1Z1JA

Crystal structure of sars 3clpro c145a mutant
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the maturation process and inhibitor design of SARS-CoV 3CLpro from the crystal structure of C145A in a product-bound form
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 67
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1z1jA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z1jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z1jA02
4OS5A 3SNEA 1BUIA 4XOJA 3RXQA 3O8CA 3KNXA 1N8OB 1AWFH 1NPMA 1W7GH 4BNRA 1YGCH 1Z8RA 1IHSH 2NU1E 1OOKB 1MD7A 1JRSA 3A85A 3HPTB 3NZIA 1OXGA 1SQTA 4U32A 2F9PA 3BTTE 2FX6A 1GBJA 3ATIA 1C2FA 5G4BA 2BDAA 2AGEX 3A8CA 1EASA 1C1MA 3A80A 1FIWA 2WPKS 5LH8A 4SGBE 2ILNA 1G32B 1C5WB 1HFDA 1T4UH 1VCWA 4ABDA 3SJKA 3MH6A 3TGJE 1F0UA 4YT7H 4OGXA 3LDXH 1B0FA 1SR5C 2QGRA 1SLUB 1XUIA 5AF9H 5GXPA 1NTPA 3JZ2B 2BD9A 4JYUH 3TJVA 2XNIA 1AHTH 3TNSA 3M36A 4BANB 1BHXB 4DIIH 3B23B 3KL6A 3M5MA 3RUOA 1IOEA 1C4V2 3S7KB 1MKXH 1SC8U 4DY7B 1AKSA 2QXGA 1EJNA 1Z6JH 1P02A 4DOQA 1KTTB 2AGIX 2ZDKA 5A8YA 3AAVA 1ZJKA 3EQ0H 1O5DH 1ARBA 2BVSH 4WWYA 1TRMA 5C5OA 2ZTXA 1GJ5H 3MNSA 1VCPA 1T8MA 2VWOA 3ITIA 2Q6DA 3QN7A 1W7XH 2O8UA 1SGFA 1TFXA 2BD5A 2PR3A 1OWJA 1KYNA 1TMUH 3DFJA 3BEFB 4CRGA 1D3QB 1HJAC 2OQ5A 8KME2 1FQ3A 2OUAA 2ZWLH 1DY9A 2FDAA 1O3PB 1Z8IB 1GI1A 1A7SA 1FN8A 2C3SA 4ASHA 1EB1H 1LQDB 2G4UA 1J17T 3SI3H 2BLWA 3M5NA 2CMYA 5ESBA 3CS7A 4DW2U 1VCQA 1TX6A 1QRXA 1BZXE 2QIQA 3PWCA 2Q6FA 2HWLB 2A4RA 1JMOH 2GCTB 1NFWA 2W7SA 1TNKA 2PLXA 4IS5A 1VITH 1GBDA 1P3CA 4XBDA 1V2OT 2ZG0H 5JB9S 1WTHD 2Y82A 3Q3YA 1VJAU 4O3TA 1IQIA 5CHAC 5A8ZA 3MU5A 1O2JA 2BZ6H 3SJ9A 1DPOA 3AVZA 2FP7B 1BJUA 1GPZA 3RC6A 5J4QA 2SGPE 1O36A 1TALA 3RM2H 1V2PT 2UWPA 3U9AH 1EPTA 3SU1A 4H6SB 3T26A 2NU3E 4FUHA 1ZJDA 2CHAC 1O31A 1E37B 3SUDA 2SNWA 2XCFA 3T27A 3UUZA 3ODDA 4AORA 1NO9H 2LIZA 3D62A 1AD8H 1IAUA 1GI5A 1O3FA 3GYMA 1GL1A 1C1QA 1FJSA 2VWNA 3ZVEA 2ZC9H 2PTCE 3RC4A 4IMZA 1MTNB 1NFYA 4D9RA 7KMEH 2ANWA 3P92A 1FMGA 2CJIA 3BTWE 4ABHA 8ESTE 2GV6A 3ZVBA 1KLTA 1GL0E 1YPEH 4JMYA 2WYJA 1TNLA 1CA8B 4XDEA 5FX6A 5F8ZA 1SQOA 2O8WA 4UD9H 4TWYA 3RU4E 1V2LT 1YC0A 2R3UA 4IC5A 1C9TA 4Y8YA 4HFPB 3LH3A 1BBRK 3EYDA 1BJVA 2M5TA 3ATKA 3U98H 3RLWH 2PHBA 5EG4A 1DX5M 1ZTKA 2P16A 5L2YH 3ZZDA 1MTSA 2FLRH 5E0JA 4HZHA 3AASA 5DJ7A 3PLPA 1QA7A 3LT3A 1EPTC 3T62A 3OTJE 1ZSLA 1GMDF 4Q7ZA 5IDKA 3ZVFA 5IYTA 2PWXA 3M61U 1F92A 3QO6A 2Y7ZA 3PROA 1PPBH 2XWBI 1ANEA 3NXPA 5HM9A 4MG3A 2GX4A 3F9HA 1GJAB 4GCHG 1GI8B 1C4U2 4FVBA 3UWIA 1T31A 1LHFH 2QXHA 3A7WA 3A89A 4WF8A 1DSTA 2HVXA 1DXWA 1C5RA 1GBFA 2VH6A 4FU9A 2ZCLP 4Y7AA 1P0SH 4X8VH 4A1VA 1ZOMA 2SGEE 4ABBA 3URDA 1Z8GA 4JZEH 3SUGA 3RMNH 1K1NA 2ZNKH 3VXFH 2TGPZ 1G3BA 1OPHB 5TJXA 1W0ZU 1A0HB 1QGFA 1TNIA 3MU4A 1AIXH 1WSSH 3Q77A 3NWUA 4JK5A 1LPZB 4IC6A 2K1QA 1NS3A 4ABFA 2ZTZA 1O2SA 1JIMA 1W0YH 4ZKRU 1DT2A 1UMAH 1WUNH 5EU8A 1OWHA 5EGMA 4E05H 4JZDH 4A7IB 3T29A 1BMMH 1O3CA 1P3EA 1HAHH 1L1GA 3RU4T 5HYOA 1H8DH 2ZGCA 2ZFPH 3BG4B 4HGCA 1OWDA 4OGYA 3TH3H 1JWTA 2C93B 4A6LA 1OWIA 1A0LA 1CA0C 1S0QA 1FIZA 2D1JA 1BDAA 4QT8C 2B9LA 2BQWB 1GJDB 4JCNA 2YNBA 3BTHE 1C5LH 4IW4E 2P8OB 3BEIB 1C2DA 1K22H 1DY8A 4AFZA 3GY3A 2BDHA 2ODPA 1O2TA 2ZA5A 3RXEA 3OU0A 4UFFH 3EA7A 4AFQA 2FI3E 1QBOA 3PO1C 2PTNA 2GZ9A 1C4Y2 1EP5A 2ZKSA 4JZIA 1AB9B 1CGHA 1G37A 1NZQH 1WAYB 3NK8A 1CGJE 2Y5FA 4YT6H 1AQ7A 2THFB 2FOMB 4NSVA 4Q7YA 1O5CB 1SSXA 1P9SA 1FI8A 1KY9A 4FUJA 4U01A 3HKJB 1BMAA 1YYY1 1GHWH 1QHRB 3M35A 1SOTA 2VU8E 1GHAG 1U6QA 3KQBA 4AFUA 1BTWA 1GHZA 4BTTB 1HAPH 1JXPA 1ETSH 2ZHQH 2H9TH 2IPHA 1GDNA 4GUXA 2A7JA 1YBWA 3H7OA 4BAKB 3DFLA 1TQ7B 2G8TA 1WQSA 1Y3YA 1PPCE 4XBCA 1HAVB 7LPRA 1F2SE 1HPGA 1RS0A 3TH2H 2B5TB 4F4OC 1LTOA 3A88A 1QJ6B 2GKVE 3KCGH 1CE5A 2RDLA 4RSPA 6CHAB 2FESH 4AX9H 2P8OC 2VNTA 3NPSA 3TPIZ 1HIAA 1SGCA 3T2NA 3VB6A 2F9UA 2Y6TA 1IQGA 1CT2E 1UTPA 3RMMH 3OSYA 2Q1JA 1T8NA 4AG1A 3ZZ3A 2G52A 5EPNA 1VZQH 5C1UA 2XBWA 1JIRA 1ESTA 1V2WT 4AOQA 1K21H 1HUTH 1C5ZB 1SGEE 4Y0YE 1UK3A 4R0IA 1TGCA 4Y76A 2F83A 2G51A 5AHGH 1O2HA 3BIVH 1V2ST 1TA6A 1N6YA 2BQ6B 3LGTA 3E6PH 2FYQA 2GGVB 1BTZA 2ZHEH 1G9IE 4A5TS 1P2MA 3MU1A 1ESBA 4UFGH 3M5LA 1KDQB 1TONA 3FP7E 1O2GH 4YZUA 4ZUHA 1HAXB 3RXTA 1JBUH 1V2UT 1D6WA 2F9OA 2ALPA 2FOFA 4INLA 2AIQA 3OX7U 1ZHPA 2VIPA 3OY5U 1ZRKA 4I31A 2XC4A 1BBRE 1EAIA 4NWLA 3D65E 3ZZ6A 1THRH 2AMDA 2ANYA 3B8JA 1TAWA 1A5GH 1P03A 4WMEA 3U1JB 1ACBE 2PGQB 2BMGB 5GWZA 1K1PA 1ESAA 3UQOA 1E36B 5HGGA 2A7CA 1PPFE 1XXFA 3PLBA 1SGQE 2PW8H 3DD2H 4D76A 5TCAA 1UTQA 1GWAA 2XC0A 2ZDMA 1B0EA 4YO9A 1CSOE 1NRPH 3ESTA 2BY5X 2Y80A 3BTME 4AB9A 5JYIA 1V2KT 2CHAB 2C8YB 1O3AA 1D6RA 4K1TA 3K6ZA 3MH4A 2A5KA 5AVDA 4X6OA 1TX7A 1KXFA 1BRCE 1O2WA 3LH1A 3MHWU 4IN2A 4NZQA 1LHDH 4B2AA 1LQEA 3TJOA 1S82A 4BOHA 3Q00A 3MNBA 1QL8A 2Z3DA 1MTUA 3I77A 4MNWA 4CHAC 3BSQA 4UE7H 2BDCA 2OINA 1Y3WA 1FY3A 1CO7E 1WYKA 3QX5H 4MNYA 4E06H 1NU7B 4LOYH 1DSUA 1D9IA 2A1DB 2XYAA 3R3GB 1FAXA 2UWOA 3ATWA 3RXUA 2P94A 1RIWB 2GDDA 2PKAB 3MO9A 4Q2KA 2ZHWH 4VGCC 3LJJA 1BRAA 1P11E 4THNH 2QN5T 3ZZAA 1A5IA 1RXPA 2R2WU 5L2ZH 1P2NA 3BEUA 3SOSA 1A4WH 1Y3VA 