1SGFA

Crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
228
structure length
203
Chain Sequence
NSQPWHVAVYRFNKYQCGGVLLDRNWVLTAAHCYNDKYQVWLGKEEPSDQHRLVSKAIPHPDFNMSLLPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKLGSTCLASICVNLKLLPNEDCDKAHEMKVTDAMLCAGEMDGGSYTCEHDSGGPLICDGILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMANNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NERVE GROWTH FACTOR
publication title Structure of mouse 7S NGF: a complex of nerve growth factor with four binding proteins.
pubmed doi rcsb
molecule tags Growth factor
total genus 36
structure length 203
sequence length 228
chains with identical sequence X
ec nomenclature
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgfA01
1C5OH 1VZQH 2C4FH 3KQBA 3VGCC 1GHXH 4YO9A 2UWOA 4IBLH 4Z6AH 1ZZZA 1PPFE 1MKWK 2IPHA 2WV4A 1ZPCA 3MNBA 5K0HA 4WH8A 1P04A 2ZGCA 1ELTA 3A84A 5LPRA 1B7XB 2FTMA 2Z9JA 1O2LA 4B75A 1QGFA 1O5EH 3MFJA 4WMFA 1K28D 1UTKA 1RIWC 3M7TA 1T4VH 5FXLA 2XXLA 5CHAB 4K69A 3GY5A 4X6NA 3SQHE 2GV6A 2ZECA 5C1UA 1ESBA 1J17T 4A92A 1DUEA 2ZDAH 1VITG 3FP6E 2BXUH 1TRMA 4I33A 1JOUB 4J2YB 1TGTA 1AU8A 2GKVE 1NC6A 1LVOA 3V13A 1NFWA 1ZMLA 8ESTE 1S83A 5DK1A 3TNSA 1MAYA 4IW4E 4NWLA 4D7GA 1ELVA 1MCTA 4AB9A 2G00A 1SGNE 1Z6EA 1KDQB 3GCTG 3BG4C 2W3KA 5I46H 1V6DA 1PPCE 3BF6H 1KLTA 5F8XA 1GI1A 4CH2B 1K9OE 1UCYH 2A45B 1O3BA 1A0LA 1C5WB 2BD4A 1TLDA 3GDUA 4A1TA 1TB6H 1LVMA 1GBJA 2J95A 1TOCB 1LHDH 5PTPA 3A8BA 1UCYE 1TOMH 2PKSC 2PR3A 3SV6A 4UONA 3SQEE 3ZVEA 5DO4H 1CA0B 3A8AA 1ELCA 1HAGE 2WINI 1HIAB 3SNDA 4B2CA 4ZAEA 3ZYEA 3TGIE 3SORA 1O2QA 3ZZDA 1O5DH 1K1OA 3P8GA 1QRXA 4MPVA 1CGJE 1O39A 2OD3B 1V2OT 2BD7A 2ZHDA 5T3HA 2ZGXH 1NFUA 2J94A 1G3BA 1GI9B 2ZF0H 2A2QH 4NG9H 3ZZ5A 1J8AA 4OGXA 1DPOA 1ELGA 3CP7A 3U9AH 1QTFA 2AFQB 2GCTB 1ETTH 3GCNA 1SGRE 