1Z1JA

Crystal structure of sars 3clpro c145a mutant
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSAGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Understanding the maturation process and inhibitor design of SARS-CoV 3CLpro from the crystal structure of C145A in a product-bound form
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 67
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1z1jA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z1jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z1jA02
4NZQA 1J8AA 1D3TB 3SUFA 1Y5BT 3ATIA 3SBKA 2C90B 4E7RG 4OS2A 1TGNA 2HWLB 3UTUH 3BTQE 1ABJH 3QGJA 1O3KA 5A2MH 4JMYA 1CA8B 1UK2A 3GY2A 4Y76A 1AKSB 1THSH 1TPSA 2FOBA 1C4V2 3MU1A 1QL8A 2VB0A 1NRPH 4CRAA 5HXFA 1PPGE 2FX4A 5TJXA 3TGJE 1TMBH 1T4VH 2ZU3A 3PM3A 1GMDG 1RD3B 3QK1A 4ISHH 3SNDA 4MPVA 4AFZA 3RP2A 3VGCB 1DSUA 2FOCA 3SI4H 2ZI2H 1ZTLA 3PLBA 3SU1A 1K1PA 1T8LA 1V2OT 2Y7ZA 3BV9B 3M3TA 1GVKB 1O39A 2TBSA 2ANKH 4NIYA 3W95A 3ZVCA 2AMDA 3LH3A 1LVOA 4J2YB 2CN0H 2VVVA 3ATLA 1DLEA 2BXTH 4NG9H 3UNRA 1VCPA 1MD7A 1YLDA 3E6PH 1EOJA 1RTFB 4K60A 1O3AA 1OYQA 1C2JA 3C1KA 1PPBH 1P2KA 2XBXA 2RCEA 1AMHA 1CT0E 1J9CH 5GPIB 1B7XB 1Z8GA 1BTPA 1BTYA 2BVXH 3BTME 2BDYA 2BZAA 1HRTH 3AVZA 3TNTA 3PMBB 5B6OA 2FI4E 1HAIH 1TB6H 1UTNA 4AB8A 1NRRH 4MNVA 1HPGA 1OWIA 3OYPA 2OC0A 4Q80A 4BAMB 1AI8H 4X6PA 1Z71A 1GJ9B 3OSYA 5HMAA 4XOJA 2C8ZB 1UHBA 2ZDVH 3KQEA 3EA9A 4ISIH 4B2AA 1GBAA 1XKAC 5IDKA 1O30A 1S84A 1H9HE 1O2MA 2OBQA 1BT7A 1TQ0B 4X2XA 4M7GA 2FLRH 1EX3A 1QL7A 2PSXA 2GT8A 2PTNA 2BY7X 1C5YB 5AF9H 1ZGVA 2A0QB 3GCTF 1O38A 3RLWH 1L4ZA 4Q2KA 2ZNKH 3LGVA 1K9OE 5I25A 5FPYA 3LKWA 4Q7YA 2C8WB 1O5FH 3A87A 1GJ7B 3NCLA 4NA9H 4NA7A 1ELVA 1HIAA 2I6SA 1G2MA 3RM2H 1RXPA 3GY5A 4K3JA 2GGVB 2PV9B 2Z6BD 4LZ4B 2C93B 4Y6DA 2Z9GA 4XBCA 1BTZA 4X2WA 1RFNA 2ILNA 1WOFA 3VEQB 2TRMA 4ISOA 3K9XB 3F9GA 3RXQA 1YPLH 1W0YH 4INHA 1BOQA 1SFIA 3UOUA 1EKBB 2H9TH 1DITH 1EZUC 2QC2A 2ZU4A 1C1NA 1GI4A 2BDGA 4I8LA 3MNSA 1O37A 2OLGA 2LIZA 2C8YB 4IGDA 7ESTE 1LHCH 3A7WA 3GISB 1V3XA 2OUAA 1P01A 1TNIA 4XBDA 4VGCB 3TU7H 1UTPA 3KQCA 1CHGA 1FZZA 2DE9A 2ZCHP 2F91A 1OOKB 1WQSA 1YPGH 2BDBA 2ZF0H 3SU0A 1XX9A 4F4OC 2XNIA 4YLQH 5DP4A 5T3HA 1IQKA 1T7CA 2FIRH 3V0XA 1EUFA 4YT6H 2FO9A 5F6MA 2SGEE 1KXAA 1C1SA 3K65B 1RIWB 2W3KA 3EBNA 1FDPA 2CHAB 3EE0B 2A5AA 4NWLA 2ZFFH 5FCRA 2W5EA 1O2WA 1FPCH 3S7HB 4I8KA 4INKA 2J34A 2VVUA 1PQ7A 1FN8A 1CT4E 1D3PB 1K1LA 1DY8A 1DDJA 4O3TA 1O0DH 1H9LB 1LPKB 1ETSH 4KTUA 5I46H 4DGJA 2FI5E 3M5OA 1WUNH 5HGGA 1AKSA 3FAOA 3IG6B 8ESTE 3EQ0H 3QWCH 3TVJB 1VR1H 1KDQA 2G5NA 4ZHMU 1HGTH 2Z9JA 4CREA 2F3CE 4KTSA 3A8BA 5FCKA 3GDSA 3ODFA 4K1EA 4MVNA 1ELTA 3GY3A 1V2RT 4UFFH 1UK4A 4WVPE 1HCGA 4KGAA 2VWNA 1PFXC 1BCUH 2ZHQH 3EGKH 4BTUB 1WCZA 3TPIZ 3SU3A 2TGPZ 1P2MA 1AVXA 2GMTB 1O3FA 2AMQA 1GG6B 1TOCB 4NIXA 1GMDF 3MU0A 3AAVA 1P8VC 1ETRH 4BNRA 2HLCA 4FUJA 1MCVA 4A6LA 4K8BA 2XC4A 2ESTE 2XXLA 2ZPSA 4FVBA 2O8LA 1LHFH 1NTPA 1VZQH 3A86A 4Y8YA 4AX9H 3SV6A 2R3UA 3D62A 1GBIA 1W13U 1EAIA 1OWKA 2P8OC 3MH4A 3RXOA 4R8TB 1W7XH 4AYVB 1RTKA 1ZHPA 1BTHH 5FXLA 4O97A 3SUEA 2PKAB 1KTTB 3SV7A 4ABDA 1ZJDA 1AUTC 5A0BA 1AVWA 1C1PA 5CHAC 2PKSC 4UFDH 3ZZ8A 1P57B 1AB9B 3BIVH 2EC9H 1FAKH 1GJ6A 1BDAA 1DXWA 5AVDA 2O8WA 4ZH8A 1BMNH 2A4RA 1ZPBA 2QIQA 2W7UA 1GBTA 1A1RA 1O3GA 2GKVE 1UTOA 1B0EA 1UJ1A 4ZHAA 3GICB 1P3EA 4ZKRU 4U32A 1EP6A 3F6UH 2BY6X 4GUXA 2ODQA 3T62A 4MPWA 3O8RA 3HKJB 3VB5A 4MQAA 3P8GA 4BOHA 3ATKA 3L3TA 2OINA 4IW4E 2ZPQA 2WPLS 2OCVB 2QXIA 4WF8A 1QQ4A 2F9NA 3RXPA 1O3NA 4F49A 1FY1A 2G81E 5GDSH 1GWAA 5DP6A 1FNIA 1IQJA 1C2LA 4H42U 2ZDKA 1QTFA 4WMDA 5ETXA 4DIHH 3HGNA 1F5LA 1HAHH 1TNJA 1KXFA 5F8XA 5L2YH 1GHBF 2NWNA 3CS7A 1C1RA 1NO9H 2Y82A 1OPHB 2BLVA 3KL6A 4FU7A 1PYTC 1JRSA 3A7XA 3UQVA 3LJOA 3BTWE 5JBTA 4DW2U 2FOMB 2BD9A 1ZPCA 1P12E 3LC3A 4Y7BA 3PMJA 3PLPA 1FQ3A 2BVRH 4Z0KA 1QIXB 3P70B 3E0NB 3DT0H 1P11E 3VGCC 1XM1A 1UO6A 3K6ZA 4YOIA 1GI9B 1UTKA 2GCTC 2EI8A 2J38A 1TA6A 3A8CA 5FX6A 4IN2A 1Y3YA 3ZVGA 1EQ9A 1HAXB 2Y81A 5EPNA 1CHOG 4AG2A 1GL1A 3A7TA 2XYAA 1H8DH 2WPHS 3BTFE 1WQVH 2VIVA 2GVFA 4K8YA 1CA0B 3K6YA 3KNXA 4K1SA 1HAOH 1OX1A 1HNEE 1EZSC 5DKMA 4BTTB 3LDXH 1BBRH 1QRZA 2A4OA 3EYDA 3SV9A 2A1DB 1O2QA 1EB2A 2HNTC 2YNBA 3PTBA 2ZC9H 3GCTG 1P05A 2QN5T 4XE4A 1TAWA 2SGDE 2D26C 3M35A 1EZXC 4MPUA 1SGTA 4Y0YE 3T25A 3SZNA 3G01A 7LPRA 3MI4A 1SB1H 2WV5A 3GY4A 4KKDA 5J4SA 1O35A 4Y79A 2V0BA 1SI5H 1T4UH 2FDAA 1S0RA 3PMHB 2HPQH 3LGYA 1YPKH 4X8UH 2G51A 5LGOA 1TWXB 1XVOA 2RA3A 1Y3UA 5GJ4B 1O5CB 1O33A 1AE8H 2FP7B 5K0HA 1A4WH 1N6XA 2WPJS 3V13A 5JB9S 4NA8A 2UUYA 1ELCA 1HAYB 2ZEBA 3NXPA 4O03A 4DOQA 3UY9A 3BTTE 3ATWA 5EPYA 3N7OA 4XSKU 2RA0A 1CSOE 2FOAA 1JIRA 2P8OB 4GVUA 5GIBA 1OWJA 1MMJN 1O3DA 1IQMA 1TNHA 1X7AC 3RXSA 1O34A 2M5TA 1GHVH 1DFPA 1FONA 3O8BA 4AORA 3ZVFA 1MKXH 1FIZA 2P94A 3R3GB 1IQFA 4B74A 2PKSB 1TPPA 5HM9A 3DFJA 1C9TA 4FXGH 5DPAA 4FU8A 2UUKB 3MTYA 1XUGA 2PKAA 2PLXA 5IYTA 2J4IA 1BHXB 4ABHA 1DWDH 1F2SE 1DOJA 1LKBA 1SGDE 2GT7A 1OWHA 1SVPA 4YTAA 1T8MA 3HGPA 1O3IA 1O2ZA 2B8OH 3MOCA 1C1WH 4VGCC 4I7YH 3UREA 3U1IB 1FJSA 5E0HA 3MU4A 2AH4X 1QGFA 1E36B 