3F9FA 2J4IA 4WH6A 3MFJA 1S85A 4VGCB 3A8AA 3RXAA 1O3OA 2BOHB 2EA3A 1YPHE 2XCNA 2TIOA 3GDVA 1GBHA 1W3CA 1FONA 2FODA 1HYLA 5GPIB 1XVOA 1O5FH 2O8LA 1Z1JA 3M7QA 4NSYA 1HRTH 1XMNB 3FVFB 3F6UH 4TWWA 5E0GA 3VB5A 1Q31A 4MLFB 4ZAEA 5E2PA 2QXIA 3SV2H 1AVWA 2EEKA 1QR3E 1EUFA 3URCA 2J2UA 5C5NA 5T6GA 3P6ZB 1TB6H 1SG8B 1OYTH 3ZVDA 5E8EH 1C1SA 1AFQC 3ZZ5A 1SQAA 2Y7XA 2ZFRH 4X8SH 1O2VA 4CRCA 1GG6C 2GZ7A 1NM6A 4OS4A 2Z6BD 4AG2A 1NFUA 1O2UA 1SGPE 5GCHF 1QTFA 1O2YA 3S9AA 5A0AE 2ZZUH 4DT7B 1C5YB 1K2I1 1GBAA 1C1WH 2OQUA 3SNBA 1IHTH 2R2MB 1G3EA 2SGFE 2XRCA 2SGAA 1GGDC 1TE0A 3QLPH 1ELDE 1BTPA 3M3SA 2BX3A 1IQMA 1O0DH 3E90B 4X1SU 4MNVA 1O2RA 1WCZA 1CGIE 1F5LA 1LKAA 2TGTA 2G5VA 2TRMA 3RXFA 4TY6A 1BMNH 1VITG 2KAIB 2VIWA 3UNRA 4Y7BA 2D8WA 1ZPBA 1P9UA 3GY7A 5AFYH 1SOZA 2ZIQH 1GI0A 3MH7A 1DWBH 5FHTA 1W2KH 2VIOA 1C1RA 2H9HA 2IOTA 2STBE 1DXPA 1P8VC 3A8BA 5C67A 1EX3A 3PTNA 2XXLA 2BDBA 1QL9A 3RU4D 1BIOA 3F9EA 1GJ4H 4KTSA 1HLTH 4FU7A 3SJ8A 3ODFA 4X6MA 5C1YA 3QDZB 1AI8H 1GJ6A 4UFEH 5F8TA 1AMHA 4O03A 1AKSB 4FVDA 4WXVA 4NA8A 4ABJA 1ZGIA 2Y81A 1ZZZA 1A2CH 1F0SA 3MNXA 3STIA 1C5XB 1P09A 2EC9H 2GD4B 1ABIH 1O3GA 1YLCA 3SNAA 3ZZ7A 4B2CA 3RMLH 1H1BA 1QQ4A 2ZFQH 4GLYA 4BAMB 1O3IA 5T6DA 3JZ1B 2WPHS 1TGBA 1K1LA 1V2TT 2CF8H 1H9IE 2G5NA 2Z9LA 1KXCA 4ZKOU 2A4OA 1GJ9B 1Z7KA 2ASUB 4I7YH 1OWKA 1XUHA 2BQ7B 1YF4A 5FBIA 2BY7X 1DUEA 4B73A 1LMWB 2QV1A 3SZNA 4ZHLU 2ZU1A 1C5NH 5TCCA 1YPGH 3F9GA 1J15A 2Q6GA 1MTNC 3ENSB 3HGNA 5DP8A 1YCPH 4ZXXH 3KQEA 2OBQA 3K6YA 4F49A 1FY5A 2PSXA 3TJUA 4NZLA 2QC2A 1ZR0A 1VR1H 3UOPA 1ARCA 3RP2A 1FPCH 5EQSA 1TIOA 2BD7A 4DVAU 1OX1A 1KSNA 3P17H 3KQDA 2HRVA 3KF2A 2GCHF 2W5EA 4TPYA 1UVSH 1GI2A 1N1LA 1HIAB 4PROA 3PYHA 1BTUA 2BD8A 2FYRA 1GCTC 3BV9B 3P95A 1ZMLA 1DANH 3UR6A 2BY8X 4FUDA 1NRQH 4BTUB 1SGRE 3I29A 3A7VA 5DP7A 1GBTA 4ZXYH 2WUBA 4JYVH 3E0NB 1H4WA 4CRDA 3V13A 3T28A 1L1JA 5JPMH 3EBNA 3VB3A 3LGWA 2ZHFH 1GG6B 3Q76A 2TGAA 2O9QA 2BVRH 4A1TA 1C9PA 4FUEA 1IQHA 1LHEH 2LNCA 1KTSB 1UTLM 4CH2B 2K7XA 6ESTA 1G3CA 2HOBA 4X1QU 2AMQA 2ZU4A 5E2OA 4HI3A 3SNCA 1CT0E 1EAUA 3MMGA 3SI4H 3VXEH 1LVMA 3MH5A 2WPLS 3FAOA 4K8YA 1G2MA 1GI4A 5JBCS 1SVPA 3TIUA 2C8XB 1UCYH 1IQNA 1DOJA 4WH8A 4WXIA 4IBLH 6GCHG 1BTXA 3VB4A 1RTLA 3QGJA 4INKA 1TABE 4NG9H 2A7HA 2ZEBA 3SQHE 4OS2A 1AO5A 1AWHB 1NC6A 3A8DA 1QURH 4OS1A 1L0ZA 1TLDA 2PV9B 1UVTH 3RXIA 4CBNA 2ZCHP 1K1IA 4CR9A 1XX9A 3A7XA 1TPAE 4D7GA 1JOUB 3MO3A 4O97A 3GY4A 3IITA 4ZROA 4BTIB 4AFSA 4FUCA 2FWWA 1TRNA 1ANCA 2ZDVH 1EZUC 3A7TA 4MPXA 3KQCA 4YOJA 4YM9A 1LVBA 1TNHA 1DVAH 2TBSA 3SBKA 3UTUH 1DLEA 4AYYB 5A09A 5JB8S 1AFEH 1E38B 2ZECA 1P2KA 1MCTA 2SGDE 3IWMA 4ISOA 3ATMA 5A0BA 1C2LA 1X7AC 2GV7A 5AFZH 4JZFH 3W95A 1ZYOA 2QF0A 1T4VH 6CHAC 3OYPA 3HATH 1D3TB 1GJ7B 3GDSA 2A0QB 2EI7A 2WV5A 4FUIA 3ZZ4A 1LVYA 2D2DA 4K69A 1HV7A 3SUFA 1C2EA 1H9LB 1TQ0B 2Y5GA 1A5HA 5HM2A 4FUFA 2FIRH 1SFQB 4ZHMU 3LONA 1FY1A 3O8RA 1C5MD 3SU4A 3VGCC 3PMJA 1FAKH 2EI6A 3BN9A 4ISHH 5ETXA 1O5BB 1GI6A 3FZDA 1DS2E 4B74A 1IQKA 1ZRBA 1A61H 3U69H 3RXVA 1C5UA 4JK6A 1SFIA 1V2RT 1XUKA 2B7DH 2A5IA 5EOKA 2P3FH 3U1IB 3PLKA 4A92A 3KN2A 2STAE 2ZPSA 3E8LA 2OC8A 3KHVA 3O8DA 1HXFH 3HK6B 3SV8A 5CE1A 4FU8A 1MZDA 4GHQA 2FEQH 1LPKB 3OY6U 4E7RG 3EGKH 1NY22 1SLXB 1L4DA 1WBGB 2FX4A 1FY8E 1C5VA 1UK2A 1UCYE 1P2OA 3LPRA 4KELA 5HMAA 1CHOF 1ABJH 2OCVB 4GVUA 1B5GH 2VWMA 4UDWH 5CHAB 1UTJA 1QA0A 3BIUH 7ESTE 3O8BA 1ORFA 2OLGA 4Y6DA 1C1NA 3VEQB 1W11U 1SGIB 3GCTG 1GBMA 2OC0A 1EQ9A 3R0FA 4NA9H 4LZ1H 2ANKH 2AH4X 3RC5A 1H9HE 1QFKH 1GMHF 1WU1A 5DP5A 3RXKA 4K1SA 3UOUA 1GBIA 2G81E 1S6HA 4AZ2B 3QWCH 1HXEH 2OTVA 2FS8A 1EJAA 1MU6B 3VFEA 1IQLA 2OC1A 3UR9A 3AW0A 3C27B 1L2EA 2ZO3H 4LK4A 2Z9JA 1UVUH 1O3BA 2W7UA 5JBBS 3GDUA 5GDSH 3BTFE 5T6FA 1SLWB 4K1EA 4AGJA 1AY6H 1UTKA 2QA9E 1O3KA 1FY4A 2P3UB 2R0LA 1T8OA 3H7TA 1THSH 1BRUP 1XXDA 2FOAA 5I25A 1HAGE 3V12A 1HJAB 1A3EH 1SI5H 1TGNA 3LOXA 1QCPA 4I8KA 4IN1A 5HXFA 2QXJA 4FXGH 2A2QH 1BB0B 2SNVA 1S6FA 2H1UA 3BF6H 1C1VH 1K1MA 2J92A 2SGQE 3P8GA 3RM0H 5CMXH 2Z94A 3MTYA 4SGAE 4X0WU 3MU0A 1LHGH 1GCTB 2H5CA 1C2HA 3I78A 3EAJA 1TBRH 3SN8A 2PGBB 4HTCH 1MTVA 5DP9A 1C5PA 2DE8A 1BTHH 4YESB 5H4IB 1YLDA 1TA2A 4NFFA 1E0FD 3GY8A 3RXOA 1TMBH 3C1KA 1YPMH 2P93A 2F3CE 1XUJA 2OD3B 5A8XA 2RG3A 4O9VA 5EPYA 2ZF0H 2FTLE 2B8OH 3RXHA 2ODQA 1PPZA 2AEIH 1TBZH 3A83A 4NFEA 2ZP0H 1O2ZA 5F6MA 1CT4E 3RXGA 1TPSA 1QIXB 2BDGA 3IG6B 4Z6AH 1LHCH 2VB0A 1HNEE 1DWEH 3S9CA 1HAOH 4B76A 2FI5E 2IN2A 2F9BH 1V2VT 4NWKA 1SGTA 4TPIZ 3RXJA 1MQ6A 1QRZA 1K1OA 3SGQE 2BOKA 3TK5A 1NU9A 1YPHC 1S83A 4X6NA 3RXCA 3SJOA 3M3TA 5C3NA 3LU9B 1P2JA 4H6TA 4FUBA 4MPUA 2NU2E 1QQUA 3SJIA 2BY6X 2PKSC 5DK1A 4OS7A 2J38A 3E0PB 4WY3A 3ZVCA 1O39A 1UCYK 4CBOA 5EODA 1V2NT 2FXRA 2W3IA 2FOCA 2ZGHA 4I33A 2FTMA 1LDTT 3UPEA 2RA3A 2DUCA 5EW2H 2Z3CA 2G55A 2R9PA 2XTTB 1V2QT 2ZGXH 4ZH8A 2VVUA 4GHTA 1AE8H 3QTVH 1KLIH 3M5OA 5FX5A 2FLBH 1O5EH 1TYNA 1P2IA 1LKBA 1J8AA 2VH0A 2VIDA 1L4ZA 3P8OA 3ZV8A 4I8HA 4Y0ZE 2QAAA 3GCTF 1AUTC 1DITH 1Z8JB 2BYAX 1GVLA 2QYIA 1T8LA 4K5ZA 1K28D 1O34A 2GP9B 5EXMA 1EPTB 3S7HB 1OP8A 4X1RU 3M7UA 3P70B 4NIWA 1BT7A 1ZTJA 1GI7B 2VVCA 1SPJA 1P57B 3E1XB 