPEA 3UR6A 3WY8A 1S84A 1B5GH 4I8GA 4FVBA 1DLKB 4Q7ZA 4ZKNU 1A0JA 1W13U 3Q3KA 2SNVA 1BBRK 1TPPA 4JMYA 3ELAH 3VG8A 5JYIA 2H9EH 2BD2A 4MNWA 1MCTA 2CGAA 2Q1JA 1PPFE 3TITA 2AFQB 1DSTA 1RGQA 5EW1H 4ZHLU 2LELA 1S0RA 3QLPH 2VVVA 3Q3YA 1J17T 2FOEA 1P12E 3BG4B 4JZFH 3FO8D 2WPLS 4ZAEA 1AFQB 2A5IA 1GG6C 2FESH 5FCKA 1DY8A 1XVOA 1ZMNA 1ESTA 2H2ZA 4ISNA 4D76A 4AB9A 2OP9A 4JK6A 5EG4A 1LHGH 2VINA 1QL9A 2THFB 3VGCB 3STIA 1GJCB 1P8VC 5EQRA 3SW2B 3RXRA 1FLEE 2O8LA 2SGDE 1AO5A 2I6SA 4DURA 2BY5X 1SLWB 3N7DA 3ZVAA 1E37B 4NFFA 3SNAA 1GDUA 4YO9A 4SGAE 2VIPA 4YT7H 3OTPA 4X6PA 1V2LT 3GCTF 4Y10E 3LGWA 2Z7FE 3SNBA 1BIOA 1L1JA 4B73A 2WV9A 1OX1A 4F49A 4IC6A 1CT0E 7ESTE 1AMHA 1C5WB 1CA0C 3BG8A 3FOAA 2XYAA 1GJ8B 1YY3A 4ISOA 4WH6A 3UNSA 2FX4A 2W3IA 4BAMB 1HAXB 3QN7A 1T32A 1ZTJA 1C5UA 4YOJA 1C5SA 1NTPA 1JXPA 1UK3A 1AUTC 1JRSA 1FY4A 3GY5A 2Y7ZA 3VXFH 1NC6A 1C2LA 2PFEA 1YPHC 1NESE 3DHKH 2XBXA 4ZMAH 4AG1A 3NZIA 1QQ4A 1SGFA 4INKA 2YNBA 3M37A 1DOJA 5E8EH 2B5TB 2J97A 1NBMD 2BDBA 1QFKH 5FX5A 1DT2A 3TPIZ 1O2TA 2ZFPH 3LH3A 3SJ9A 1UK4A 1WQSA 1K1IA 1O3CA 2GV6A 4FOUC 5JDUB 3RXSA 5EXMA 1BTYA 1TGCA 1AVXA 3GYLB 3SNDA 1EFRD 1ELEE 2ZDNA 5A8YA 1N8OC 1GBDA 1QCPA 3M36A 3SQEE 1O2PA 3RLWH 2GGVB 1K28D 4UD9H 2A5AA 1C2EA 2ZIQH 3F2HA 3ZVCA 2Q6FA 4KGAA 1BHXB 4TY7A 2WPKS 2A0QB 3BTHE 1W7GH 2W6ID 1UVPA 1W10U 1LTOA 3KNXA 1IQLA 1P2QA 1PPEE 2IPHA 5EJLA 5HKKD 1BTHH 3IG6B 1UMAH 2ZDAH 4NSYA 3RXKA 2KX4A 1HRTH 2BOHB 1W0YH 1E79D 2GDDA 3A80A 5A09A 1FDPA 3P95A 1Y3YA 1OYQA 2BDGA 4MLFB 4ASHA 5EQQA 2QF4A 2HGTH 5DN6D 2GZ7A 1PQ5A 1SC8U 2OC0A 2Z6BD 1ZYOA 1IHTH 2FOBA 3KIDU 1LPGB 1NRNH 3BIVH 4ESTE 4UFGH 1YBWA 5HGGA 1NFUA 4K69A 2ZCKP 1DWBH 1UO6A 2PKSB 4MQAA 1O5BB 1AIXH 2FI3E 1SG8B 1W0ZU 1Y5UT 5DSFA 4XBDA 4BANB 3MQKC 4TPIZ 1EKBB 3MNBA 3RC5A 3LC3A 1ARBA 2VBCA 1NFYA 1O2WA 1F5KU 4YLQH 3MWIU 5EXNA 2OQUA 1B0FA 5C94A 4DT4A 2HALA 3FZDA 4FUGA 1MQ6A 1HXEH 1AWFH 5CMXH 1C4U2 1OWEA 1PYTC 1GI4A 2EQNA 1XM1A 2R2MB 4LOYH 3SV7A 2JJ2D 5FX6A 1DX5M 3ZVEA 1INCA 3PV4A 1HPGA 1UCYE 2B7DH 2NU4E 2VWOA 1KIGH 3MHWU 5ESBA 4ZKSU 2EC9H 3LOXA 1BZXE 1C1MA 1QRWA 3PTNA 1GI8B 2AERH 5ESTE 1VR1H 2WZQA 3MNXA 4JCNA 2AIPA 2VVCA 2AH4X 1ABIH 1QL8A 1ESAA 1EB1H 1N6XA 1KDQA 1TX7A 3SOSA 1S83A 1CGHA 1D6RA 3GCHB 4FU9A 2C8ZB 1O3FA 1G36A 3GDUA 1UVUH 2XC0A 3M3VA 2R0KA 4O9VA 1CHGA 2F9BH 3M5NA 1NFWA 2XNDD 1Z6EA 1ACBE 2CJIA 3FP7E 2ZTXA 2A4GA 2BLQA 3SI3H 2F9UA 1GJ9B 3SUEA 1P9SA 2YMSB 2DUCA 1GHVH 3SZEA 4FUJA 4HI3A 1DVAH 1F0SA 1LHCH 1LMWB 3GDVA 1FY8E 3SN8A 2WHXA 1W12U 3A7ZA 2ANKH 4ISLA 1K9OE 2KAIA 4J2YB 3F9FA 4X8VH 5GPIB 1O3MA 2P94A 2ULLA 3TGIE 4ABDA 1O39A 1LVBA 1SGRE 2BLWA 2HOBA 1TA6A 3UTUH 1A3BH 1C5RA 3BTWE 1GJ6A 1O2KA 1O5EH 4JZIA 4FETA 2QE7D 4CREA 2G00A 3SHAH 5HIYA 1LCYA 2R3UA 1O2JA 1DANH 1YPJH 1Z8IB 2XXLA 1T4UH 3MI4A 3BTQE 4FUFA 2VWLA 1RIWB 1KTTB 1F0TA 5E2PA 1QGFA 1O2IA 3A87A 4MDSA 1KYNA 3A81A 2ZU4A 5TJXA 3QX5H 5DJ7A 3SBKA 1WV7H 4K1EA 3RMLH 2FOHA 1ZZZA 4K2YA 