2NU3E 3LGWA 3PTBA 1XUFA 1HIAA 5EOKA 3BTTE 3BTFE 6GCHG 1P01A 3ZZ8A 1SGDE 1X7AC 2BX3A 2VVCA 1DXPA 4ABEA 3VPKA 2BDYA 4U01A 2XYAA 1C1QA 4DGJA 2OQ5A 2XRCA 1P11E 3S9AA 1B0FA 3GY3A 3U8OH 1Y5UT 3TH3H 2EC9H 1UJ1A 2W3IA 1YPKH 5EW1H 2Z9IA 4E06H 2VVUA 4X2YA 2PWXA 3RXIA 4MPXA 3EA8A 1DS2E 1YCPK 4K1SA 4IN2A 1K22H 4FUGA 4GHTA 3T25A 3TLOA 3R0FA 2ZDVH 2HWLB 2WPMS 3RXJA 1AVGH 1NZQH 3LKWA 1RRKA 1GMDF 1OWIA 1WU1A 3K6ZA 4NA9H 2OTVA 2R9PA 4Y10E 4AN7A 5F8ZA 1C5YB 1O3MA 4U30A 4UE7H 1ZGVA 3T27A 5TCCA 4ABJA 1P2OA 3AVZA 1LMWB 5BRRE 1EJAA 4FVBA 1FNIA 2ZG0H 4B76A 3ZV9A 3TH4H 1HRTH 2PGBB 1DSTA 2TGTA 4AFQA 8GCHF 5J4SA 3RXAA 3SU0A 1UMAH 1GBMA 2OUAA 4KTSA 1GG6B 8KME2 1S84A 1LHFH 2B0FA 1ELBA 3PWCA 5HYOA 1ANDA 2RDLA 3QZRA 2BLWA 1PPZA 3T28A 1JRTA 1W0YH 4GLYA 4I31A 4Q7ZA 1QB9A 4HZHA 1HFDA 4X2XA 1OYTH 4BAOB 1C5LH 5C1YA 4Y6DA 4BAHB 5C67A 4ESTE 3TIUA 5LPFA 7ESTE 1HLTH 1O2WA 1UTQA 1W7XH 1TRNA 1YKTA 4TPYA 4YLUA 2CXVA 2GT7A 1UVOA 2OQUA 2XCFA 1ZRKA 3SUEA 2A1DB 1NESE 1EUFA 1GBTA 1K1PA 3SI3H 1TPPA 2HNTC 3RMMH 4LZ4B 4AYYB 4MDSA 4ABDA 2ZC9H 4UEHH 3BV9B 3A8CA 1ZPZA 3VB3A 1D6WA 3ENSB 3RXLA 1DWBH 4X1SU 3A86A 1GBEA 1QA7A 2AIQA 5EXMA 9LPRA 4KTCA 5LH8A 1BDAA 1V2NT 1F5KU 1C9PA 2ANYA 1L4DA 1SGFA 1WOFA 2O8WA 1ZHRA 2ZQ1A 1IQFA 1A5HA 2LPRA 5DP8A 1QB1A 2FOCA 2Z7FE 3RU4T 1WQVH 3MYWA 1P3CA 3A82A 4AFSA 4ISHH 4Y7BA 3FAOA 5K7RA 2XNIA 5DP5A 1C1VH 3A83A 2P8OB 1O2XA 1O34A 4ASHA 4JZFH 1FMGA 1MBMA 1Q31A 5A8XA 1GCDA 1G2MA 1FIWA 1HNEE 1W2KH 3MI4A 2W26A 2JH5D 1PPGE 2BD5A 2GD4B 2G5VA 2VIWA 3BTQE 4FUHA 1P12E 2G8TA 1W7GH 1TPAE 2V6NA 2FXRA 1IQNA 1P0SH 5GIBA 4IC6A 1HV7A 1YLDA 4IGDA 2O9QA 1H9HE 4VGCB 1KIGH 2F9OA 4I8HA 1GHYH 5FCRA 1CO7E 3MH6A 3RP2A 1L0ZA 4UFGH 4DCDA 1V2LT 4E05H 1PPEE 3V3MA 1O2TA 2PTCE 1NRPH 2FS9A 3BIUH 4WY3A 2OC1A 5DJ7A 1LHGH 1EPTB 1MTWA 1P05A 4D8NA 5GXPA 5CMXH 2CHAC 2PTNA 1UTPA 