2F9NA 3FP6E 3ZZBA 2GCHG 1Y3UA 1EKBB 3SU5A 2V6NA 2A4GA 1WTGH 2GMTC 2JETC 3L33A 1S81A 4I8JA 1QBVH 2FOBA 1UK4A 2WPJS 4X8UH 3BTDE 2ZPRA 4MDSA 5B6OA 4JYTA 1O35A 2XW9A 2ALVA 4NIVA 1BMLA 1O2QA 8GCHG 3UNQA 2ZU5A 1FXYA 1HB0B 4TYDA 1PPHE 1EAWA 1ELTA 1RTKA 1AN1E 1ELAA 2A4QA 3MOCA 1BCUH 1B7XB 1CBWB 2BXUH 2ZDNA 4AB8A 1NRSH 2ODYB 1CQQA 3F68H 5GCHG 1BOQA 1C5TA 4WVPE 5DGJA 1AVGH 5GJ4B 1MKWH 1KLJH 1MH0A 3E16B 3RDZA 5FAHA 1C1TA 3ZYEA 1HAVA 1CBWC 2ZTYA 1EAXA 3K9XB 1ZSKA 5FPTA 4NGAH 5E0HA 3WY8A 3AAUA 3U8RH 1ANDA 2VJ1A 2FPZA 4CRFA 1BITA 3ATLA 1KDQA 2WINI 1O5GH 3MU8A 2PFEA 4WMFA 5BRRE 8LPRA 3PM3A 3PMAB 1RJXB 1O3LA 1A0JA 1FN6A 3SW2B 4DIHH 1XUGA 1EZXC 1O2LA 1PQ7A 1O3NA 1NRNH 3KGPA 2Y5HA 5K7RA 1KXDA 1LPGB 3FFGA 1Z1IA 1GHXH 4B2BA 1GMCF 5JBAS 1Y59T 1YP9A 3HK3B 5DG6A 3BTEE 3EA8A 3VB7A 2UUYA 4DCDA 1DUAA 1OWEA 4XE4A 4CHAB 4YOIA 3TGIE 3ZZ8A 1ZSJA 1GJBB 3K2UA 1N8OC 2FM2A 2FOEA 3MI4A 1TX8A 2PKAA 1DE7H 1FUJA 3GY5A 3QUMP 2RCEA 1BHXF 5ESTE 3SU2A 2AMPA 2GDEH 3LJOA 2BHGA 1HCGA 1YM0A 1C5SA 1OS8A 5FPSA 3MWIU 2WPIS 5F8XA 1OKXA 1D3PB 1YPJH 1K9OE 1EP6A 4B71A 1ETRH 1GDQA 2V3OH 3E91A 3ELAH 8GCHF 4NA7A 1YPKH 2AERH 2FO9A 3UREA 1IQFA 1TNGA 3GISB 3L6PA 2WYGA 3SUEA 3BG4C 3HGPA 3QZQA 7GCHF 2HALA 3ZZ9A 4LZ4B 2QCYA 2ZDLA 1GDUA 2FI4E 1NN6A 1MKXK 2HNTE 1Z6EA 9LPRA 2PUQH 1ELEE 2HGTH 4Y79A 1TMTH 2ULLA 1MD8A 1SHHB 2XBVA 2F91A 1C5QA 4UFDH 1PYTD 3GCHB 2ZDAH 2NWNA 2JETB 2GMTB 2YNAA 1QJ7B 4X2YA 2G00A 2IJOB 4YTAA 3LKWA 2LPRA 2DE9A 1MCVA 2PSYA 3UNSA 2WPMS 4MPVA 1E34B 4MNXA 1NT1A 1XKAC 3VGCB 4MTBA 1WV7H 1AVXA 2ZFFH 5JBTA 1FPHH 1RD3B 3MO6A 4MQAA 4TY7A 2R3YA 1C1UH 1OP2A 1ANBA 2FZZA 1QL7A 3UFAA 4Q80A 3TLOA 4UEHH 2HNTF 3B9FH 1EOLA 3RMOH 3M3VA 1GHBF 1P12E 1P05A 1TWXB 1MTWA 3MYWA 1J9CH 5K0HA 3FANA 1GGDB 3A84A 1WQVH 1YPLH 3PO1B 5LPEA 4X6PA 1ELVA 1UTOA 1NRRH 1RIWC 4Y8XA 1F5RA 4A1XA 3RXMA 4K3JA 2GT7A 2ESTE 1Y3XA 1QB6A 3QK1A 4U30A 3VPKA 4OS6A 4GSOA 1DWCH 1G36A 1UTMA 2HPQH 4Y11E 1HAZB 9ESTA 3S9BA 1LCYA 2FS9A 1O30A 1VGCC 3GICB 1BTYA 2VGCC 1O2PA 2HNTC 4GCHF 3U8OH 2AYWA 1Q2WA 5F03A 1BA8B 1OYQA 3ZVGA 1O33A 1UVOA 1GHBG 1SGYE 1C5OH 3SV7A 1F7ZA 3SGBE 2BM2A 3V7TA 2H2ZA 1NROH 2AIPA 2GZ8A 3D23A 1ZGVA 3A7ZA 1G2LA 2P3TB 1Z71A 3SV9A 1N6XA 4Y8ZA 3DA9B 1HDTH 4XBBA 4MPWA 1GVKB 2GTBA 3SU6A 1FV9A 1PYTC 1P04A 2BZAA 1MKWK 2JH6D 1YKTA 1ZPCA 2J34A 3SV6A 1UHBA 1AB9C 3GY6A 3ZV9A 1RFNA 1LO6A 2JKHA 2ZGJA 2VIQA 1KXEA 1O3HA 3QTOH 3S0NA 1O37A 1E35B 4ISIH 1T32A 1ZPZA 4CRBA 1W8BH 5LGOA 4D9QA 2O8TA 1BBRH 1SMFE 4FUGA 3UY9A 3SHCH 2ZU3A 2A5AA 2WUCA 1S0RA 2H9EH 4WJG2 4UONA 1DDJA 1GJCB 2JH0D 2VGCB 2VWLA 1C1PA 2VVVA 3SNDA 1VITF 4ABGA 3GY2A 3F1SB 4ABIA 3V3MA 3K65B 3TK9A 1PQAA 4ZKSU 2UUFB 3BG8A 3ZYDA 4WMDA 3DUXH 5L6NH 1TGTA 1O2XA 4BAOB 2D26C 3MNCA 1YCPM 3PMHB 4IGDA 2BLVA 2RA0A 3SU0A 2Z7FE 2BLQA 2UUJB 1O3EA 5C2ZA 1GBCA 1RGQA 1HAYB 1QRWA 1ZLRA 1Y5AT 1O3MA 1ID5H 4KGAA 4BXSA 1C2JA 3EDXB 2BDYA 1QJ1B 1ELFA 4GPGA 4XFQA 1SGDE 3GCOA 1SBWA 2XBXA 3DT0H 4Y71A 3W94A 1D3DB 1ZMNA 3RLYH 2H5DA 2GT8A 3QZRA 2AS9A 4H4FA 3HKIB 5JDUB 1GHYH 1MZAA 3BTKE 1W14U 4CRAA 5EQRA 1GJ8B 1O2KA 2B0FA 1ZHMA 4MVNA 1AZ8A 2BD4A 1TRYA 3GYLB 5J4SA 2ZI2H 1EJMA 2GVFA 3BTQE 1PQ8A 3LGVA 2OP9A 1O2IA 1Y5UT 3LGIA 5FCRA 1SL3A 2ZQ1A 1AFQB 1ZHRA 1O2MA 4X1NU 7GCHG 1CU1A 3CS0A 3SGAE 1FDPA 1UTNA 1BQYA 2HLCA 1O3JA 3Q3KA 3L3TA 1WOFA 3LC3A 1XKBC 5DPAA 1GI9B 3LC5A 4GAWA 3E3TA 3SORA 1O32A 3UQVA 2PKSB 1MU8B 4K2YA 3A82A 1F5KU 1C2MA 1O2OA 2J94A 1EZQA 2BVXH 3G01A 3TU7H 2A31A 5L30H 2BDIA 4M7GA 1A46H 3ZZCA 3LGYA 3TNTA 1GBKA 1MAYA 1EZSC 2Z9KA 4ZHAA 3EE0B 1GI3A 4O3UA 1Y5BT 3NUMA 2FOHA 3LGUA 3LIWA 4D8NA 1EB2A 4ABEA 2ZFTA 2Z9IA 3SU3A 1EOJA 2A45B 5FXLA 2FMJA 4R8TB 3S69A 2ZCKP 1O3DA 2YOLA 1MAXA 3Q3XA 4AYVB 1QB9A 5A2MH 1S84A 4K8BA 1DICA 1HAIH 2BD2A 1F0RA 1J16A 1NFXA 1HJ9A 1O2NA 3DHKH 4K60A 4BAQB 2GCTC 1A1RA 1W12U 1PFXC 1NESE 1GMDG 1KXBA 4U2WA 2I6QA 1TGSZ 4CR5A 3RXBA 1ELBA 3KIDU 2CXVA 3H5CB 1J14A 1V3XA 1SGFG 1AE5A 3T25A 3PMBB 2FOGA 2OBOA 1SLVB 4E7NA 1ETTH 1YCPK 4X1PU 2XC5A 1D4PB 1GBLA 4RKOB 3TVJB 2R0KA 3GOVB 5ABWA 1AGJA 1ELGA 2TGDA 1DFPA 5LPRA 1M9UA 4CH8B 3FZZA 1IQJA 5GIBA 4BXWA 2ZGBH 5DKMA 1UHBB 3RXSA 2C8WB 2A2XH 2I6SA 3NKKA 4NCYA 4RKJB 4DJZB 1KXAA 4KTCA 3RXPA 3T5FH 5C20A 1QY6A 5EQQA 1IQEA 3A7YA 5I46H 2EI8A 1Y8TA 1K1JA 1F0TA 5BPEA 4AN7A 5DP4A 3CENA 1C1OA 1FNIA 2NU4E 2BX4A 2PUXB 1P06A 1T7CA 2OXSA 1GMHG 1MUEB 3A87A 2CV3A 4B1TA 2C8ZB 1VGCB 2J95A 3RXDA 1A3BH 1MBMA 5C1XA 4JZ1A 1VJ9U 3TK6A 1KIGH 3ZVAA 1S5SA 4DGJA 1P10A 3P8FA 4KTUA 3TGKE 3M7TA 1TOCB 4DURA 1UVPA 3UWJH 2TPIZ 3BTGE 1CA0B 4YOGA 2G4TA 4AGKA 2AGGX 3CP7A 5PTPA 3GCHC 1AZZA 3SO3A 1QB1A 1QNJA 4D7FA 1ELCA 5T3HA 2XBYA 4RN6A 4ZKNU 2V0BA 4DG4A 5FPYA 2C90B 4Z0KA 4IMQA 3V0XA 1PPGE 4BAHB 1GHAF 2ZFSA 1XUFA 3PB1E 4CREA 2XWAA 1AUJA 1AU8A 1FLEE 2P95A 4ISNA 4LXBH 2V35A 2W26A 1C2KA 5FBEA 2JH5D 3TITA 3RXLA 1RTFB 2WV4A 4KP0A 5SGAE 3PTBA 1G30B 2CN0H 2OC7A 4X2WA 2J9NA 2ANMH 2W3KA 4H42U 1PPEE 2Z3EA 2KAIA 2HPPH 2VIVA 1INCA 1TBQH 3FP8E 4NIYA 1V6DA 3PWBA 4KKDA 1MMJN 1ZTLA 2A32A 6LPRA 3SQEE 1TPPA 2BB4A 4ISLA 1THPB 3N7OA 1FZZA 3NCLA 4J2YB 1L1NA 1EXFA 2BD3A 3D49H 1DM4B 4ZMAH 2BXTH 4YLQH 5EW1H 1W10U 2UUKB 4ABAA 1GHVH 1XM1A 5A0CA 1DWDH 1SHYA 4ESTE 1C2IA 3SHAH 1ZMJA 2ZPQA 1SB1H 4INHA 3GCNA 1OSSA 1PJPA 5DO4H 2H6MA 2P59A 5EXNA 1HGTH 1HJ8A 3U8TH 2VINA 3STJA 1P2QA 3UIRA 2BTCE 1EATA 2NU0E 3TJNA 5LPFA 1PQ5A 1TNJA 3PV4A 2AFQB 1GMCG 3TH4H 4X8TH 5FCKA 4XSKU 4I32A 2F9VA 4B75A 2BY9X 3AW1A 1QBNA 1V2JT 2V3HH 4J1YA 1MQ5A 1LVOA 1TPOA 1TOMH 2CGAA 3QGNB 4Y10E 1H8IH 1SGNE 1GBBA 3EA9A 5DP6A 1DLKB 4Q7XA 2ZU2A 4I8LA 1UO6A 2Z9GA 1CHGA 1O38A 1Q3XA 6GCHF 1UJ1A 1GBEA 1V2MT 5EXLA 4NIXA 1HBTH 1C2GA 2QF3A 1OP0A 1XVMA 2ZQ2A 5DP3A 4X2XA 1RRKA 3M37A 3RXRA 1G3DA 1P01A 4YLUA 2O8MA 1GCDA 2SFAA 4I8GA 2BLOA 1CVWH 3KEEA 1W13U 1JRTA 3P8NA 1BRBE 3A81A 2C4FH 1MBQA 1CHOG 2CF9H 4X2VA 1O5AB 2UWLA 3A86A 2QY0B 1GVZA 2ZHDA