4ABFA 3F3BA 1PFXC 4A1XA 4IW4E 3PV2A 1AE5A 1ZPCA 2FOAA 2SFAA 3TLOA 2FS8A 1LO6A 2FO9A 2FLRH 3JZ2B 2QC2A 1KXBA 2A7JA 4XOJA 4XRNA 1OP8A 3L33A 2FOGA 1T8MA 1P9UA 2FI5E 2FMJA 2OLGA 1O5AB 2G4UA 1ANDA 1H8HD 1HJ9A 3K6ZA 2F9PA 1XUKA 4FXGH 4BOHA 1GGDB 2Y82A 3UOPA 1UTMA 3GY4A 1P02A 2ZGXH 2STBE 1V6DA 5CE1A 2WPMS 5LPRA 1IQEA 1C5NH 1G3EA 3RXJA 2ASUB 1THSH 1G3DA 1EJNA 2HPQH 1ELAA 3BEIB 2ZHDA 4RKOB 2OUAA 3QGJA 1SGIB 1MTNC 1OKXA 1EPTB 1TNKA 1UTLM 4GHQA 5I46H 3A8CA 1GBMA 3AW0A 4XSKU 3O8DA 1N1LA 4Q63A 2QXJA 5GDSH 5C5NA 1ETTH 5CDFE 2HVYB 3C1KA 5EPNA 1NU9A 1P2OA 3RXUA 3H7TA 1HJ8A 3ZZ3A 4X6MA 4AN7A 2BD9A 1C2KA 2VWNA 2B0FA 1LVYA 4F48B 4X2YA 2TPIZ 2G81E 4JYTA 4B71A 3AASA 3K2UA 4U2WA 3ZZBA 4AFSA 1QY6A 4HZHA 2ZGJA 1AKSB 1DY9A 1Q3XA 1SQRA 2Y5FA 1DWDH 4NGAH 1MH0A 4F4OC 5C3NA 3RC4A 2PTCE 1T4VH 3MH6A 3U28C 1A0LA 5IDKA 3PLPA 4KKDA 1MTWA 1K2I1 5HMAA 3ENSB 3KQ5A 2D2DA 1TGTA 1O3BA 1V2QT 1VKYA 2OBOA 3NWUA 4O3UA 3SQHE 1V2RT 1E36B 3FANA 1O3NA 1GHBG 9LPRA 4CHAB 1E0FD 2D1JA 1YLNA 2ZTZA 3W95A 1O2MA 2A4OA 4YOIA 4TT3D 3ODFA 3DFJA 1AVWA 3ITIA 4K60A 1C5LH 2BTCE 3H09A 3RXGA 5L30H 1CO7E 1S82A 1KXDA 2OD3B 1OSSA 4MPWA 4NA9H 5SGAE 2FZZA 4ZXYH 1KXCA 3PMJA 2VIVA 3TNTA 2WPDD 3VPKA 1GBFA 1DLEA 3UB0A 2JETB 3SORA 3MO9A 1BRAA 2BXTH 2HLCA 2ZU1A 4I8HA 2OC8A 1AU8A 4X8SH 3KQDA 3ZZ5A 4X6OA 7LPRA 3TK9A 3SU0A 3PWBA 4NWLA 1AB9B 1VCWA 1AN1E 1HJAB 1MTSA 2FI4E 2JH5D 2NU3E 1CGIE 1TA2A 2BHGA 4Y71A 2AS9A 4XE4A 2Z9LA 3ZZ8A 1FJSA 1GJ4H 5LGOA 5JB9S 1EZQA 1F92A 3RXFA 2GCTC 5C1UA 1DE7H 1AE8H 2C8XB 1UW7A 4XDEA 2XC5A 3EA9A 1O3DA 1SGQE 4NSVA 3STJA 2RDEA 1DITH 2AMPA 1K1MA 1TALA 2UUYA 3TIUA 5J4QA 5K7RA 2AGEX 1NT1A 5DP5A 2BDIA 3BF6H 4Y76A 1RTFB 4MNVA 1FNIA 2NU1E 4CBNA 3SJOA 2BYAX 1IQGA 1CA8B 1NBME 1BBRH 3AAUA 3TGJE 2ANWA 3QO6A 3TJVA 2ZPSA 3LU9B 1T8NA 3A83A 4CH8B 2BZAA 1WAYB 1MZAA 1UK2A 1GL0E 2FP7B 5FBIA 2TBSA 3MO3A 4XD7D 2TGTA 2PGBB 1RRKA 4YLUA 2RA0A 1ETSH 2WUCA 2XCNA 3LIWA 3SJIA 3FKSD 2Z9KA 5DP9A 2P8OB 4ISIH 4D7GA 3KQCA 3MMGA 1B7XB 1Q31A 1TNLA 3RXAA 1CE5A 3W94A 1YLDA 4LXBH 4Q80A 3HPTB 3F6UH 4F55A 3LJOA 2CV3A 5EW2H 1GI1A 4XBCA 4GAWA 1BTPA 3BTKE 2GKVE 4H42U 3A89A 1J9CH 1SPJA 4FUIA 4U32A 1ZRKA 5AF9H 5KECA 3V3MA 1TE0A 2F91A 1D4PB 1S5SA 1MUEB 1P09A 1TRNA 2SGEE 4X8UH 4CRGA 1P0SH 3PROA 1O37A 1GCTC 1G2MA 4IN2A 1NM6A 1XMNB 1WDIA 3RP2A 5EJ1A 3IITA 3EAJA 1P01A 4E06H 3LDXH 4ZH8A 2ZPRA 3M7TA 4MPXA 1EASA 2ZGBH 1HIAB 1ZHRA 3PLKA 2XBYA 4D9RA 1W8BH 4BAQB 3BN9A 2QXHA 4P00A 1C1PA 1Z1JA 3RC6A 3A7XA 4DIIH 1UTKA 2GT8A 3SU6A 3N7EA 2A7HA 2XBVA 2R2WU 3GCTG 2LNCA 3DT0H 2J4IA 5G4BA 3GY7A 1BJUA 5LH8A 1PQ8A 1WCZA 1ZGVA 3PO1B 1EJMA 1SGFG 3RXPA 3QTOH 1ZR0A 1IQMA 3UIRA 2W7SA 1E38B 2JKHA 4FVDA 2EI7A 1U6QA 4U01A 1OXGA 3UWIA 4RKJB 1WXRA 2CHAB 1DUAA 2PGQB 4OS5A 1E35B 1L4ZA 3P8OA 1PYTD 1OWIA 1YGCH 2IJOB 1P11E 3KGPA 3UWJH 3LH1A 1V2ST 5DGJA 1GL1A 1TQ0B 1TNJA 4LK4A 1Q2WA 1O2QA 3OEED 2JDID 1EB2A 4ZCNA 1TNGA 1C5YB 2H5CA 1L4DA 1VCQA 4FUDA 4KTUA 