3Q76A 2ODQA 2ZZUH 3MNSA 1KLIH 2GCHG 1P57B 1TE0A 4OS1A 5LGOA 3KQDA 1CT0E 2BY6X 4Y79A 3HKJB 4K1TA 2D26C 2BHGA 3SGAE 2C90B 4IN1A 2BQ6B 1N1LA 3SV2H 1JBUH 1C2HA 4XBDA 7GCHG 1AKSB 4PROA 1O3KA 1BRBE 1EPTA 1DANH 1G9IE 1ZR0A 4LOYH 4I7YH 1VR1H 1HAOH 1AZZA 3M7QA 1NT1A 3UQVA 2G81E 3A7VA 2BY8X 1V2VT 3GY7A 1ELEE 4INHA 2PKAB 3IWMA 3EA7A 3E90B 2ZFRH 1SPJA 2D2DA 4AX9H 2A4QA 5ETXA 1NRNH 2QIQA 1SGCA 1JWTA 2Q6DA 2ZA5A 5AFZH 1HAPH 4B1TA 1V2ST 1TGBA 4XBBA 4YESB 1NY22 4GCHF 3GY8A 2VIDA 8LPRA 2Z9KA 3BSQA 3S7HB 2B7DH 1EAWA 1AWHB 1MKXH 2PFEA 4Q80A 2ZHFH 1G3EA 3EE0B 4I8KA 3LOXA 4AORA 1ABIH 2QGRA 4O97A 3RXTA 1E37B 4OS5A 3MNXA 1HAXB 1XUHA 4WWYA 4CREA 1CA8B 3SU3A 1FY1A 2CJIA 2EA3A 1TNJA 2BB4A 2P59A 5GCHF 3URDA 1Y5AT 1ZOMA 2QY0B 1GVLA 1D9IA 4I8JA 2HALA 2P93A 1W3CA 1MU8B 3SGBE 1O33A 2Y6TA 2ZI2H 1HAVB 2FEQH 3KCGH 3PMHB 4BNRA 5JB9S 4MLFB 3OY5U 1C2EA 1THSH 2CMYA 4Z0KA 1ESTA 1Y3VA 3QGJA 1EOLA 2ANMH 1T7CA 1TONA 4M7GA 3CS7A 2ZTZA 4NFFA 4SGBE 3BTDE 3RM0H 1GCTB 1SLXB 1SQTA 2XBVA 1O3CA 3HGPA 1ABJH 3PTNA 2FIRH 2TRMA 2ZDNA 3BTHE 4BXWA 1MCVA 4NIXA 3SUFA 1HAVA 2ODYB 1EZSC 1AE8H 2A0QB 1ZTLA 1LKBA 2ILNA 1C5PA 4JZ1A 5C2ZA 5J4QA 3F6UH 1TA2A 4JK6A 4O9VA 1L1JA 1AUJA 4ZKOU 1BBRH 4XDEA 3UR6A 2ZHQH 1C2KA 3K9XB 5CE1A 2AS9A 1RGQA 1N8OB 2C8YB 1K1IA 5JDUB 1ZTKA 1O2ZA 4NSYA 5DPAA 1O3PB 2XC0A 3MU1A 4DVAU 1GJ8B 2VWMA 3U8TH 3SNEA 2FTLE 2BTCE 4NSVA 3RDZA 3EGKH 1Z8JB 2BVSH 3PROA 1BBRE 1MTNC 1GJ5H 1GI7B 3U1IB 1ZMNA 2VIOA 1FQ3A 1GL0E 2Y5FA 3U1JB 2FPZA 1YPHE 1C1TA 1N6XA 5L2ZH 4DOQA 1ETSH 5FX5A 1RJXB 3PLBA 3ATLA 4WVPE 1BQYA 3SUDA 1O3OA 3RXPA 1CU1A 1GMCF 1C1OA 2VIPA 1BUIA 1TALA 2EEKA 2ZIQH 1MTVA 1GWAA 1H1BA 3RXOA 4ISLA 4BAQB 3LGIA 2ODPA 1C5TA 2BDGA 1OS8A 1YBWA 3SGQE 1O5BB 1QNJA 3JZ2B 4FUDA 2WPHS 2P3TB 4B71A 1T8OA 2G4TA 3MNCA 3UTUH 1Z7KA 4ZXYH 1UTLM 1FN8A 2XBXA 4DURA 5EGMA 4MPUA 