chains in the Genus database with same CATH superfamily
4OS5A 4RT1A 3SNEA 1BUIA 4XOJA 3RXQA 3O8CA 3KNXA 1N8OB 1AWFH 1NPMA 1W7GH 4BNRA 1YGCH 1Z8RA 1IHSH 2NU1E 1OOKB 1MD7A 1JRSA 3A85A 3HPTB 3NZIA 1OXGA 1SQTA 4U32A 2F9PA 3BTTE 2FX6A 1GBJA 3ATIA 1C2FA 5G4BA 2BDAA 2AGEX 3A8CA 1EASA 2KCAA 1C1MA 3A80A 2QE7D 2LP6A 1FIWA 2WPKS 5LH8A 4SGBE 2ILNA 3ZIAD 1G32B 1C5WB 1HFDA 1T4UH 1VCWA 4ABDA 3SJKA 3MH6A 3TGJE 1F0UA 4YT7H 4OGXA 3LDXH 1B0FA 1SR5C 2PP6A 2QGRA 1SLUB 1XUIA 5AF9H 5GXPA 1NTPA 3UAIC 3JZ2B 2BD9A 4JYUH 3TJVA 2J97A 2XNIA 1AHTH 3TNSA 3M36A 4BANB 1BHXB 4DIIH 3B23B 3KL6A 3M5MA 3RUOA 1YWUA 1IOEA 1C4V2 3S7KB 1MKXH 1SC8U 4DY7B 1AKSA 2QXGA 1EJNA 1Z6JH 1P02A 4DOQA 1KTTB 2AGIX 2ZDKA 5A8YA 3AAVA 1ZJKA 3EQ0H 1O5DH 1ARBA 2BVSH 4WWYA 1TRMA 5C5OA 2ZTXA 1GJ5H 3MNSA 1VCPA 1T8MA 2VWOA 3ITIA 2Q6DA 3QN7A 1W7XH 2O8UA 1SGFA 1TFXA 2BD5A 2PR3A 1OWJA 1KYNA 1TMUH 3DFJA 3BEFB 4CRGA 1D3QB 1HJAC 2OQ5A 8KME2 1FQ3A 2OUAA 2KR7A 2ZWLH 1DY9A 2FDAA 1O3PB 1Z8IB 1GI1A 1A7SA 1FN8A 2C3SA 4ASHA 1EB1H 1LQDB 2G4UA 1J17T 3SI3H 2BLWA 3M5NA 2CMYA 5ESBA 3CS7A 4DW2U 1VCQA 1TX6A 1QRXA 1BZXE 2QIQA 3PWCA 2Q6FA 2HWLB 2A4RA 1JMOH 2GCTB 1NFWA 2W7SA 1TNKA 2KM0A 2PLXA 4IS5A 1VITH 1GBDA 4XD7D 1P3CA 4XBDA 1V2OT 2ZG0H 5JB9S 1WTHD 2HVYB 2Y82A 3Q3YA 1VJAU 4O3TA 5DSFA 1IQIA 5CHAC 5A8ZA 3MU5A 1O2JA 2BZ6H 3SJ9A 3F0PA 1DPOA 3AVZA 2FP7B 1BJUA 1GPZA 3RC6A 5J4QA 2SGPE 1O36A 1TALA 3RM2H 1V2PT 2UWPA 3U9AH 1EPTA 3SU1A 4H6SB 3T26A 2NU3E 4FUHA 1ZJDA 1VKYA 2CHAC 2L6OA 2K8IA 1O31A 1E37B 3SUDA 2SNWA 2XCFA 3T27A 3UUZA 1E1QD 3ODDA 4AORA 1NO9H 2LIZA 3D62A 1AD8H 1IAUA 1GI5A 5CDFE 1O3FA 3GYMA 1GL1A 1C1QA 1FJSA 2VWNA 3ZVEA 2ZC9H 2PTCE 5EJZA 3RC4A 4IMZA 1MTNB 1NFYA 4D9RA 7KMEH 2ANWA 3P92A 1FMGA 2CJIA 3BTWE 4ABHA 8ESTE 2GV6A 3ZVBA 1KLTA 1GL0E 1YPEH 4JMYA 2WYJA 1TNLA 1CA8B 4XDEA 5FX6A 5F8ZA 1SQOA 2O8WA 4UD9H 4TWYA 3RU4E 1V2LT 1YC0A 2R3UA 4IC5A 2KFWA 5HIYA 1C9TA 4Y8YA 4HFPB 3LH3A 1BBRK 3EYDA 1BJVA 2WPDD 2M5TA 3ATKA 3U98H 3RLWH 2PHBA 5EG4A 1DX5M 1ZTKA 2P16A 5L2YH 3ZZDA 1MTSA 2FLRH 5E0JA 4HZHA 3AASA 5DJ7A 3PLPA 1QA7A 3LT3A 1EPTC 3T62A 3OTJE 1ZSLA 3SYJA 4ASUD 2AHME 1GMDF 4Q7ZA 3KYFA 5IDKA 3ZVFA 5IYTA 2PWXA 3M61U 1F92A 3QO6A 2Y7ZA 3PROA 1PPBH 2XWBI 1ANEA 3NXPA 5HM9A 4MG3A 2GX4A 3F9HA 1GJAB 4GCHG 1GI8B 1C4U2 4FVBA 3UWIA 1T31A 1LHFH 2QXHA 3A7WA 3A89A 4WF8A 1DSTA 2HVXA 1DXWA 1C5RA 1GBFA 2VH6A 4FU9A 4ACAA 2ZCLP 4Y7AA 1P0SH 4X8VH 4A1VA 1ZOMA 2SGEE 4ABBA 3URDA 1Z8GA 4JZEH 3SUGA 3RMNH 1K1NA 2ZNKH 2XNDD 3VXFH 2TGPZ 1G3BA 1OPHB 5TJXA 3F2HA 1W0ZU 1A0HB 1QGFA 5KEDA 1TNIA 3MU4A 1AIXH 1WSSH 3Q77A 3NWUA 4JK5A 1LPZB 4IC6A 5GNDA 2K1QA 1NS3A 4ABFA 2F4LA 2ZTZA 1O2SA 1JIMA 1W0YH 4ZKRU 1DT2A 1UMAH 1WUNH 5EU8A 1OWHA 5EGMA 4E05H 4JZDH 4A7IB 3T29A 1BMMH 3EE7A 1O3CA 1P3EA 1HAHH 1L1GA 3RU4T 5HYOA 1H8DH 2ZGCA 2ZFPH 3BG4B 4HGCA 1OWDA 4F48B 4OGYA 3TH3H 1JWTA 2C93B 4A6LA 1OWIA 1A0LA 1CA0C 1S0QA 1FIZA 2D1JA 1BDAA 4QT8C 2B9LA 2BQWB 1GJDB 4JCNA 2YNBA 3BTHE 3DSGA 1C5LH 4IW4E 2P8OB 3BEIB 1C2DA 3WWBA 1K22H 1DY8A 4AFZA 3GY3A 2BDHA 2KZ4A 2ODPA 1O2TA 2ZA5A 3RXEA 3OU0A 4UFFH 3EA7A 4AFQA 2FI3E 1QBOA 3PO1C 2PTNA 2GZ9A 1C4Y2 1EP5A 2ZKSA 4JZIA 1AB9B 1CGHA 1G37A 1NZQH 1WAYB 3NK8A 1CGJE 2Y5FA 4YT6H 1AQ7A 2THFB 2FOMB 4NSVA 4Q7YA 1O5CB 1SSXA 1P9SA 1FI8A 1KY9A 4FUJA 4U01A 3HKJB 1BMAA 1YYY1 1GHWH 2WZQA 1WXRA 1QHRB 3M35A 1SOTA 2VU8E 1GHAG 1U6QA 3KQBA 4AFUA 1BTWA 1GHZA 4BTTB 1HAPH 1JXPA 1ETSH 2ZHQH 2H9TH 5C0UA 2IPHA 1GDNA 4GUXA 2A7JA 1YBWA 3H7OA 4BAKB 3DFLA 1TQ7B 2G8TA 1WQSA 1Y3YA 1PPCE 4XBCA 1HAVB 7LPRA 1F2SE 1HPGA 1RS0A 3TH2H 2B5TB 4F4OC 1LTOA 3A88A 1QJ6B 2GKVE 3KCGH 1CE5A 2RDLA 4RSPA 6CHAB 2FESH 4AX9H 2P8OC 2VNTA 3NPSA 3TPIZ 1HIAA 1SGCA 3T2NA 3VB6A 2F9UA 2Y6TA 1IQGA 1CT2E 1UTPA 3RMMH 3OSYA 1KMHB 2Q1JA 1S6LA 1T8NA 1WDIA 4AG1A 2KCOA 3ZZ3A 2G52A 5EPNA 1VZQH 5C1UA 2XBWA 1JIRA 1ESTA 1V2WT 4AOQA 1K21H 1HUTH 1C5ZB 1SGEE 3OAAD 4Y0YE 1UK3A 4R0IA 1TGCA 4Y76A 2F83A 2G51A 2WSSD 5AHGH 1O2HA 3BIVH 1V2ST 1TA6A 1N6YA 2BQ6B 3LGTA 3E6PH 2FYQA 2GGVB 1BTZA 2ZHEH 1G9IE 4A5TS 1P2MA 3MU1A 1ESBA 4UFGH 3M5LA 1KDQB 1TONA 3FP7E 1O2GH 4YZUA 4ZUHA 1HAXB 3RXTA 1JBUH 1V2UT 1D6WA 2F9OA 2ALPA 2FOFA 4INLA 2AIQA 3OX7U 1ZHPA 3PV5A 2VIPA 2J98B 3OY5U 1ZRKA 4I31A 2XC4A 1BBRE 1EAIA 4NWLA 3D65E 3ZZ6A 1THRH 3OE7D 2AMDA 2ANYA 3B8JA 4DT4A 2JDID 1TAWA 2RFKC 1A5GH 1P03A 4WMEA 3U1JB 1ACBE 2PGQB 2BMGB 5GWZA 1K1PA 