1Z1JA

Crystal structure of sars 3clpro c145a mutant
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Understanding the maturation process and inhibitor design of SARS-CoV 3CLpro from the crystal structure of C145A in a product-bound form
pubmed doi rcsb
source organism Sars coronavirus
total genus 67
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1z1jA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z1jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z1jA02
4AFUA 1ZMJA 1L4DA 1C5OH 1P2IA 1BOQA 1C2FA 1CGIE 1QL9A 2SGPE 2GZ9A 3EYDA 2ZHQH 4U2WA 1DLEA 3TJOA 1ELEE 1D4PB 1FY4A 1QRZA 4DT7B 2STAE 2WYGA 3F68H 3LC3A 1D6WA 2C8ZB 2VINA 3RXCA 3NKKA 2ZF0H 3HK6B 1BTHH 4O03A 3MTYA 1WOFA 2CJIA 1ZHMA 1SGNE 1EAWA 1O2PA 1RTLA 1AE8H 4X8TH 3GY2A 1HB0B 1QBOA 2GVFA 3A7XA 4JK5A 3V0XA 1JMOH 3VEQB 4Y8YA 4CHAC 3E3TA 3KQEA 1FXYA 2P8OB 2RA0A 2VH0A 5A0AE 1UK3A 3EDXB 1GJ4H 3KQBA 2C4FH 5EU8A 3ODDA 2Z94A 1DWEH 1ACBE 3BTTE 5DPAA 3TK5A 1P8VC 3LH1A 4MPXA 1GBDA 4XFQA 5L30H 1LPGB 2Z3DA 5HM2A 1SBWA 2VGCC 3MH6A 3SJ8A 1BBRH 1O30A 3RXTA 4JYTA 3ZVAA 3D23A 1TX7A 1P2MA 1TGSZ 4FUCA 3GOVB 4IBLH 1HJAB 3N7OA 1N8OC 1S0RA 1E34B 1LKBA 2BY9X 2EI8A 1T32A 3S9BA 1F7ZA 3MI4A 2P16A 1Q31A 2ZEBA 3M35A 2HWLB 1XUFA 3I77A 1FI8A 1ZTJA 1VITG 2TRMA 1XUGA 2G8TA 2H2ZA 1K28D 4AG2A 4INKA 2QIQA 2BQ7B 1ABJH 2NU3E 1GHVH 2BOKA 4H6TA 2HVXA 4MNVA 1AE5A 1CHOG 3RXPA 1NRSH 3M3VA 3A86A 1IQKA 2GT8A 5I46H 2GDEH 1YCPH 1NC6A 1KSNA 1PQ8A 1QIXB 1WV7H 4ASHA 1P06A 2ZDKA 1EKBB 2OP9A 1CA0B 1SMFE 3OU0A 1BTUA 3RXUA 3SUEA 3VB7A 1C1MA 1NM6A 4K69A 1HAOH 4B2CA 2AGIX 4R8TB 1BRCE 2A45B 1O2TA 2P59A 3T62A 1LVOA 2BVXH 3MH7A 4JYVH 2UUYA 2OXSA 1FONA 1BTZA 1ANBA 1TWXB 2JH6D 3RXBA 5GXPA 2JETC 3A8CA 1P09A 1ANCA 4BAKB 1O5FH 1UK4A 3RXVA 1P2JA 1A5IA 2ALVA 3LGYA 2QV1A 2ZFTA 3QTVH 4A92A 2AIPA 1ETRH 2FOHA 5GDSH 4UE7H 1C5MD 6ESTA 3EAJA 1QRWA 1N1LA 1P02A 4JYUH 5TCCA 2QGRA 5HM9A 5JBAS 1G2MA 1S84A 2AIQA 4BAHB 3SNBA 4BAMB 1VCWA 1HAYB 1ZJDA 3KHVA 3RMNH 3T25A 1O2RA 4BOHA 1MKXH 1O2LA 5E0GA 1UVTH 1P9SA 4K60A 1CE5A 4ABEA 3TLOA 4DGJA 1GHAG 1BDAA 1FZZA 1HAXB 5A2MH 1ZRBA 1FY3A 2WPKS 3NK8A 2ZC9H 1C1WH 1SGFG 2P8OC 4FVDA 1NT1A 1AD8H 5PTPA 1PPZA 4IN1A 1DXWA 5LPEA 4ZKSU 3PTNA 3IG6B 2PLXA 1V2UT 4FUGA 4U32A 3UWIA 1Z8JB 2FLRH 7LPRA 1DVAH 3ATIA 2P3TB 1ESTA 1GBKA 2FI3E 2B8OH 1QFKH 3OY5U 4CRCA 2TIOA 1MUEB 2QC2A 3UR6A 1MBQA 1J17T 1S0QA 4ISLA 3RM0H 5FCKA 1WYKA 4MQAA 2F9NA 4PROA 2FTMA 2OBOA 4BANB 2GT7A 3GY5A 1S6HA 3QGNB 1HJAC 1ELAA 3HPTB 2BX4A 1VITF 1EZXC 3GYMA 1ELCA 4RSPA 2UWPA 1V3XA 1DFPA 2A7HA 1TONA 1GDNA 1NZQH 2ZHWH 4NIYA 1P10A 5ESBA 1UTQA 2OC7A 2R3UA 3GCTG 3SV2H 2WYJA 1W8BH 2ZTZA 1Z6JH 1W0YH 2R0LA 2F9BH 3UOUA 1IHSH 5EGMA 1CHOF 1DY8A 1NS3A 3URCA 1IQIA 1H1BA 5J4QA 2G55A 1XXFA 1SOTA 2EI6A 4X6MA 1O36A 2P94A 3T2NA 1A46H 1C4V2 4KELA 5C5NA 2F9PA 2NU1E 1GCTB 3PTBA 2ZECA 3TH4H 3E1XB 1WU1A 4NA7A 5JBCS 1A0JA 6CHAB 3BF6H 4CBOA 3KN2A 5A09A 5CMXH 3EBNA 2ZG0H 1SGEE 3SOSA 3T5FH 1O2VA 4DG4A 1XX9A 2C90B 2TBSA 1C4U2 2GZ8A 4NCYA 1AY6H 1TGBA 1A3BH 1UCYK 4FUDA 3PROA 1IOEA 1O2KA 1YPMH 5GIBA 1PPHE 1P2OA 3S7KB 2OC8A 4BTUB 1O2HA 2ZFQH 4Y10E 1ID5H 4ABIA 1UVOA 2FI4E 1THPB 3A7TA 1OOKB 1NROH 1O3PB 1JOUB 2PKAB 1G2LA 1AIXH 1EATA 2GCTB 1TNGA 1GBMA 3PWBA 2ZFPH 3LGUA 2W26A 1ZJKA 4NA8A 5EPYA 4SGAE 3KNXA 1P57B 4TY7A 1RFNA 3ATLA 4NFEA 2A5IA 3UY9A 1PQ7A 1TALA 3OSYA 3O8CA 1GJAB 1BTPA 3ZZ6A 1GHAF 3FFGA 3O8RA 1C1QA 4GPGA 2LPRA 3ZZ9A 1P05A 3A82A 3RC4A 3KIDU 3RMMH 2HPPH 3S69A 5GWZA 3T26A 2ZHFH 3SGQE 1J15A 4A1TA 3BTKE 1GHBG 1WTGH 3MU5A 4Y7AA 3UQOA 1BITA 2GCHG 1XKBC 3GDUA 1LHFH 4AOQA 1DUEA 1Q2WA 4ISOA 3SNCA 1ZSLA 5DP6A 1OYTH 3UFAA 3V13A 3RM2H 2LNCA 5AFYH 2AEIH 4B2BA 2FOEA 2ZU1A 2FX4A 1FNIA 3AAVA 1DE7H 2ZCKP 5GJ4B 3ZYEA 1FN6A 4Q7ZA 3SU3A 3RXAA 1O33A 3DHKH 1SOZA 2XC4A 3EQ0H 2ZP0H 1V2OT 3CP7A 5T6DA 2Y5FA 1NFXA 4NZLA 4K1TA 2EA3A 1EQ9A 4UD9H 3GDVA 1VJ9U 1GJ7B 2PR3A 3A80A 1FPCH 3ZVBA 4NWLA 2O8MA 3SV7A 1KXAA 1O3BA 1LMWB 4IS5A 3DFLA 1IQJA 3UUZA 1D3TB 1FIWA 4Y79A 1NO9H 1FIZA 1MCVA 1O3HA 1SGRE 3K6ZA 5GCHF 3HKIB 1K1IA 1SGCA 1YC0A 3U8RH 1RIWC 3K2UA 3BSQA 1D3DB 4E05H 3A7WA 1UMAH 1B0EA 1P11E 2RG3A 4OS5A 2P3FH 2QY0B 4KP0A 1W12U 2STBE 2O8UA 2BM2A 2PFEA 6GCHG 1P2KA 3UQVA 2JKHA 1C5ZB 3RU4T 2QF3A 1EXFA 1FAKH 3ITIA 1TB6H 2QXJA 1DPOA 4YLUA 2ZNKH 3UNQA 1PJPA 1KTTB 1O31A 2BY6X 5FBIA 2BDCA 1SGQE 3EA9A 1QR3E 2Z7FE 1MU8B 1HBTH 4ZROA 4B76A 1HGTH 1EZUC 1GMHG 3H7TA 1S82A 2OQ5A 3ATWA 4DY7B 4A7IB 1O2IA 2Z3EA 1BRUP 4X6NA 4OGYA 2TGAA 4AFZA 2ZQ1A 1UHBB 1C1VH 1MD7A 3B8JA 1F5KU 1ZGVA 1AI8H 1UVUH 3L33A 4XSKU 1GI0A 2WPMS 1XUHA 2J34A 2PTCE 3D49H 2RA3A 3KCGH 4HTCH 1GBBA 2ANKH 4ZXYH 3S9AA 5C1XA 1ETTH 1OP0A 1BA8B 1VZQH 4X8SH 2OINA 4ABBA 5E8EH 1AKSA 1GPZA 3IWMA 2ZPRA 1GHBF 1PQ5A 1C2DA 3M3TA 3E16B 1HV7A 1QY6A 2QXHA 1BBRE 2XXLA 2ANMH 1RD3B 3OYPA 2J38A 3MMGA 1EPTC 1RGQA 1C9PA 1ABIH 2F3CE 2WPIS 1Y3UA 1OWJA 3QUMP 2TGPZ 3M7TA 1IQFA 1OWKA 1E36B 3LJJA 4TY6A 1SSXA 1SLWB 1MTUA 1TQ7B 2FOFA 1UTMA 1TNKA 2A1DB 2G4UA 1P9UA 4Z0KA 1DLKB 1VCQA 4Y6DA 2XWBI 1QBVH 1D9IA 2VJ1A 2GV7A 1DM4B 3LJOA 3RDZA 3QZRA 1QQUA 2BDAA 1ZOMA 4NIXA 3MH4A 1FAXA 4HFPB 