1AN1E 3NK8A 1O2IA 1P02A 3F9HA 1GMCF 4X1RU 3D65E 2B7DH 1AZZA 2FOEA 4MDSA 1BQYA 3QLPH 1EJMA 4UFEH 3T27A 4D9RA 1ZRBA 2K7XA 1KYNA 3AW0A 1MKWH 2CF9H 1NESE 2BYAX 1C2EA 3RXVA 1GJ5H 1ZSJA 1RIWC 1V2LT 3F68H 1G32B 1UVOA 2CHAC 2Y7XA 3O8CA 1ZTJA 2BB4A 1HXFH 4DJZB 4ASHA 3UFAA 4AGJA 2B0FA 2ZQ1A 3B9FH 3V3MA 1GDUA 1OP2A 1GCTB 3SI3H 1TRNA 2EI6A 1KDQB 3ZYDA 1UVSH 2EA3A 1W0ZU 2QYIA 2AEIH 3E3TA 3SO3A 1SGNE 2H5DA 1ID5H 2IN2A 2XWAA 2ZHDA 3LGTA 1Z1IA 5A8YA 1C4U2 4TWYA 3M61U 4KTCA 1QJ7B 2PSYA 3S0NA 3U8TH 2GCTB 4ZKSU 2OC7A 1JMOH 4ESTE 3SGBE 2VU8E 1HFDA 5E0GA 5A0CA 1TE0A 1AO5A 1S83A 2FOHA 3ZVEA 1P06A 1GI7B 2FPZA 1TBZH 1C2IA 3RXRA 1FY5A 1O2JA 4R0IA 1KSNA 2GMTC 4XDEA 1SOTA 1P2JA 1GG6C 2A2XH 1TLDA 6GCHF 2OD3B 1HAVA 1BJUA 2LPRA 1QNJA 2GV6A 1D6WA 4FUIA 1TYNA 3ZZAA 1MQ5A 4ZMAH 1O2OA 2QY0B 2Q6FA 3B8JA 3DFLA 3URDA 3LGUA 2V3OH 1K2I1 1V2JT 1LHEH 1ELEE 1H9IE 1DM4B 1UK3A 1ELAA 3RC6A 5EG4A 1HBTH 3RC4A 3RM0H 4TY7A 1SR5C 1CHOF 1ANBA 1GJAB 4YOGA 2ZQ2A 1PQAA 1Z7KA 4RKOB 2TGAA 3P95A 4U01A 1TGBA 2ANYA 5L6NH 4GLYA 1XUFA 2UWLA 2FZZA 1IAUA 3SQHE 1O3JA 5AHGH 4A92A 1QQUA 4PROA 1A61H 3MO9A 1AB9C 4JZ1A 2OBOA 1DANH 1DUAA 4JK5A 1IQNA 3ESTA 2ZZUH 4YLUA 3VXFH 5C5OA 3Q76A 2AGEX 1YKTA 3EDXB 4YO9A 2XRCA 5JBBS 1BRBE 1GHAF 1ZHRA 3P8OA 5JBAS 2Z3CA 1TX6A 3U98H 1J16A 2BHGA 4B75A 3RMNH 1QBOA 1P2NA 1HJ9A 1EXFA 2VWLA 5EXLA 1LHDH 1GHBG 4A5TS 2BM2A 2F83A 1NY22 4THNH 3SHAH 1O36A 2Y80A 1HUTH 2SNVA 2UWOA 3ZV8A 1PPFE 3S9AA 4YM9A 3IWMA 2OP9A 5PTPA 1Y5AT 1LQEA 3RXAA 1MTNC 4WXIA 2A31A 4D9QA 3HK6B 2IOTA 1V2PT 4IN1A 3BTKE 4GCHF 1LVMA 3MH6A 1KXCA 2J94A 5HM2A 2HPPH 1O2HA 1DX5M 4AFSA 2OQ5A 3RMMH 4MNWA 3E1XB 4WH8A 1TQ7B 3LC5A 4XBBA 1PPZA 3ZZ6A 3RXCA 1BRUP 1YLCA 1CGHA 4CH8B 3OTJE 4FUCA 1TGSZ 1K1IA 3A80A 1QJ6B 4NFFA 2ZECA 2VH6A 4X1SU 2UWPA 1QB6A 2GZ9A 4BAOB 1EASA 2ZGHA 4K5ZA 1KY9A 1AZ8A 4UD9H 1GDNA 2FODA 2JH5D 3FP6E 3HK3B 1S5SA 4X8SH 1BBRK 5FAHA 2R3YA 1V2KT 5DO4H 2Q6DA 1FY3A 4Z6AH 4NSVA 4A1XA 3M36A 4NZLA 3SV8A 1EAUA 4FUHA 1B0FA 2THFB 3E16B 2OC8A 1AWHB 3A82A 1BRAA 2BXUH 1C2KA 2NU2E 4BANB 2FMJA 4U2WA 2QXGA 2C3SA 1XXFA 1AWFH 4DT7B 4Q7XA 1XMNB 1BITA 1CA0C 2FX6A 1QA0A 1YC0A 1TALA 1H4WA 2GCHF 1QBVH 2FS8A 2BD4A 3P17H 1FV9A 4LXBH 3SN8A 2HOBA 1OP8A 5CMXH 1NPMA 1UTLM 1LQDB 1MUEB 1MTUA 1C5MD 1Z8JB 2FS9A 3KHVA 2AGGX 4FUBA 3KIDU 1C2FA 1SHHB 5SGAE 1LO6A 3M5MA 1FUJA 1ANEA 1V2UT 3HKIB 1A3BH 3TGKE 4CHAB 2FI3E 4Y10E 3U1JB 2ZTXA 3QTOH 1MQ6A 2ULLA 3DA9B 4ABAA 4CR5A 1SOZA 4Y0ZE 3M37A 1BJVA 1SGQE 4RN6A 1O5AB 2PW8H 3L6PA 1Y59T 2PHBA 1NZQH 3F9EA 3MMGA 2B9LA 1S85A 2WPKS 1FLEE 1TOMH 4SGBE 2A2QH 3AASA 2J92A 1MKXK 2Q6GA 1L1GA 2ZHFH 2ZWLH 2VINA 1DWCH 3SU5A 1Z6EA 2VWOA 1O3OA 4DCDA 2G8TA 1P0SH 3QTVH 1S0QA 1EB1H 1NROH 1OYTH 1NC6A 1CU1A 1KXEA 1ESTA 2PUQH 1C1VH 5T6FA 1Y3XA 4IMZA 4TY6A 1H1BA 2XCFA 4Y71A 1EATA 5F8ZA 2D8WA 1ACBE 3PWBA 2I6QA 1VGCB 2QF0A 1VITH 1OWEA 3KCGH 1SC8U 4DY7B 1O32A 2ALVA 2HNTE 2STAE 3EAJA 1HYLA 1TIOA 4JCNA 1GHZA 1C5PA 4H6SB 4AN7A 5EGMA 4TPYA 1KLTA 2FEQH 2ANWA 1GMCG 2ZA5A 3CENA 3GCNA 3PO1C 3K2UA 3RXIA 3LT3A 1CT2E 4Y8ZA 4ZXXH 3SJOA 1RGQA 2G4UA 2QF3A 4FVDA 3QGNB 1QY6A 1FI8A 1MKWK 4OS4A 2AIPA 3BG4B 1EAXA 2GV7A 3PYHA 2SFAA 1C5ZB 1S81A 1O2GH 4IBLH 4NFEA 4K69A 4A1TA 2WV4A 3EA8A 1DS2E 1LCYA 2FOFA 2TGTA 1K28D 1NFYA 4GPGA 2OTVA 2ZHWH 3SNCA 1GHWH 2NU1E 2J2UA 1TGCA 1O2PA 3ZVDA 1MTNB 5DP8A 1ARCA 2FOGA 3RLYH 1BTUA 3D23A 3ZZ3A 1K1MA 3MFJA 3SJKA 4AB9A 1ZSKA 1AQ7A 1C1QA 4K1TA 7GCHF 1QA7A 4AOQA 3VXEH 1GBLA 4X6MA 1H8IH 5DJ7A 1RRKA 2SNWA 1SG8B 2BOKA 5DK1A 1DY9A 1LMWB 1ZTKA 2AGIX 5F03A 2R0KA 3FP8E 4SGAE 1SQAA 3BTDE 4YZUA 1BMAA 3VB6A 3OY5U 3SQEE 1GCTC 5EXMA 2AIQA 3DUXH 1CBWB 1WTGH 4KELA 5EW1H 1V6DA 1P2QA 4NIWA 4D76A 1PPHE 1Z8IB 1Q3XA 3P92A 6GCHG 3QN7A 3SV2H 3M5LA 3HATH 4JZFH 2FTMA 4BTIB 1AGJA 4E06H 3T26A 1IQHA 2R0LA 3PB1E 1WV7H 4HGCA 2BLWA 1F0TA 3TGIE 2ZDLA 2ODPA 4OS7A 1GBMA 1GBDA 3OY6U 3SJIA 1AFQB 2A4QA 4YT7H 3QO6A 5EODA 1K1OA 4AFQA 1TRYA 5JBCS 5LPRA 5DG6A 1XKBC 3NZIA 1HAVB 1LKAA 2P3UB 4TWWA 2Z9IA 2GTBA 1D6RA 2JETC 2BLQA 1GMHF 3ZZ5A 1PQ8A 3MNBA 1FMGA 4B73A 5JB8S 1MAYA 1FAXA 5C20A 1NS3A 2VGCB 4FUGA 4B1TA 5EW2H 2ZO3H 1PQ5A 1UCYH 1KXDA 5DP3A 3QZQA 2UUJB 3NPSA 4X2YA 2FXRA 3MO3A 1V2NT 4IS5A 3KQDA 2RG3A 3F9FA 1UCYE 3SNEA 4BAKB 1K1NA 1P09A 1TX7A 2QXHA 2FYRA 3SNAA 1GPZA 1MTSA 1V2WT 1ZZZA 2ZDMA 3SU4A 3M7TA 1MZDA 3E90B 1V2VT 1GHAG 1P10A 1ZMLA 1IQLA 1MTVA 1E35B 2P93A 3MH7A 2ZPRA 1OP0A 1YPHC 5LPEA 1O2XA 1L0ZA 5EQRA 1FN6A 3JZ2B 2ZU5A 2H2ZA 4O3UA 1VITG 3ITIA 8LPRA 4AGKA 1Y8TA 3GYLB 1A46H 3GCHB 1GBCA 1O5DH 5TCAA 3VB3A 3CP7A 1UTJA 4HFPB 2C4FH 4ZAEA 4E7NA 4ZKOU 1A0JA 1O2RA 1IOEA 1QRWA 2WYJA 4ABGA 2F9PA 3KGPA 3WY8A 4GCHG 3RU4T 3ZZDA 5FBIA 3BN9A 4AZ2B 5EQQA 1GBFA 3PWCA 2FLBH 3A7VA 3BTGE 2OQUA 1EPTB 3TJUA 2BDAA 3NKKA 4X1QU 3AW1A 4UFGH 2EI7A 2SGAA 4GAWA 1T8OA 1D4PB 1Q2WA 1ANDA 1G37A 1N8OB 3TJVA 1TMUH 3SU2A 1C9PA 3W94A 2BQ7B 3RXKA 4ZKNU 3M7QA 1C5TA 3ZZ9A 1S82A 1F7ZA 4IC6A 1YBWA 2JH0D 1AIXH 2G4TA 4NIVA 2QA9E 3E91A 3S69A 2HALA 3TITA 3RXGA 5C1YA 1O3PB 4U30A 3GDVA 3PO1B 2F9BH 4D7FA 3VB4A 1ELBA 2HVXA 4I8GA 1AHTH 1J17T 3FP7E 4B71A 1RJXB 1C5UA 2CF8H 2ZFSA 5L30H 3GOVB 5DGJA 