1ESAA 3UQOA 1E36B 5HGGA 2A7CA 1PPFE 1XXFA 3PLBA 1SGQE 2PW8H 3DD2H 4D76A 5TCAA 1UTQA 1GWAA 2XC0A 2ZDMA 1B0EA 4YO9A 1CSOE 1NRPH 3ESTA 2BY5X 2Y80A 3BTME 4AB9A 5JYIA 1V2KT 2CHAB 2C8YB 1O3AA 1D6RA 4K1TA 3K6ZA 2KX4A 3MH4A 2A5KA 5AVDA 4X6OA 1TX7A 1KXFA 1BRCE 1O2WA 3LH1A 3MHWU 4IN2A 4NZQA 1LHDH 4B2AA 1LQEA 3TJOA 1S82A 1H8HD 4BOHA 3Q00A 3MNBA 3AK5A 1QL8A 2Z3DA 1MTUA 3I77A 4MNWA 4CHAC 3BSQA 4UE7H 2BDCA 2OINA 1Y3WA 1FY3A 1CO7E 1WYKA 3QX5H 4MNYA 4E06H 1NU7B 4LOYH 1DSUA 1D9IA 4RT0A 2A1DB 2JIZD 2XYAA 3R3GB 1FAXA 2UWOA 3ATWA 3RXUA 4Z1MD 2P94A 1RIWB 2GDDA 2PKAB 3MO9A 4Q2KA 2ZHWH 3UB0A 4VGCC 3LJJA 1BRAA 1P11E 4THNH 2QN5T 3ZZAA 1A5IA 1RXPA 2R2WU 2WV9A 1P2NA 5L2ZH 3BEUA 3SOSA 1A4WH 1Y3VA 3F9FA 2J4IA 4WH6A 3MFJA 1S85A 4VGCB 3A8AA 2V7QD 3RXAA 1O3OA 2BOHB 2EA3A 1YPHE 2XCNA 2TIOA 3GDVA 1GBHA 1W3CA 5C17A 1FONA 2FODA 1HYLA 5GPIB 1XVOA 1O5FH 2O8LA 1Z1JA 3M7QA 4NSYA 1HRTH 1XMNB 3FVFB 3F6UH 4TWWA 5E0GA 3VB5A 1Q31A 4MLFB 4ZAEA 5E2PA 2QXIA 3SV2H 1AVWA 2EEKA 1QR3E 1EUFA 3URCA 2J2UA 5C5NA 5T6GA 3P6ZB 1TB6H 1SG8B 1UW7A 4HG6A 1OYTH 3ZVDA 5E8EH 1C1SA 1AFQC 3ZZ5A 1SQAA 2Y7XA 2ZFRH 4X8SH 1O2VA 4CRCA 1GG6C 2GZ7A 1NM6A 4OS4A 2Z6BD 4AG2A 1NFUA 1O2UA 1SGPE 5GCHF 1QTFA 1O2YA 2EQNA 3S9AA 2ZZUH 4DT7B 1C5YB 5A0AE 1K2I1 1GBAA 1C1WH 2OQUA 3SNBA 1IHTH 2R2MB 4TSFD 1G3EA 2SGFE 2XRCA 2SGAA 1GGDC 1TE0A 3F2GA 3QLPH 1ELDE 1BTPA 1EFRD 3M3SA 2BX3A 1IQMA 1O0DH 3E90B 4X1SU 4MNVA 1O2RA 1WCZA 1CGIE 1F5LA 1LKAA 2TGTA 2G5VA 2TRMA 3RXFA 4TY6A 1BMNH 1VITG 2KAIB 4M9FA 1FX0B 2VIWA 3UNRA 4Y7BA 2D8WA 1ZPBA 1P9UA 3GY7A 5AFYH 1SQRA 1SOZA 2ZIQH 1GI0A 3MH7A 1DWBH 5FHTA 1W2KH 2VIOA 1C1RA 2H9HA 2IOTA 2STBE 1DXPA 1P8VC 3A8BA 5C67A 2GJGA 1EX3A 3PTNA 2XXLA 2BDBA 1QL9A 3RU4D 4FETA 1BIOA 3F9EA 1GJ4H 4KTSA 4Q4LA 1HLTH 4FU7A 2K0QA 3SJ8A 3ODFA 4X6MA 5C1YA 3QDZB 1AI8H 1GJ6A 4UFEH 5F8TA 1AMHA 4O03A 1AKSB 4FVDA 4WXVA 4NA8A 4ABJA 1ZGIA 2Y81A 1ZZZA 3N99A 1A2CH 1F0SA 3MNXA 3STIA 1C5XB 1P09A 2EC9H 2GD4B 1ABIH 1O3GA 1YLCA 3SNAA 3ZZ7A 4B2CA 3RMLH 1H1BA 1QQ4A 2ZFQH 4GLYA 4BAMB 1O3IA 5T6DA 3JZ1B 3WW7A 2WPHS 1TGBA 1K1LA 1V2TT 2CF8H 1H9IE 2G5NA 2Z9LA 1KXCA 4ZKOU 2A4OA 1GJ9B 1Z7KA 2ASUB 4I7YH 1OWKA 1XUHA 2BQ7B 1YF4A 5FBIA 2BY7X 1DUEA 4B73A 1LMWB 2QV1A 3SZNA 4ZHLU 2ZU1A 1C5NH 5TCCA 1YPGH 3F9GA 1J15A 2YMSD 3NRLA 2Q6GA 1MTNC 3ENSB 3HGNA 5DP8A 1YCPH 4ZXXH 3KQEA 2OBQA 3K6YA 4F49A 1FY5A 2PSXA 3TJUA 4NZLA 2QC2A 1ZR0A 1VR1H 3UOPA 1ARCA 1MABB 1FPCH 3RP2A 5EQSA 1TIOA 2BD7A 3PV2A 1OX1A 4DVAU 1KSNA 3P17H 3KQDA 2HRVA 3KF2A 2GCHF 2W5EA 4TPYA 1UVSH 1GI2A 1N1LA 1HIAB 3KQ5A 4PROA 3PYHA 1BTUA 2BD8A 2FYRA 1GCTC 3BV9B 3P95A 1ZMLA 1DANH 3UR6A 2BY8X 4FUDA 1NRQH 4BTUB 1SGRE 3I29A 5F53A 3A7VA 5DP7A 1GBTA 4ZXYH 2WUBA 4JYVH 3E0NB 1H4WA 4CRDA 3V13A 3T28A 1L1JA 5JPMH 3EBNA 3VB3A 3LGWA 2ZHFH 1GG6B 3Q76A 2TGAA 2O9QA 2BVRH 4A1TA 1C9PA 4FUEA 1IQHA 1LHEH 2LNCA 1KTSB 3KYGA 1UTLM 4CH2B 2K7XA 6ESTA 1G3CA 2HOBA 3DSPA 4X1QU 2AMQA 2ZU4A 5E2OA 4HI3A 3SNCA 1CT0E 1EAUA 3MMGA 3SI4H 3VXEH 1LVMA 3MH5A 2WPLS 3FAOA 4K8YA 1G2MA 1GI4A 5JBCS 1SVPA 3TIUA 2C8XB 1UCYH 1IQNA 1DOJA 3DSOA 4WH8A 4IBLH 4WXIA 1BTXA 3VB4A 1RTLA 3QGJA 4INKA 1TABE 4NG9H 2A7HA 2ZEBA 3SQHE 4OS2A 1AO5A 1AWHB 1NC6A 3A8DA 1QURH 4OS1A 1L0ZA 1TLDA 4I86A 2PV9B 1UVTH 3RXIA 4CBNA 2ZCHP 1K1IA 4CR9A 1XX9A 3A7XA 1TPAE 4D7GA 1JOUB 3MO3A 4O97A 3GY4A 3IITA 1H8ED 4ZROA 4BTIB 4AFSA 4FUCA 2FWWA 1TRNA 5EJ1A 1ANCA 2ZDVH 1EZUC 3A7TA 3DCLA 4MPXA 4ZCNA 3KQCA 4YOJA 4YM9A 1LVBA 1TNHA 1DVAH 2TBSA 3SBKA 3UTUH 1DLEA 4AYYB 5A09A 5JB8S 1AFEH 1E38B 2ZECA 1P2KA 1MCTA 2SGDE 3IWMA 4ISOA 3ATMA 5A0BA 1C2LA 1X7AC 2GV7A 5AFZH 4JZFH 3W95A 1ZYOA 2QF0A 1T4VH 6CHAC 3OYPA 3HATH 1D3TB 1GJ7B 3GDSA 2A0QB 2EI7A 2WV5A 4FUIA 3ZZ4A 1LVYA 2D2DA 4K69A 1HV7A 3SUFA 1C2EA 1H9LB 1TQ0B 2Y5GA 1A5HA 5HM2A 4FUFA 2FIRH 1SFQB 4ZHMU 3LONA 1FY1A 3O8RA 1C5MD 3SU4A 3VGCC 3PMJA 1FAKH 2EI6A 3BN9A 4ISHH 5ETXA 1O5BB 1GI6A 3FZDA 1DS2E 1OHHD 4B74A 1IQKA 1ZRBA 1A61H 3U69H 3RXVA 1C5UA 4JK6A 1SFIA 1V2RT 1XUKA 2B7DH 2A5IA 5EOKA 2P3FH 5T1VA 3U1IB 3PLKA 4A92A 3KN2A 2STAE 1E79D 2ZPSA 3E8LA 2OC8A 3KHVA 3O8DA 1HXFH 3HK6B 3SV8A 5CE1A 4FU8A 1MZDA 4GHQA 2FEQH 1LPKB 3OY6U 4E7RG 3EGKH 1NY22 1SLXB 1L4DA 1WBGB 2FX4A 1FY8E 1C5VA 1UK2A 1UCYE 4B6EA 1P2OA 3LPRA 4KELA 5HMAA 1CHOF 1ABJH 2OCVB 4GVUA 1B5GH 2VWMA 4UDWH 5CHAB 1UTJA 1QA0A 3BIUH 7ESTE 3O8BA 1ORFA 2OLGA 4Y6DA 1C1NA 3VEQB 1W11U 1SGIB 3GCTG 5IK2D 5B6LA 3OTPA 1GBMA 2OC0A 1EQ9A 3R0FA 4NA9H 4LZ1H 2ANKH 2AH4X 3RC5A 1H9HE 1QFKH 1GMHF 1WU1A 5DP5A 3RXKA 4K1SA 3UOUA 1GBIA 2G81E 1S6HA 4AZ2B 3QWCH 1HXEH 2OTVA 2FS8A 1EJAA 1MU6B 3VFEA 1IQLA 2OC1A 3UR9A 3AW0A 3C27B 1L2EA 2ZO3H 4LK4A 2Z9JA 5C0TA 1UVUH 1O3BA 2W7UA 5JBBS 3GDUA 5GDSH 3BTFE 5T6FA 1SLWB 4K1EA 4AGJA 1AY6H 1UTKA 2QA9E 1O3KA 1FY4A 3WWFA 2P3UB 2R0LA 1T8OA 3H7TA 1THSH 1BRUP 1XXDA 2FOAA 5I25A 1HAGE 3V12A 1HJAB 1A3EH 1SI5H 1TGNA 3LOXA 1QCPA 4I8KA 4IN1A 5HXFA 2QXJA 4FXGH 2A2QH 1BB0B 2SNVA 1S6FA 2H1UA 3BF6H 1C1VH 1K1MA 4OM9A 3VG8A 2J92A 2SGQE 3P8GA 3RM0H 5CMXH 2Z94A 3MTYA 6GCHG 4SGAE 2F43B 4X0WU 3MU0A 1LHGH 1GCTB 2H5CA 1C2HA 3I78A 3EAJA 1TBRH 3SN8A 2PGBB 4HTCH 1MTVA 5DP9A 1C5PA 2DE8A 4F55A 