5DO4H 1BMMH 1TABE 1T8LA 2H5CA 2PUXB 1VGCB 2JH5D 4ZKOU 3ZZ3A 4NA9H 4ESTE 1UTNA 1YPEH 2H5DA 1A1RA 3RUOA 3H5CB 1AGJA 3PYHA 2ZPQA 1C5VA 1ELVA 2AGEX 2SGQE 2BZ6H 4UFDH 2ZHEH 1XXDA 4TYDA 1ZYOA 2Y82A 3MH5A 3BIVH 1TGNA 1DSUA 1Y5AT 1QJ6B 3SNEA 4Q80A 1K1NA 1O2NA 2OCVB 4XBCA 1RXPA 3LGVA 1GJ5H 2GDDA 4DW2U 1K1PA 3DD2H 1O39A 4AFQA 3D65E 2BDIA 1C2KA 1DITH 5LPFA 1NU9A 2OLGA 1FY8E 3IITA 1TNIA 5LGOA 2F9VA 5T6FA 3RU4D 4JMYA 1J9CH 1KYNA 1SPJA 2HNTF 3JZ2B 1Q3XA 2BHGA 4I32A 4Y7BA 1Y3XA 3UIRA 1S5SA 3K6YA 1GBLA 1A61H 1FJSA 5FX6A 2ZKSA 4JZ1A 5DGJA 1O3JA 1GMHF 2J95A 4X1SU 1ZGIA 3RLYH 1YKTA 2G51A 2R2WU 1DSTA 1MBMA 3SZNA 1GGDB 3F9FA 1O38A 1SL3A 3P70B 5EODA 1O3LA 2AERH 2FO9A 2WUBA 8ESTE 1KLTA 3SI4H 2W3IA 1SHHB 4Q2KA 5DP4A 2BXUH 1Y3WA 1KLIH 3JZ1B 3MO3A 5JYIA 1LCYA 4OS4A 5FCRA 1GVZA 3P8NA 1SB1H 1AZ8A 2BY8X 2THFB 3CS7A 2PV9B 1BZXE 3KEEA 2G00A 5DG6A 1K21H 2UWOA 2BLVA 1QBNA 1T4UH 3F9HA 2BDGA 3CENA 4JZFH 4I8GA 1FLEE 5BRRE 5ETXA 2CV3A 2F91A 3BN9A 1IQHA 1GCDA 3PO1B 4CH8B 4MPWA 1SI5H 1ZHRA 2Y6TA 3RLWH 3UTUH 3A8DA 3RU4E 2VIPA 3M37A 5DP7A 1UTPA 2BDYA 1W7GH 1CQQA 3BIUH 1YCPK 1EOLA 1EJMA 1OXGA 2ZGCA 3DUXH 4TWWA 4UEHH 4Z6AH 4RKOB 5FHTA 1P0SH 2C8YB 4LXBH 1SGPE 1FQ3A 1A5GH 1GI7B 2Z6BD 3I78A 4ABGA 5EQQA 1VR1H 2BZAA 3PB1E 4FUBA 3MU0A 1G36A 3VGCB 1QHRB 5EW1H 2J94A 4ZHAA 4ISNA 1SGDE 1TPOA 4OS1A 3ZVDA 1G3BA 2HPQH 2ALPA 3MWIU 1L0ZA 1WSSH 2WPJS 1DWBH 1Z71A 2BYAX 3KQDA 4WF8A 3ZZBA 1O2GH 4ZKNU 5JBBS 5L2ZH 3A81A 3UREA 4MLFB 1O3FA 4X2VA 2PGQB 1EAUA 3ZZAA 1S81A 4GVUA 1W3CA 3GCNA 4NIVA 3MHWU 2K1QA 1LQEA 1PPCE 3HK3B 3M5LA 2P95A 3LT3A 1RS0A 3A85A 2GKVE 3A83A 1TFXA 2ZDAH 1TBRH 2WPLS 5K0HA 1WQSA 5ESTE 1EB1H 1SGYE 1F5RA 2CMYA 2GX4A 1PQAA 3MU1A 1AB9C 2O8TA 2BLQA 2YNBA 3NUMA 4D9RA 1B0FA 7ESTE 5EPNA 3RXOA 1C5XB 1NFWA 1S85A 2SNVA 1GBFA 3VB4A 1TPPA 2A5AA 2ZQ2A 1FN8A 3RXJA 4GCHG 4ABHA 2ZI2H 2J9NA 3AASA 4D8NA 1TNHA 2BY5X 4IGDA 1H8IH 5DP5A 4I8LA 3ZVEA 1ZSJA 2Z9GA 3LPRA 2XBYA 3ZV9A 3GDSA 4MNWA 3ZVFA 2A4GA 1FDPA 4UFEH 2AMQA 4YESB 3SJ9A 4DIIH 1DT2A 1A0HB 1EP6A 5C3NA 2SGEE 4SGBE 1PPGE 3ODFA 1V2VT 1T7CA 2FIRH 1W13U 2ZCLP 4K1EA 2FXRA 4Y0YE 4YOGA 1TIOA 3SO3A 3U98H 5EW2H 4U01A 3TU7H 3TIUA 1W10U 2ASUB 1GBHA 1SQOA 1W11U 5HXFA 3VFEA 1LKAA 1OYQA 2SGFE 1C2HA 1DWDH 1XVOA 1HCGA 2O8WA 2FEQH 1UVPA 1SFQB 1MTSA 1QA0A 3FZZA 1HAVA 4JZIA 3C1KA 1G32B 4FU9A 3VXFH 4AFSA 5GPIB 4YLQH 2VU8E 3AW1A 3BTHE 1NY22 3LOXA 1QJ1B 2BVSH 1MQ6A 1QL7A 1UTJA 1O2WA 2IJOB 1YBWA 3QWCH 2W3KA 2W5EA 1K9OE 2J92A 1GBEA 4KGAA 4B1TA 3TH3H 4AZ2B 4X2YA 3HGNA 4MVNA 1C5UA 3QLPH 1BHXF 3RC5A 8KME2 5DK1A 4JK6A 4KTSA 1CVWH 3RXGA 4K2YA 4ZUHA 1KLJH 1Z6EA 1OWDA 1O2UA 3NPSA 3L3TA 2NU0E 4ABAA 1KDQB 1MTVA 2BMGB 2TGTA 4I8KA 3ZZ4A 1B5GH 3TJNA 3TVJB 4TWYA 2M5TA 3BEFB 4FU7A 2Y5HA 2FLBH 3SJOA 1DOJA 1PPEE 5A0BA 5F03A 1DY9A 2KAIB 3V3MA 3BG8A 1P01A 1GMDG 1GBIA 3MO6A 3TGIE 4OS6A 1SFIA 5GCHG 1N6XA 2VVCA 1CA0C 4X2XA 3SJKA 3AVZA 4AN7A 5F8ZA 1O5AB 2HRVA 4YT6H 4AYYB 3EGKH 1UJ1A 1O32A 4I8JA 4YTAA 3SNDA 1GMCF 1HLTH 1QB6A 4FUHA 1O37A 4B73A 1BIOA 4IC6A 3E8LA 1AWFH 3SV8A 1TLDA 4HZHA 3K9XB 1VCPA 1YM0A 3VB6A 1KIGH 1C5NH 1WAYB 3GCHB 3RC6A 1ESBA 1P3CA 3VB5A 2FZZA 4H42U 3MNCA 3F9GA 1LVBA 4CRAA 4GCHF 5BPEA 2RCEA 2XW9A 5H4IB 1WUNH 1GVLA 4AX9H 1TBZH 1O2OA 2QYIA 5DP3A 1AKSB 1UK2A 2PKSB 2R2MB 2ZWLH 2VWNA 1E38B 1WBGB 1SC8U 3M61U 3SORA 3T28A 2K7XA 4AYVB 1SR5C 3E0NB 1QQ4A 1C2MA 1S83A 1BMNH 2BXTH 1MAXA 1YPLH 3SBKA 1A2CH 1FY5A 1GI4A 5TJXA 2VVUA 3F1SB 3PM3A 3KGPA 1Z8RA 3W94A 2FOGA 1G3CA 1O3CA 1O35A 5JPMH 1GBTA 1V2KT 2A4QA 2A2XH 5C1YA 3U8TH 3P95A 2Q6DA 1UVSH 3B9FH 4CREA 1DDJA 1CT4E 1BJVA 1O3EA 2A7CA 4CH2B 4MPVA 1EZQA 4F4OC 3SUFA 1DXPA 2PSXA 2QF0A 3RP2A 3RXLA 1V2TT 1SVPA 5FAHA 4NWKA 4E7NA 1RJXB 3SGBE 1LVYA 1GG6B 1O2QA 2QXGA 4Y0ZE 1HJ8A 1IHTH 4UFGH 3RXEA 1CGHA 3FANA 1C2JA 4YZUA 1VITH 4D76A 8GCHF 1J14A 1WCZA 1PFXC 1O3OA 2ZZUH 2FM2A 4DIHH 2HALA 3FVFB 3SU5A 1O5DH 5EOKA 1JIMA 2ZIQH 9ESTA 1EJAA 1QNJA 2AMPA 4BNRA 2C8XB 1GI9B 4Y8XA 1YF4A 3V12A 2GMTB 7KMEH 1XM1A 4JZDH 2ZGXH 3OY6U 1Y5BT 1GMDF 4HGCA 1SLUB 5FBEA 2WPHS 4GSOA 3UWJH 2BY7X 5EQSA 1HYLA 1EOJA 1TRMA 4J1YA 5E2PA 2XBXA 1GCTC 1JXPA 2ZPSA 5EQRA 1HAPH 2FOBA 2UWLA 1OWIA 1ZPBA 2C93B 1SLXB 6CHAC 1KY9A 3M5MA 1T8OA 2P3UB 1LQDB 4UONA 4J2YB 1H8DH 3R3GB 4CRDA 1V2ST 1CA8B 1Z1IA 3KL6A 5CE1A 2R9PA 1O34A 1GJ8B 3LH3A 3BTEE 4F49A 3A7ZA 1O5CB 1CHGA 1ZR0A 5FXLA 1EASA 4B74A 4THNH 4KTCA 3OTJE 3QX5H 3SJIA 1AFQB 3MO9A 3OX7U 4GHQA 1ZTKA 2XYAA 4Y8ZA 1L1JA 3QK1A 4WMFA 3BTME 2BD9A 4E06H 1HRTH 3F9EA 4ZXXH 2GCTC 1QL8A 1TA6A 1MZDA 1NFYA 1MQ5A 4DJZB 4CRFA 4A6LA 3PMAB 1T4VH 2ZDLA 1THSH 2ZTYA 1C5QA 3SI3H 1KTSB 1V2QT 3MOCA 3SQEE 4IMQA 3ATKA 3SHCH 5I25A 3RXFA 4FUEA 2A7JA 1MTNB 5C20A 4D9QA 1THRH 3M7QA 1ELTA 4Y11E 1F2SE 1FV9A 2XTTB 4NSYA 4YT7H 4ZHLU 5TCAA 2A0QB 2V35A 3SHAH 4DOQA 3RXSA 1C5RA 2XCFA 2Z9KA 1DWCH 2PKAA 4DVAU 2GP9B 2XBVA 1C5SA 3MU4A 2FS9A 5G4BA 1C5LH 5T6GA 1SGFA 1TOMH 2J4IA 3Q3KA 4K1SA 1SQAA 1HNEE 1SG8B 1HAGE 2SGDE 2WINI 1M9UA 1W0ZU 4YM9A 2FWWA 1YPHC 3U9AH 2CHAB 1GHXH 2NWNA 3SUDA 1GG6C 2SGAA 3F6UH 1A3EH 2IOTA 4RN6A 1V2MT 1IQEA 5DP8A 1HIAA 2OUAA 2VGCB 1ZSKA 4BXSA 3M5OA 5LH8A 