1GGDC 2P16A 2FXRA 2BDHA 1MU8B 2HRVA 4VGCB 3T29A 1ID5H 2ESTE 7GCHF 2XBWA 1Y59T 1UTPA 2A1DB 1DPOA 1BITA 1CBWB 2XOKD 2ALVA 2ZO3H 2C3SA 4X2WA 3ZZ6A 2ZPQA 3SGBE 1P2NA 1FUJA 1VGCC 1EPTC 2HPPH 3HK3B 1SOZA 4CRBA 5A0AE 1FI8A 4Y0YE 2GZ8A 8KME2 9ESTA 2V3HH 3GOVB 4BNRA 3D23A 3V7TA 3ZZCA 4FUEA 1PPGE 2AYWA 2FYRA 1V2WT 1O2RA 2LP6A 2TRMA 4YM9A 2STAE 1GDQA 1TGNA 1GHZA 3PYHA 2ODQA 3T5FH 4A1VA 1C4V2 3DD2H 5PTPA 2VB0A 5EPYA 1GDNA 2P93A 1HAPH 1OWJA 2SGAA 4YT6H 1C2IA 2GT7A 3SGQE 1GPZA 3RXLA 1KLIH 1O2GH 1GBCA 1EP6A 1F2SE 1BMFD 4NIYA 5T3HA 1J16A 1O3EA 2KCOA 3RMMH 1XVMA 1ZSKA 1ELBA 3UREA 5AFYH 1V3XA 1EAXA 2J92A 5LPFA 1AZZA 2Q6DA 2LPRA 1GVZA 2CN0H 1HGTH 3CENA 1Y3VA 3GISB 1ZPBA 4Y11E 3M7UA 3NKKA 4CHAC 3ATWA 4NA7A 1S85A 3BEFB 3SJKA 1FAKH 1V2KT 3DFLA 3L6PA 1SGDE 2BQWB 3K9XB 2O8MA 2Y5GA 2QXIA 2GZ9A 3NUMA 2ZECA 2M2AA 5C67A 1KXEA 1W7XH 1W0JD 1J15A 2O9QA 1SGYE 5FBEA 3SV8A 2PKAB 4D7FA 2C90B 4CBOA 4Q4LA 3SO3A 1IQIA 1P04A 4Y79A 2JETC 1SHYA 3TU7H 4Y6DA 5F8ZA 1HAZB 3SV2H 1O30A 2FWWA 1O2UA 1BTUA 3E6PH 4AYYB 1S81A 1OHHD 3LONA 1QRXA 3SUDA 2BY6X 2BY9X 4CH2B 1ANCA 1SGTA 4WVPE 3O8RA 1DS2E 1TPOA 3GY3A 1TOCB 2A2XH 2KFWA 3ZZ4A 1FZZA 1SGEE 3GYMA 2WV5A 1DFPA 2SNWA 1C5OH 2J5UA 1C5TA 4I33A 8GCHG 3RU4D 1B0EA 3RXTA 3PTBA 1ETRH 2BD3A 3I77A 1A46H 4J1YA 3ATKA 2PLXA 4ABIA 4THNH 1H9IE 1CVWH 1C2HA 1ZHMA 4ZHMU 5DP4A 1Z6JH 2K0QA 2R3YA 4FUBA 1P2IA 2KZ4A 1OS8A 5CHAC 2JH6D 6ESTA 3O8BA 1SOTA 1EXFA 2PHBA 4GCHF 3A7YA 1CHOF 1LQDB 1T8OA 1LQEA 2GVFA 4PROA 1DDJA 1O3HA 3CS7A 5E2OA 3TJUA 1FV9A 2ZDLA 2I6QA 1H8IH 3A7TA 2P3TB 1WTHD 1MCVA 5GXPA 2A4RA 3KHVA 2WPHS 2CF8H 1P06A 4B1TA 4UDWH 2ZG0H 1Z8JB 2QN5T 1GBKA 1XUGA 3VXEH 2ZU5A 2A4QA 3RLYH 3F9HA 3AK5A 1WSSH 1KXAA 1YCPM 1CGJE 3U69H 3HGPA 1F0UA 1AWHB 4CRAA 3ZZ7A 3MYWA 4GUXA 2P8OC 3QUMP 4XBBA 1WUNH 4AOQA 2UUJB 2NU0E 2FEQH 1O3JA 1XUHA 4R0IA 3RXEA 3AVZA 1A5IA 3R0FA 4ISHH 2FOFA 2GD4B 1KLTA 1ZPZA 1T7CA 2ZDVH 1AGJA 1K1PA 1O3LA 1F7ZA 2VWMA 2WINI 4YESB 8GCHF 1NS3A 5AFZH 1O2ZA 1BBRE 2ANMH 1A7SA 1FY3A 2FTMA 2Y80A 1HUTH 2BY8X 4KTCA 1RXPA 2ZI2H 3WWFA 2QXGA 3N99A 1YF4A 3EE0B 1W14U 1TPAE 3ZIAD 2G4TA 3TK6A 4UFFH 3GICB 1C5ZB 1GBAA 1MD7A 4JZEH 1NO9H 2V3OH 1LKBA 2XW9A 5EIYA 1BT7A 2ZHFH 4OS2A 1JWTA 1FY5A 2EY4C 2W26A 1C5PA 5C17A 1KTSB 2ZFTA 3MNCA 2BD4A 1RD3B 1QJ1B 4X1RU 1EAUA 3Q3XA 4IC5A 2BD7A 2M5TA 1VCPA 4RT1A 5TCCA 1SL3A 2K8IA 3S9CA 1SLXB 8ESTE 5L6NH 2VGCC 4WJG2 2FOCA 3EA7A 1GMCF 3G01A 1QBVH 1EZUC 1HXFH 4TWWA 4K5ZA 4MNYA 1TBRH 5GCHF 4B74A 4INLA 1TONA 1EUFA 4ABHA 1YPHE 3S7KB 2PR3A 2OBQA 2BMGB 3PO1C 4K3JA 1SBWA 3A88A 3ZVGA 4MNXA 2OC1A 4IBLH 3O8CA 1GBEA 2BDAA 2BQ6B 3P8GA 4QT8C 5HM9A 5EQSA 2H6MA 1C1TA 4P02A 1J8AA 4WXIA 3ATMA 3ZVFA 2IN2A 2SGPE 2Z9GA 1RS0A 2GV7A 4OS6A 1P2JA 1J14A 1C2DA 3OY6U 1QHRB 3BG4C 4Y8XA 2BVXH 2WSSD 5T6FA 1P2KA 1DWCH 1YPKH 1O2OA 1K22H 1AFQC 1PPHE 3UQOA 3MNSA 2QIQA 5FXLA 3B8JA 2V6NA 4CRDA 1GG6B 2BXUH 1EATA 1AFEH 1YM0A 3VGCC 2P3UB 4VGCC 1C1RA 1P10A 1UHBA 