5GCHF 1V2TT 1F5KU 2A7CA 1ZLRA 2G00A 1HAZB 1GI2A 5BRRE 1ESBA 1UMAH 3B23B 1E34B 3ZV9A 2ASUB 1GI8B 4TYDA 2F9OA 3LONA 4X8TH 3TIUA 1YM0A 4J1YA 2BX3A 1OS8A 1GJCB 5ABWA 1O2TA 2GCHG 2V35A 2VIPA 3Q3XA 3TK5A 2XW9A 1C2GA 1T32A 5JYIA 1V2ST 5A8ZA 2VIOA 1QHRB 5HYOA 2PWXA 2EEKA 2ZGBH 4X0WU 1NRSH 5JDUB 3A85A 4UEHH 1JRTA 2Z9LA 1MU6B 2ZDNA 2H1UA 2GDDA 2Z3DA 2PGBB 4X1PU 2Z9KA 1YPMH 1F5RA 3LPRA 1ELDE 1BHXF 1SGCA 1S6HA 5H4IB 3FVFB 1MH0A 5BPEA 6CHAB 1UVPA 3I78A 2LNCA 1BTXA 2BQ6B 4LZ1H 1W12U 2ZFTA 3Q3YA 1BB0B 3RU4D 2ZHEH 1PJPA 1UTMA 4WMEA 1E38B 1HJ8A 2XBVA 1GJDB 1GBKA 4MG3A 1A5GH 1PYTD 3BTEE 1ELGA 1C4Y2 4A7IB 2J9NA 3RC5A 2NU4E 3L33A 2R2MB 4GHTA 1O3EA 3A89A 4YOJA 4CHAC 2F9VA 2WUBA 8GCHG 4JYVH 1ELFA 3FANA 1O5BB 3UOPA 1ETTH 2VIQA 1C5NH 1TBRH 1SMFE 1TFXA 2BZ6H 3RXBA 2JETB 4IMQA 2ZKSA 1YCPH 1ZMJA 3ZZBA 4CRDA 1Z8RA 1W7GH 1SGFG 3RXDA 2GDEH 3EA7A 3PMAB 4DVAU 1EZQA 1C2HA 1W3CA 3TJNA 1TNGA 2VNTA 2Y6TA 4BAQB 3PV4A 1HB0B 3T2NA 1O3BA 1DUEA 1A2CH 3ZVAA 1E0FD 1GVZA 2WPMS 3ATMA 2FWWA 1NRQH 2BDIA 2BD5A 2A5KA 3QZRA 3RXMA 2A45B 3TNSA 3FFGA 1VGCC 2BVSH 2GZ8A 2H9HA 1L4DA 1CVWH 1P9SA 3NWUA 5DP7A 4H6TA 5C67A 3P6ZB 5EXNA 1TNLA 1A0HB 2Z94A 3IITA 2ZGXH 1MCTA 2CJIA 4K2YA 3MYWA 3VPKA 1CQQA 1AVGH 5G4BA 1O3LA 1OXGA 4UONA 1GI1A 3RXHA 1Y5UT 3BEIB 2PGQB 3UNQA 1XXDA 2ZU2A 2W7SA 3H7TA 4B2BA 1N6YA 5EOKA 2BD3A 2VH0A 4AG1A 1QCPA 2Y5HA 3BG4C 2Q1JA 2ZCLP 7GCHG 1GGDB 1YYY1 1QFKH 1JWTA 1IQGA 2HNTF 2P95A 3BIUH 1VITF 1IHSH 3BSQA 5C1UA 4CBOA 1TNKA 1VCWA 4FUFA 2ZTYA 1TA2A 2P16A 3MHWU 4OS6A 2H6MA 3M5NA 1EPTA 2BD7A 5C2ZA 1QRXA 3T29A 1LPGB 1DT2A 1IHTH 4HZHA 1U6QA 3A84A 4I8JA 2VIWA 3SGQE 1G36A 3RXUA 3ZZ4A 3U8RH 5TCCA 4BXWA 1A5IA 4RSPA 3GYMA 3RDZA 4Q7ZA 3TLOA 1THRH 3GY7A 1XUHA 3SU6A 5AFYH 2R2WU 3R0FA 3V7TA 2QGRA 2F9UA 5CE1A 1GDQA 3D49H 4WH6A 1SFQB 2AERH 3URCA 4OS1A 3KEEA 4HTCH 4OGXA 1JBUH 2XBYA 2YNAA 3STJA 3UIRA 3UR9A 1KIGH 1HAPH 1NT1A 1GMHG 5C5NA 4MLFB 2BDCA 1KXBA 1D9IA 1WU1A 3UUZA 1CBWC 4Y7AA 2PTCE 1C5SA 4YESB 1HLTH 9LPRA 1GJ4H 1ARBA 1UCYK 3SUDA 3FZZA 2OXSA 2XTTB 1K22H 2STBE 4AFUA 1PPCE 3GDUA 3GCOA 4DIIH 1C5XB 1ZMNA 4MNYA 1L1NA 1O2VA 2ODYB 3S7KB 1J15A 1AFQC 2QXJA 1HJAB 1O2KA 1G30B 1IQIA 3NUMA 1NU9A 6LPRA 1O3MA 1S6FA 4BXSA 2GX4A 4CRFA 2AMPA 1THPB 3ODDA 1K1JA 1SQTA 1C2DA 5C1XA 2PR3A 1QR3E 1MBQA 2VGCC 1E37B 1BMMH 1C1TA 3U69H 1AU8A 1WYKA 4X2VA 5C3NA 4CBNA 1EJNA 1FIWA 1TPOA 1JIMA 5LH8A 3RU4E 2G55A 4OS5A 4CRCA 1P9UA 2BLOA 1INCA 4B76A 4LOYH 1BMLA 2OC1A 3CS0A 1RS0A 1WAYB 2K1QA 5FHTA 1ZOMA 3Q77A 4JZEH 3TH3H 1P3CA 2V3HH 3LGWA 2BY9X 1Q31A 4FUDA 2CMYA 1NM6A 3SGAE 3U9AH 2Z7FE 2ZIQH 4I32A 5FBEA 6ESTA 5J4QA 3V12A 1TPAE 2G5VA 1P04A 3VFEA 1P2OA 3U8OH 4ABEA 2Z3EA 2AFQB 4I31A 4X1NU 4CH2B 1BUIA 1BZXE 2GP9B 1O2UA 3GCHC 1W11U 3MH5A 1ZYOA 3Q3KA 4NGAH 2GZ7A 1XVMA 4NWKA 4WJG2 2DUCA 4I8HA 1CGIE 2O8TA 2Y5FA 3ZYEA 2JKHA 1KLJH 4D8NA 1WTHD 5A0AE 1F0UA 1SLVB 5ESTE 1EP5A 3BTHE 3GY6A 1W8BH 1SGYE 1ZSLA 1JXPA 3KQBA 1EPTC 2CXVA 1T31A 5E8EH 3KF2A 3RMOH 1MD8A 8GCHF 1GI6A 3JZ1B 1ZPZA 4ISLA 1ZHMA 3A8AA 2NU0E 4Y8XA 2BD2A 3H7OA 8KME2 1HAGE 3HPTB 5T6GA 2H5CA 2ANMH 3BF6H 3TH2H 1YP9A 3I29A 1N8OC 2W3IA 3A88A 2GD4B 5GCHG 2RDLA 1PPEE 3KN2A 1GI3A 3S9BA 1TMTH 3UR6A 1A3EH 1GHXH 1Y3VA 2WPIS 1O31A 2VIDA 1W10U 3C27B 3A81A 1K21H 5E2PA 3ZZ7A 1YPHE 2W26A 1ZR0A 2XBWA 2KAIB 3RXEA 9ESTA 2QAAA 4LK4A 1FPHH 1GJ8B 1O2YA 4AYYB 2P59A 1HXEH 2P3TB 5GWZA 4OGYA 1O3HA 2ZFRH 3MNXA 1QB1A 3MNCA 1AD8H 1QL9A 4ZROA 1GL0E 1WBGB 1GCDA 4X8VH 4JYTA 5GXPA 4E05H 3LGIA 3RXFA 2ZDAH 3DD2H 1G3DA 1A5HA 5FPTA 3SJ9A 4JK6A 1BA8B 1AFEH 1NRNH 4I33A 4X6OA 4Y11E 1G9IE 1L1JA 5A09A 1G3CA 2A5IA 2XC5A 1B5GH 1EJAA 2WINI 2Y5GA 2IPHA 4ABJA 4X6NA 1VCQA 1HDTH 2AYWA 1J14A 2VJ1A 1QBNA 3TH4H 2ZU1A 1DWEH 3S9CA 2WYGA 4CR9A 1NFUA 1SGPE 5AFZH 1QJ1B 3AAUA 3RUOA 1XUKA 2J95A 2P3FH 2JH6D 2ZGCA 4TPIZ 4KP0A 3BEUA 2XC0A 1G2LA 6CHAC 1YGCH 1CGJE 1OWDA 1YPEH 1SSXA 3LJJA 5E2OA 4HI3A 1FY8E 3Q00A 2A32A 1DLKB 1GI5A 1O5GH 3A7ZA 1YCPK 4INLA 1GBHA 4CRBA 1V2QT 5JPMH 2H9EH 1ORFA 1M9UA 1CO7E 3A83A 3M3VA 5EU8A 1A0LA 3MO6A 3QDZB 4ZXYH 3SUGA 1O3CA 1C1OA 2FYQA 3RXJA 1NU7B 3UNSA 1ABIH 4GSOA 1C5LH 4A1VA 4JZIA 1C5WB 1VJ9U 1UTQA 1BIOA 1C5OH 1YPJH 4DURA 1SLWB 5T6DA 2VWMA 4ZUHA 4DG4A 1Z6JH 1LTOA 2ALPA 2G52A 3MWIU 2ZTZA 1WSSH 5ESBA 3QX5H 1XUIA 1SLXB 2SGFE 3UPEA 1MZAA 1SGIB 1F92A 2UUFB 2PFEA 1MAXA 2ZCKP 1MU8B 1AY6H 2BY8X 4WWYA 3QUMP 3OU0A 3A8DA 3RMLH 4O9VA 2VVCA 4MPXA 3TJOA 3SNBA 1DWBH 4UDWH 4BAHB 2HGTH 1YCPM 2TIOA 4NSYA 3E8LA 3PTNA 4H4FA 1GBBA 3LU9B 1C2MA 1DVAH 4CRGA 2BDHA 5DP9A 4B2CA 1AE5A 3BEFB 4WXVA 1C5RA 1DICA 3M7UA 1YF4A 3VB7A 1SQOA 2C8XB 2O9QA 2ZFPH 5FX5A 1OKXA 3ZVBA 1TABE 1C5VA 1GVLA 5LPFA 2O8UA 1BBRE 1JOUB 2XCNA 1BTWA 1UHBB 3ENSB 3PROA 3LH1A 5K7RA 1ZJKA 1EOLA 5EQSA 2SGPE 3T5FH 2O8MA 5F8TA 2WUCA 4FU9A 1SBWA 2BX4A 3P8NA 1GJBB 1TBQH 4UE7H 1BRCE 2YOLA 3TK6A 3MU5A 1TX8A 1G3BA 2FTLE 1GBJA 2IJOB 2XWBI 4FUEA 1FY4A 1D3QB 1GGDC 5A8XA 4D7GA 1SGFA 4JZDH 2BMGB 3FZDA 2BD8A 2ZGJA 3RXTA 3SOSA 4ABIA 2A7JA 2NU3E 4WY3A 1SGEE 1C1MA 5L2ZH 1P2IA 4ABBA 1HV7A 1A7SA 5FPSA 3SW2B 5DP5A 1HIAB 1O2SA 3UWIA 3SHCH 2A7HA 5E0JA 1W2KH 2BOHB 2CGAA 2D2DA 1ZRKA 1DXPA 