5SGAE 1AVGH 3VXEH 1ZMLA 1AO5A 5JBTA 1H9LB 1Z1JA 4BTTB 3SV6A 4K3JA 1PPBH 4IN2A 2ZU5A 2BQWB 1GVKB 1O2YA 2NU4E 3LONA 3M36A 1L1NA 3RMOH 4GAWA 2FYRA 5E0HA 1SHYA 1MKWH 1QTFA 1JIRA 1EPTA 4WVPE 2ZO3H 3STJA 8LPRA 3LDXH 1XKAC 5C67A 2B9LA 3ATMA 4ISHH 2G52A 1H9HE 2ZGJA 1T31A 4FUIA 4GUXA 1TAWA 1ELGA 3W95A 4LZ4B 2G81E 2HGTH 4AGKA 2PHBA 1GWAA 3TNSA 3UR9A 5FPSA 2Y5GA 2D1JA 3P17H 3SW2B 2G5VA 2I6QA 1IAUA 1OSSA 4LZ1H 3LU9B 5EXNA 4WXVA 3MNBA 4BAQB 3SU4A 4AB9A 1K2I1 2O9QA 2PW8H 1AFQC 4ZAEA 4WWYA 4QT8C 1GI1A 4M7GA 3UOPA 4U30A 3GICB 3TK6A 1GHZA 2CN0H 4R0IA 4WH8A 1XUJA 2ILNA 1ZLRA 2VB0A 4B71A 4X1QU 4LK4A 5F8XA 1QURH 1V2JT 1O3IA 1OPHB 3BTDE 1ZHPA 3BTWE 1O3GA 2YNAA 2ULLA 4D7GA 1HAZB 1HAVB 1BBRK 1P04A 3CS0A 1FPHH 3LGWA 2ZTXA 4VGCB 3BTQE 4O3TA 2ZU2A 1C2EA 1ARCA 5E2OA 1V2LT 4WH6A 2QCYA 1MTNC 1IQNA 2W7UA 2BB4A 5EXLA 5AVDA 2Y81A 1GI8B 4AG1A 1Z7KA 1GL1A 3M7UA 1MTWA 3Q77A 2TGDA 1AQ7A 1VJAU 3TGKE 3Q76A 2VVVA 5FX5A 4NZQA 4FU8A 2FYQA 2P93A 3U1JB 4ABDA 5L2YH 1QJ7B 1TA2A 4B75A 1BJUA 3ZV8A 1O5GH 3EA7A 4H6SB 1NRRH 2RDLA 3P8FA 4XOJA 1TNLA 1ARBA 3U8OH 1E35B 3PV4A 4CR9A 4WMDA 1EUFA 1A4WH 1O0DH 4XE4A 1P2QA 1UHBA 1XUKA 2VIDA 1EAXA 2FX6A 1Z8IB 2CHAC 2V3HH 3QO6A 1GDUA 3RXIA 2ZGBH 6LPRA 2H9EH 3HATH 1LHGH 1BMAA 5IDKA 2OTVA 3VPKA 3QGJA 1TBQH 1KXCA 3HGPA 2CF8H 2H9TH 1MCTA 2ODPA 1O2XA 3FAOA 1F5LA 4YOJA 3TGJE 1VGCC 4I8HA 4K8BA 4I31A 2BD5A 4WJG2 4B2AA 3KQCA 2C8WB 4GHTA 1DS2E 1BUIA 1QRXA 4MDSA 1C1PA 3UNRA 1FY1A 1EJNA 1AUJA 4BAOB 2ESTE 3HKJB 2W7SA 1ZPCA 4IC5A 1HXEH 1GBAA 1LHCH 2B5TB 1C5TA 1V6DA 2BLWA 1AMHA 3BV9B 1U6QA 1F92A 1AZZA 1DUAA 3GISB 2HNTC 1J16A 3S9CA 2A2QH 4D7FA 1RTFB 1GMCG 2FODA 4Y76A 2FMJA 1OKXA 2OQUA 1JRTA 1ELDE 4NGAH 1QA7A 2BDBA 1MKXK 2Z9LA 1BTXA 1BMLA 4X1PU 1AUTC 3ZZ5A 4UFFH 1GJBB 5HMAA 1C1NA 1A7SA 3LIWA 7GCHF 1WTHD 1O5EH 1MU6B 1GJCB 3M5NA 3LC5A 1C2IA 1ZZZA 4LOYH 3FP7E 1EX3A 3I29A 4MTBA 3U1IB 1ZTLA 3P8OA 5AFZH 3TH2H 3L6PA 5C5OA 4ZKRU 3PMHB 3P8GA 4K8YA 1C5PA 1PPFE 1F0UA 2EC9H 2ZFRH 2H9HA 4IW4E 3GY6A 4I33A 5JB9S 3STIA 2SFAA 5HGGA 1OX1A 1NU7B 2J2UA 4WXIA 5DKMA 3SQHE 1GGDC 4MG3A 3E6PH 1TE0A 5A8XA 4TPYA 3TITA 3VB3A 2B0FA 5AHGH 1TRNA 2CGAA 1AN1E 2FPZA 3NWUA 3PLPA 1C1TA 1UCYE 2ZU3A 4VGCC 3T27A 4KTUA 1MMJN 1GJ9B 4RKJB 2IN2A 1X7AC 1AWHB 1C2GA 1F0RA 1TYNA 1O3KA 1ZPZA 2F9UA 3RXKA 5L6NH 3LGTA 4FUJA 1BHXB 1XUIA 3FP8E 2PTNA 3ZYDA 2A4OA 2A5KA 4IMZA 3PO1C 3FP6E 2VWOA 1EZSC 1P03A 1LHDH 1Y3YA 4OS7A 1UTOA 5E0JA 4X8VH 1NPMA 1ANDA 1NESE 2BLOA 1CU1A 2UUFB 1G3EA 1C1RA 3SU0A 1PYTC 3B23B 3V7TA 3EE0B 4X0WU 2AGGX 8GCHG 3GCOA 1P12E 1W7XH 2OD3B 3SNAA 3ZVGA 1NRQH 3GY4A 1O3AA 3VGCC 1HFDA 1HUTH 2NU2E 2BD8A 4OS2A 1NRNH 2ANWA 2BTCE 1SLVB 5JDUB 2BDHA 3EA8A 1IQMA 1DANH 3D62A 2FP7B 1AHTH 2SNWA 1AU8A 2IPHA 1O2SA 4MNYA 3RXHA 4Q7XA 5ABWA 3ELAH 2VWMA 2O8LA 1N6YA 4X6OA 1F0SA 3M3SA 1CT0E 4FUFA 1ESAA 2QN5T 2UUKB 3MYWA 5EG4A 1K1OA 2VWLA 2Q6FA 1HXFH 3ZZDA 1V2PT 3A88A 2VIOA 1GI3A 1O2MA 2FESH 4AGJA 2Y7XA 2AYWA 3A7YA 2XBWA 1T8MA 2LIZA 1INCA 2PUQH 1RIWB 1W14U 3Q3YA 2G4TA 4YOIA 4I7YH 3A84A 1C1OA 3BG4B 3BTGE 4JZEH 2EI7A 4OGXA 2G5NA 3A87A 2OC0A 1SGIB 1EB2A 1G30B 1Y8TA 4NG9H 3GYLB 1BCUH 2YOLA 1GJDB 3SUGA 1L2EA 3ENSB 2AMDA 4NSVA 1G9IE 4CBNA 1P3EA 1C1SA 2BD2A 1HJ9A 2FOAA 2BX3A 2ANYA 5HYOA 1C4Y2 2ZCHP 1GJ6A 2Q1JA 3H7OA 4X6PA 3P92A 1LPKB 4NFFA 1C2LA 3E0PB 1D6RA 1TQ0B 1O3DA 3S7HB 1LTOA 4ISIH 1Y59T 2QXIA 2Y7ZA 4GLYA 1OWEA 3TNTA 1UTLM 4O3UA 2XC0A 1KXDA 1TX6A 2PGBB 1S6FA 2ZFFH 5C1UA 3TPIZ 1UCYH 3MNXA 2JH0D 2ODYB 3U69H 1BQYA 3ZVCA 1K22H 1CGJE 2VIWA 1HIAB 1BT7A 1OP2A 2ODQA 1TMTH 1O2JA 1HPGA 4XBBA 2D8WA 3BEIB 3GY7A 3URDA 5CHAB 4XBDA 5DJ7A 2Y80A 4TPIZ 1UO6A 1BTWA 1MH0A 4JCNA 5F6MA 1YGCH 1SGTA 3RXDA 2A4RA 2AH4X 2DE9A 4CRGA 3PMBB 1GI2A 1Z8GA 1Y5UT 2V6NA 2A31A 1E37B 1YYY1 2I6SA 2ZA5A 1EPTB 1NN6A 3SV9A 1KXEA 1YPHE 4ZHMU 3E91A 1K1JA 1H4WA 4Q7YA 3A7VA 4A1VA 3SU1A 5T3HA 3BEUA 3DA9B 4DURA 2Z9JA 3QN7A 4WY3A 2VIQA 1ZRKA 1RTKA 4MNXA 1L1GA 2AFQB 2GD4B 2XWAA 2V0BA 3PMJA 1UTKA 2FI5E 3UNSA 2XNIA 4FVBA 3LKWA 3A8AA 1TMUH 2BD3A 1JRSA 5IYTA 3RXRA 1V2RT 2EEKA 1SQTA 2CXVA 4KKDA 4YO9A 1CBWB 1FMGA 3GCTF 2UUJB 3SU2A 1AVXA 4ABFA 2FOCA 3C27B 1IQGA 2V3OH 3A89A 5FPYA 1RRKA 3G01A 2FTLE 4FXGH 3ZZCA 2VNTA 1Y3VA 2PSYA 4H4FA 1XVMA 5A0CA 1CT2E 2ZU4A 1DX5M 1TMBH 3DFJA 4X1RU 1D3QB 4INHA 3ZZ7A 1NTPA 3MU8A 3NCLA 3TJUA 2ZDMA 3O8BA 3TK9A 3ESTA 1ZMNA 1HDTH 1KDQA 2B7DH 3BG4C 1BRAA 1C5YB 1MZAA 4AORA 4HI3A 2XC5A 3RXQA 3GCHC 1EP5A 9LPRA 2OC1A 3NXPA 2KAIA 1CO7E 1NFUA 1EAIA 2H1UA 3RXMA 2FS8A 4X1NU 2BQ6B 1GL0E 3BTFE 2F83A 5A8YA 1YPKH 1WQVH 1TX8A 3PWCA 2PKSC 4ABJA 3MNSA 1GHYH 1TPSA 1OWHA 5C2ZA 3GY3A 1F0TA 1YPGH 1K1LA 1GBCA 3K65B 4ZH8A 3QZQA 1B7XB 2ZDVH 1LPZB 3QTOH 2GV6A 4NIWA 2R0KA 1ETSH 2XCNA 1K1MA 2Z9IA 1LVMA 1C5WB 1KXBA 4AB8A 2GTBA 1CSOE 1YPJH 3E90B 1J8AA 2OBQA 2C3SA 2WV5A 1A0LA 3NZIA 5AF9H 3WY8A 3GY8A 2D2DA 1YLDA 4CHAB 5DP9A 3AW0A 5K7RA 2FOMB 4E7RG 3SU6A 1MAYA 2Q6GA 2QA9E 2XRCA 3Q3XA 5FPTA 4A1XA 1LO6A 1ELBA 2QAAA 1KXFA 5CHAC 3FZDA 3DT0H 2VIVA 1TPAE 1MKWK 3SN8A 4MPUA 4X8UH 1ANEA 2BD7A 2GCHF 2AS9A 4BTIB 5B6OA 1T8NA 2PWXA 1OP8A 1FUJA 1O3NA 1TOCB 1HAIH 2ZFSA 1QGFA 1ELFA 2ZHDA 4ZMAH 3AAUA 1LHEH 4UDWH 1DICA 2DUCA 1BB0B 1TGCA 3R0FA 5EXMA 3T29A 4A5TS 1IQLA 5A8ZA 1HAHH 1GDQA 2R3YA 2BVRH 5JB8S 2VH6A 2H6MA 1N8OB 2DE8A 2ZDNA 1AFEH 1AVWA 1O5BB 3SGAE 4Y71A 5LPRA 2WV4A 1W2KH 3TJVA 3UPEA 4DCDA 4BXWA 2GMTC 4O97A 1OS8A 1L4ZA 1GBJA 5F8TA 3P6ZB 1O2ZA 1E0FD 1P2NA 2D26C 1QB9A 2A32A 1TGTA 1V2NT 2F9OA 2HLCA 3O8DA 1G37A 4O9VA 4INLA 1YCPM 3S0NA 1CBWC 1XMNB 2Z3CA 1JWTA 1JBUH 3QDZB 1C1UH 4WMEA 2BD4A 4X2WA 3PLKA 1D3PB 2CF9H 2HNTE 1YLCA 3A8BA 1MD8A 1TNJA 4K5ZA 2HOBA 3RMLH 1LDTT 2ZGHA 7GCHG 2TPIZ 1C9TA 1QCPA 4XDEA 1V2WT 1BRBE 1GI6A 2GGVB 1NRPH 6GCHF 1AB9B 2GZ7A 1YP9A 2WUCA 1G3DA 1A5HA 3KF2A 2JETB 1TRYA 1GI5A 1H9IE 3MFJA 3LGIA 1QB1A 3Q00A 1BTYA 4CRBA 1O3MA 1GHWH 3PLBA 4CR5A 5J4SA 2FDAA 1ORFA 3ZZ8A 2BOHB 1PYTD