1BTHH 4YESB 5H4IB 1YLDA 1TA2A 4NFFA 2RDEA 1E0FD 3GY8A 3RXOA 1TMBH 3C1KA 1YPMH 2P93A 2F3CE 1XUJA 2OD3B 5A8XA 2RG3A 4O9VA 5EPYA 2ZF0H 2FTLE 2B8OH 3RXHA 2ODQA 1PPZA 2AEIH 1TBZH 3A83A 4NFEA 3F0OA 2ZP0H 1O2ZA 5F6MA 1CT4E 3RXGA 1TPSA 1QIXB 2BDGA 3F3BA 3IG6B 4Z6AH 1LHCH 2VB0A 1HNEE 1DWEH 3S9CA 1HAOH 3FO8D 2FI5E 2IN2A 4B76A 2F9BH 1V2VT 4NWKA 1SGTA 4TPIZ 3RXJA 1MQ6A 1QRZA 1K1OA 3SGQE 2BOKA 3TK5A 1NU9A 1YPHC 1S83A 4X6NA 2YMSB 3RXCA 3H09A 3SJOA 3M3TA 5C3NA 3LU9B 1P2JA 4H6TA 4FUBA 4MPUA 2NU2E 1QQUA 3SJIA 2BY6X 2PKSC 5DK1A 4OS7A 2J38A 3E0PB 4WY3A 3ZVCA 1O39A 1UCYK 4CBOA 5EODA 1V2NT 2FXRA 2W3IA 2FOCA 2M2AA 2ZGHA 2FTMA 1LDTT 4I33A 3UPEA 2RA3A 3CNRA 2DUCA 5EW2H 2Z3CA 2G55A 2R9PA 2XTTB 1V2QT 2ZGXH 4ZH8A 2VVUA 4GHTA 1AE8H 3QTVH 1KLIH 3M5OA 2JJ1D 5FX5A 2FLBH 1O5EH 1TYNA 1P2IA 1LKBA 1J8AA 2VH0A 2VIDA 1L4ZA 3P8OA 3ZV8A 4I8HA 4Y0ZE 2QAAA 3GCTF 1AUTC 1DITH 1Z8JB 3PRDA 2BYAX 1GVLA 2QYIA 1T8LA 4K5ZA 1K28D 1O34A 2GP9B 5EXMA 1EPTB 3S7HB 1BMFD 1OP8A 4X1RU 3M7UA 3P70B 4NIWA 1BT7A 1ZTJA 1GI7B 2VVCA 1SPJA 1P57B 3E1XB 2F9NA 3FP6E 3ZZBA 2GCHG 1Y3UA 1EKBB 3SU5A 2V6NA 2A4GA 1WTGH 2GMTC 2JETC 3L33A 1S81A 4I8JA 1QBVH 2FOBA 1UK4A 4XRNA 2WPJS 4X8UH 3BTDE 2ZPRA 2XOKD 4MDSA 5B6OA 4JYTA 1O35A 2XW9A 2ALVA 4NIVA 1BMLA 5KECA 1O2QA 8GCHG 3UNQA 2ZU5A 1FXYA 1HB0B 4TYDA 1PPHE 1EAWA 1ELTA 1RTKA 1AN1E 1ELAA 2A4QA 3MOCA 1BCUH 1B7XB 1CBWB 2BXUH 2ZDNA 4AB8A 1NRSH 2ODYB 1CQQA 2W6ID 3F68H 3U28C 5GCHG 1BOQA 1C5TA 4WVPE 5DGJA 1AVGH 5GJ4B 2OK5A 1MKWH 1KLJH 1MH0A 3E16B 3RDZA 5FAHA 1C1TA 3ZYEA 1HAVA 1CBWC 2ZTYA 1EAXA 3K9XB 1ZSKA 5FPTA 4NGAH 5E0HA 4AC9A 3WY8A 3AAUA 3U8RH 1ANDA 2VJ1A 2FPZA 4CRFA 1BITA 3ATLA 1KDQA 2WINI 1O5GH 3MU8A 2PFEA 4WMFA 5BRRE 8LPRA 3PM3A 3PMAB 1RJXB 1O3LA 1A0JA 1FN6A 3SW2B 4DIHH 1XUGA 1EZXC 1O2LA 1PQ7A 1O3NA 1NRNH 3KGPA 2Y5HA 5K7RA 1KXDA 3F2FA 1LPGB 3FFGA 1Z1IA 1GHXH 2V3MA 4B2BA 1GMCF 5JBAS 1Y59T 1YP9A 3HK3B 5DG6A 3BTEE 3EA8A 3VB7A 2UUYA 4DCDA 1DUAA 1OWEA 4XE4A 4CHAB 4YOIA 3TGIE 3ZZ8A 1ZSJA 1GJBB 3K2UA 1N8OC 2FM2A 2FOEA 1W0JD 3MI4A 1TX8A 2PKAA 1DE7H 1FUJA 3GY5A 3QUMP 2RCEA 1BHXF 1E1RD 5ESTE 3SU2A 2AMPA 2GDEH 3LJOA 2BHGA 1HCGA 1YM0A 1C5SA 1OS8A 5FPSA 3MWIU 2WPIS 3N7DA 5F8XA 5KGOA 1OKXA 1D3PB 1YPJH 1K9OE 1EP6A 4B71A 1ETRH 1GDQA 2V3OH 3E91A 3ELAH 8GCHF 4NA7A 1YPKH 2AERH 2FO9A 3UREA 3OFND 2CK3D 1IQFA 1TNGA 3GISB 3L6PA 2WYGA 3SUEA 3BG4C 3HGPA 3QZQA 7GCHF 2HALA 2IJD1 3ZZ9A 4LZ4B 2QCYA 2ZDLA 1GDUA 2FI4E 1NN6A 1MKXK 2HNTE 1Z6EA 9LPRA 4P00A 2PUQH 1ELEE 2JJ2D 2HGTH 4Y79A 1TMTH 4P02A 4RI0A 2ULLA 1MD8A 1SHHB 2XBVA 2F91A 1C5QA 4UFDH 2WHXA 1PYTD 3GCHB 2ZDAH 2NWNA 2JETB 2GMTB 2YNAA 1QJ7B 4X2YA 2G00A 2IJOB 4YTAA 3LKWA 2LPRA 2DE9A 1MCVA 3OEED 2PSYA 3UNSA 2WPMS 4MPVA 1E34B 4MNXA 1NT1A 1XKAC 3VGCB 4MTBA 1WV7H 1AVXA 2ZFFH 5JBTA 1FPHH 1RD3B 2HLDD 3MO6A 4MQAA 4TY7A 2R3YA 1C1UH 1OP2A 1ANBA 2FZZA 1QL7A 3UFAA 4Q80A 3TLOA 4UEHH 2HNTF 3B9FH 1EOLA 3RMOH 3M3VA 1GHBF 1P12E 1P05A 1TWXB 3SZEA 1MTWA 3MYWA 1J9CH 5K0HA 3FANA 1GGDB 3A84A 3MQKC 1WQVH 1YPLH 3PO1B 5LPEA 4X6PA 1ELVA 1UTOA 1NRRH 1RIWC 4Y8XA 1F5RA 4A1XA 3RXMA 4K3JA 2GT7A 2ESTE 1Y3XA 3FN8A 1QB6A 3QK1A 4U30A 3VPKA 4OS6A 4GSOA 1DWCH 1G36A 1UTMA 2HPQH 4Y11E 1HAZB 9ESTA 3S9BA 1LCYA 2FS9A 1O30A 1VGCC 3GICB 1BTYA 2VGCC 1O2PA 2HNTC 4GCHF 3U8OH 2AYWA 1Q2WA 5F03A 1BA8B 1OYQA 3ZVGA 1O33A 1UVOA 1GHBG 1SGYE 1C5OH 3SV7A 1F7ZA 3SGBE 2BM2A 3V7TA 2H2ZA 1NROH 2AIPA 2GZ8A 3D23A 1ZGVA 3A7ZA 1G2LA 2P3TB 1Z71A 3SV9A 4FOUC 1N6XA 4Y8ZA 2W6JD 1HDTH 3DA9B 4XBBA 3OEHD 4MPWA 1GVKB 2GTBA 3SU6A 1FV9A 1PYTC 1P04A 2BZAA 1MKWK 2JH6D 1YKTA 1ZPCA 2J34A 3SV6A 1UHBA 1AB9C 3GY6A 3ZV9A 1RFNA 1LO6A 2JKHA 2ZGJA 2VIQA 3FOAA 1KXEA 1O3HA 3QTOH 3S0NA 1O37A 1E35B 2QF5A 4ISIH 1T32A 1ZPZA 4CRBA 1W8BH 5LGOA 2YMSC 4D9QA 2O8TA 1BBRH 1SMFE 4FUGA 3UY9A 3SHCH 2ZU3A 2A5AA 2WUCA 1S0RA 2H9EH 4WJG2 4UONA 1DDJA 1GJCB 2JH0D 2QF4A 2VGCB 2VWLA 1C1PA 2VVVA 3SNDA 1VITF 4ABGA 3GY2A 3F1SB 4ABIA 3V3MA 3K65B 3TK9A 1PQAA 4ZKSU 2UUFB 3BG8A 3ZYDA 4WMDA 3DUXH 5L6NH 1TGTA 1O2XA 4BAOB 2D26C 3MNCA 1YCPM 3PMHB 4IGDA 2BLVA 2RA0A 3SU0A 2Z7FE 2BLQA 2UUJB 1O3EA 5C2ZA 1GBCA 1RGQA 1HAYB 1QRWA 2L74A 1Y5AT 1O3MA 1ID5H 1ZLRA 4KGAA 4BXSA 1C2JA 3EDXB 2BDYA 1QJ1B 1ELFA 4GPGA 4XFQA 1SGDE 3GCOA 1SBWA 2XBXA 3DT0H 4Y71A 3W94A 1D3DB 1ZMNA 3RLYH 2H5DA 1YLNA 1K0HA 2GT8A 3QZRA 2AS9A 4H4FA 3HKIB 5JDUB 5HIZA 1GHYH 1MZAA 3BTKE 1W14U 4CRAA 5EQRA 1GJ8B 1O2KA 2B0FA 1ZHMA 4MVNA 1AZ8A 2BD4A 1TRYA 3GYLB 3PRBA 5J4SA 2ZI2H 1EJMA 2GVFA 3BTQE 1PQ8A 3LGVA 2OP9A 1COWD 1O2IA 1Y5UT 3LGIA 5FCRA 1SL3A 2ZQ1A 1AFQB 1ZHRA 1O2MA 2IPQX 4X1NU 7GCHG 1CU1A 3CS0A 5EIYA 3SGAE 1FDPA 1UTNA 1BQYA 2HLCA 1O3JA 3Q3KA 5CHBA 3L3TA 1WOFA 3LC3A 1XKBC 5DPAA 1GI9B 3LC5A 4GAWA 3E3TA 3SORA 1O32A 3UQVA 2PKSB 1MU8B 4K2YA 3A82A 1F5KU 1C2MA 1O2OA 2J94A 1EZQA 2BVXH 3G01A 3TU7H 2A31A 2J5UA 5L30H 2BDIA 4M7GA 1A46H 3ZZCA 3LGYA 3TNTA 1GBKA 1MAYA 1EZSC 2Z9KA 4ZHAA 3EE0B 1GI3A 1W0KD 4O3UA 1Y5BT 3NUMA 2FOHA 3LGUA 3LIWA 4TT3D 4D8NA 1EB2A 4ABEA 2ZFTA 2Z9IA 3SU3A 3N7EA 1EOJA 2A45B 5FXLA 2FMJA 4R8TB 3S69A 2ZCKP 1O3DA 2YOLA 1MAXA 3Q3XA 4AYVB 1QB9A 5A2MH 1S84A 4K8BA 1DICA 1HAIH 2BD2A 