1SPJA 1DPOA 1QB9A 1LHGH 1C1UH 3RXLA 2BQWB 1DSTA 1XUJA 1LVYA 1GBEA 2TGDA 3DHKH 4ABFA 1G3EA 1ESAA 4IC5A 2FESH 1TONA 2QCYA 2PUXB 2DE8A 3GY8A 1RTLA 3P8FA 1NN6A 3H5CB 3PLKA 1W14U 2D1JA 4GHQA 3MU8A 4JYUH 3TK9A 4ZHLU 1ANCA 2TPIZ 3STIA 5CHAB 1UVTH 3LOXA 4NCYA 1TRMA 3UQOA 2KAIA 1V2MT 3T28A 2ZP0H 3I77A 3SORA 1N1LA 3SJ8A 1O2NA 1VJAU 1EAWA 2R9PA 1NFXA 2ZFQH 2CV3A 1MBMA 2B5TB 2BY5X 1IQEA 4RKJB 1OSSA 1SHYA 1Z1JA 1LDTT 1O5EH 1LVBA 4XFQA 1GHYH 4MNXA 1AUJA 1D3DB 1ZGIA 1QURH 1SGRE 1F0RA 3O8DA 1KTSB 1DE7H 2V6NA 1SL3A 1HJAC 3UWJH 7KMEH 1MTWA 3ZZCA 2BTCE 1SLUB 1Y3WA 1P03A 2A4GA 2HRVA 1F0SA 1L2EA 3F1SB 3OX7U 1LPZB 4QT8C 3BG8A 1TGTA 2SGQE 3A7YA 3E0PB 1KLIH 1GI0A 4WMFA 1T8NA 2QV1A 3M3SA 1O2LA 1UVUH 2AS9A 1FXYA 3LIWA 4ISNA 1CE5A 3ELAH 1NFWA 2FM2A 2ZG0H 4MTBA 1C5QA
chains in the Genus database with same CATH superfamily
4NZQA 1J8AA 1D3TB 3SUFA 1Y5BT 3ATIA 3SBKA 2C90B 4E7RG 4OS2A 1TGNA 2HWLB 3UTUH 3BTQE 1ABJH 3QGJA 1O3KA 5A2MH 4JMYA 1CA8B 1UK2A 3GY2A 4Y76A 1AKSB 4ZCNA 1THSH 1TPSA 2FOBA 1C4V2 3MU1A 1QL8A 2VB0A 1NRPH 4CRAA 5HXFA 1PPGE 2FX4A 5TJXA 3TGJE 1TMBH 1T4VH 2ZU3A 3PM3A 1GMDG 1RD3B 3QK1A 4ISHH 3SNDA 4MPVA 4AFZA 3OTPA 3RP2A 3VGCB 1DSUA 2FOCA 3SI4H 2JDID 2ZI2H 1ZTLA 3PLBA 3SU1A 1K1PA 1T8LA 1V2OT 2Y7ZA 3BV9B 3M3TA 1GVKB 1O39A 2TBSA 2ANKH 4NIYA 3W95A 3ZVCA 2AMDA 3LH3A 1LVOA 4J2YB 2CN0H 2VVVA 3ATLA 1DLEA 2BXTH 4NG9H 3UNRA 1VCPA 1MD7A 1YLDA 3E6PH 1EOJA 1RTFB 3U28C 4K60A 1O3AA 1OYQA 1C2JA 3C1KA 1E1QD 1PPBH 1P2KA 2XBXA 2RCEA 1AMHA 1CT0E 1J9CH 5GPIB 1B7XB 3F2GA 1Z8GA 1BTPA 1BTYA 3F3BA 2BVXH 3BTME 2BDYA 2BZAA 3AK5A 1HRTH 3AVZA 3TNTA 3PMBB 5B6OA 2FI4E 1HAIH 1TB6H 1UTNA 4AB8A 1H8ED 1NRRH 4MNVA 1HPGA 1OWIA 3OYPA 2OC0A 4Q80A 4BAMB 1AI8H 4X6PA 1Z71A 1GJ9B 3OSYA 5HMAA 4XOJA 2C8ZB 1UHBA 2ZDVH 3KQEA 3EA9A 4ISIH 4B2AA 1GBAA 1XKAC 2KM0A 5IDKA 1O30A 1S84A 1H9HE 1O2MA 2OBQA 1BT7A 1TQ0B 4X2XA 4M7GA 2FLRH 1EX3A 4Q63A 1QL7A 3VG8A 2PSXA 2GT8A 2PTNA 2BY7X 1C5YB 5AF9H 1ZGVA 2A0QB 3GCTF 1O38A 3RLWH 4YXWD 1L4ZA 4Q2KA 2ZNKH 3LGVA 1K9OE 5I25A 5FPYA 3LKWA 4Q7YA 2C8WB 1O5FH 3A87A 1GJ7B 3NCLA 4NA9H 4NA7A 1ELVA 5HIYA 1HIAA 2I6SA 1G2MA 3RM2H 1RXPA 3GY5A 4K3JA 2GGVB 2PV9B 2Z6BD 4LZ4B 2C93B 4Y6DA 2Z9GA 4XBCA 1BTZA 4X2WA 1RFNA 2ILNA 1WOFA 3VEQB 2TRMA 4ISOA 3K9XB 3F9GA 3RXQA 1YPLH 1W0YH 4INHA 1BOQA 1SFIA 3UOUA 1EKBB 2H9TH 1DITH 1EZUC 2QC2A 2ZU4A 1C1NA 1GI4A 2BDGA 4I8LA 3MNSA 1O37A 2OLGA 2LIZA 2C8YB 4IGDA 4AC9A 7ESTE 1LHCH 3A7WA 3GISB 1V3XA 2OUAA 1P01A 2VBCA 1TNIA 4XBDA 4VGCB 3TU7H 3F2FA 1UTPA 3KQCA 1CHGA 1FZZA 2DE9A 2JJ2D 2J97A 2ZCHP 2F91A 1OOKB 1WQSA 1YPGH 2BDBA 2ZF0H 3SU0A 1XX9A 4F4OC 2XNIA 4YLQH 5DP4A 5T3HA 1IQKA 1T7CA 2FIRH 3V0XA 1EUFA 4YT6H 2FO9A 5F6MA 2SGEE 2L74A 1KXAA 1C1SA 3K65B 1RIWB 2W3KA 3EBNA 1FDPA 1E1RD 2CHAB 1W0KD 3EE0B 2A5AA 4NWLA 2ZFFH 5FCRA 2W5EA 1O2WA 1FPCH 3S7HB 4I8KA 4INKA 2J34A 2VVUA 1PQ7A 1FN8A 1CT4E 1D3PB 1K1LA 1DY8A 1DDJA 4O3TA 1O0DH 1H9LB 1LPKB 1ETSH 4KTUA 5I46H 4DGJA 2FI5E 3M5OA 1WUNH 5HGGA 1AKSA 3FAOA 3IG6B 8ESTE 3EQ0H 2WV9A 3QWCH 3TVJB 1VR1H 1KDQA 2G5NA 4ZHMU 1HGTH 2Z9JA 4CREA 2F3CE 4KTSA 3A8BA 5FCKA 3GDSA 3ODFA 4K1EA 4MVNA 1ELTA 3GY3A 1V2RT 4UFFH 1UK4A 4WVPE 1HCGA 4KGAA 2VWNA 1PFXC 1BCUH 2WPDD 2ZHQH 3EGKH 4BTUB 1WCZA 3TPIZ 3SU3A 2K8IA 2TGPZ 1P2MA 1AVXA 2GMTB 1O3FA 2AMQA 1GG6B 3ZIAD 1TOCB 4NIXA 1GMDF 3MU0A 3AAVA 1P8VC 1ETRH 4BNRA 2HLCA 5FL7D 4FUJA 1MCVA 4FOUC 4A6LA 4K8BA 2XC4A 2ESTE 2XXLA 2ZPSA 4FVBA 2O8LA 1LHFH 1NTPA 1VZQH 3A86A 4Y8YA 4AX9H 3SV6A 2R3UA 3D62A 1GBIA 1W13U 1EAIA 1OWKA 2P8OC 3MH4A 2L6OA 3RXOA 4R8TB 1W7XH 4AYVB 1RTKA 1ZHPA 1BTHH 5FXLA 4O97A 3SUEA 2PKAB 1KTTB 3SV7A 4ABDA 1ZJDA 1AUTC 5A0BA 4FETA 1AVWA 1C1PA 5CHAC 2PKSC 4UFDH 3ZZ8A 1P57B 1AB9B 3BIVH 2EC9H 1FAKH 1GJ6A 1BDAA 1DXWA 5AVDA 2O8WA 4ZH8A 1BMNH 4OM9A 2A4RA 1ZPBA 2QIQA 2W7UA 1GBTA 1A1RA 1O3GA 2GKVE 1UTOA 1B0EA 1UJ1A 4ZHAA 3GICB 1P3EA 4ZKRU 4U32A 1EP6A 3F6UH 2BY6X 4GUXA 2ODQA 3T62A 4MPWA 3O8RA 3HKJB 3VB5A 4MQAA 3P8GA 4BOHA 3ATKA 3L3TA 2OINA 4IW4E 2ZPQA 2WPLS 2OCVB 2QXIA 4WF8A 1QQ4A 2F9NA 3RXPA 1O3NA 4F49A 1FY1A 2G81E 5GDSH 1GWAA 5DP6A 1FNIA 1IQJA 1C2LA 4H42U 2ZDKA 1QTFA 4WMDA 5ETXA 4DIHH 3HGNA 1F5LA 1HAHH 1TNJA 3GS9A 1KXFA 5F8XA 5L2YH 1GHBF 2NWNA 3CS7A 1C1RA 1NO9H 2Y82A 1OPHB 2BLVA 3KL6A 4FU7A 1PYTC 1JRSA 3A7XA 3UQVA 4ASUD 3LJOA 3BTWE 5JBTA 4DW2U 2FOMB 2BD9A 1ZPCA 1P12E 3LC3A 4Y7BA 3PMJA 3PLPA 1FQ3A 2BVRH 4Z0KA 1QIXB 3P70B 3E0NB 3DT0H 1P11E 3VGCC 1XM1A 1UO6A 3K6ZA 4YOIA 1GI9B 1UTKA 2GCTC 2EI8A 2J38A 1TA6A 3A8CA 5FX6A 4IN2A 1Y3YA 3PRBA 3ZVGA 1EQ9A 1HAXB 2Y81A 5EPNA 1CHOG 4AG2A 1GL1A 3A7TA 2XYAA 1H8DH 2WPHS 3BTFE 1WQVH 2VIVA 2GVFA 4K8YA 1CA0B 3K6YA 3KNXA 4K1SA 1HAOH 1OX1A 1HNEE 1EZSC 3EE7A 5DKMA 4BTTB 3LDXH 1BBRH 1QRZA 2A4OA 3EYDA 3SV9A 2A1DB 1O2QA 1EB2A 2HNTC 2YNBA 3PTBA 2HLDD 2ZC9H 3GCTG 2RFKC 1P05A 2QN5T 4XE4A 1TAWA 2SGDE 2D26C 3M35A 1EZXC 4MPUA 1SGTA 4Y0YE 3T25A 3SZNA 3G01A 7LPRA 3MI4A 1SB1H 2WV5A 3GY4A 2M2AA 4KKDA 5J4SA 1O35A 4Y79A 2V0BA 1SI5H 1T4UH 2FDAA 1S0RA 3PMHB 2HPQH 3LGYA 1YPKH 4X8UH 2G51A 3UAIC 5LGOA 1TWXB 1XVOA 2RA3A 1Y3UA 5GJ4B 1O5CB 1O33A 1AE8H 2FP7B 5K0HA 1A4WH 1N6XA 2WPJS 3V13A 