chains in the Genus database with same CATH superfamily
4AFUA 1ZMJA 1L4DA 1C5OH 1P2IA 1BOQA 1C2FA 1CGIE 1QL9A 2SGPE 2GZ9A 3EYDA 2ZHQH 4U2WA 1DLEA 3TJOA 1ELEE 1D4PB 1FY4A 1QRZA 4DT7B 2STAE 2WYGA 3F68H 3LC3A 1D6WA 2C8ZB 2VINA 3RXCA 3NKKA 2ZF0H 3HK6B 1BTHH 4O03A 3MTYA 3DSOA 1WOFA 2CJIA 1ZHMA 1SGNE 1EAWA 1O2PA 1RTLA 1AE8H 4X8TH 2AHME 3GY2A 1HB0B 1QBOA 2GVFA 3A7XA 4JK5A 3V0XA 1JMOH 3VEQB 4Y8YA 4CHAC 3E3TA 3KQEA 1FXYA 2P8OB 2RA0A 2VH0A 5A0AE 1UK3A 3EDXB 1GJ4H 3KQBA 5T1VA 2C4FH 5EU8A 3ODDA 2YMSC 2Z94A 1DWEH 1ACBE 3BTTE 5DPAA 3TK5A 1P8VC 3LH1A 4MPXA 1GBDA 4XFQA 5L30H 1LPGB 2Z3DA 1EFRD 5HM2A 1SBWA 2VGCC 3MH6A 3SJ8A 1BBRH 1O30A 3RXTA 4JYTA 5EJLA 3ZVAA 3D23A 1TX7A 2JIZD 1P2MA 1TGSZ 4FUCA 3GOVB 4IBLH 1HJAB 3N7OA 1N8OC 1S0RA 1E34B 1LKBA 2BY9X 2EI8A 1T32A 3S9BA 1F7ZA 3MI4A 2P16A 1Q31A 2ZEBA 3M35A 2HWLB 1XUFA 3I77A 1FI8A 1ZTJA 1VITG 2TRMA 1XUGA 2G8TA 4TT3D 2H2ZA 1K28D 5C0TA 4AG2A 4ZCNA 4INKA 2QIQA 2BQ7B 1ABJH 2NU3E 1GHVH 2BOKA 4H6TA 3WWBA 2HVXA 4MNVA 1AE5A 1CHOG 3RXPA 1NRSH 3M3VA 3A86A 1IQKA 2GT8A 5I46H 2GDEH 1YCPH 3FOAA 1NC6A 1KSNA 1PQ8A 1QIXB 1WV7H 4ASHA 1P06A 2ZDKA 1EKBB 2OP9A 1CA0B 1SMFE 3OU0A 1BTUA 3RXUA 3SUEA 2WHXA 3VB7A 1C1MA 1H8HD 1NM6A 4K69A 1HAOH 4B2CA 2AGIX 4R8TB 1BRCE 2A45B 1O2TA 2P59A 3T62A 1LVOA 2W6JD 2BVXH 3MH7A 4JYVH 2UUYA 2OXSA 1FONA 1BTZA 1ANBA 1TWXB 2JH6D 3RXBA 5GXPA 2JETC 3A8CA 1P09A 1ANCA 4BAKB 1O5FH 1UK4A 3RXVA 1P2JA 1A5IA 2ALVA 3LGYA 2QV1A 2ZFTA 3QTVH 3OFND 4A92A 2AIPA 1ETRH 2FOHA 5GDSH 4UE7H 5B6LA 1C5MD 6ESTA 3EAJA 1QRWA 1N1LA 1P02A 4JYUH 5TCCA 2QGRA 5HM9A 5JBAS 1G2MA 1S84A 2AIQA 4BAHB 3SNBA 4BAMB 1VCWA 1HAYB 1ZJDA 3KHVA 3RMNH 3T25A 1O2RA 4BOHA 1MKXH 1O2LA 5E0GA 1UVTH 5F53A 1P9SA 4K60A 1CE5A 4ABEA 3TLOA 4DGJA 1GHAG 1BDAA 1FZZA 1HAXB 5A2MH 1ZRBA 1FY3A 2WPKS 3NK8A 2ZC9H 1C1WH 1SGFG 2P8OC 4FVDA 1NT1A 1AD8H 5PTPA 1PPZA 4IN1A 1DXWA 1W0JD 5LPEA 4ZKSU 3PTNA 3IG6B 2PLXA 1V2UT 4FUGA 4U32A 3UWIA 1Z8JB 3OEHD 2FLRH 7LPRA 1DVAH 2KCAA 3ATIA 2P3TB 1ESTA 1GBKA 2FI3E 2B8OH 1QFKH 3OY5U 4CRCA 2TIOA 1MUEB 2QC2A 3UR6A 1MBQA 1J17T 1S0QA 4ISLA 3RM0H 5FCKA 1WYKA 4MQAA 2F9NA 4PROA 2FTMA 2OBOA 4BANB 2GT7A 3GY5A 1S6HA 3QGNB 1HJAC 1ELAA 3HPTB 2BX4A 1VITF 1EZXC 3GYMA 1ELCA 4RSPA 2KR7A 2UWPA 1V3XA 1DFPA 2A7HA 1TONA 1GDNA 1NZQH 2ZHWH 4NIYA 1P10A 5ESBA 1UTQA 2OC7A 2R3UA 3GCTG 3SV2H 2WYJA 1W8BH 2ZTZA 1Z6JH 1W0YH 2R0LA 2F9BH 3UOUA 1IHSH 5EGMA 1CHOF 1DY8A 1NS3A 3URCA 1IQIA 1H1BA 5J4QA 2G55A 1XXFA 1SOTA 2EI6A 4X6MA 1O36A 2JDID 2P94A 3T2NA 1A46H 1C4V2 4KELA 5C5NA 2F9PA 2NU1E 1GCTB 3PTBA 2ZECA 3FN8A 3TH4H 3E1XB 1WU1A 4NA7A 5JBCS 1A0JA 6CHAB 3BF6H 4CBOA 3KN2A 5A09A 5CMXH 3EBNA 2ZG0H 1SGEE 3SOSA 2RDEA 3T5FH 1O2VA 4DG4A 1XX9A 2C90B 2TBSA 1C4U2 2GZ8A 4NCYA 1AY6H 1TGBA 1A3BH 1UCYK 4FUDA 3PROA 1IOEA 1O2KA 1YPMH 5GIBA 1PPHE 1P2OA 3S7KB 2OC8A 4BTUB 1O2HA 2ZFQH 4Y10E 1ID5H 4TSFD 4ABIA 1UVOA 2FI4E 1THPB 3A7TA 1OOKB 1NROH 1O3PB 1JOUB 2PKAB 1G2LA 1AIXH 1EATA 2GCTB 1TNGA 1GBMA 3PWBA 2ZFPH 3LGUA 5C0UA 2W26A 1ZJKA 4NA8A 5EPYA 4SGAE 3KNXA 1P57B 4TY7A 1RFNA 3ATLA 4NFEA 2A5IA 3UY9A 1PQ7A 1TALA 3OSYA 3O8CA 3SYJA 1GJAB 1BTPA 3ZZ6A 1GHAF 3FFGA 3O8RA 1C1QA 4GPGA 2LPRA 3ZZ9A 1P05A 3A82A 3RC4A 3KIDU 3RMMH 2HPPH 4RT0A 3S69A 4XRNA 5GWZA 3T26A 2ZHFH 3SGQE 1J15A 4A1TA 3BTKE 1GHBG 1WTGH 3MU5A 4Y7AA 3UQOA 1BITA 2GCHG 1XKBC 3GDUA 1LHFH 4AOQA 1DUEA 1Q2WA 4ISOA 3SNCA 1ZSLA 5DP6A 1OYTH 4DT4A 3UFAA 3V13A 3RM2H 3KQ5A 2LNCA 5AFYH 2AEIH 4B2BA 2FOEA 2ZU1A 4FOUC 2FX4A 1FNIA 3AAVA 1DE7H 2ZCKP 5GJ4B 3ZYEA 1FN6A 4Q7ZA 3SU3A 3RXAA 1O33A 3DHKH 1H8ED 1SOZA 2XC4A 3EQ0H 2ZP0H 1V2OT 3CP7A 5T6DA 2Y5FA 1NFXA 4NZLA 2GJGA 4K1TA 2EA3A 1EQ9A 4UD9H 3GDVA 1VJ9U 1GJ7B 2PR3A 3A80A 1FPCH 3ZVBA 4NWLA 2O8MA 3SV7A 4FETA 1KXAA 1O3BA 1LMWB 4IS5A 3DFLA 1IQJA 4I86A 3UUZA 1D3TB 1FIWA 4Y79A 1NO9H 1FIZA 1MCVA 1O3HA 1SGRE 3K6ZA 5GCHF 3HKIB 1K1IA 1SGCA 1YC0A 3U8RH 1RIWC 3K2UA 3BSQA 1D3DB 4E05H 3A7WA 1UMAH 1B0EA 1P11E 2RG3A 4OS5A 2P3FH 2QY0B 4KP0A 1W12U 2STBE 2O8UA 2BM2A 2PFEA 6GCHG 1P2KA 3UQVA 2JKHA 1C5ZB 3RU4T 2QF3A 1EXFA 1FAKH 3ITIA 3U28C 1TB6H 2QXJA 2YMSD 1DPOA 4YLUA 2ZNKH 3UNQA 1PJPA 1KTTB 1O31A 2KCOA 2WV9A 2BY6X 5FBIA 2BDCA 3NRLA 1SGQE 3EA9A 1QR3E 2Z7FE 1MU8B 1HBTH 4ZROA 4B76A 1HGTH 1EZUC 1GMHG 3H7TA 1S82A 2JJ2D 2LELA 2OQ5A 3F2FA 3ATWA 4DY7B 4A7IB 3WW7A 1O2IA 2Z3EA 1BRUP 4X6NA 4OGYA 2TGAA 4AFZA 2ZQ1A 1UHBB 1C1VH 