1YWUA 4B6FA 3S9AA 3ATIA 3VB7A 1KMHB 2QYIA 2IPQX 2ANYA 1MKWH 2ZTYA 1C1QA 1THRH 1TIOA 1C5XB 2J34A 1TYNA 4K8BA 5K0HA 2OTVA 4UEHH 3EYDA 1LVMA 2FTLE 4ABAA 1T31A 4WH8A 4BTUB 2OCVB 3RMNH 4AGJA 2UUKB 2ZZUH 1F5RA 2BOKA 5B6LA 4TYDA 2PP6A 3HKIB 4WMDA 4ABEA 4BXSA 2KCAA 1V2NT 1QB9A 3BEUA 2R9PA 3M3SA 1EZXC 1EP5A 1SFQB 4B75A 4OGXA 1CA0B 2XRCA 1KSNA 1RFNA 4BXWA 5A0BA 1RTLA 1DXWA 1H9HE 4RI0A 1HAOH 1H1BA 1H9LB 3M61U 1BMNH 1BRUP 1XX9A 2KR7A 1TX6A 4AC9A 1W11U 2KCPA 4RN6A 4BAOB 1GJDB 3OY5U 4DJZB 1TNIA 2ALPA 3LC5A 2AEIH 1V2UT 3MU0A 1SVPA 2ZA5A 3VFEA 5JBBS 5FAHA 1GMDF 1T8LA 3OSYA 1O2HA 2EI8A 3SGAE 1GBTA 4B2AA 2CXVA 2O8WA 1O5FH 3VB3A 3KQBA 3RXBA 1BTWA 3RMOH 3KN2A 3OYPA 2CK3D 4ABBA 4DW2U 1SQOA 1UVTH 1EPTA 4Z1MD 2W5EA 3KYGA 1N8OB 2RCEA 2GX4A 3GY2A 1ANEA 2F3CE 5FPTA 2Z9JA 5A0CA 3V13A 4HFPB 1A1RA 2VIDA 3FAOA 3ZZ9A 3DUXH 1A0HB 2J98A 3MU4A 4X6NA 3ZZDA 3UPEA 4A1TA 2L74A 1LPKB 1UTNA 1GJAB 1EX3A 1ZMJA 4HGCA 2O8TA 4ZROA 1ELTA 2AGIX 2ZFSA 1OWKA 4MPVA 3FN8A 1MBQA 1OYTH 1MKWK 1YPGH 3NK8A 3ZVDA 1ELGA 3T2NA 3U1JB 2H1UA 1GHXH 3A86A 1Z71A 1TWXB 2IJD1 2XTTB 4AZ2B 4AB8A 4A92A 1Y3WA 1A61H 5I25A 1YLCA 1D9IA 1AKSA 4WY3A 1XXFA 3SV6A 4IMQA 2F9NA 1HAVB 3ZV8A 5C20A 2A5KA 2PKSC 1ZJDA 3MU1A 2A31A 1Y8TA 1E34B 2OQ5A 1Z1IA 2QA9E 1PQAA 1V2TT 1MAXA 1XUJA 5EJZA 2J2UA 4RSPA 2AMQA 4E05H 1L0ZA 1NRSH 2JJ1D 2FIRH 1RJXB 1VITH 5DG6A 2BY7X 2FDAA 3F68H 4I8JA 1IQKA 2ODYB 2PW8H 2ZFQH 2L6OA 1TAWA 1KXFA 4AG2A 4ACBA 3WW7A 3UFAA 3FZZA 1ZGIA 2H9HA 2ZP0H 5EODA 3UQVA 3CNRA 1NROH 2FM2A 3OFND 1CT4E 2OC7A 1COWD 2BLOA 3NXPA 3KYFA 3FP8E 1GI5A 3HATH 2XNIA 2WYJA 1Z7KA 1ZSJA 1BJVA 2GTBA 3RXOA 1EAWA 1EOJA 3MU5A 2BD8A 3VB5A 1MD8A 3WWBA 1DSUA 3GCOA 1V2PT 5GIBA 2ZQ1A 5DP3A 3GCHC 1K1LA 3BTDE 3F0OA 4K8YA 2HNTC 2G8TA 2YNAA 4JYUH 1PQ7A 3T27A 4X2XA 1GCDA 1UTOA 3Q00A 1FX0B 1SQAA 1ORFA 3NCLA 3GDSA 1SHHB 4OGYA 3SUFA 4KP0A 2XC4A 2WV4A 3QWCH 1GHAG 3HK6B 1P57B 3OE7D 2Z94A 2BX4A 2V35A 4AFQA 3GS9A 4H6SB 2YMSC 3PRBA 1G3CA 5C1XA 3RU4E 3MTYA 3M3TA 2GMTB 2TIOA 3EGKH 5A8ZA 2QCYA 3K65B 1ZTKA 2BZ6H 1GBBA 2VVUA 1O2XA 1FQ3A 1K21H 2A7CA 3LGUA 3PRDA 4O03A 7GCHG 1IQJA 2IOTA 2XWBI 2Y5HA 4KELA 1AVGH 1O2LA 3F1SB 1O38A 3M35A 1FONA 4GPGA 2KM0A 3DSOA 1IQFA 1LHDH 3TH4H 4D8NA 1LKAA 3E1XB 3Q77A 1EQ9A 4RT0A 3P6ZB 2OXSA 1RIWC 1XXDA 3RXCA 1P3EA 5F03A 5HXFA 3OAAD 1GHWH 1GWAA 2ODPA 1NPMA 3SZNA 1CU1A 3E90B 6LPRA 4U30A 4ZHAA 3EE7A 2WYGA 3S69A 4DGJA 1CSOE 1XKBC 2BDCA 2R0LA 4OS7A 4BAKB 2AIQA 2ZU3A 2G52A 4X1QU 4ASUD 1QNJA 1GHAF 1GJ5H 3T28A 3MOCA 3ZZAA 2F9OA 2ZF0H 1P03A 3UY9A 3SYJA 1N6YA 4Q7XA 4OS1A 4NCYA 3SI4H 3QDZB 5E0HA 3DSGA 2RFKC 1IHSH 2BVSH 5ETXA 4NA8A 1VZQH 5JBCS 2FS9A 4AORA 1BDAA 3MU8A 4M7GA 1GVKB 1CT2E 4GHTA 3E0PB 3SHCH 5C5OA 2BM2A 1O0DH 1NU7B 1SSXA 2WPJS 1C9TA 1DICA 4HTCH 3OTJE 3TVJB 1AY6H 5EU8A 2Y7XA 1HIAA 3U8OH 1ZSLA 1HNEE 1TRMA 1NZQH 4BTTB 4UFDH 1GI6A 1O2SA 2AMDA 3SNEA 1X7AC 1ZJKA 3V0XA 1MTNB 1V2OT 3CS0A 3U98H 4M9FA 1SI5H 1YC0A 2CMYA 