5JB9S 4NA8A 2UUYA 1ELCA 1HAYB 2ZEBA 3NXPA 4O03A 4DOQA 3UY9A 3BTTE 3ATWA 5EPYA 3N7OA 4XSKU 2RA0A 1CSOE 2FOAA 1JIRA 2P8OB 4GVUA 5GIBA 1OWJA 1MMJN 1O3DA 1IQMA 1TNHA 1X7AC 3RXSA 1O34A 2M5TA 1GHVH 1DFPA 1FONA 3O8BA 4AORA 3CNRA 3ZVFA 1MKXH 1FIZA 2P94A 3R3GB 1IQFA 4B74A 2PKSB 1TPPA 5HM9A 3DFJA 1C9TA 4FXGH 5DPAA 4FU8A 2UUKB 3MTYA 1XUGA 2PKAA 2PLXA 5IYTA 2J4IA 1BHXB 4ABHA 1DWDH 1F2SE 2KCPA 1DOJA 1LKBA 1SGDE 2GT7A 1OWHA 1SVPA 4YTAA 1T8MA 3HGPA 1O3IA 1O2ZA 2B8OH 3MOCA 1SQRA 1C1WH 4VGCC 4I7YH 3UREA 5B6LA 3U1IB 1FJSA 5E0HA 3MU4A 2AHME 2AH4X 1QGFA 1E36B 1AN1E 3NK8A 1O2IA 1P02A 3F9HA 1GMCF 4X1RU 4ACAA 3D65E 2B7DH 1AZZA 2FOEA 4MDSA 1BQYA 3QLPH 1EJMA 4UFEH 3T27A 4D9RA 1ZRBA 2K7XA 1KYNA 3AW0A 1MKWH 2CF9H 1NESE 2BYAX 1C2EA 3UB0A 2HVYB 3RXVA 1GJ5H 1ZSJA 1RIWC 1V2LT 3F68H 1G32B 1UVOA 2CHAC 4RI0A 1YLNA 1SKYE 2Y7XA 3O8CA 1ZTJA 2BB4A 1HXFH 4DJZB 4ASHA 3UFAA 4AGJA 2B0FA 2ZQ1A 3B9FH 3V3MA 1GDUA 2KCAA 1OP2A 1GCTB 3SI3H 1TRNA 2EI6A 1KDQB 3OEHD 3ZYDA 1UVSH 2EA3A 1W0ZU 2QYIA 2AEIH 2IPQX 3E3TA 1KMHB 3SO3A 1SGNE 2H5DA 3NRLA 1ID5H 2IN2A 2XWAA 2ZHDA 3KYFA 3LGTA 1Z1IA 5A8YA 1C4U2 4TWYA 3M61U 3PV5A 4KTCA 1QJ7B 2PSYA 3S0NA 3U8TH 2GCTB 4F48B 4ZKSU 2OC7A 1JMOH 4ESTE 3N99A 3SGBE 2VU8E 1HFDA 5E0GA 5A0CA 1TE0A 1AO5A 1S83A 2FOHA 3ZVEA 5DN6D 5EJ1A 1P06A 1GI7B 2FPZA 1TBZH 1C2IA 3RXRA 1FY5A 1O2JA 4R0IA 1KSNA 2GMTC 4XDEA 3FN8A 1SOTA 1P2JA 1GG6C 2A2XH 1TLDA 6GCHF 2OD3B 1HAVA 1BJUA 2LPRA 1QNJA 4I86A 2GV6A 1D6WA 4FUIA 1TYNA 3ZZAA 1MQ5A 4ZMAH 1O2OA 2QY0B 2Q6FA 3B8JA 3DFLA 3URDA 4Z1MD 3LGUA 2V3OH 1K2I1 1V2JT 1LHEH 1ELEE 1H9IE 1DM4B 1UK3A 1ELAA 4B6FA 3RC6A 5EG4A 1HBTH 3RC4A 3RM0H 4TY7A 1SR5C 3H09A 1CHOF 1ANBA 1GJAB 5HKKD 5T1VA 4YOGA 2ZQ2A 1PQAA 1Z7KA 4RKOB 2TGAA 3P95A 4U01A 1TGBA 2ANYA 5L6NH 4GLYA 1XUFA 2UWLA 2FZZA 1IAUA 3SQHE 1O3JA 3DCLA 5AHGH 1BMFD 4A92A 1QQUA 4PROA 1A61H 3MO9A 1AB9C 4JZ1A 2OBOA 1DANH 5GNDA 1DUAA 4JK5A 1IQNA 3ESTA 2ZZUH 4YLUA 3VXFH 5C5OA 3Q76A 2AGEX 1YKTA 3EDXB 4YO9A 2XRCA 5JBBS 1BRBE 1GHAF 1ZHRA 3P8OA 3OAAD 2Z3CA 5JBAS 1TX6A 3U98H 2K0QA 1J16A 2BHGA 4B75A 3RMNH 1QBOA 1P2NA 1HJ9A 1EXFA 2VWLA 5EXLA 1LHDH 1GHBG 4A5TS 2BM2A 2F83A 1NY22 4THNH 2KX4A 3SHAH 2EQNA 1O36A 2Y80A 1HUTH 2SNVA 2UWOA 3ZV8A 1PPFE 3S9AA 4YM9A 3IWMA 2OP9A 5PTPA 1Y5AT 1LQEA 3RXAA 1MTNC 4WXIA 2A31A 4D9QA 3HK6B 2IOTA 1V2PT 4IN1A 3BTKE 4GCHF 2F43B 2J98A 1LVMA 3MH6A 1KXCA 2J94A 5HM2A 3WWFA 2HPPH 1O2HA 1DX5M 4AFSA 2OQ5A 3RMMH 3KYGA 3KQ5A 4MNWA 3E1XB 4WH8A 1TQ7B 2W6ID 3LC5A 4XBBA 5KEDA 1PPZA 3OE7D 3ZZ6A 3RXCA 1BRUP 1YLCA 1CGHA 4CH8B 3OTJE 4FUCA 1TGSZ 1K1IA 3A80A 1QJ6B 4NFFA 2ZECA 2VH6A 4X1SU 2UWPA 1QB6A 2GZ9A 4BAOB 1EASA 2ZGHA 4K5ZA 1KY9A 1AZ8A 4UD9H 4RT1A 1GDNA 2FODA 2JH5D 3FP6E 3HK3B 1S5SA 4X8SH 1BBRK 5FAHA 2R3YA 1V2KT 5DO4H 1YWUA 4XD7D 2Q6DA 1FY3A 4Z6AH 4NSVA 4A1XA 3M36A 4NZLA 3SV8A 1EAUA 4FUHA 1B0FA 2THFB 3E16B 2OC8A 1AWHB 3A82A 1BRAA 2BXUH 1C2KA 2NU2E 4BANB 2FMJA 4U2WA 2QXGA 2C3SA 1XXFA 1AWFH 4DT7B 4Q7XA 1XMNB 1BITA 1CA0C 2FX6A 1QA0A 1YC0A 1TALA 1H4WA 2GCHF 1QBVH 2FS8A 2BD4A 3P17H 1FV9A 4LXBH 3SN8A 2HOBA 1OP8A 5CMXH 1NPMA 1UTLM 1LQDB 1MUEB 1MTUA 1C5MD 1Z8JB 2FS9A 3KHVA 2AGGX 4FUBA 3KIDU 1C2FA 1SHHB 5SGAE 1LO6A 3M5MA 1FUJA 1ANEA 1V2UT 3HKIB 1A3BH 3TGKE 4CHAB 2FI3E 4Y10E 3U1JB 2ZTXA 3QTOH 1MQ6A 2ULLA 3DA9B 4ABAA 2XNDD 1OHHD 4CR5A 1SOZA 4Y0ZE 3M37A 1BJVA 1SGQE 4RN6A 1O5AB 2PW8H 3L6PA 1Y59T 2PHBA 1NZQH 3F9EA 1W0JD 3MMGA 2B9LA 1S85A 2WPKS 1FLEE 1TOMH 4SGBE 2A2QH 3AASA 2J92A 1MKXK 2Q6GA 1L1GA 2ZHFH 2ZWLH 2VINA 1COWD 1DWCH 3SU5A 1Z6EA 2VWOA 1O3OA 4DCDA 2G8TA 2PP6A 1P0SH 3QTVH 1S0QA 1EB1H 1NROH 1OYTH 1NC6A 1CU1A 1KXEA 1ESTA 2PUQH 1C1VH 5T6FA 1Y3XA 4IMZA 4TY6A 1H1BA 2XCFA 4Y71A 1EATA 5F53A 5F8ZA 2D8WA 1ACBE 3PWBA 2I6QA 1VGCB 2QF0A 1VITH 1OWEA 3KCGH 1SC8U 4DY7B 1O32A 2ALVA 2HNTE 2STAE 3EAJA 1HYLA 1TIOA 4JCNA 1GHZA 1C5PA 4H6SB 4AN7A 5EGMA 4TPYA 1KLTA 2FEQH 2ANWA 1GMCG 2ZA5A 3CENA 3GCNA 3PO1C 3K2UA 3RXIA 3LT3A 1CT2E 4Y8ZA 4ZXXH 3SJOA 1RGQA 2G4UA 2QF3A 4FVDA 3QGNB 1QY6A 1FI8A 1MKWK 4OS4A 5C0TA 2AIPA 3BG4B 1EAXA 2GV7A 3PYHA 2SFAA 1C5ZB 1S81A 1O2GH 4IBLH 4NFEA 4K69A 4A1TA 2WV4A 3EA8A 1DS2E 1LCYA 2FOFA 2TGTA 2OK5A 1K28D 1NFYA 4GPGA 2OTVA 2ZHWH 3SNCA 1GHWH 2NU1E 2J2UA 1TGCA 1O2PA 3ZVDA 1MTNB 5DP8A 1ARCA 2FOGA 3RLYH 1BTUA 3OFND 3D23A 3ZZ3A 1K1MA 3MFJA 4P02A 3SJKA 4AB9A 1ZSKA 1AQ7A 1C1QA 4K1TA 7GCHF 1QA7A 4AOQA 2WSSD 3VXEH 1GBLA 4X6MA 1H8IH 5DJ7A 1RRKA 2SNWA 1SG8B 2BOKA 5DK1A 1DY9A 1LMWB 1QZ8A 1ZTKA 2AGIX 5F03A 2R0KA 3FP8E 4TT3D 4SGAE 1SQAA 3BTDE 4YZUA 1BMAA 3VB6A 3OY5U 3SQEE 1GCTC 5EXMA 2AIQA 4HG6A 3DUXH 1CBWB 1WTGH 4KELA 5EW1H 1V6DA 1P2QA 4NIWA 4D76A 1PPHE 1Z8IB 1Q3XA 3P92A 6GCHG 3QN7A 3SV2H 3M5LA 3HATH 4JZFH 2FTMA 4BTIB 1AGJA 4E06H 3T26A 1IQHA 2R0LA 3PB1E 1WV7H 4HGCA 2BLWA 1F0TA 3TGIE 2ZDLA 2ODPA 4OS7A 1GBMA 1GBDA 3FO8D 3OY6U 1AFQB 2A4QA 3SJIA 4YT7H 3QO6A 5EODA 1K1OA 4AFQA 1TRYA 5JBCS 5LPRA 5DG6A 1XKBC 3NZIA 1HAVB 1LKAA 2P3UB 4TWWA 2Z9IA 2GTBA 1D6RA 2JETC 2BLQA 1GMHF 3ZZ5A 1PQ8A 3MNBA 1FMGA 4B73A 5JB8S 1MAYA 1FAXA 5C20A 1NS3A 2WZQA 2VGCB 4FUGA 4B1TA 5EW2H 2ZO3H 1PQ5A 1UCYH 1KXDA 3PRDA 5DP3A 3QZQA 2UUJB 3NPSA 4X2YA 2FXRA 