1F0RA 1J16A 1NFXA 1HJ9A 1O2NA 3DHKH 4K60A 4BAQB 2GCTC 1A1RA 1W12U 1PFXC 1NESE 1GMDG 1KXBA 4Q63A 2I6QA 4U2WA 1TGSZ 3FKSD 4CR5A 3RXBA 1ELBA 3KIDU 2CXVA 3H5CB 1J14A 1V3XA 1SGFG 1AE5A 3T25A 3PMBB 2FOGA 2OBOA 2VBCA 1SLVB 4E7NA 1ETTH 1YCPK 4X1PU 2XC5A 1D4PB 1GBLA 1YY3A 4RKOB 3TVJB 2R0KA 3GOVB 5ABWA 1AGJA 1ELGA 2TGDA 1DFPA 5LPRA 1M9UA 4CH8B 3FZZA 1IQJA 5GIBA 4BXWA 2ZGBH 5DKMA 1UHBB 3RXSA 2C8WB 2I6SA 2A2XH 3NKKA 4NCYA 4RKJB 4ACBA 2EY4C 4DJZB 1KXAA 4KTCA 3RXPA 3T5FH 5C20A 1QY6A 5EQQA 1IQEA 3A7YA 5I46H 2EI8A 1Y8TA 1K1JA 1F0TA 5BPEA 4AN7A 5DP4A 3CENA 1C1OA 1FNIA 2NU4E 2BX4A 1P06A 2PUXB 1T7CA 2OXSA 1GMHG 1MUEB 3A87A 2CV3A 4B1TA 2C8ZB 1VGCB 2J95A 3RXDA 1A3BH 1MBMA 5C1XA 4JZ1A 1VJ9U 3TK6A 1KIGH 3ZVAA 1S5SA 4DGJA 1P10A 3P8FA 5EJLA 4KTUA 3TGKE 3M7TA 5FL7D 1TOCB 4DURA 1UVPA 3UWJH 2TPIZ 3BTGE 1CA0B 4YOGA 2G4TA 4AGKA 2AGGX 3CP7A 5PTPA 3GCHC 1AZZA 3SO3A 1QB1A 1QNJA 4D7FA 1ELCA 5T3HA 2XBYA 4RN6A 4ZKNU 5C94A 2V0BA 4DG4A 5FPYA 2C90B 4Z0KA 4IMQA 3V0XA 1PPGE 4BAHB 1GHAF 2ZFSA 1XUFA 3PB1E 4CREA 2XWAA 1AUJA 1AU8A 1FLEE 2P95A 4ISNA 4LXBH 2V35A 2W26A 1C2KA 5FBEA 2JH5D 3TITA 3RXLA 1RTFB 2WV4A 4KP0A 5SGAE 3PTBA 1G30B 2CN0H 2OC7A 4X2WA 2J9NA 2ANMH 2W3KA 4H42U 1PPEE 2Z3EA 2KAIA 2HPPH 2VIVA 1INCA 1TBQH 3FP8E 4NIYA 1V6DA 3PWBA 4KKDA 1NBME 1MMJN 1ZTLA 2A32A 4YXWD 6LPRA 3SQEE 1TPPA 2BB4A 4ISLA 1THPB 3N7OA 1FZZA 3NCLA 4J2YB 1L1NA 1EXFA 2LELA 3GS9A 2BD3A 3D49H 1DM4B 4ZMAH 2BXTH 4YLQH 5EW1H 1W10U 2UUKB 4ABAA 1GHVH 1SKYE 1XM1A 5A0CA 1DWDH 1SHYA 4ESTE 1C2IA 3SHAH 1ZMJA 2ZPQA 1SB1H 4INHA 3GCNA 1OSSA 1PJPA 5DO4H 2H6MA 2P59A 5EXNA 1HGTH 1HJ8A 1NBMD 3U8TH 2VINA 3STJA 1P2QA 3UIRA 2BTCE 1EATA 2NU0E 3TJNA 5LPFA 1PQ5A 1TNJA 3PV4A 2AFQB 1GMCG 3TH4H 4X8TH 5FCKA 4XSKU 4I32A 2F9VA 4B75A 2BY9X 3AW1A 1QBNA 5HKKD 1V2JT 2V3HH 4J1YA 1MQ5A 1LVOA 1QZ8A 1TOMH 1TPOA 2CGAA 3QGNB 4Y10E 1H8IH 1SGNE 1GBBA 3EA9A 5DP6A 1DLKB 4Q7XA 4B6FA 2ZU2A 4I8LA 1UO6A 2Z9GA 1CHGA 1O38A 1Q3XA 6GCHF 1UJ1A 1GBEA 1V2MT 5EXLA 4NIXA 2KCYA 1HBTH 1C2GA 2QF3A 1OP0A 1XVMA 2ZQ2A 5DP3A 4X2XA 1RRKA 3M37A 3RXRA 1G3DA 1P01A 4YLUA 2KCPA 2O8MA 1GCDA 2SFAA 4I8GA 2BLOA 1CVWH 3KEEA 1W13U 1JRTA 3P8NA 1BRBE 3A81A 2C4FH 1MBQA 5DN6D 1CHOG 2CF9H 4X2VA 1O5AB 2UWLA 3A86A 3W1EA 2QY0B 1GVZA 2J98A 2ZHDA
chains in the Genus database with same CATH topology
4OS5A 3SNEA 1BUIA 4XOJA 3RXQA 3O8CA 3KNXA 1N8OB 1AWFH 1NPMA 1W7GH 4BNRA 1YGCH 1Z8RA 1IHSH 2NU1E 1OOKB 1MD7A 1JRSA 3A85A 3HPTB 3NZIA 1OXGA 1SQTA 4U32A 2F9PA 3BTTE 2FX6A 1GBJA 3ATIA 1C2FA 5G4BA 2BDAA 2AGEX 3A8CA 1EASA 1C1MA 3A80A 1FIWA 2WPKS 5LH8A 4SGBE 2ILNA 1G32B 1C5WB 1HFDA 1T4UH 1VCWA 4ABDA 3SJKA 3MH6A 3TGJE 1F0UA 4YT7H 4OGXA 3LDXH 1B0FA 1SR5C 2QGRA 1SLUB 1XUIA 5AF9H 5GXPA 1NTPA 3JZ2B 2BD9A 4JYUH 3TJVA 2XNIA 1AHTH 3TNSA 3M36A 4BANB 1BHXB 4DIIH 3B23B 3KL6A 3M5MA 3RUOA 1IOEA 1C4V2 3S7KB 1MKXH 1SC8U 4DY7B 1AKSA 2QXGA 1EJNA 1Z6JH 1P02A 4DOQA 1KTTB 2AGIX 2ZDKA 5A8YA 3AAVA 1ZJKA 3EQ0H 1O5DH 1ARBA 2BVSH 4WWYA 1TRMA 5C5OA 2ZTXA 1GJ5H 3MNSA 1VCPA 1T8MA 2VWOA 3ITIA 2Q6DA 3QN7A 1W7XH 2O8UA 1SGFA 1TFXA 2BD5A 2PR3A 1OWJA 1KYNA 1TMUH 3DFJA 3BEFB 4CRGA 1D3QB 1HJAC 2OQ5A 8KME2 1FQ3A 2OUAA 2ZWLH 1DY9A 2FDAA 1O3PB 1Z8IB 1GI1A 1A7SA 1FN8A 2C3SA 4ASHA 1EB1H 1LQDB 2G4UA 1J17T 3SI3H 2BLWA 3M5NA 2CMYA 5ESBA 3CS7A 4DW2U 1VCQA 1TX6A 1QRXA 1BZXE 2QIQA 3PWCA 2Q6FA 2HWLB 2A4RA 1JMOH 2GCTB 1NFWA 2W7SA 1TNKA 2PLXA 4IS5A 1VITH 1GBDA 1P3CA 4XBDA 1V2OT 2ZG0H 5JB9S 1WTHD 2Y82A 3Q3YA 1VJAU 4O3TA 1IQIA 5CHAC 5A8ZA 3MU5A 1O2JA 2BZ6H 3SJ9A 1DPOA 3AVZA 2FP7B 1BJUA 1GPZA 3RC6A 5J4QA 2SGPE 1O36A 1TALA 3RM2H 1V2PT 2UWPA 3U9AH 1EPTA 3SU1A 4H6SB 3T26A 2NU3E 4FUHA 1ZJDA 2CHAC 1O31A 1E37B 3SUDA 2SNWA 2XCFA 3T27A 3UUZA 3ODDA 4AORA 1NO9H 2LIZA 3D62A 1AD8H 1IAUA 1GI5A 1O3FA 3GYMA 1GL1A 1C1QA 1FJSA 2VWNA 3ZVEA 2ZC9H 2PTCE 3RC4A 4IMZA 1MTNB 1NFYA 4D9RA 7KMEH 2ANWA 3P92A 1FMGA 2CJIA 3BTWE 4ABHA 8ESTE 2GV6A 3ZVBA 1KLTA 1GL0E 1YPEH 4JMYA 2WYJA 1TNLA 1CA8B 4XDEA 5FX6A 5F8ZA 1SQOA 2O8WA 4UD9H 4TWYA 3RU4E 1V2LT 1YC0A 2R3UA 4IC5A 1C9TA 4Y8YA 4HFPB 3LH3A 1BBRK 3EYDA 1BJVA 2M5TA 3ATKA 3U98H 3RLWH 2PHBA 5EG4A 1DX5M 1ZTKA 2P16A 5L2YH 3ZZDA 1MTSA 2FLRH 5E0JA 4HZHA 3AASA 5DJ7A 3PLPA 1QA7A 3LT3A 1EPTC 3T62A 3OTJE 1ZSLA 1GMDF 4Q7ZA 5IDKA 3ZVFA 5IYTA 2PWXA 3M61U 1F92A 3QO6A 2Y7ZA 3PROA 1PPBH 2XWBI 1ANEA 3NXPA 5HM9A 4MG3A 2GX4A 3F9HA 1GJAB 4GCHG 1GI8B 1C4U2 4FVBA 3UWIA 1T31A 1LHFH 2QXHA 3A7WA 3A89A 4WF8A 1DSTA 2HVXA 1DXWA 1C5RA 1GBFA 2VH6A 4FU9A 2ZCLP 4Y7AA 1P0SH 4X8VH 4A1VA 1ZOMA 2SGEE 4ABBA 3URDA 1Z8GA 4JZEH 3SUGA 3RMNH 1K1NA 2ZNKH 3VXFH 2TGPZ 1G3BA 1OPHB 5TJXA 1W0ZU 1A0HB 1QGFA 1TNIA 3MU4A 1AIXH 1WSSH 3Q77A 3NWUA 4JK5A 1LPZB 4IC6A 2K1QA 1NS3A 4ABFA 2ZTZA 1O2SA 1JIMA 1W0YH 4ZKRU 1DT2A 1UMAH 1WUNH 5EU8A 1OWHA 5EGMA 4E05H 4JZDH 4A7IB 3T29A 1BMMH 1O3CA 1P3EA 1HAHH 1L1GA 3RU4T 5HYOA 1H8DH 2ZGCA 2ZFPH 3BG4B 4HGCA 1OWDA 4OGYA 3TH3H 1JWTA 2C93B 4A6LA 1OWIA 1A0LA 1CA0C 1S0QA 1FIZA 2D1JA 1BDAA 4QT8C 2B9LA 2BQWB 1GJDB 4JCNA 2YNBA 3BTHE 1C5LH 4IW4E 2P8OB 3BEIB 1C2DA 1K22H 1DY8A 4AFZA 3GY3A 2BDHA 2ODPA 1O2TA 2ZA5A 3RXEA 3OU0A 4UFFH 3EA7A 4AFQA 2FI3E 1QBOA 