1JMOH 1MAYA 1KY9A 4DOQA 3L3TA 2PUXB 1K1OA 1A2CH 2H9TH 3TJNA 1D3PB 1TNHA 2B9LA 2PWXA 2ZHQH 5DP8A 3UUZA 1D3QB 3S7HB 3RDZA 3BTFE 1ESBA 1O2YA 4Q7YA 2P3FH 1EZSC 1DUEA 4B6EA 1ANBA 3KCGH 4X1PU 4X1NU 1NY22 1C2FA 4YOGA 2NU2E 1ZMLA 2ZHEH 3QTVH 3ZVBA 2VH0A 4NZLA 2EA3A 1ZTLA 1YPLH 2CF9H 1S0QA 5C0UA 2NWNA 3LKWA 4IMZA 3I29A 3B9FH 1QZ8A 1G37A 5J4SA 1G30B 1MQ5A 3HGNA 3A8DA 1C1NA 1WTGH 1FY1A 4MTBA 1JIRA 1W2KH 1EJAA 4KTSA 5BRRE 1OOKB 3JZ1B 3ATLA 3RXDA 1ELCA 2DE9A 1O5DH 5F6MA 2V3MA 3LT3A 1ZRBA 3U1IB 6GCHG 1QA0A 2GCHG 1GI2A 3KEEA 5FHTA 1AI8H 2K1QA 1AQ7A 1PPBH 1W3CA 4GCHG 2PV9B 1CHOG 4I8LA 2ZHWH 1GI9B 3QZRA 2VIOA 4BTIB 3LGVA 1K1JA 2BB4A 4K1SA 2C93B 5JBTA 5F8TA 1SR5C 2HNTE 3GY8A 1TQ7B 3LGYA 3Q76A 1OWHA 1C5MD 1MZDA 1TGSZ 3BTME 1HAHH 4CRCA 1GJ7B 3FP6E 1TOMH 1AUJA 2J95A 1FIWA 2OINA 5HM2A 2QF3A 3ZYDA 2W6JD 1AB9C 3TGKE 5GNDA 1HJAC 2UWOA 1O31A 1L1NA 1Y5BT 2SGFE 3LJJA 3SU2A 1ELFA 1SGCA 1RTKA 3OU0A 4JYVH 1IAUA 1JOUB 2A2QH 1KDQB 3OEHD 2BDYA 3PLBA 2D26C 5GWZA 1WOFA 1FPCH 3UR9A 1A5HA 1BHXF 3AW1A 1AD8H 7KMEH 3V12A 2VU8E 3M5LA 2ILNA 2GCTB 5FCRA 5T1VA 6CHAB 1D3TB 2ZFRH 3SU3A 4CR9A 1C1SA 4HG6A 1LHEH 3W1EA 2ZGCA 5C1YA 2F43B 1LDTT 5F53A 2RDLA 6GCHF 1QL7A 1YP9A 4TY6A 1MTUA 2GCHF 1C5VA 1L2EA 1TLDA 3D49H 1BTXA 4Z0KA 2WUBA 3P92A 3F9GA 1F0RA 2HLDD 2KAIB 1HCGA 4NG9H 3EDXB 3I78A 1QBOA 5CHBA 2BX3A 1LVOA 2ZCHP 5ABWA 3RXHA 1Y5AT 3F9EA 3N7OA 1O3IA 1HDTH 2G5VA 2PTNA 3A7VA 4GSOA 5DP7A 5F8XA 4B2BA 1DM4B 1GMCG 1A5GH 2J38A 4X8TH 2PKAA 1FMGA 1UTJA 1HV7A 1CQQA 1YPEH 2DE8A 1QTFA 1BRCE 2AHME 5GCHG 1A3EH 4OM9A 4TSFD 3QK1A 1GHYH 2Z3CA 1ELVA 4Y7BA 2FLBH 4ZKRU 2FX6A 1QJ7B 4Y8YA 1QR3E 3CP7A 4O3TA 1C1VH 1XUFA 2Z9IA 3DCLA 4WWYA 1PPCE 2F4LA 1ARCA 1C1OA 1SB1H 1JRTA 1TBZH 1GBLA 4E7RG 2EEKA 1NRQH 1C2GA 2ZKSA 3A85A 3FVFB 3E0NB 3K6YA 4Y7AA 4DIHH 1C4Y2 3URDA 1SMFE 5JBAS 1S6LA 1EOLA 1V2JT 2KCYA 2TGPZ 2VIQA 2F83A 4LZ1H 4AX9H 3U9AH 2P59A 4B2CA 2JH0D 3AAVA 4FUHA 4O97A 1WYKA 3H7OA 3RXQA 1ZOMA 2FODA 3MO6A 2Y6TA 2QAAA 1QURH 2GMTC 1W0KD 1TMUH 1UVSH 5EOKA 1F5LA 4I8KA 1GCTB 4X1SU 3IWMA 1XKAC 3OX7U 4JK5A 2HNTF 3SU1A 4A7IB 2UWPA 4DCDA 3UNRA 1QRZA 2Z3EA 5LPEA 4Y0ZE 5DK1A 2Y81A 2YOLA 3VB6A 1K1NA 4TPYA 1FPHH 2QY0B 5H4IB 3U8TH 1UHBB 1OP2A 1THPB 1S6FA 5L2ZH 1OP0A 1OWDA 1QBNA 1ZLRA 3P8FA 3VB4A 1QA7A 5DKMA 1LPZB 1WQVH 3F2FA 5L2YH 1YCPH 4A5TS 4Q2KA 5A8XA 1GI0A 4I86A 3PMBB 1C1UH 2CHAC 5AVDA 2B8OH 2XCFA 4WMFA 3PM3A 1HAYB 4CRFA 1UJ1A 1IOEA 1VITG 2WPIS 1FN8A 3C27B 3MH5A 3PWCA 3RXVA 1DXPA 1WU1A 4NFEA 1SGPE 5DP6A 1C2JA 1GVLA 3SNCA 3SU4A 2V0BA 2UUFB 4AFZA 2PSXA 3UNQA 4A6LA 3FFGA 4BAHB 4CR5A 1C1WH 4H4FA 1MU6B 1YPMH 3BTTE 5C0TA 4YZUA 3URCA 3T62A 3TJOA 1GMDG 1O3GA 1NFXA 1GBJA 5IK2D 1MKXH 1O5GH 3EA8A 5TCAA 1DWEH 3ODDA 1MMJN 1O3KA 4IGDA 1VJAU 1BMMH 1S6HA 1CBWC 5E0GA 4YTAA 3RXIA 4ABJA 3BTGE 4JZ1A 4AGKA 1IQNA 2C4FH 4ACAA 1ELDE 1VJ9U 2Z3DA 2QV1A 1ZHPA 3A82A 4IN1A 2QGRA 1MABB 3TH3H 2J94A 3BSQA 5KEDA 2W7UA 4TWYA 1VGCB 1P3CA 2YMSD 