3MO3A 1V2NT 4IS5A 3KQDA 2RG3A 1WXRA 3F9FA 1UCYE 3SNEA 4BAKB 1K1NA 1P09A 1TX7A 2QXHA 1K0HA 2FYRA 3SNAA 1GPZA 1MTSA 1V2WT 1ZZZA 2ZDMA 3SU4A 3M7TA 1MZDA 3E90B 1V2VT 1GHAG 1P10A 1ZMLA 1IQLA 3F0OA 1MTVA 1E35B 2P93A 3MH7A 2ZPRA 1OP0A 2YMSB 1YPHC 4F55A 5LPEA 1O2XA 1L0ZA 5EQRA 1FN6A 3JZ2B 2ZU5A 2H2ZA 2J5UA 4O3UA 1VITG 3ITIA 8LPRA 4AGKA 1Y8TA 3GYLB 1A46H 3GCHB 1GBCA 1O5DH 5TCAA 3VB3A 3CP7A 2F4LA 1UTJA 4HFPB 2C4FH 4ZAEA 4E7NA 4ZKOU 1A0JA 1O2RA 1IOEA 1QRWA 2WYJA 4ABGA 2F9PA 3KGPA 3WY8A 4GCHG 3RU4T 3ZZDA 5FBIA 3BN9A 4AZ2B 5EQQA 1GBFA 3PWCA 2FLBH 3A7VA 3BTGE 2OQUA 1EPTB 2KZ4A 3TJUA 2BDAA 3NKKA 4X1QU 3AW1A 2KCOA 4UFGH 2EI7A 2SGAA 2WHXA 4GAWA 5CHBA 1T8OA 1D4PB 1Q2WA 1ANDA 1G37A 1N8OB 3TJVA 1TMUH 3SU2A 1C9PA 3W94A 2BQ7B 2J98B 3RXKA 4ZKNU 3M7QA 1C5TA 3ZZ9A 1S82A 1F7ZA 1NBME 4IC6A 1YBWA 2W6JD 2JH0D 1AIXH 2G4TA 4NIVA 2QA9E 3E91A 3S69A 2HALA 3TITA 3RXGA 5C1YA 1O3PB 4U30A 3GDVA 1WDIA 3PO1B 2F9BH 4D7FA 3VB4A 1ELBA 2HVXA 4I8GA 1AHTH 1J17T 3FP7E 4B71A 1RJXB 1C5UA 2CF8H 2ZFSA 5L30H 3GOVB 5DGJA 5GCHF 1V2TT 1F5KU 2A7CA 1ZLRA 2G00A 1HAZB 1GI2A 5BRRE 1ESBA 1UMAH 3B23B 1E34B 3ZV9A 2ASUB 1GI8B 4TYDA 2F9OA 3LONA 4X8TH 3TIUA 1YM0A 4J1YA 2QE7D 2BX3A 1OS8A 1GJCB 5ABWA 1O2TA 2GCHG 2V35A 2VIPA 3DSPA 3Q3XA 3TK5A 2XW9A 1C2GA 1T32A 5JYIA 1V2ST 5A8ZA 2VIOA 1QHRB 5HYOA 2PWXA 2EEKA 2ZGBH 4X0WU 1NRSH 5JDUB 3A85A 4UEHH 1JRTA 2Z9LA 1MU6B 2ZDNA 2H1UA 5EJLA 2GDDA 2Z3DA 2PGBB 4X1PU 2Z9KA 1YPMH 1F5RA 3LPRA 1ELDE 1BHXF 1SGCA 1S6HA 5H4IB 3FVFB 1MH0A 5BPEA 6CHAB 3SZEA 1UVPA 3DSGA 2JIZD 2LNCA 3I78A 1MABB 1BTXA 2BQ6B 4LZ1H 1W12U 2ZFTA 3Q3YA 1BB0B 3RU4D 2ZHEH 1PJPA 1UTMA 4WMEA 1E38B 1HJ8A 2XBVA 1GJDB 1GBKA 3DSOA 4MG3A 1A5GH 1PYTD 3BTEE 1ELGA 1C4Y2 4A7IB 2J9NA 3RC5A 2NU4E 3L33A 2R2MB 4GHTA 1O3EA 3A89A 4YOJA 2LELA 2F9VA 2WUBA 4CHAC 8GCHG 4JYVH 1ELFA 3FANA 1O5BB 3UOPA 1ETTH 2VIQA 1C5NH 1TBRH 1SMFE 1TFXA 2BZ6H 3RXBA 2JETB 4IMQA 2ZKSA 1YCPH 1ZMJA 3ZZBA 4CRDA 1Z8RA 1W7GH 1SGFG 3RXDA 2GDEH 3EA7A 3PMAB 4DVAU 1EZQA 1C2HA 1W3CA 3TJNA 3MQKC 1TNGA 2VNTA 2Y6TA 4BAQB 3PV4A 5HIZA 1HB0B 3T2NA 1O3BA 1DUEA 1A2CH 3ZVAA 1E0FD 1GVZA 2WPMS 3ATMA 2FWWA 3N7EA 1NRQH 2BDIA 2BD5A 2A5KA 3QZRA 3RXMA 2A45B 3TNSA 3FFGA 1VGCC 2BVSH 3N7DA 2GZ8A 2H9HA 1L4DA 1CVWH 1P9SA 3NWUA 5DP7A 4H6TA 5C67A 3WWBA 3P6ZB 5EXNA 1TNLA 1A0HB 2Z94A 3IITA 2ZGXH 1MCTA 2CJIA 1S6LA 4K2YA 3MYWA 3VPKA 4B6EA 1CQQA 1AVGH 5G4BA 1O3LA 1OXGA 4UONA 1GI1A 3RXHA 1Y5UT 3BEIB 2PGQB 3UNQA 1XXDA 2ZU2A 2W7SA 3H7TA 4B2BA 1N6YA 5EOKA 2BD3A 2VH0A 4AG1A 1QCPA 2Y5HA 3BG4C 2Q1JA 4TSFD 2ZCLP 7GCHG 1GGDB 1YYY1 3OEED 1QFKH 1JWTA 1IQGA 2HNTF 2P95A 3BIUH 1VITF 1IHSH 3BSQA 5C1UA 4CBOA 1TNKA 1VCWA 4FUFA 2ZTYA 1TA2A 2P16A 3MHWU 4OS6A 2H6MA 3M5NA 1EPTA 2BD7A 5C2ZA 1QRXA 3T29A 1LPGB 1DT2A 1IHTH 4HZHA 1U6QA 3A84A 4I8JA 2VIWA 3SGQE 1G36A 3RXUA 3ZZ4A 3U8RH 5TCCA 4BXWA 1A5IA 4RSPA 3GYMA 3RDZA 4Q7ZA 3TLOA 1THRH 3GY7A 1XUHA 3SU6A 5AFYH 4DT4A 3FOAA 2R2WU 3R0FA 3V7TA 2QGRA 2F9UA 5CE1A 1GDQA 3D49H 4WH6A 1SFQB 2AERH 3URCA 4M9FA 4OS1A 3KEEA 4HTCH 4OGXA 1JBUH 2XBYA 2YNAA 3STJA 3UIRA 3F0PA 1KIGH 3UR9A 1HAPH 1NT1A 1GMHG 5C5NA 4MLFB 2BDCA 1E79D 1KXBA 1D9IA 1WU1A 3UUZA 1CBWC 4Y7AA 2PTCE 1C5SA 4YESB 1HLTH 9LPRA 1GJ4H 1ARBA 1UCYK 3SUDA 3SYJA 3FZZA 2OXSA 2XTTB 1K22H 2STBE 4AFUA 1PPCE 3GDUA 4XRNA 3FKSD 3GCOA 4DIIH 1C5XB 1ZMNA 4MNYA 1L1NA 1O2VA 2ODYB 3S7KB 1J15A 1AFQC 2QXJA 1HJAB 1O2KA 1G30B 1IQIA 3NUMA 1NU9A 6LPRA 1O3MA 1S6FA 4BXSA 2GX4A 4CRFA 2AMPA 1THPB 2V7QD 3ODDA 1K1JA 1SQTA 1C2DA 5C1XA 2PR3A 1QR3E 1MBQA 2VGCC 1E37B 1BMMH 1C1TA 3U69H 1AU8A 1WYKA 2GJGA 4X2VA 5C3NA 4CBNA 1EJNA 1FIWA 1TPOA 1JIMA 5LH8A 3RU4E 2G55A 4OS5A 4CRCA 1P9UA 2BLOA 1INCA 4B76A 4LOYH 1BMLA 2OC1A 3CS0A 2QF5A 1RS0A 1WAYB 2K1QA 2KFWA 1ZOMA 3Q77A 4JZEH 5FHTA 1P3CA 2V3HH 3TH3H 4RT0A 3LGWA 2BY9X 1Q31A 4FUDA 2YMSC 2CMYA 1NM6A 3SGAE 3U9AH 2Z7FE 2ZIQH 4I32A 5FBEA 6ESTA 5J4QA 3V12A 2V3MA 1TPAE 2G5VA 1P04A 3VFEA 1P2OA 3U8OH 4ABEA 2Z3EA 4ACBA 2AFQB 4I31A 4X1NU 4CH2B 1BUIA 1BZXE 2GP9B 1O2UA 3GCHC 1W11U 3MH5A 1ZYOA 3Q3KA 4NGAH 2GZ7A 1XVMA 4NWKA 4WJG2 1FX0B 2DUCA 4I8HA 1CGIE 2O8TA 2Y5FA 3ZYEA 2JKHA 1KLJH 4D8NA 1WTHD 5A0AE 1F0UA 1SLVB 5ESTE 1EP5A 3BTHE 3GY6A 1W8BH 1SGYE 1ZSLA 1JXPA 3KQBA 1EPTC 2CXVA 1T31A 5E8EH 3KF2A 3RMOH 1MD8A 8GCHF 1GI6A 3JZ1B 1ZPZA 4ISLA 1ZHMA 3A8AA 2NU0E 4Y8XA 2BD2A 3H7OA 8KME2 1HAGE 3HPTB 5T6GA 2H5CA 2ANMH 3BF6H 3TH2H 1YP9A 3I29A 1N8OC 2W3IA 3A88A 1NBMD 2GD4B 5GCHG 2RDLA 1PPEE 3KN2A 1GI3A 3S9BA 1TMTH 3UR6A 1A3EH 1GHXH 1Y3VA 2WPIS 1O31A 2VIDA 1W10U 3C27B 5DSFA 3A81A 1K21H 5E2PA 3ZZ7A 1YPHE 2W26A 1ZR0A 2XBWA 2KAIB 3RXEA 9ESTA 2QAAA 4LK4A 1FPHH 1GJ8B 1O2YA 4AYYB 2P59A 1HXEH 2P3TB 5GWZA 4OGYA 3WW7A 1O3HA 2ZFRH 3MNXA 1QB1A 3MNCA 1AD8H 1QL9A 4ZROA 1GL0E 1WBGB 1GCDA 4X8VH 4JYTA 5GXPA 5C17A 4E05H 3LGIA 3RXFA 2ZDAH 3DD2H 1G3DA 1A5HA 5FPTA 3SJ9A 4JK6A 1BA8B 1AFEH 1NRNH 4I33A 4X6OA 4Y11E 1G9IE 1L1JA 5A09A 1G3CA 2A5IA 2XC5A 1B5GH 1EJAA 2WINI 2Y5GA 2IPHA 4ABJA 4X6NA 1VCQA 1HDTH 2AYWA 2LP6A 1J14A 2VJ1A 1H8HD 1QBNA 3TH4H 2ZU1A 1DWEH 3S9CA 2KCYA 2WYGA 4CR9A 1NFUA 1SGPE 5AFZH 1QJ1B 2RDEA 3AAUA 3RUOA 1XUKA 2J95A 2P3FH 2JH6D 2ZGCA 