1MD7A 3B8JA 1F5KU 2KX4A 1ZGVA 1AI8H 1UVUH 3L33A 4XSKU 1GI0A 2WPMS 1XUHA 2F43B 2J34A 2PTCE 2RA3A 3D49H 3KCGH 4HTCH 1GBBA 2ANKH 4ZXYH 3S9AA 5C1XA 1ETTH 1OP0A 1BA8B 1VZQH 4X8SH 2OINA 4ABBA 5E8EH 1AKSA 1GPZA 3IWMA 2ZPRA 1GHBF 1PQ5A 1C2DA 3M3TA 3E16B 2LP6A 1HV7A 1QY6A 2QXHA 1BBRE 2XXLA 2ANMH 1RD3B 5HIZA 3OYPA 2J38A 2F4LA 3MMGA 1EPTC 1RGQA 1C9PA 1ABIH 4ACBA 2F3CE 2WPIS 1Y3UA 1OWJA 3QUMP 2TGPZ 3M7TA 1IQFA 1OWKA 1E36B 3LJJA 4TY6A 1SSXA 1SLWB 1MTUA 1TQ7B 1E1RD 1UTMA 1TNKA 2FOFA 2A1DB 1P9UA 2G4UA 4Z0KA 1DLKB 1VCQA 4Y6DA 2XWBI 1QBVH 1D9IA 2VJ1A 2GV7A 1DM4B 3LJOA 3RDZA 3QZRA 1QQUA 2BDAA 1ZOMA 4NIXA 3MH4A 1FAXA 4HFPB 5DO4H 1BMMH 1TABE 1T8LA 2H5CA 2PUXB 1VGCB 2JH5D 4ZKOU 3ZZ3A 4NA9H 4ESTE 1UTNA 3F2GA 1YPEH 2H5DA 1A1RA 3RUOA 3H5CB 1AGJA 5EIYA 3PYHA 2ZPQA 1C5VA 1ELVA 2AGEX 2SGQE 2BZ6H 4UFDH 4Z1MD 2ZHEH 1XXDA 4TYDA 1ZYOA 2Y82A 3MH5A 3BIVH 1TGNA 1DSUA 1Y5AT 1QJ6B 3SNEA 4Q80A 1K1NA 1O2NA 2OCVB 4XBCA 1RXPA 3LGVA 1GJ5H 2GDDA 4DW2U 1K1PA 3DD2H 1O39A 4AFQA 3D65E 2BDIA 3DSPA 1C2KA 1DITH 5LPFA 1NU9A 2OLGA 1FY8E 3IITA 1TNIA 5LGOA 2F9VA 1SQRA 5T6FA 3RU4D 4JMYA 1J9CH 1KYNA 1SPJA 2HNTF 3JZ2B 1Q3XA 2BHGA 4I32A 4Y7BA 1Y3XA 3UIRA 2KCPA 1S5SA 3K6YA 1GBLA 1A61H 1FJSA 5FX6A 2ZKSA 4JZ1A 5DGJA 1O3JA 1GMHF 2J95A 4X1SU 3PV2A 1ZGIA 3RLYH 1YKTA 2G51A 2R2WU 1DSTA 1MBMA 3SZNA 1GGDB 3F9FA 1O38A 1SL3A 2QF5A 3P70B 5EODA 1O3LA 2AERH 2FO9A 2WUBA 8ESTE 1KLTA 3SI4H 2W3IA 1SHHB 4Q2KA 5DP4A 2BXUH 1Y3WA 1KLIH 3JZ1B 4Q63A 3MO3A 5JYIA 1LCYA 4OS4A 5FCRA 1GVZA 3P8NA 1SB1H 1AZ8A 2BY8X 2THFB 3CS7A 2PV9B 1BZXE 2J98A 3KEEA 2G00A 5DG6A 1K21H 2UWOA 2BLVA 5KECA 1QBNA 1T4UH 3F9HA 2BDGA 3CENA 4JZFH 4I8GA 1FLEE 2CK3D 5BRRE 5ETXA 2CV3A 2F91A 3BN9A 1IQHA 1GCDA 3PO1B 4CH8B 4MPWA 1SI5H 1ZHRA 2Y6TA 3RLWH 3UTUH 3A8DA 3RU4E 2VIPA 3M37A 5DP7A 1UTPA 2BDYA 2JJ1D 1W7GH 1CQQA 3BIUH 1YCPK 1EOLA 1EJMA 1OXGA 2ZGCA 3DCLA 3DUXH 4TWWA 4UEHH 4Z6AH 4RKOB 5FHTA 1P0SH 2C8YB 4LXBH 1SGPE 1FQ3A 1A5GH 1GI7B 2Z6BD 3I78A 4ABGA 5EQQA 1VR1H 2BZAA 3PB1E 4FUBA 5DN6D 3MU0A 1G36A 3VGCB 1QHRB 1NBMD 5EW1H 2J94A 4ZHAA 4ISNA 1SGDE 1TPOA 4OS1A 3ZVDA 1G3BA 2HPQH 2ALPA 2WPDD 4F55A 3MWIU 1L0ZA 4B6FA 1WSSH 2WPJS 1DWBH 1Z71A 2BYAX 3KQDA 4WF8A 3ZZBA 1O2GH 4ZKNU 5JBBS 5L2ZH 3A81A 3UREA 4MLFB 1O3FA 4X2VA 2PGQB 1EAUA 3ZZAA 1S81A 4GVUA 1W3CA 3GCNA 4NIVA 3H09A 1VKYA 3MHWU 2K1QA 1LQEA 1PPCE 3HK3B 3M5LA 2P95A 3LT3A 1RS0A 3A85A 2GKVE 3A83A 1TFXA 2ZDAH 1TBRH 2WPLS 5K0HA 1WQSA 5ESTE 1EB1H 5CHBA 1SGYE 1F5RA 2CMYA 2GX4A 1PQAA 2PP6A 3MU1A 1AB9C 2KM0A 5KEDA 2O8TA 2BLQA 2YNBA 3NUMA 4D9RA 1NBME 5DSFA 1B0FA 7ESTE 5EPNA 3RXOA 1C5XB 1NFWA 1S85A 2SNVA 1GBFA 3VB4A 1TPPA 2A5AA 2ZQ2A 1FN8A 3RXJA 4GCHG 4ABHA 2ZI2H 2J9NA 3AASA 4D8NA 1TNHA 2BY5X 4IGDA 1H8IH 5DP5A 4I8LA 3ZVEA 1ZSJA 2Z9GA 3LPRA 2XBYA 3ZV9A 3GDSA 4MNWA 3ZVFA 2A4GA 1FDPA 4UFEH 2AMQA 4YESB 3SJ9A 4DIIH 1DT2A 1A0HB 1EP6A 5C3NA 2SGEE 4SGBE 1PPGE 3ODFA 3MQKC 3SZEA 1V2VT 1T7CA 2FIRH 1W13U 2ZCLP 4K1EA 2FXRA 4Y0YE 4YOGA 1TIOA 3SO3A 3U98H 4YXWD 5EW2H 4U01A 3TU7H 3TIUA 1W10U 3PRDA 2ASUB 1GBHA 1SQOA 1W11U 5HXFA 3VFEA 1LKAA 1OYQA 2SGFE 1C2HA 1DWDH 1XVOA 1HCGA 2O8WA 2FEQH 1UVPA 1YWUA 1SFQB 1MTSA 1QA0A 2KFWA 3FZZA 1HAVA 4JZIA 3C1KA 1G32B 4FU9A 3VXFH 1COWD 5GPIB 4AFSA 4YLQH 2VU8E 2WSSD 3AW1A 3BTHE 1NY22 3LOXA 1QJ1B 2BVSH 1MQ6A 1QL7A 4ASUD 1UTJA 1O2WA 2IJOB 3KYGA 1YBWA 3QWCH 2W3KA 2W5EA 1K9OE 2J92A 1GBEA 4KGAA 4B1TA 3TH3H 4AZ2B 4X2YA 3HGNA 4MVNA 1C5UA 3QLPH 1BHXF 2QF4A 4HG6A 3RC5A 8KME2 4OM9A 5DK1A 4JK6A 4KTSA 1CVWH 3RXGA 4K2YA 4ZUHA 4F48B 1KLJH 1Z6EA 1OWDA 1O2UA 3NPSA 3L3TA 2NU0E 4ABAA 1KDQB 1MTVA 2BMGB 2TGTA 4I8KA 3ZZ4A 1B5GH 2J5UA 3TJNA 4TWYA 2M5TA 3BEFB 4FU7A 2Y5HA 3TVJB 2FLBH 1K0HA 3SJOA 1DOJA 1PPEE 5A0BA 5F03A 1DY9A 2KAIB 3V3MA 3BG8A 1P01A 1GMDG 1GBIA 5GNDA 3MO6A 3TGIE 4OS6A 1SFIA 5GCHG 1N6XA 2VVCA 1CA0C 4X2XA 3N99A 3GS9A 4RT1A 3SJKA 3AVZA 4AN7A 5HKKD 5F8ZA 1O5AB 2EQNA 2HRVA 4YT6H 4AYYB 3EGKH 1YLNA 1UJ1A 1O32A 4I8JA 4YTAA 3SNDA 1GMCF 1HLTH 1QB6A 4FUHA 1O37A 4B73A 5IK2D 1BIOA 4IC6A 3E8LA 1AWFH 3SV8A 1TLDA 4HZHA 3K9XB 1VCPA 1YM0A 2XNDD 3VB6A 1KIGH 1C5NH 1WAYB 3GCHB 3RC6A 1ESBA 1P3CA 3VB5A 2FZZA 4H42U 3MNCA 3F9GA 1LVBA 4CRAA 4GCHF 5BPEA 2RCEA 2XW9A 2RFKC 5H4IB 1WUNH 1GVLA 4AX9H 1TBZH 1O2OA 2QYIA 5DP3A 1AKSB 1UK2A 2PKSB 2R2MB 2ZWLH 2VWNA 1E38B 1WBGB 1SC8U 3M61U 3SORA 3T28A 2K7XA 4AYVB 1SR5C 3E0NB 1QQ4A 1C2MA 1S83A 1BMNH 2BXTH 1MAXA 1YPLH 3SBKA 1A2CH 1FY5A 3FO8D 1GI4A 5TJXA 2VVUA 3F1SB 3PM3A 3KGPA 1Z8RA 3W94A 2FOGA 1G3CA 1O3CA 1O35A 5JPMH 1GBTA 1V2KT 2A4QA 2A2XH 5C1YA 3U8TH 3P95A 2Q6DA 1UVSH 3B9FH 4CREA 1DDJA 1CT4E 1BJVA 1O3EA 2A7CA 4CH2B 3KYFA 4MPVA 1EZQA 4F4OC 3SUFA 1DXPA 2PSXA 2QF0A 3RP2A 3RXLA 1V2TT 1MABB 1SVPA 5FAHA 4NWKA 4E7NA 1RJXB 3SGBE 1LVYA 1GG6B 1O2QA 2QXGA 4Y0ZE 1HJ8A 1IHTH 4UFGH 3RXEA 1CGHA 3FANA 1C2JA 4YZUA 3OE7D 1VITH 4D76A 8GCHF 1J14A 1WCZA 1PFXC 1O3OA 2ZZUH 2FM2A 4DIHH 2HALA 3FVFB 3SU5A 1O5DH 5EOKA 1JIMA 2ZIQH 9ESTA 1EJAA 1QNJA 2AMPA 4BNRA 2C8XB 1GI9B 4Y8XA 1YF4A 3V12A 2GMTB 7KMEH 1XM1A 3F0PA 4JZDH 2ZGXH 3OY6U 1Y5BT 1GMDF 4HGCA 1SLUB 5FBEA 2WPHS 4GSOA 3UWJH 2BY7X 5EQSA 1HYLA 1EOJA 1TRMA 4J1YA 