2JIZD 4E7NA 2OK5A 2VNTA 5FPYA 4H6TA 2V7QD 1GI7B 3F0PA 1GMHG 1TMBH 2HWLB 4NWKA 8LPRA 1H8ED 3A8AA 2ZU2A 2P95A 3PV5A 1NN6A 2C8YB 3ZV9A 1ABJH 2A45B 1C9PA 1VITF 4DY7B 1O36A 2J98B 1NRPH 2G5NA 4IS5A 5C2ZA 4X0WU 4D9QA 1QB1A 1SLUB 2BLVA 1FIZA 1QB6A 2ZDKA 1SGNE 1GJBB 2RG3A 1BA8B 3R3GB 1HB0B 3T26A 2FPZA 4Y8ZA 3BTEE 1FXYA 5FPSA 3RU4T 1SFIA 1QQUA 3NRLA 3NPSA 1V2VT 1EAIA 1BUIA 1YCPK 5DPAA 2H5DA 3M5OA 3P17H 5FL7D 5T6DA 2A32A 3TNSA 1WBGB 2VJ1A 5AHGH 1Y3UA 1Z8GA 2TGDA 1JIMA 1O5CB 1OPHB 1TGBA 1E1RD 4SGBE 3QZQA 1SQTA 1GBHA 1BCUH 3E91A 4NIXA 1UVOA 3P70B 1SLVB 4I32A 3GY6A 4OS4A 2GDEH 1HFDA 5A2MH 2GP9B 3S9BA 1PPZA 3F2GA 3SV9A 3KF2A 1KLJH 2D8WA 1GMHF 1A4WH 4MVNA 4DG4A 1YKTA 3PB1E 3A7WA 5HYOA 2VIWA 2F9VA 3PMAB 3VEQB 1MKXK 2ZNKH 1BB0B 1P2MA 3TH2H 4R8TB 3T25A 3E16B 3SU5A 2W3KA 5HIZA 4FU8A
chains in the Genus database with same CATH topology
1G3BA 2EI6A 3PMHB 1O35A 1O34A 4DVAU 1P05A 1HAGE 1UCYH 5GJ4B 4WXVA 3GCNA 3RM2H 1MTVA 3UOUA 4ABGA 1MBMA 4AFUA 3SJ8A 2ZCLP 1O2VA 1QIXB 4MPUA 2C8WB 3SUGA 3ESTA 3D62A 3E3TA 6CHAC 2XWAA 1H8DH 3E8LA 2PSYA 3HKJB 2SGQE 3RUOA 4FUCA 4FU7A 5T6GA 1GI3A 2J9NA 1M9UA 3KQEA 1G2LA 2BD5A 3H5CB 5CHAB 1GHBF 1TPSA 1TB6H 4I7YH 4MG3A 4UFEH 2RA3A 1O33A 4AYVB 4GVUA 4B76A 2AGGX 1D6WA 1BQYA 1HAIH 3MFJA 1HBTH 1TX8A 2ZDMA 2ZFFH 2ZWLH 1BMLA 4I31A 4DT7B 2ZC9H 5EGMA 1V2MT 3LGTA 1D3DB 4GLYA 1BMAA 1O2NA 1H4WA 1IQHA 4NZQA 3QGNB 3D65E 5DO4H 2G55A 4UE7H 1TABE 1G9IE 3A84A 3DA9B 1C5QA 2VH6A 4WF8A 3M5MA 4JZDH 1HYLA 4UONA 3LGIA 1FAXA 3RM0H 4INHA 1TRYA 2FOMB 1XUIA 3BV9B 1QJ6B 2ZGHA 2TGAA 1TBQH 2BQ7B 1FN6A 1O3PB 3EQ0H 4X2VA 5E0JA 3P8NA 3MH7A 2ZEBA 1UTQA 1BTZA 4NIWA 3KL6A 4NIVA 1YYY1 1HAVA 2G51A 1AZ8A 1JBUH 1C2MA 2PUQH 2ZQ2A 3S0NA 3RXMA 1PJPA 2O8UA 1TFXA 1LHFH 5B6OA 1L1GA 2HVXA 4Z6AH 5EXLA 5JB8S 1TMTH 4ZUHA 1HLTH 1Z8RA 4ZXXH 3TK5A 1GBIA 3BIUH 1G32B 4XFQA 1UCYK 3A8BA 5IYTA 1Y3XA 3B23B 1AHTH 1O3AA 3LPRA 4WMEA 1NRRH 2UWLA 1BRBE 3MH4A 2BVRH 1BOQA 2QF0A 2VGCB 3ZYEA 1O3OA 2Q6GA 5JPMH 2FYQA 1O32A 4ZKOU 3U8RH 4LZ4B 3M7QA 4K1TA 5BPEA 3UR6A 3WY8A 1S84A 1B5GH 4I8GA 4FVBA 1DLKB 4Q7ZA 4ZKNU 1A0JA 1W13U 3Q3KA 2SNVA 1BBRK 1TPPA 4JMYA 3ELAH 5JYIA 2H9EH 2BD2A 4MNWA 1MCTA 2CGAA 2Q1JA 1PPFE 3TITA 2AFQB 1DSTA 1RGQA 5EW1H 4ZHLU 1S0RA 3QLPH 2VVVA 3Q3YA 1J17T 2FOEA 1P12E 3BG4B 4JZFH 2WPLS 4ZAEA 1AFQB 2A5IA 1GG6C 2FESH 5FCKA 1DY8A 1XVOA 1ZMNA 1ESTA 2H2ZA 4ISNA 4D76A 4AB9A 2OP9A 4JK6A 5EG4A 1LHGH 2VINA 1QL9A 2THFB 3VGCB 3STIA 1GJCB 1P8VC 5EQRA 3SW2B 3RXRA 1FLEE 2O8LA 2SGDE 1AO5A 2I6SA 4DURA 2BY5X 1SLWB 3ZVAA 1E37B 4NFFA 3SNAA 1GDUA 4YO9A 4SGAE 2VIPA 4YT7H 4X6PA 1V2LT 3GCTF 4Y10E 3LGWA 2Z7FE 3SNBA 1BIOA 1L1JA 4B73A 1OX1A 4F49A 4IC6A 1CT0E 7ESTE 1AMHA 1C5WB 1CA0C 3BG8A 2XYAA 1GJ8B 4ISOA 4WH6A 3UNSA 2FX4A 2W3IA 4BAMB 1HAXB 3QN7A 1T32A 1ZTJA 1C5UA 4YOJA 1C5SA 1NTPA 1JXPA 1UK3A 1AUTC 1JRSA 1FY4A 3GY5A 2Y7ZA 3VXFH 1NC6A 1C2LA 2PFEA 1YPHC 1NESE 3DHKH 2XBXA 4ZMAH 4AG1A 3NZIA 1QQ4A 1SGFA 