4TPIZ 4KP0A 3BEUA 2XC0A 1G2LA 4P00A 6CHAC 1YGCH 1CGJE 1OWDA 1YPEH 1SSXA 3LJJA 5E2OA 4HI3A 1FY8E 3Q00A 2A32A 1DLKB 1GI5A 5EIYA 1O5GH 3A7ZA 1YCPK 4INLA 1GBHA 4CRBA 1V2QT 5JPMH 2H9EH 1ORFA 1M9UA 4Q4LA 1CO7E 3A83A 3M3VA 5EU8A 1A0LA 3MO6A 3QDZB 4ZXYH 3SUGA 1O3CA 1C1OA 2FYQA 3RXJA 1NU7B 3UNSA 1ABIH 4GSOA 1C5LH 4A1VA 4JZIA 1C5WB 1VJ9U 1UTQA 2QF4A 3W1EA 1BIOA 1C5OH 1YPJH 4DURA 1SLWB 5T6DA 2VWMA 4ZUHA 4DG4A 1Z6JH 1LTOA 2ALPA 2G52A 3MWIU 2ZTZA 2JJ1D 1WSSH 5ESBA 3QX5H 1XUIA 1SLXB 2SGFE 3UPEA 1MZAA 1SGIB 1F92A 2UUFB 2PFEA 1MAXA 2ZCKP 1MU8B 1AY6H 2BY8X 4WWYA 3QUMP 3OU0A 3A8DA 3RMLH 4O9VA 5IK2D 2VVCA 4MPXA 3TJOA 3SNBA 1DWBH 5EJZA 4UDWH 4BAHB 2HGTH 1YCPM 2TIOA 4NSYA 3E8LA 3PTNA 4H4FA 1GBBA 3LU9B 1C2MA 1DVAH 4CRGA 2BDHA 5DP9A 4B2CA 1AE5A 3BEFB 4WXVA 1C5RA 1DICA 1VKYA 3M7UA 1YF4A 3VB7A 1SQOA 2C8XB 2O9QA 2ZFPH 5FX5A 1OKXA 3ZVBA 1TABE 1C5VA 1GVLA 5LPFA 2O8UA 1BBRE 1JOUB 2XCNA 1BTWA 1UHBB 2YMSD 3ENSB 3PROA 3LH1A 5K7RA 5KECA 1ZJKA 1EOLA 5EQSA 2SGPE 3T5FH 5C0UA 2O8MA 5F8TA 2WUCA 4FU9A 1SBWA 2CK3D 2BX4A 3P8NA 1GJBB 1TBQH 4UE7H 1BRCE 2YOLA 1YY3A 3MU5A 1TX8A 1G3BA 2FTLE 1GBJA 2IJOB 2XWBI 4FUEA 3TK6A 1FY4A 1D3QB 1GGDC 5A8XA 4D7GA 1SGFA 2IJD1 4JZDH 2BMGB 3FZDA 2BD8A 2ZGJA 3RXTA 3SOSA 4ABIA 1EFRD 2A7JA 2NU3E 4WY3A 1SGEE 1C1MA 5L2ZH 1P2IA 4ABBA 1HV7A 1A7SA 5FPSA 3SW2B 5DP5A 1HIAB 1O2SA 3F2HA 3UWIA 3SHCH 2A7HA 5E0JA 1W2KH 2BOHB 2CGAA 2D2DA 1ZRKA 1DXPA 1SPJA 1DPOA 1QB9A 1LHGH 1C1UH 3RXLA 2BQWB 1DSTA 1XUJA 1LVYA 1GBEA 2TGDA 3DHKH 4ABFA 1G3EA 1ESAA 4IC5A 2FESH 1TONA 2QCYA 2PUXB 2DE8A 3GY8A 1RTLA 3P8FA 1NN6A 3H5CB 3PLKA 1W14U 2D1JA 4GHQA 3MU8A 2KR7A 4JYUH 3TK9A 4ZHLU 1ANCA 2TPIZ 3STIA 5CHAB 1UVTH 3LOXA 4NCYA 1TRMA 3UQOA 2KAIA 1V2MT 3T28A 2ZP0H 3I77A 3SORA 1N1LA 3SJ8A 1O2NA 1VJAU 1EAWA 2R9PA 1NFXA 2ZFQH 2CV3A 1MBMA 2B5TB 2BY5X 1IQEA 4RKJB 1OSSA 1SHYA 1Z1JA 1UW7A 1LDTT 1O5EH 1LVBA 4XFQA 1GHYH 2XOKD 3PV2A 4MNXA 5CDFE 1AUJA 1D3DB 5KGOA 1ZGIA 1QURH 1SGRE 1F0RA 3O8DA 1KTSB 1DE7H 2V6NA 1SL3A 1HJAC 3UWJH 7KMEH 1MTWA 3ZZCA 2BTCE 1SLUB 1Y3WA 5C94A 1P03A 2A4GA 2HRVA 1F0SA 1L2EA 3F1SB 3OX7U 1LPZB 4QT8C 3BG8A 1TGTA 2SGQE 3A7YA 3E0PB 1KLIH 1GI0A 4WMFA 1T8NA 2QV1A 3M3SA 1O2LA 1UVUH 2AS9A 1FXYA 3LIWA 4ISNA 1CE5A 3ELAH 1NFWA 2FM2A 2ZG0H 4MTBA 1C5QA 2EY4C
chains in the Genus database with same CATH topology
4NZQA 1J8AA 1D3TB 3SUFA 1Y5BT 3ATIA 3SBKA 2C90B 4E7RG 4OS2A 1TGNA 2HWLB 3UTUH 3BTQE 1ABJH 3QGJA 1O3KA 5A2MH 4JMYA 1CA8B 1UK2A 3GY2A 4Y76A 1AKSB 1THSH 1TPSA 2FOBA 1C4V2 3MU1A 1QL8A 2VB0A 1NRPH 4CRAA 5HXFA 1PPGE 2FX4A 5TJXA 3TGJE 1TMBH 1T4VH 2ZU3A 3PM3A 1GMDG 1RD3B 3QK1A 4ISHH 3SNDA 4MPVA 4AFZA 3RP2A 3VGCB 1DSUA 2FOCA 3SI4H 2ZI2H 1ZTLA 3PLBA 3SU1A 1K1PA 1T8LA 1V2OT 2Y7ZA 3BV9B 3M3TA 1GVKB 1O39A 2TBSA 2ANKH 4NIYA 3W95A 3ZVCA 2AMDA 3LH3A 1LVOA 4J2YB 2CN0H 2VVVA 3ATLA 1DLEA 2BXTH 4NG9H 3UNRA 1VCPA 1MD7A 1YLDA 3E6PH 1EOJA 1RTFB 4K60A 1O3AA 1OYQA 1C2JA 3C1KA 1PPBH 1P2KA 2XBXA 2RCEA 1AMHA 1CT0E 1J9CH 5GPIB 1B7XB 1Z8GA 1BTPA 1BTYA 2BVXH 3BTME 2BDYA 2BZAA 1HRTH 3AVZA 3TNTA 3PMBB 5B6OA 2FI4E 1HAIH 1TB6H 1UTNA 4AB8A 1NRRH 4MNVA 1HPGA 1OWIA 3OYPA 2OC0A 4Q80A 4BAMB 1AI8H 4X6PA 1Z71A 1GJ9B 3OSYA 5HMAA 4XOJA 2C8ZB 1UHBA 2ZDVH 3KQEA 3EA9A 4ISIH 4B2AA 1GBAA 1XKAC 5IDKA 1O30A 1S84A 1H9HE 1O2MA 2OBQA 1BT7A 1TQ0B 4X2XA 4M7GA 2FLRH 1EX3A 1QL7A 2PSXA 2GT8A 2PTNA 2BY7X 1C5YB 5AF9H 1ZGVA 2A0QB 3GCTF 1O38A 3RLWH 1L4ZA 4Q2KA 2ZNKH 3LGVA 1K9OE 5I25A 5FPYA 3LKWA 4Q7YA 2C8WB 1O5FH 3A87A 1GJ7B 3NCLA 4NA9H 4NA7A 1ELVA 1HIAA 2I6SA 1G2MA 3RM2H 1RXPA 3GY5A 4K3JA 2GGVB 2PV9B 2Z6BD 4LZ4B 2C93B 4Y6DA 2Z9GA 4XBCA 1BTZA 4X2WA 1RFNA 2ILNA 1WOFA 3VEQB 2TRMA 4ISOA 3K9XB 3F9GA 3RXQA 1YPLH 1W0YH 4INHA 1BOQA 1SFIA 3UOUA 1EKBB 2H9TH 1DITH 1EZUC 2QC2A 2ZU4A 1C1NA 1GI4A 2BDGA 4I8LA 3MNSA 1O37A 2OLGA 2LIZA 2C8YB 4IGDA 7ESTE 1LHCH 3A7WA 3GISB 1V3XA 2OUAA 1P01A 1TNIA 4XBDA 4VGCB 3TU7H 1UTPA 3KQCA 1CHGA 1FZZA 2DE9A 2ZCHP 2F91A 1OOKB 1WQSA 1YPGH 2BDBA 2ZF0H 3SU0A 1XX9A 4F4OC 2XNIA 4YLQH 5DP4A 5T3HA 1IQKA 1T7CA 2FIRH 3V0XA 1EUFA 4YT6H 2FO9A 5F6MA 2SGEE 1KXAA 1C1SA 3K65B 1RIWB 2W3KA 3EBNA 1FDPA 2CHAB 3EE0B 2A5AA 4NWLA 2ZFFH 5FCRA 2W5EA 1O2WA 1FPCH 3S7HB 4I8KA 4INKA 2J34A 2VVUA 1PQ7A 1FN8A 1CT4E 1D3PB 1K1LA 1DY8A 1DDJA 4O3TA 1O0DH 1H9LB 1LPKB 1ETSH 4KTUA 5I46H 4DGJA 2FI5E 3M5OA 1WUNH 5HGGA 1AKSA 3FAOA 3IG6B 8ESTE 3EQ0H 3QWCH 3TVJB 1VR1H 1KDQA 2G5NA 4ZHMU 1HGTH 2Z9JA 4CREA 2F3CE 4KTSA 3A8BA 5FCKA 3GDSA 3ODFA 4K1EA 4MVNA 1ELTA 3GY3A 1V2RT 4UFFH 1UK4A 4WVPE 1HCGA 4KGAA 2VWNA 1PFXC 1BCUH 2ZHQH 3EGKH 4BTUB 1WCZA 3TPIZ 3SU3A 2TGPZ 1P2MA 1AVXA 2GMTB 1O3FA 2AMQA 1GG6B 1TOCB 4NIXA 1GMDF 3MU0A 3AAVA 1P8VC 1ETRH 4BNRA 2HLCA 4FUJA 1MCVA 4A6LA 4K8BA 2XC4A 2ESTE 2XXLA 2ZPSA 4FVBA 2O8LA 1LHFH 1NTPA 1VZQH 3A86A 4Y8YA 4AX9H 3SV6A 2R3UA 3D62A 1GBIA 1W13U 1EAIA 1OWKA 2P8OC 3MH4A 3RXOA 4R8TB 1W7XH 4AYVB 1RTKA 1ZHPA 1BTHH 5FXLA 4O97A 3SUEA 2PKAB 1KTTB 3SV7A 4ABDA 1ZJDA 1AUTC 5A0BA 1AVWA 1C1PA 5CHAC 2PKSC 4UFDH 3ZZ8A 1P57B 1AB9B 3BIVH 2EC9H 1FAKH 1GJ6A 1BDAA 1DXWA 5AVDA 2O8WA 4ZH8A 1BMNH 2A4RA 1ZPBA 2QIQA 2W7UA 1GBTA 1A1RA 1O3GA 2GKVE 1UTOA 1B0EA 1UJ1A 