5E2PA 2XBXA 1GCTC 1JXPA 2ZPSA 5EQRA 1HAPH 2FOBA 2UWLA 1OWIA 1ZPBA 2C93B 1SLXB 2OK5A 6CHAC 1KY9A 3M5MA 1T8OA 2P3UB 1LQDB 4UONA 4J2YB 1H8DH 3R3GB 4CRDA 1V2ST 1CA8B 1Z1IA 3KL6A 5CE1A 2R9PA 1O34A 1GJ8B 3LH3A 3BTEE 4F49A 3A7ZA 1O5CB 1CHGA 1ZR0A 5FXLA 1EASA 4B74A 4THNH 4KTCA 3OTJE 3QX5H 3SJIA 1AFQB 3MO9A 3OX7U 2K8IA 1ZTKA 4GHQA 2XYAA 4Y8ZA 1L1JA 3QK1A 4WMFA 2M2AA 3BTME 2BD9A 4E06H 1HRTH 3F9EA 4ZXXH 2GCTC 1QL8A 1TA6A 1MZDA 1NFYA 1MQ5A 4DJZB 4CRFA 4A6LA 3PMAB 1T4VH 2ZDLA 1THSH 2ZTYA 3OAAD 1C5QA 3SI3H 2J97A 1KTSB 1V2QT 3MOCA 3SQEE 4IMQA 3ATKA 3SHCH 5I25A 5KGOA 3RXFA 4FUEA 2A7JA 1MTNB 5C20A 4D9QA 1THRH 3M7QA 1ELTA 4Y11E 1F2SE 5CDFE 1FV9A 2XTTB 4NSYA 4YT7H 4ZHLU 5TCAA 2A0QB 2V35A 3SHAH 4DOQA 3RXSA 1C5RA 2XCFA 2Z9KA 5FL7D 1DWCH 2WZQA 2PKAA 4DVAU 2GP9B 2XBVA 1C5SA 3MU4A 2FS9A 3W1EA 5G4BA 1C5LH 5T6GA 1SGFA 1TOMH 2J4IA 2YMSB 3Q3KA 4K1SA 1SQAA 1HNEE 1SG8B 1HAGE 2SGDE 2WINI 1M9UA 1W0ZU 4YM9A 2FWWA 1YPHC 3U9AH 2CHAB 1GHXH 2NWNA 3SUDA 1GG6C 2SGAA 3F6UH 1A3EH 2IOTA 4RN6A 1YY3A 1V2MT 1IQEA 5DP8A 1HIAA 2OUAA 2VGCB 1ZSKA 4BXSA 3M5OA 5LH8A 5SGAE 1AVGH 1KMHB 3VXEH 1ZMLA 1AO5A 5JBTA 1H9LB 1Z1JA 4BTTB 3SV6A 4K3JA 2VBCA 1PPBH 4IN2A 2ZU5A 2BQWB 1GVKB 1O2YA 2NU4E 2KZ4A 3LONA 1L1NA 3M36A 3RMOH 4GAWA 2FYRA 5E0HA 1SHYA 1MKWH 1QTFA 1OHHD 1JIRA 1EPTA 2HLDD 4WVPE 2ZO3H 3STJA 3VG8A 3N7DA 8LPRA 3LDXH 1XKAC 5C67A 2B9LA 3ATMA 4ISHH 2G52A 1H9HE 2ZGJA 1T31A 5EJ1A 4FUIA 4GUXA 1TAWA 1ELGA 3W95A 4LZ4B 1WDIA 1BMFD 1S6LA 2G81E 2HGTH 4AGKA 2PHBA 1SKYE 1GWAA 3TNSA 3UR9A 5FPSA 2Y5GA 2D1JA 3P17H 3SW2B 2G5VA 2I6QA 1IAUA 1OSSA 4LZ1H 3LU9B 5EXNA 4WXVA 3MNBA 4BAQB 3SU4A 4AB9A 1K2I1 2O9QA 2PW8H 1AFQC 4ZAEA 4WWYA 4QT8C 1GI1A 4M7GA 3UOPA 4U30A 3GICB 3TK6A 1GHZA 2CN0H 4R0IA 4WH8A 1XUJA 2ILNA 1ZLRA 2VB0A 4B71A 4X1QU 4LK4A 5F8XA 1QURH 1V2JT 1O3IA 1OPHB 3BTDE 1ZHPA 3BTWE 1O3GA 2YNAA 2ULLA 4D7GA 1HAZB 1HAVB 1BBRK 1P04A 4RI0A 3CS0A 3OEED 1FPHH 3LGWA 2ZTXA 4VGCB 3BTQE 4O3TA 2ZU2A 1C2EA 1ARCA 5E2OA 1V2LT 4WH6A 2QCYA 1MTNC 1IQNA 2W7UA 2BB4A 5EXLA 5AVDA 2Y81A 1GI8B 4AG1A 1Z7KA 2V3MA 1GL1A 3M7UA 1MTWA 3Q77A 2TGDA 1AQ7A 1VJAU 2K0QA 3TGKE 3Q76A 2VVVA 5FX5A 4NZQA 4FU8A 2FYQA 2P93A 3U1JB 4ABDA 5L2YH 1QJ7B 1TA2A 4B75A 1BJUA 3ZV8A 1O5GH 3EA7A 4H6SB 1NRRH 2RDLA 3P8FA 4XOJA 1TNLA 1ARBA 3U8OH 1E35B 3PV4A 4CR9A 4WMDA 1EUFA 3N7EA 1A4WH 1O0DH 4XE4A 1P2QA 1UHBA 1XUKA 2VIDA 1EAXA 2FX6A 1Z8IB 2CHAC 2V3HH 3QO6A 1GDUA 3RXIA 2ZGBH 6LPRA 2H9EH 3HATH 1LHGH 1BMAA 5IDKA 2OTVA 3VPKA 3QGJA 1TBQH 1KXCA 3HGPA 2CF8H 2H9TH 1MCTA 2ODPA 1O2XA 3FAOA 1F5LA 4YOJA 1WXRA 3TGJE 1VGCC 4I8HA 4K8BA 4I31A 2BD5A 4WJG2 4B2AA 3KQCA 2C8WB 4GHTA 1DS2E 1BUIA 1QRXA 4MDSA 1C1PA 3UNRA 1FY1A 1EJNA 1AUJA 4BAOB 2ESTE 3HKJB 2W7SA 1ZPCA 4IC5A 1HXEH 1GBAA 1LHCH 2B5TB 1C5TA 1V6DA 2BLWA 1AMHA 3BV9B 1U6QA 1F92A 1AZZA 1DUAA 3GISB 2HNTC 1J16A 3S9CA 2A2QH 4D7FA 1RTFB 1GMCG 2FODA 4Y76A 2FMJA 1OKXA 2OQUA 1JRTA 1ELDE 4NGAH 1QA7A 2BDBA 1MKXK 2Z9LA 1BTXA 1BMLA 4X1PU 1AUTC 3ZZ5A 4UFFH 1GJBB 5HMAA 1C1NA 1A7SA 4P00A 3LIWA 7GCHF 1WTHD 1O5EH 1MU6B 1GJCB 3M5NA 3LC5A 1C2IA 1ZZZA 4LOYH 3FP7E 1UW7A 1EX3A 3I29A 4MTBA 3U1IB 1ZTLA 3P8OA 5AFZH 3TH2H 4XD7D 3L6PA 5C5OA 4ZKRU 3PMHB 3P8GA 4K8YA 1C5PA 2QE7D 1PPFE 3F3BA 1F0UA 2EC9H 2ZFRH 2H9HA 4IW4E 3GY6A 4I33A 5JB9S 3STIA 2SFAA 5HGGA 1OX1A 1NU7B 2J2UA 4WXIA 5DKMA 3SQHE 1GGDC 4MG3A 3E6PH 1TE0A 5A8XA 4TPYA 3TITA 3VB3A 2B0FA 5AHGH 1TRNA 2CGAA 1AN1E 2FPZA 3NWUA 3PLPA 1C1TA 1UCYE 2ZU3A 4VGCC 3T27A 4KTUA 1MMJN 1GJ9B 4RKJB 2IN2A 1X7AC 1AWHB 1C2GA 1F0RA 1TYNA 1O3KA 1ZPZA 2F9UA 3RXKA 5L6NH 3LGTA 4FUJA 1BHXB 1XUIA 3FP8E 5HIYA 2PTNA 3ZYDA 2A4OA 2A5KA 4IMZA 3PO1C 2W6ID 3FP6E 2VWOA 1EZSC 1P03A 1LHDH 1QZ8A 1Y3YA 4OS7A 1UTOA 5E0JA 4X8VH 1NPMA 1ANDA 1NESE 2BLOA 1CU1A 2UUFB 1G3EA 1C1RA 3SU0A 1PYTC 3B23B 5C17A 3V7TA 3EE0B 4X0WU 2AGGX 8GCHG 3GCOA 1P12E 1W7XH 2OD3B 3SNAA 3ZVGA 1NRQH 3GY4A 1O3AA 3VGCC 1HFDA 1HUTH 2NU2E 2BD8A 4OS2A 1NRNH 2ANWA 2BTCE 1SLVB 5JDUB 2BDHA 3EA8A 1IQMA 1DANH 3D62A 2FP7B 1AHTH 2SNWA 1AU8A 2IPHA 1O2SA 4MNYA 3RXHA 4Q7XA 3F2HA 5ABWA 3WWFA 2KCYA 3ELAH 2VWMA 2O8LA 1N6YA 4X6OA 1F0SA 3M3SA 1CT0E 4FUFA 2L6OA 1ESAA 2QN5T 2UUKB 3MYWA 5EG4A 1K1OA 2VWLA 2Q6FA 1HXFH 3ZZDA 1V2PT 3A88A 2VIOA 1GI3A 1O2MA 2FESH 4AGJA 2Y7XA 2AYWA 3A7YA 2XBWA 1T8MA 2LIZA 1INCA 2PUQH 1RIWB 1W14U 3Q3YA 2G4TA 4YOIA 4I7YH 3A84A 1C1OA 3BG4B 3BTGE 4JZEH 2EI7A 4OGXA 2G5NA 3A87A 2OC0A 1SGIB 1EB2A 1G30B 1Y8TA 4NG9H 3GYLB 1BCUH 2YOLA 1GJDB 3SUGA 1L2EA 3ENSB 2AMDA 4NSVA 1G9IE 4CBNA 1P3EA 1C1SA 2BD2A 1HJ9A 2FOAA 2BX3A 2ANYA 5HYOA 1C4Y2 2ZCHP 1GJ6A 3EE7A 2Q1JA 3H7OA 4X6PA 3P92A 1LPKB 4NFFA 1C2LA 3E0PB 1D6RA 1TQ0B 1O3DA 3S7HB 1LTOA 4ISIH 1Y59T 2QXIA 2Y7ZA 4GLYA 1OWEA 3TNTA 1UTLM 4O3UA 2XC0A 1KXDA 1TX6A 2PGBB 1S6FA 2ZFFH 5C1UA 3TPIZ 1UCYH 3MNXA 2JH0D 2ODYB 3U69H 1BQYA 3ZVCA 1K22H 1CGJE 2VIWA 1HIAB 1BT7A 1OP2A 5C94A 2ODQA 4M9FA 1TMTH 1O2JA 1HPGA 4XBBA 2D8WA 3BEIB 3GY7A 2XOKD 3UAIC 3URDA 2V7QD 4XBDA 5CHAB 5DJ7A 2Y80A 4TPIZ 1E1QD 4AC9A 2HVYB 1UO6A 1BTWA 1MH0A 4JCNA 5F6MA 1YGCH 1SGTA 3RXDA 2A4RA 2AH4X 2DE9A 3DSGA 3PMBB 4CRGA 1GI2A 1Z8GA 1Y5UT 2IJD1 2V6NA 2A31A 1E37B 1YYY1 