4INKA 2YNBA 3M37A 1DOJA 5E8EH 2B5TB 2BDBA 1QFKH 5FX5A 1DT2A 3TPIZ 1O2TA 2ZFPH 3LH3A 3SJ9A 1UK4A 1WQSA 1K1IA 1O3CA 2GV6A 5JDUB 3RXSA 5EXMA 1BTYA 1TGCA 1AVXA 3GYLB 3SNDA 1ELEE 2ZDNA 5A8YA 1N8OC 1GBDA 1QCPA 3M36A 3SQEE 1O2PA 3RLWH 2GGVB 1K28D 4UD9H 2A5AA 1C2EA 2ZIQH 3ZVCA 2Q6FA 4KGAA 1BHXB 4TY7A 2WPKS 2A0QB 3BTHE 1W7GH 1UVPA 1W10U 1LTOA 3KNXA 1IQLA 1P2QA 1PPEE 2IPHA 1BTHH 3IG6B 1UMAH 2ZDAH 4NSYA 3RXKA 1HRTH 2BOHB 1W0YH 2GDDA 3A80A 5A09A 1FDPA 3P95A 1Y3YA 1OYQA 2BDGA 4MLFB 4ASHA 5EQQA 2HGTH 2GZ7A 1PQ5A 1SC8U 2OC0A 2Z6BD 1ZYOA 1IHTH 2FOBA 3KIDU 1LPGB 1NRNH 3BIVH 4ESTE 4UFGH 1YBWA 5HGGA 1NFUA 4K69A 2ZCKP 1DWBH 1UO6A 2PKSB 4MQAA 1O5BB 1AIXH 2FI3E 1SG8B 1W0ZU 1Y5UT 4XBDA 4BANB 4TPIZ 1EKBB 3MNBA 3RC5A 3LC3A 1ARBA 1NFYA 1O2WA 1F5KU 4YLQH 3MWIU 5EXNA 2OQUA 1B0FA 2HALA 3FZDA 4FUGA 1MQ6A 1HXEH 1AWFH 5CMXH 1C4U2 1OWEA 1PYTC 1GI4A 1XM1A 2R2MB 4LOYH 3SV7A 5FX6A 1DX5M 3ZVEA 1INCA 3PV4A 1HPGA 1UCYE 2B7DH 2NU4E 2VWOA 1KIGH 3MHWU 5ESBA 4ZKSU 2EC9H 3LOXA 1BZXE 1C1MA 1QRWA 3PTNA 1GI8B 2AERH 5ESTE 1VR1H 3MNXA 4JCNA 2AIPA 2VVCA 2AH4X 1ABIH 1QL8A 1ESAA 1EB1H 1N6XA 1KDQA 1TX7A 3SOSA 1S83A 1CGHA 1D6RA 3GCHB 4FU9A 2C8ZB 1O3FA 1G36A 3GDUA 1UVUH 2XC0A 3M3VA 2R0KA 4O9VA 1CHGA 2F9BH 3M5NA 1NFWA 1Z6EA 1ACBE 2CJIA 3FP7E 2ZTXA 2A4GA 2BLQA 3SI3H 2F9UA 1GJ9B 3SUEA 1P9SA 2DUCA 1GHVH 4FUJA 4HI3A 1DVAH 1F0SA 1LHCH 1LMWB 3GDVA 1FY8E 3SN8A 1W12U 3A7ZA 2ANKH 4ISLA 1K9OE 2KAIA 4J2YB 3F9FA 4X8VH 5GPIB 1O3MA 2P94A 2ULLA 3TGIE 4ABDA 1O39A 1LVBA 1SGRE 2BLWA 2HOBA 1TA6A 3UTUH 1A3BH 1C5RA 3BTWE 1GJ6A 1O2KA 1O5EH 4JZIA 4CREA 2G00A 3SHAH 1LCYA 2R3UA 1O2JA 1DANH 1YPJH 1Z8IB 2XXLA 1T4UH 3MI4A 3BTQE 4FUFA 2VWLA 1RIWB 1KTTB 1F0TA 5E2PA 1QGFA 1O2IA 3A87A 4MDSA 1KYNA 3A81A 2ZU4A 5TJXA 3QX5H 5DJ7A 3SBKA 1WV7H 4K1EA 3RMLH 2FOHA 1ZZZA 4K2YA 4ABFA 1PFXC 4A1XA 4IW4E 1AE5A 1ZPCA 2FOAA 2SFAA 3TLOA 2FS8A 1LO6A 2FO9A 2FLRH 3JZ2B 2QC2A 1KXBA 2A7JA 4XOJA 1OP8A 3L33A 2FOGA 1T8MA 1P9UA 2FI5E 2FMJA 2OLGA 1O5AB 2G4UA 1ANDA 1HJ9A 3K6ZA 2F9PA 1XUKA 4FXGH 4BOHA 1GGDB 2Y82A 3UOPA 1UTMA 3GY4A 1P02A 2ZGXH 2STBE 1V6DA 5CE1A 2WPMS 5LPRA 1IQEA 1C5NH 1G3EA 3RXJA 2ASUB 1THSH 1G3DA 1EJNA 2HPQH 1ELAA 3BEIB 2ZHDA 4RKOB 2OUAA 3QGJA 1SGIB 1MTNC 1OKXA 1EPTB 1TNKA 1UTLM 4GHQA 5I46H 3A8CA 1GBMA 3AW0A 4XSKU 3O8DA 1N1LA 2QXJA 5GDSH 5C5NA 1ETTH 3C1KA 5EPNA 1NU9A 1P2OA 3RXUA 3H7TA 1HJ8A 3ZZ3A 4X6MA 4AN7A 2BD9A 1C2KA 2VWNA 2B0FA 1LVYA 4X2YA 2TPIZ 2G81E 4JYTA 4B71A 3AASA 3K2UA 4U2WA 3ZZBA 4AFSA 1QY6A 4HZHA 2ZGJA 1AKSB 1DY9A 1Q3XA 2Y5FA 1DWDH 4NGAH 1MH0A 4F4OC 5C3NA 3RC4A 2PTCE 1T4VH 3MH6A 1A0LA 5IDKA 3PLPA 4KKDA 1MTWA 1K2I1 5HMAA 3ENSB 2D2DA 1TGTA 1O3BA 1V2QT 2OBOA 3NWUA 4O3UA 3SQHE 1V2RT 1E36B 3FANA 1O3NA 1GHBG 9LPRA 4CHAB 1E0FD 2D1JA 2ZTZA 3W95A 1O2MA 2A4OA 4YOIA 3ODFA 3DFJA 1AVWA 3ITIA 4K60A 1C5LH 2BTCE 3RXGA 5L30H 1CO7E 1S82A 1KXDA 2OD3B 1OSSA 4MPWA 4NA9H 5SGAE 2FZZA 4ZXYH 1KXCA 3PMJA 2VIVA 3TNTA 3VPKA 1GBFA 1DLEA 