4ZHAA 3GICB 1P3EA 4ZKRU 4U32A 1EP6A 3F6UH 2BY6X 4GUXA 2ODQA 3T62A 4MPWA 3O8RA 3HKJB 3VB5A 4MQAA 3P8GA 4BOHA 3ATKA 3L3TA 2OINA 4IW4E 2ZPQA 2WPLS 2OCVB 2QXIA 4WF8A 1QQ4A 2F9NA 3RXPA 1O3NA 4F49A 1FY1A 2G81E 5GDSH 1GWAA 5DP6A 1FNIA 1IQJA 1C2LA 4H42U 2ZDKA 1QTFA 4WMDA 5ETXA 4DIHH 3HGNA 1F5LA 1HAHH 1TNJA 1KXFA 5F8XA 5L2YH 1GHBF 2NWNA 3CS7A 1C1RA 1NO9H 2Y82A 1OPHB 2BLVA 3KL6A 4FU7A 1PYTC 1JRSA 3A7XA 3UQVA 3LJOA 3BTWE 5JBTA 4DW2U 2FOMB 2BD9A 1ZPCA 1P12E 3LC3A 4Y7BA 3PMJA 3PLPA 1FQ3A 2BVRH 4Z0KA 1QIXB 3P70B 3E0NB 3DT0H 1P11E 3VGCC 1XM1A 1UO6A 3K6ZA 4YOIA 1GI9B 1UTKA 2GCTC 2EI8A 2J38A 1TA6A 3A8CA 5FX6A 4IN2A 1Y3YA 3ZVGA 1EQ9A 1HAXB 2Y81A 5EPNA 1CHOG 4AG2A 1GL1A 3A7TA 2XYAA 1H8DH 2WPHS 3BTFE 1WQVH 2VIVA 2GVFA 4K8YA 1CA0B 3K6YA 3KNXA 4K1SA 1HAOH 1OX1A 1HNEE 1EZSC 5DKMA 4BTTB 3LDXH 1BBRH 1QRZA 2A4OA 3EYDA 3SV9A 2A1DB 1O2QA 1EB2A 2HNTC 2YNBA 3PTBA 2ZC9H 3GCTG 1P05A 2QN5T 4XE4A 1TAWA 2SGDE 2D26C 3M35A 1EZXC 4MPUA 1SGTA 4Y0YE 3T25A 3SZNA 3G01A 7LPRA 3MI4A 1SB1H 2WV5A 3GY4A 4KKDA 5J4SA 1O35A 4Y79A 2V0BA 1SI5H 1T4UH 2FDAA 1S0RA 3PMHB 2HPQH 3LGYA 1YPKH 4X8UH 2G51A 5LGOA 1TWXB 1XVOA 2RA3A 1Y3UA 5GJ4B 1O5CB 1O33A 1AE8H 2FP7B 5K0HA 1A4WH 1N6XA 2WPJS 3V13A 5JB9S 4NA8A 2UUYA 1ELCA 1HAYB 2ZEBA 3NXPA 4O03A 4DOQA 3UY9A 3BTTE 3ATWA 5EPYA 3N7OA 4XSKU 2RA0A 1CSOE 2FOAA 1JIRA 2P8OB 4GVUA 5GIBA 1OWJA 1MMJN 1O3DA 1IQMA 1TNHA 1X7AC 3RXSA 1O34A 2M5TA 1GHVH 1DFPA 1FONA 3O8BA 4AORA 3ZVFA 1MKXH 1FIZA 2P94A 3R3GB 1IQFA 4B74A 2PKSB 1TPPA 5HM9A 3DFJA 1C9TA 4FXGH 5DPAA 4FU8A 2UUKB 3MTYA 1XUGA 2PKAA 2PLXA 5IYTA 2J4IA 1BHXB 4ABHA 1DWDH 1F2SE 1DOJA 1LKBA 1SGDE 2GT7A 1OWHA 1SVPA 4YTAA 1T8MA 3HGPA 1O3IA 1O2ZA 2B8OH 3MOCA 1C1WH 4VGCC 4I7YH 3UREA 3U1IB 1FJSA 5E0HA 3MU4A 2AH4X 1QGFA 1E36B 1AN1E 3NK8A 1O2IA 1P02A 3F9HA 1GMCF 4X1RU 3D65E 2B7DH 1AZZA 2FOEA 4MDSA 1BQYA 3QLPH 1EJMA 4UFEH 3T27A 4D9RA 1ZRBA 2K7XA 1KYNA 3AW0A 1MKWH 2CF9H 1NESE 2BYAX 1C2EA 3RXVA 1GJ5H 1ZSJA 1RIWC 1V2LT 3F68H 1G32B 1UVOA 2CHAC 2Y7XA 3O8CA 1ZTJA 2BB4A 1HXFH 4DJZB 4ASHA 3UFAA 4AGJA 2B0FA 2ZQ1A 3B9FH 3V3MA 1GDUA 1OP2A 1GCTB 3SI3H 1TRNA 2EI6A 1KDQB 3ZYDA 1UVSH 2EA3A 1W0ZU 2QYIA 2AEIH 3E3TA 3SO3A 1SGNE 2H5DA 1ID5H 2IN2A 2XWAA 2ZHDA 3LGTA 1Z1IA 5A8YA 1C4U2 4TWYA 3M61U 4KTCA 1QJ7B 2PSYA 3S0NA 3U8TH 2GCTB 4ZKSU 2OC7A 1JMOH 4ESTE 3SGBE 2VU8E 1HFDA 5E0GA 5A0CA 1TE0A 1AO5A 1S83A 2FOHA 3ZVEA 1P06A 1GI7B 2FPZA 1TBZH 1C2IA 3RXRA 1FY5A 1O2JA 4R0IA 1KSNA 2GMTC 4XDEA 1SOTA 1P2JA 1GG6C 2A2XH 1TLDA 6GCHF 2OD3B 1HAVA 1BJUA 2LPRA 1QNJA 2GV6A 1D6WA 4FUIA 1TYNA 3ZZAA 1MQ5A 4ZMAH 1O2OA 2QY0B 2Q6FA 3B8JA 3DFLA 3URDA 3LGUA 2V3OH 1K2I1 1V2JT 1LHEH 1ELEE 1H9IE 1DM4B 1UK3A 1ELAA 3RC6A 5EG4A 1HBTH 3RC4A 3RM0H 4TY7A 1SR5C 1CHOF 1ANBA 1GJAB 4YOGA 2ZQ2A 1PQAA 1Z7KA 4RKOB 2TGAA 3P95A 4U01A 1TGBA 2ANYA 5L6NH 4GLYA 1XUFA 2UWLA 2FZZA 1IAUA 3SQHE 1O3JA 5AHGH 4A92A 1QQUA 4PROA 1A61H 3MO9A 1AB9C 4JZ1A 2OBOA 1DANH 1DUAA 4JK5A 1IQNA 3ESTA 2ZZUH 4YLUA 3VXFH 5C5OA 3Q76A 2AGEX 1YKTA 3EDXB 4YO9A 2XRCA 5JBBS 1BRBE 1GHAF 1ZHRA 3P8OA 5JBAS 2Z3CA 1TX6A 3U98H 1J16A 2BHGA 4B75A 3RMNH 1QBOA 1P2NA 1HJ9A 1EXFA 2VWLA 5EXLA 1LHDH 1GHBG 4A5TS 2BM2A 2F83A 1NY22 4THNH 3SHAH 1O36A 2Y80A 1HUTH 2SNVA 2UWOA 3ZV8A 1PPFE 3S9AA 4YM9A 3IWMA 2OP9A 5PTPA 1Y5AT 1LQEA 3RXAA 1MTNC 4WXIA 2A31A 4D9QA 3HK6B 2IOTA 1V2PT 4IN1A 3BTKE 4GCHF 1LVMA 3MH6A 1KXCA 2J94A 5HM2A 2HPPH 1O2HA 1DX5M 4AFSA 2OQ5A 3RMMH 4MNWA 3E1XB 4WH8A 1TQ7B 3LC5A 4XBBA 1PPZA 3ZZ6A 3RXCA 1BRUP 1YLCA 1CGHA 4CH8B 3OTJE 4FUCA 1TGSZ 1K1IA 3A80A 1QJ6B 4NFFA 2ZECA 2VH6A 4X1SU 2UWPA 1QB6A 2GZ9A 4BAOB 1EASA 2ZGHA 4K5ZA 1KY9A 1AZ8A 4UD9H 1GDNA 2FODA 2JH5D 3FP6E 3HK3B 1S5SA 4X8SH 1BBRK 5FAHA 2R3YA 1V2KT 5DO4H 2Q6DA 1FY3A 4Z6AH 4NSVA 4A1XA 3M36A 4NZLA 3SV8A 1EAUA 4FUHA 1B0FA 2THFB 3E16B 2OC8A 1AWHB 3A82A 1BRAA 2BXUH 1C2KA 2NU2E 4BANB 2FMJA 4U2WA 2QXGA 2C3SA 1XXFA 1AWFH 4DT7B 4Q7XA 1XMNB 1BITA 1CA0C 2FX6A 1QA0A 1YC0A 1TALA 1H4WA 2GCHF 1QBVH 2FS8A 2BD4A 3P17H 1FV9A 4LXBH 3SN8A 2HOBA 1OP8A 5CMXH 1NPMA 1UTLM 1LQDB 1MUEB 1MTUA 1C5MD 1Z8JB 2FS9A 3KHVA 2AGGX 4FUBA 3KIDU 1C2FA 1SHHB 5SGAE 1LO6A 3M5MA 1FUJA 1ANEA 1V2UT 3HKIB 1A3BH 3TGKE 4CHAB 2FI3E 4Y10E 3U1JB 2ZTXA 3QTOH 1MQ6A 2ULLA 3DA9B 4ABAA 4CR5A 1SOZA 4Y0ZE 3M37A 1BJVA 1SGQE 4RN6A 1O5AB 2PW8H 3L6PA 1Y59T 2PHBA 1NZQH 3F9EA 3MMGA 2B9LA 1S85A 2WPKS 1FLEE 1TOMH 4SGBE 2A2QH 3AASA 2J92A 1MKXK 2Q6GA 1L1GA 2ZHFH 2ZWLH 2VINA 1DWCH 3SU5A 1Z6EA 2VWOA 1O3OA 4DCDA 2G8TA 1P0SH 3QTVH 1S0QA 1EB1H 1NROH 1OYTH 1NC6A 1CU1A 1KXEA 1ESTA 2PUQH 1C1VH 5T6FA 1Y3XA 4IMZA 4TY6A 1H1BA 2XCFA 4Y71A 1EATA 5F8ZA 2D8WA 1ACBE 3PWBA 2I6QA 1VGCB 2QF0A 1VITH 1OWEA 3KCGH 1SC8U 4DY7B 1O32A 2ALVA 2HNTE 2STAE 3EAJA 1HYLA 1TIOA 4JCNA 1GHZA 1C5PA 4H6SB 4AN7A 5EGMA 4TPYA 1KLTA 2FEQH 2ANWA 1GMCG 2ZA5A 3CENA 3GCNA 3PO1C 3K2UA 3RXIA 3LT3A 1CT2E 4Y8ZA 4ZXXH 3SJOA 1RGQA 2G4UA 2QF3A 4FVDA 3QGNB 1QY6A 1FI8A 1MKWK 4OS4A 2AIPA 3BG4B 1EAXA 2GV7A 3PYHA 2SFAA 1C5ZB 1S81A 1O2GH 4IBLH 4NFEA 4K69A 4A1TA 2WV4A 3EA8A 1DS2E 1LCYA 2FOFA 2TGTA 1K28D 1NFYA 4GPGA 2OTVA 2ZHWH 3SNCA 1GHWH 2NU1E 2J2UA 1TGCA 1O2PA 3ZVDA 1MTNB 5DP8A 1ARCA 2FOGA