2I6SA 2ZA5A 1EPTB 1NN6A 3SV9A 1KXEA 1YPHE 4ZHMU 3E91A 1K1JA 1H4WA 4Q7YA 3A7VA 2L74A 4A1VA 3SU1A 5T3HA 2IPQX 3BEUA 3DA9B 4DURA 2Z9JA 3QN7A 4WY3A 2VIQA 1ZRKA 1RTKA 4MNXA 1L1GA 4B6EA 1FX0B 2AFQB 2GD4B 2XWAA 2V0BA 3PMJA 1UTKA 2FI5E 3UNSA 2XNIA 4FVBA 3LKWA 3A8AA 1TMUH 2BD3A 1JRSA 5IYTA 3RXRA 1V2RT 2EEKA 1SQTA 5EJZA 2CXVA 4KKDA 4YO9A 1CBWB 1FMGA 3AK5A 3GCTF 2UUJB 3SU2A 1AVXA 4ABFA 2FOCA 3C27B 1IQGA 2V3OH 3A89A 3F0OA 5FPYA 1RRKA 3G01A 2FTLE 4FXGH 3OTPA 3ZZCA 2VNTA 1Y3VA 2PSYA 4H4FA 1XVMA 5A0CA 1CT2E 1E79D 2ZU4A 1DX5M 1TMBH 1W0KD 3DFJA 1D3QB 4X1RU 4INHA 3ZZ7A 1NTPA 3MU8A 3NCLA 3TJUA 2ZDMA 3O8BA 3TK9A 3ESTA 1ZMNA 3ZIAD 1HDTH 1KDQA 2B7DH 3BG4C 1BRAA 1C5YB 1MZAA 4AORA 4HI3A 2XC5A 3RXQA 3GCHC 3CNRA 1EP5A 9LPRA 2OC1A 3NXPA 2KAIA 1CO7E 1NFUA 1EAIA 2H1UA 3RXMA 2FS8A 4X1NU 2BQ6B 2J98B 1GL0E 3BTFE 2F83A 5A8YA 1YPKH 1WQVH 1TX8A 3PWCA 2PKSC 4ABJA 3MNSA 1GHYH 1TPSA 1OWHA 5C2ZA 3GY3A 1F0TA 1YPGH 1K1LA 1GBCA 3K65B 4ZH8A 3QZQA 1B7XB 2ZDVH 1LPZB 3PRBA 3QTOH 3FKSD 2GV6A 4NIWA 2R0KA 1ETSH 2XCNA 1K1MA 2Z9IA 1LVMA 1C5WB 1KXBA 4AB8A 2GTBA 1CSOE 1YPJH 3E90B 1J8AA 2OBQA 2C3SA 2WV5A 1A0LA 3NZIA 5AF9H 3WY8A 3GY8A 2D2DA 1YLDA 4CHAB 5DP9A 3AW0A 5K7RA 4ACAA 2FOMB 4E7RG 3SU6A 1MAYA 2Q6GA 2QA9E 2XRCA 3Q3XA 5FPTA 4A1XA 1LO6A 1ELBA 2QAAA 1KXFA 5CHAC 3FZDA 3DT0H 2VIVA 1TPAE 1MKWK 3SN8A 4MPUA 4X8UH 1ANEA 2BD7A 2GCHF 2AS9A 4BTIB 5B6OA 1T8NA 2PWXA 1OP8A 1FUJA 1O3NA 1TOCB 1HAIH 2ZFSA 1QGFA 1ELFA 2ZHDA 4ZMAH 3AAUA 1LHEH 4UDWH 1DICA 2DUCA 1BB0B 1TGCA 3R0FA 5EXMA 3T29A 4A5TS 1IQLA 5A8ZA 1HAHH 1GDQA 2R3YA 2BVRH 5JB8S 2VH6A 2H6MA 1N8OB 2DE8A 2ZDNA 1AFEH 1AVWA 1O5BB 3SGAE 4Y71A 5LPRA 2WV4A 1W2KH 3TJVA 3UPEA 4DCDA 4BXWA 2GMTC 4O97A 1OS8A 1L4ZA 1GBJA 5F8TA 3P6ZB 3UB0A 1O2ZA 1E0FD 1P2NA 2D26C 1QB9A 2A32A 1TGTA 1V2NT 2F9OA 2HLCA 3O8DA 1G37A 4O9VA 4INLA 1YCPM 3S0NA 2EY4C 1CBWC 1XMNB 2Z3CA 1JWTA 1JBUH 3QDZB 1C1UH 4WMEA 2BD4A 4X2WA 3PLKA 1D3PB 2CF9H 2HNTE 1YLCA 3A8BA 1MD8A 1TNJA 4Q4LA 4K5ZA 2HOBA 3RMLH 1LDTT 2ZGHA 7GCHG 2TPIZ 1C9TA 1QCPA 4XDEA 1V2WT 4P02A 1BRBE 1GI6A 2GGVB 1NRPH 6GCHF 1AB9B 2GZ7A 1YP9A 2WUCA 1G3DA 1A5HA 3KF2A 2JETB 1TRYA 1GI5A 1H9IE 3MFJA 3LGIA 1QB1A 3Q00A 1BTYA 4CRBA 1O3MA 1GHWH 3PLBA 3PV5A 4CR5A 5J4SA 2FDAA 1ORFA 3ZZ8A 2BOHB 1PYTD
chains in the Genus database with same CATH topology
4AFUA 1ZMJA 1L4DA 1C5OH 1P2IA 1BOQA 1C2FA 1CGIE 1QL9A 2SGPE 2GZ9A 3EYDA 2ZHQH 4U2WA 1DLEA 3TJOA 1ELEE 1D4PB 1FY4A 1QRZA 4DT7B 2STAE 2WYGA 3F68H 3LC3A 1D6WA 2C8ZB 2VINA 3RXCA 3NKKA 2ZF0H 3HK6B 1BTHH 4O03A 3MTYA 1WOFA 2CJIA 1ZHMA 1SGNE 1EAWA 1O2PA 1RTLA 1AE8H 4X8TH 3GY2A 1HB0B 1QBOA 2GVFA 3A7XA 4JK5A 3V0XA 1JMOH 3VEQB 4Y8YA 4CHAC 3E3TA 3KQEA 1FXYA 2P8OB 2RA0A 2VH0A 5A0AE 1UK3A 3EDXB 1GJ4H 3KQBA 2C4FH 5EU8A 3ODDA 2Z94A 1DWEH 1ACBE 3BTTE 5DPAA 3TK5A 1P8VC 3LH1A 4MPXA 1GBDA 4XFQA 5L30H 1LPGB 2Z3DA 5HM2A 1SBWA 2VGCC 3MH6A 3SJ8A 1BBRH 1O30A 3RXTA 4JYTA 3ZVAA 3D23A 1TX7A 1P2MA 1TGSZ 4FUCA 3GOVB 4IBLH 1HJAB 3N7OA 1N8OC 1S0RA 1E34B 1LKBA 2BY9X 2EI8A 1T32A 3S9BA 1F7ZA 3MI4A 2P16A 1Q31A 2ZEBA 3M35A 2HWLB 1XUFA 3I77A 1FI8A 1ZTJA 1VITG 2TRMA 1XUGA 2G8TA 2H2ZA 1K28D 4AG2A 4INKA 2QIQA 2BQ7B 1ABJH 2NU3E 1GHVH 2BOKA 4H6TA 2HVXA 4MNVA 1AE5A 1CHOG 3RXPA 1NRSH 3M3VA 3A86A 1IQKA 2GT8A 5I46H 2GDEH 1YCPH 1NC6A 1KSNA 1PQ8A 1QIXB 1WV7H 4ASHA 1P06A 2ZDKA 1EKBB 2OP9A 1CA0B 1SMFE 3OU0A 1BTUA 3RXUA 3SUEA 3VB7A 1C1MA 1NM6A 4K69A 1HAOH 4B2CA 2AGIX 4R8TB 1BRCE 2A45B 1O2TA 2P59A 3T62A 1LVOA 2BVXH 3MH7A 4JYVH 2UUYA 2OXSA 1FONA 1BTZA 1ANBA 1TWXB 2JH6D 3RXBA 5GXPA 2JETC 3A8CA 1P09A 1ANCA 4BAKB 1O5FH 1UK4A 3RXVA 1P2JA 1A5IA 2ALVA 3LGYA 2QV1A 2ZFTA 3QTVH 4A92A 2AIPA 1ETRH 2FOHA 5GDSH 4UE7H 1C5MD 6ESTA 3EAJA 1QRWA 1N1LA 1P02A 4JYUH 5TCCA 2QGRA 5HM9A 5JBAS 1G2MA 1S84A 2AIQA 4BAHB 3SNBA 4BAMB 1VCWA 1HAYB 1ZJDA 3KHVA 3RMNH 3T25A 1O2RA 4BOHA 1MKXH 1O2LA 5E0GA 1UVTH 1P9SA 4K60A 1CE5A 4ABEA 3TLOA 4DGJA 1GHAG 1BDAA 1FZZA 1HAXB 5A2MH 1ZRBA 1FY3A 2WPKS 3NK8A 2ZC9H 1C1WH 1SGFG 2P8OC 4FVDA 1NT1A 1AD8H 5PTPA 1PPZA 4IN1A 1DXWA 5LPEA 4ZKSU 3PTNA 3IG6B 2PLXA 1V2UT 4FUGA 4U32A 3UWIA 1Z8JB 2FLRH 7LPRA 1DVAH 3ATIA 2P3TB 1ESTA 1GBKA 2FI3E 2B8OH 1QFKH 3OY5U 4CRCA 2TIOA 1MUEB 2QC2A 3UR6A 1MBQA 1J17T 1S0QA 4ISLA 3RM0H 5FCKA 1WYKA 4MQAA 2F9NA 4PROA 2FTMA 2OBOA 4BANB 2GT7A 3GY5A 1S6HA 3QGNB 1HJAC 1ELAA 3HPTB 2BX4A 1VITF 1EZXC 3GYMA 1ELCA 4RSPA 2UWPA 1V3XA 1DFPA 2A7HA 1TONA 1GDNA 1NZQH 2ZHWH 4NIYA 1P10A 5ESBA 1UTQA 2OC7A 2R3UA 3GCTG 3SV2H 2WYJA 1W8BH 2ZTZA 1Z6JH 1W0YH 2R0LA 2F9BH 3UOUA 1IHSH 5EGMA 1CHOF 1DY8A 1NS3A 3URCA 1IQIA 1H1BA 5J4QA 2G55A 1XXFA 1SOTA 2EI6A 4X6MA 1O36A 2P94A 3T2NA 1A46H 1C4V2 4KELA 5C5NA 2F9PA 2NU1E 1GCTB 3PTBA 2ZECA 3TH4H 3E1XB 1WU1A 4NA7A 5JBCS 1A0JA 6CHAB 3BF6H 4CBOA 3KN2A 5A09A 5CMXH 3EBNA 2ZG0H 1SGEE 3SOSA 3T5FH 1O2VA 4DG4A 1XX9A 2C90B 2TBSA 1C4U2 2GZ8A 4NCYA 1AY6H 1TGBA 1A3BH 1UCYK 4FUDA 3PROA 1IOEA 1O2KA 1YPMH 5GIBA 1PPHE 1P2OA 3S7KB 2OC8A 4BTUB 1O2HA 2ZFQH 4Y10E 1ID5H 4ABIA 1UVOA 2FI4E 1THPB 3A7TA 1OOKB 1NROH 1O3PB 1JOUB 2PKAB 1G2LA 1AIXH 1EATA 2GCTB 1TNGA 1GBMA 3PWBA 2ZFPH 3LGUA 2W26A 1ZJKA 4NA8A 5EPYA 4SGAE 3KNXA 