2JETB 3SORA 3MO9A 1BRAA 2BXTH 2HLCA 2ZU1A 4I8HA 2OC8A 1AU8A 4X8SH 3KQDA 3ZZ5A 4X6OA 7LPRA 3TK9A 3SU0A 3PWBA 4NWLA 1AB9B 1VCWA 2NU3E 1AN1E 1HJAB 1MTSA 2FI4E 2JH5D 1CGIE 1TA2A 2BHGA 4Y71A 2AS9A 4XE4A 2Z9LA 3ZZ8A 1FJSA 1GJ4H 5LGOA 5JB9S 1EZQA 1F92A 3RXFA 2GCTC 5C1UA 1DE7H 1AE8H 2C8XB 4XDEA 2XC5A 3EA9A 1O3DA 1SGQE 4NSVA 3STJA 1DITH 2AMPA 1K1MA 1TALA 2UUYA 3TIUA 5J4QA 5K7RA 2AGEX 1NT1A 5DP5A 2BDIA 3BF6H 4Y76A 1RTFB 4MNVA 1FNIA 2NU1E 4CBNA 3SJOA 2BYAX 1IQGA 1CA8B 1BBRH 3AAUA 3TGJE 2ANWA 3QO6A 3TJVA 2ZPSA 3LU9B 1T8NA 3A83A 4CH8B 2BZAA 1WAYB 1MZAA 1UK2A 1GL0E 2FP7B 5FBIA 2TBSA 3MO3A 2TGTA 2PGBB 1RRKA 4YLUA 2RA0A 1ETSH 2WUCA 2XCNA 3LIWA 3SJIA 2Z9KA 5DP9A 2P8OB 4ISIH 4D7GA 3KQCA 3MMGA 1B7XB 1Q31A 1TNLA 3RXAA 1CE5A 3W94A 1YLDA 4LXBH 4Q80A 3HPTB 3F6UH 3LJOA 2CV3A 5EW2H 1GI1A 4XBCA 4GAWA 1BTPA 3BTKE 2GKVE 4H42U 3A89A 1J9CH 1SPJA 4FUIA 4U32A 1ZRKA 5AF9H 3V3MA 1TE0A 2F91A 1D4PB 1S5SA 1MUEB 1P09A 1TRNA 2SGEE 4X8UH 4CRGA 1P0SH 3PROA 1O37A 1GCTC 1G2MA 4IN2A 1NM6A 1XMNB 3RP2A 3IITA 3EAJA 1P01A 4E06H 3LDXH 4ZH8A 2ZPRA 3M7TA 4MPXA 1EASA 2ZGBH 1HIAB 1ZHRA 3PLKA 2XBYA 4D9RA 1W8BH 4BAQB 3BN9A 2QXHA 1C1PA 1Z1JA 3RC6A 3A7XA 4DIIH 1UTKA 2GT8A 3SU6A 2A7HA 2XBVA 2R2WU 3GCTG 2LNCA 3DT0H 2J4IA 5G4BA 3GY7A 1BJUA 5LH8A 1PQ8A 1WCZA 1ZGVA 3PO1B 1EJMA 1SGFG 3RXPA 3QTOH 1ZR0A 1IQMA 3UIRA 2W7SA 1E38B 2JKHA 4FVDA 2EI7A 1U6QA 4U01A 1OXGA 3UWIA 4RKJB 2CHAB 1DUAA 2PGQB 4OS5A 1E35B 1L4ZA 3P8OA 1PYTD 1OWIA 1YGCH 2IJOB 1P11E 3KGPA 3UWJH 3LH1A 1V2ST 5DGJA 1GL1A 1TQ0B 1TNJA 4LK4A 1Q2WA 1O2QA 1EB2A 1TNGA 1C5YB 2H5CA 1L4DA 1VCQA 4FUDA 4KTUA 1GGDC 2P16A 2FXRA 2BDHA 1MU8B 2HRVA 4VGCB 3T29A 1ID5H 2ESTE 7GCHF 2XBWA 1Y59T 1UTPA 2A1DB 1DPOA 1BITA 1CBWB 2ALVA 2ZO3H 2C3SA 4X2WA 3ZZ6A 2ZPQA 3SGBE 1P2NA 1FUJA 1VGCC 1EPTC 2HPPH 3HK3B 1SOZA 4CRBA 5A0AE 1FI8A 4Y0YE 2GZ8A 8KME2 9ESTA 2V3HH 3GOVB 4BNRA 3D23A 3V7TA 3ZZCA 4FUEA 1PPGE 2AYWA 2FYRA 1V2WT 1O2RA 2TRMA 4YM9A 2STAE 1GDQA 1TGNA 1GHZA 3PYHA 2ODQA 3T5FH 4A1VA 1C4V2 3DD2H 5PTPA 2VB0A 5EPYA 1GDNA 2P93A 1HAPH 1OWJA 2SGAA 4YT6H 1C2IA 2GT7A 3SGQE 1GPZA 3RXLA 1KLIH 1O2GH 1GBCA 1EP6A 1F2SE 4NIYA 5T3HA 1J16A 1O3EA 3RMMH 1XVMA 1ZSKA 1ELBA 3UREA 5AFYH 1V3XA 1EAXA 2J92A 5LPFA 1AZZA 2Q6DA 2LPRA 1GVZA 2CN0H 1HGTH 3CENA 1Y3VA 3GISB 1ZPBA 4Y11E 3M7UA 3NKKA 4CHAC 3ATWA 4NA7A 1S85A 3BEFB 3SJKA 1FAKH 1V2KT 3DFLA 3L6PA 1SGDE 2BQWB 3K9XB 2O8MA 2Y5GA 2QXIA 2GZ9A 3NUMA 2ZECA 5C67A 1KXEA 1W7XH 1J15A 2O9QA 1SGYE 5FBEA 3SV8A 2PKAB 4D7FA 2C90B 4CBOA 3SO3A 1IQIA 1P04A 4Y79A 2JETC 1SHYA 3TU7H 4Y6DA 5F8ZA 1HAZB 3SV2H 1O30A 2FWWA 1O2UA 1BTUA 3E6PH 4AYYB 1S81A 3LONA 1QRXA 3SUDA 2BY6X 2BY9X 4CH2B 1ANCA 1SGTA 4WVPE 3O8RA 1DS2E 1TPOA 3GY3A 1TOCB 2A2XH 3ZZ4A 1FZZA 1SGEE 3GYMA 2WV5A 1DFPA 2SNWA 1C5OH 1C5TA 4I33A 8GCHG 3RU4D 1B0EA 3RXTA 3PTBA 1ETRH 2BD3A 3I77A 1A46H 4J1YA 3ATKA 2PLXA 4ABIA 4THNH 1H9IE 1CVWH 1C2HA 1ZHMA 4ZHMU 5DP4A 1Z6JH 2R3YA 4FUBA 1P2IA 1OS8A 5CHAC