3PO1C 2PTNA 2GZ9A 1C4Y2 1EP5A 2ZKSA 4JZIA 1AB9B 1CGHA 1G37A 1NZQH 1WAYB 3NK8A 1CGJE 2Y5FA 4YT6H 1AQ7A 2THFB 2FOMB 4NSVA 4Q7YA 1O5CB 1SSXA 1P9SA 1FI8A 1KY9A 4FUJA 4U01A 3HKJB 1BMAA 1YYY1 1GHWH 1QHRB 3M35A 1SOTA 2VU8E 1GHAG 1U6QA 3KQBA 4AFUA 1BTWA 1GHZA 4BTTB 1HAPH 1JXPA 1ETSH 2ZHQH 2H9TH 2IPHA 1GDNA 4GUXA 2A7JA 1YBWA 3H7OA 4BAKB 3DFLA 1TQ7B 2G8TA 1WQSA 1Y3YA 1PPCE 4XBCA 1HAVB 7LPRA 1F2SE 1HPGA 1RS0A 3TH2H 2B5TB 4F4OC 1LTOA 3A88A 1QJ6B 2GKVE 3KCGH 1CE5A 2RDLA 4RSPA 6CHAB 2FESH 4AX9H 2P8OC 2VNTA 3NPSA 3TPIZ 1HIAA 1SGCA 3T2NA 3VB6A 2F9UA 2Y6TA 1IQGA 1CT2E 1UTPA 3RMMH 3OSYA 2Q1JA 1T8NA 4AG1A 3ZZ3A 2G52A 5EPNA 1VZQH 5C1UA 2XBWA 1JIRA 1ESTA 1V2WT 4AOQA 1K21H 1HUTH 1C5ZB 1SGEE 4Y0YE 1UK3A 4R0IA 1TGCA 4Y76A 2F83A 2G51A 5AHGH 1O2HA 3BIVH 1V2ST 1TA6A 1N6YA 2BQ6B 3LGTA 3E6PH 2FYQA 2GGVB 1BTZA 2ZHEH 1G9IE 4A5TS 1P2MA 3MU1A 1ESBA 4UFGH 3M5LA 1KDQB 1TONA 3FP7E 1O2GH 4YZUA 4ZUHA 1HAXB 3RXTA 1JBUH 1V2UT 1D6WA 2F9OA 2ALPA 2FOFA 4INLA 2AIQA 3OX7U 1ZHPA 2VIPA 3OY5U 1ZRKA 4I31A 2XC4A 1BBRE 1EAIA 4NWLA 3D65E 3ZZ6A 1THRH 2AMDA 2ANYA 3B8JA 1TAWA 1A5GH 1P03A 4WMEA 3U1JB 1ACBE 2PGQB 2BMGB 5GWZA 1K1PA 1ESAA 3UQOA 1E36B 5HGGA 2A7CA 1PPFE 1XXFA 3PLBA 1SGQE 2PW8H 3DD2H 4D76A 5TCAA 1UTQA 1GWAA 2XC0A 2ZDMA 1B0EA 4YO9A 1CSOE 1NRPH 3ESTA 2BY5X 2Y80A 3BTME 4AB9A 5JYIA 1V2KT 2CHAB 2C8YB 1O3AA 1D6RA 4K1TA 3K6ZA 3MH4A 2A5KA 5AVDA 4X6OA 1TX7A 1KXFA 1BRCE 1O2WA 3LH1A 3MHWU 4IN2A 4NZQA 1LHDH 4B2AA 1LQEA 3TJOA 1S82A 4BOHA 3Q00A 3MNBA 1QL8A 2Z3DA 1MTUA 3I77A 4MNWA 4CHAC 3BSQA 4UE7H 2BDCA 2OINA 1Y3WA 1FY3A 1CO7E 1WYKA 3QX5H 4MNYA 4E06H 1NU7B 4LOYH 1DSUA 1D9IA 2A1DB 2XYAA 3R3GB 1FAXA 2UWOA 3ATWA 3RXUA 2P94A 1RIWB 2GDDA 2PKAB 3MO9A 4Q2KA 2ZHWH 4VGCC 3LJJA 1BRAA 1P11E 4THNH 2QN5T 3ZZAA 1A5IA 1RXPA 2R2WU 5L2ZH 1P2NA 3BEUA 3SOSA 1A4WH 1Y3VA 3F9FA 2J4IA 4WH6A 3MFJA 1S85A 4VGCB 3A8AA 3RXAA 1O3OA 2BOHB 2EA3A 1YPHE 2XCNA 2TIOA 3GDVA 1GBHA 1W3CA 1FONA 2FODA 1HYLA 5GPIB 1XVOA 1O5FH 2O8LA 1Z1JA 3M7QA 4NSYA 1HRTH 1XMNB 3FVFB 3F6UH 4TWWA 5E0GA 3VB5A 1Q31A 4MLFB 4ZAEA 5E2PA 2QXIA 3SV2H 1AVWA 2EEKA 1QR3E 1EUFA 3URCA 2J2UA 5C5NA 5T6GA 3P6ZB 1TB6H 1SG8B 1OYTH 3ZVDA 5E8EH 1C1SA 1AFQC 3ZZ5A 1SQAA 2Y7XA 2ZFRH 4X8SH 1O2VA 4CRCA 1GG6C 2GZ7A 1NM6A 4OS4A 2Z6BD 4AG2A 1NFUA 1O2UA 1SGPE 5GCHF 1QTFA 1O2YA 3S9AA 5A0AE 2ZZUH 4DT7B 1C5YB 1K2I1 1GBAA 1C1WH 2OQUA 3SNBA 1IHTH 2R2MB 1G3EA 2SGFE 2XRCA 2SGAA 1GGDC 1TE0A 3QLPH 1ELDE 1BTPA 3M3SA 2BX3A 1IQMA 1O0DH 3E90B 4X1SU 4MNVA 1O2RA 1WCZA 1CGIE 1F5LA 1LKAA 2TGTA 2G5VA 2TRMA 3RXFA 4TY6A 1BMNH 1VITG 2KAIB 2VIWA 3UNRA 4Y7BA 2D8WA 1ZPBA 1P9UA 3GY7A 5AFYH 1SOZA 2ZIQH 1GI0A 3MH7A 1DWBH 5FHTA 1W2KH 2VIOA 1C1RA 2H9HA 2IOTA 2STBE 1DXPA 1P8VC 3A8BA 5C67A 1EX3A 3PTNA 2XXLA 2BDBA 1QL9A 3RU4D 1BIOA 3F9EA 1GJ4H 4KTSA 1HLTH 4FU7A 3SJ8A 3ODFA 4X6MA 5C1YA 3QDZB 1AI8H 1GJ6A 4UFEH 5F8TA 1AMHA 4O03A 1AKSB 4FVDA 4WXVA 4NA8A 4ABJA 1ZGIA 2Y81A 1ZZZA 1A2CH 1F0SA 3MNXA 3STIA 1C5XB 1P09A 2EC9H 2GD4B 1ABIH 1O3GA 1YLCA 3SNAA 3ZZ7A 4B2CA 3RMLH 1H1BA 1QQ4A 2ZFQH 4GLYA 4BAMB 1O3IA 5T6DA 3JZ1B 2WPHS 1TGBA 1K1LA 1V2TT 2CF8H 1H9IE 2G5NA 2Z9LA 1KXCA 4ZKOU 2A4OA 1GJ9B 1Z7KA 2ASUB 4I7YH 1OWKA 1XUHA 2BQ7B 1YF4A 5FBIA 2BY7X 1DUEA 4B73A 1LMWB 2QV1A 3SZNA 4ZHLU 2ZU1A 1C5NH 5TCCA 1YPGH 3F9GA 1J15A 2Q6GA 1MTNC 3ENSB 3HGNA 5DP8A 1YCPH 4ZXXH 3KQEA 2OBQA 3K6YA 4F49A 1FY5A 2PSXA 3TJUA 4NZLA 2QC2A 1ZR0A 1VR1H 3UOPA 1ARCA 3RP2A 1FPCH 5EQSA 1TIOA 2BD7A 4DVAU 1OX1A 1KSNA 3P17H 3KQDA 2HRVA 3KF2A 2GCHF 2W5EA 4TPYA 1UVSH 1GI2A 1N1LA 1HIAB 4PROA 3PYHA 1BTUA 2BD8A 2FYRA 1GCTC 3BV9B 3P95A 1ZMLA 1DANH 3UR6A 2BY8X 4FUDA 1NRQH 4BTUB 1SGRE 3I29A 3A7VA 5DP7A 1GBTA 4ZXYH 2WUBA 4JYVH 3E0NB 1H4WA 4CRDA 3V13A 3T28A 1L1JA 5JPMH 3EBNA 3VB3A 3LGWA 2ZHFH 1GG6B 3Q76A 2TGAA 2O9QA 2BVRH 4A1TA 1C9PA 4FUEA 1IQHA 1LHEH 2LNCA 1KTSB 1UTLM 4CH2B 2K7XA 6ESTA 1G3CA 2HOBA 4X1QU 2AMQA 2ZU4A 5E2OA 4HI3A 3SNCA 1CT0E 1EAUA 3MMGA 3SI4H 3VXEH 1LVMA 3MH5A 2WPLS 3FAOA 4K8YA 1G2MA 1GI4A 5JBCS 1SVPA 3TIUA 2C8XB 1UCYH 1IQNA 1DOJA 4WH8A 4WXIA 4IBLH 6GCHG 1BTXA 3VB4A 1RTLA 3QGJA 4INKA 1TABE 4NG9H 2A7HA 2ZEBA 3SQHE 4OS2A 1AO5A 1AWHB 1NC6A 3A8DA 1QURH 4OS1A 1L0ZA 1TLDA 2PV9B 1UVTH 3RXIA 4CBNA 2ZCHP 1K1IA 4CR9A 1XX9A 3A7XA 1TPAE 4D7GA 1JOUB 3MO3A 4O97A 3GY4A 3IITA 4ZROA 4BTIB 4AFSA 4FUCA 2FWWA 1TRNA 1ANCA 2ZDVH 1EZUC 3A7TA 4MPXA 3KQCA 4YOJA 4YM9A 1LVBA 1TNHA 1DVAH 2TBSA 3SBKA 3UTUH 1DLEA 4AYYB 5A09A 5JB8S 1AFEH 1E38B 2ZECA 1P2KA 1MCTA 2SGDE 3IWMA 4ISOA 3ATMA 5A0BA 1C2LA 1X7AC 2GV7A 5AFZH 4JZFH 3W95A 1ZYOA 2QF0A 1T4VH 6CHAC 3OYPA 3HATH 1D3TB 1GJ7B 3GDSA 2A0QB 2EI7A 2WV5A 4FUIA 3ZZ4A 1LVYA 2D2DA 4K69A 1HV7A 3SUFA 1C2EA 1H9LB 1TQ0B 2Y5GA 1A5HA 5HM2A 4FUFA 2FIRH 1SFQB 4ZHMU 3LONA 1FY1A 3O8RA 1C5MD 3SU4A 3VGCC 3PMJA 1FAKH 2EI6A 3BN9A 4ISHH 5ETXA 1O5BB 1GI6A 3FZDA 1DS2E 4B74A 1IQKA 1ZRBA 1A61H 3U69H 3RXVA 1C5UA 4JK6A 1SFIA 1V2RT 1XUKA 2B7DH 2A5IA 5EOKA 2P3FH 3U1IB 3PLKA 4A92A 3KN2A 2STAE 2ZPSA 3E8LA 2OC8A 3KHVA 3O8DA 1HXFH 3HK6B 3SV8A 5CE1A 4FU8A 1MZDA 4GHQA 2FEQH 1LPKB 3OY6U 4E7RG 3EGKH 1NY22 1SLXB 1L4DA 1WBGB 2FX4A 1FY8E 1C5VA 1UK2A 1UCYE 1P2OA 3LPRA