1P57B 4TY7A 1RFNA 3ATLA 4NFEA 2A5IA 3UY9A 1PQ7A 1TALA 3OSYA 3O8CA 1GJAB 1BTPA 3ZZ6A 1GHAF 3FFGA 3O8RA 1C1QA 4GPGA 2LPRA 3ZZ9A 1P05A 3A82A 3RC4A 3KIDU 3RMMH 2HPPH 3S69A 5GWZA 3T26A 2ZHFH 3SGQE 1J15A 4A1TA 3BTKE 1GHBG 1WTGH 3MU5A 4Y7AA 3UQOA 1BITA 2GCHG 1XKBC 3GDUA 1LHFH 4AOQA 1DUEA 1Q2WA 4ISOA 3SNCA 1ZSLA 5DP6A 1OYTH 3UFAA 3V13A 3RM2H 2LNCA 5AFYH 2AEIH 4B2BA 2FOEA 2ZU1A 2FX4A 1FNIA 3AAVA 1DE7H 2ZCKP 5GJ4B 3ZYEA 1FN6A 4Q7ZA 3SU3A 3RXAA 1O33A 3DHKH 1SOZA 2XC4A 3EQ0H 2ZP0H 1V2OT 3CP7A 5T6DA 2Y5FA 1NFXA 4NZLA 4K1TA 2EA3A 1EQ9A 4UD9H 3GDVA 1VJ9U 1GJ7B 2PR3A 3A80A 1FPCH 3ZVBA 4NWLA 2O8MA 3SV7A 1KXAA 1O3BA 1LMWB 4IS5A 3DFLA 1IQJA 3UUZA 1D3TB 1FIWA 4Y79A 1NO9H 1FIZA 1MCVA 1O3HA 1SGRE 3K6ZA 5GCHF 3HKIB 1K1IA 1SGCA 1YC0A 3U8RH 1RIWC 3K2UA 3BSQA 1D3DB 4E05H 3A7WA 1UMAH 1B0EA 1P11E 2RG3A 4OS5A 2P3FH 2QY0B 4KP0A 1W12U 2STBE 2O8UA 2BM2A 2PFEA 6GCHG 1P2KA 3UQVA 2JKHA 1C5ZB 3RU4T 2QF3A 1EXFA 1FAKH 3ITIA 1TB6H 2QXJA 1DPOA 4YLUA 2ZNKH 3UNQA 1PJPA 1KTTB 1O31A 2BY6X 5FBIA 2BDCA 1SGQE 3EA9A 1QR3E 2Z7FE 1MU8B 1HBTH 4ZROA 4B76A 1HGTH 1EZUC 1GMHG 3H7TA 1S82A 2OQ5A 3ATWA 4DY7B 4A7IB 1O2IA 2Z3EA 1BRUP 4X6NA 4OGYA 2TGAA 4AFZA 2ZQ1A 1UHBB 1C1VH 1MD7A 3B8JA 1F5KU 1ZGVA 1AI8H 1UVUH 3L33A 4XSKU 1GI0A 2WPMS 1XUHA 2J34A 2PTCE 3D49H 2RA3A 3KCGH 4HTCH 1GBBA 2ANKH 4ZXYH 3S9AA 5C1XA 1ETTH 1OP0A 1BA8B 1VZQH 4X8SH 2OINA 4ABBA 5E8EH 1AKSA 1GPZA 3IWMA 2ZPRA 1GHBF 1PQ5A 1C2DA 3M3TA 3E16B 1HV7A 1QY6A 2QXHA 1BBRE 2XXLA 2ANMH 1RD3B 3OYPA 2J38A 3MMGA 1EPTC 1RGQA 1C9PA 1ABIH 2F3CE 2WPIS 1Y3UA 1OWJA 3QUMP 2TGPZ 3M7TA 1IQFA 1OWKA 1E36B 3LJJA 4TY6A 1SSXA 1SLWB 1MTUA 1TQ7B 2FOFA 1UTMA 1TNKA 2A1DB 2G4UA 1P9UA 4Z0KA 1DLKB 1VCQA 4Y6DA 2XWBI 1QBVH 1D9IA 2VJ1A 2GV7A 1DM4B 3LJOA 3RDZA 3QZRA 1QQUA 2BDAA 1ZOMA 4NIXA 3MH4A 1FAXA 4HFPB 5DO4H 1BMMH 1TABE 1T8LA 2H5CA 2PUXB 1VGCB 2JH5D 4ZKOU 3ZZ3A 4NA9H 4ESTE 1UTNA 1YPEH 2H5DA 1A1RA 3RUOA 3H5CB 1AGJA 3PYHA 2ZPQA 1C5VA 1ELVA 2AGEX 2SGQE 2BZ6H 4UFDH 2ZHEH 1XXDA 4TYDA 1ZYOA 2Y82A 3MH5A 3BIVH 1TGNA 1DSUA 1Y5AT 1QJ6B 3SNEA 4Q80A 1K1NA 1O2NA 2OCVB 4XBCA 1RXPA 3LGVA 1GJ5H 2GDDA 4DW2U 1K1PA 3DD2H 1O39A 4AFQA 3D65E 2BDIA 1C2KA 1DITH 5LPFA 1NU9A 2OLGA 1FY8E 3IITA 1TNIA 5LGOA 2F9VA 5T6FA 3RU4D 4JMYA 1J9CH 1KYNA 1SPJA 2HNTF 3JZ2B 1Q3XA 2BHGA 4I32A 4Y7BA 1Y3XA 3UIRA 1S5SA 3K6YA 1GBLA 1A61H 1FJSA 5FX6A 2ZKSA 4JZ1A 5DGJA 1O3JA 1GMHF 2J95A 4X1SU 1ZGIA 3RLYH 1YKTA 2G51A 2R2WU 1DSTA 1MBMA 3SZNA 1GGDB 3F9FA 1O38A 1SL3A 3P70B 5EODA 1O3LA 2AERH 2FO9A 2WUBA 8ESTE 1KLTA 3SI4H 2W3IA 1SHHB 4Q2KA 5DP4A 2BXUH 1Y3WA 1KLIH 3JZ1B 3MO3A 5JYIA 1LCYA 4OS4A 5FCRA 1GVZA 3P8NA 1SB1H 1AZ8A 2BY8X 2THFB 3CS7A 2PV9B 1BZXE 3KEEA 2G00A 5DG6A 1K21H 2UWOA 2BLVA 1QBNA 1T4UH 3F9HA 2BDGA 3CENA 4JZFH 4I8GA 1FLEE 5BRRE 5ETXA 2CV3A 2F91A 3BN9A 1IQHA 1GCDA 3PO1B 4CH8B 4MPWA 1SI5H 1ZHRA 2Y6TA 3RLWH 3UTUH 3A8DA 3RU4E 2VIPA 3M37A 5DP7A 1UTPA 2BDYA 1W7GH 1CQQA 3BIUH 1YCPK 1EOLA 1EJMA 1OXGA 2ZGCA 3DUXH 4TWWA 4UEHH 4Z6AH 4RKOB 5FHTA 1P0SH 2C8YB 4LXBH 1SGPE 1FQ3A 1A5GH 1GI7B 2Z6BD 3I78A 4ABGA 5EQQA 1VR1H 2BZAA 3PB1E 4FUBA 3MU0A 1G36A 3VGCB 1QHRB 5EW1H 2J94A 4ZHAA 4ISNA 1SGDE 1TPOA 4OS1A 3ZVDA 1G3BA 2HPQH 2ALPA 3MWIU 1L0ZA 1WSSH 2WPJS 1DWBH 1Z71A 2BYAX 3KQDA 4WF8A 3ZZBA 1O2GH 4ZKNU 5JBBS 5L2ZH 3A81A 3UREA 4MLFB 1O3FA 4X2VA 2PGQB 1EAUA 3ZZAA 1S81A 4GVUA 1W3CA 3GCNA 4NIVA 3MHWU 2K1QA 1LQEA 1PPCE 3HK3B 3M5LA 2P95A 3LT3A 1RS0A 3A85A 2GKVE 3A83A 1TFXA 2ZDAH 1TBRH 2WPLS 5K0HA 1WQSA 5ESTE 1EB1H 1SGYE 1F5RA 2CMYA 2GX4A 1PQAA 3MU1A 1AB9C 2O8TA 2BLQA 2YNBA 3NUMA 4D9RA 1B0FA 7ESTE 5EPNA 3RXOA 1C5XB 1NFWA 1S85A 2SNVA 1GBFA 3VB4A 1TPPA 2A5AA 2ZQ2A 1FN8A 3RXJA 4GCHG 4ABHA 2ZI2H 2J9NA 3AASA 4D8NA 1TNHA 2BY5X 4IGDA 1H8IH 5DP5A 4I8LA 3ZVEA 1ZSJA 2Z9GA 3LPRA 2XBYA 3ZV9A 3GDSA 4MNWA 3ZVFA 2A4GA 1FDPA 4UFEH 2AMQA 4YESB 3SJ9A 4DIIH 1DT2A 1A0HB 1EP6A 5C3NA 2SGEE 4SGBE 1PPGE 3ODFA 1V2VT 1T7CA 2FIRH 1W13U 2ZCLP 4K1EA 2FXRA 4Y0YE 4YOGA 1TIOA 3SO3A 3U98H 5EW2H 4U01A 3TU7H 3TIUA 1W10U 2ASUB 1GBHA 1SQOA 1W11U 5HXFA 3VFEA 1LKAA 1OYQA 2SGFE 1C2HA 1DWDH 1XVOA 1HCGA 2O8WA 2FEQH 1UVPA 1SFQB 1MTSA 1QA0A 3FZZA 1HAVA 4JZIA 3C1KA 1G32B 4FU9A 3VXFH 4AFSA 5GPIB 4YLQH 2VU8E 3AW1A 3BTHE 1NY22 3LOXA 1QJ1B 2BVSH 1MQ6A 1QL7A 1UTJA 1O2WA 2IJOB 1YBWA 3QWCH 2W3KA 2W5EA 1K9OE 2J92A 1GBEA 4KGAA 4B1TA 3TH3H 4AZ2B 4X2YA 3HGNA 4MVNA 1C5UA 3QLPH 1BHXF 3RC5A 8KME2 5DK1A 4JK6A 4KTSA 1CVWH 3RXGA 4K2YA 4ZUHA 1KLJH 1Z6EA 1OWDA 1O2UA 3NPSA 3L3TA 2NU0E 4ABAA 1KDQB 1MTVA 2BMGB 2TGTA 4I8KA 3ZZ4A 1B5GH 3TJNA 3TVJB 4TWYA 2M5TA 3BEFB 4FU7A 2Y5HA 2FLBH 3SJOA 1DOJA 1PPEE 5A0BA 5F03A 1DY9A 2KAIB 3V3MA 3BG8A 1P01A 1GMDG 1GBIA 3MO6A 3TGIE 4OS6A 1SFIA 5GCHG 1N6XA 2VVCA 1CA0C 4X2XA 3SJKA 3AVZA 4AN7A 5F8ZA 1O5AB 2HRVA 4YT6H 4AYYB 3EGKH 1UJ1A 1O32A 4I8JA 4YTAA 3SNDA 1GMCF 1HLTH 1QB6A 4FUHA 1O37A 4B73A 1BIOA 4IC6A 3E8LA 1AWFH 3SV8A 1TLDA 4HZHA 3K9XB 1VCPA 1YM0A 3VB6A 1KIGH 1C5NH 1WAYB 3GCHB 3RC6A 1ESBA 1P3CA 3VB5A 2FZZA 4H42U 3MNCA 3F9GA 1LVBA 4CRAA 4GCHF 5BPEA 2RCEA 2XW9A 5H4IB 1WUNH 1GVLA 4AX9H 1TBZH 1O2OA 2QYIA 5DP3A 1AKSB 1UK2A 2PKSB 2R2MB 2ZWLH 2VWNA 1E38B 1WBGB