4ZKRU 2VH6A 3ZZ9A 4A5TS 2FI5E 3IITA 1O2KA 3CENA 1AN1E 1O3LA 1TX7A 1H9IE 3DFLA 1QJ1B 2ZQ2A 1GHVH 4D9RA 1D6RA 4DY7B 4H6TA 1RIWB 4K1EA 1CSOE 2XW9A 1C5QA 1GHWH 1XUKA 2GT8A 5T6DA 1C2MA 3TGJE 1E38B 4D7FA 3KIDU 2ZCLP 2WUCA 1DOJA 1AVWA 2SGAA 1QQ4A 2BLVA 2H5DA 3ZZ4A 3URCA 2FZZA 1K2I1 3EA9A 4R8TB 5T6GA 5G4BA 3AW0A 1O2OA 2BZAA 3CS0A 2ZPRA 2FDAA 1C1WH 1DITH 3GCHB 4CBNA 3UNSA 1UTJA 1K1JA 5L30H 1EB1H 1PFXC 1SOTA 2HGTH 4O3UA 3RMNH 3UPEA 2VGCC 2UUJB 3Q3KA 2QN5T 3A7ZA 3LONA 1H8IH 1LHCH 3PMJA 2GMTC 3A7YA 1OXGA 1EP5A 2PLXA 3Q3YA 1MKWH 4H42U 1V2PT 1C2LA 2O8TA 1QFKH 3M3TA 1BTUA 2WPKS 1SOZA 2PKSB 1FLEE 4HI3A 3UUZA 2R3YA 3GY4A 2F9BH 1C2JA 3KNXA 2ALPA 5EXNA 1O38A 1NROH 4WXVA 2GV7A 1CHOG 5L2YH 3DD2H 1DDJA 3UY9A 1OKXA 1FIZA 2ASUB 3MMGA 1SGIB 1C2IA 1GHBG 5HMAA 1RTKA 3QTVH 2VJ1A 1P2KA 1SB1H 2NWNA 1IHSH 2BLQA 1KY9A 4FU7A 1MH0A 4WXIA 2ZGJA 1MMJN 3P6ZB 1EZXC 3QTOH 4H4FA 3TPIZ 3A8DA 3O8DA 4AFUA 2HPPH 4CR9A 4ABAA 1V3XA 2AMDA 1B5GH 4X8VH 3RC5A 2I6SA 1PPHE 1AFEH 3KGPA 4B2BA 1UK2A 4Y7AA 4XE4A 4AYVB 3PMBB 4UFDH 3BTME 4KP0A 5SGAE 3E8LA 3NKKA 2ZU3A 2GDDA 1VITF 4F4OC 1UCYK 1CT4E 1SHHB 3MU4A 2VNTA 3M5LA 5EQSA 2BD3A 1ZLRA 4OS2A 5FPYA 1G36A 2WV5A 3GCTF 1FONA 3BEFB 2AYWA 5EW2H 2B8OH 4OS6A 3LU9B 1GDUA 1QA0A 2Y5HA 1AD8H 1LTOA 3E0NB 1ELFA 4CRGA 1EAIA 1HJAC 3QWCH 1SFIA 3WY8A 5HM2A 5E2OA 2STAE 1C5VA 1ESAA 2RG3A 2W7SA 3O8CA 1SQOA 2A4OA 1QRWA 4QT8C 4X6OA 5E0HA 5CHAC 4JCNA 4Y11E 2V0BA 2QXIA 2QC2A 1V2KT 1AFQC 2VIQA 2HNTF 2PUQH 1NFYA 1FI8A 4RN6A 1UK4A 4ABIA 1A2CH 4BANB 2FI3E 1T8LA 5A0BA 1GBIA 1XM1A 3IG6B 1O37A 1J9CH 1O3DA 4NIVA 2C93B 3RC6A 2IOTA 2QAAA 2C8XB 5T6FA 1PQ8A 2BOHB 1PYTD 2FODA 3FFGA 5HXFA 1GBDA 1HXFH 1Z1IA 1J15A 1GJ6A 3RXVA 1VGCB 1TYNA 3RXHA 2JKHA 2ZHEH 6GCHF 4ISNA 5E2PA 1BHXF 1YCPH 1SC8U 1SSXA 3MO9A 3D23A 3UFAA 3SU4A 1AQ7A 2AMQA 1K1LA 1SGPE 2WPIS 3PLKA 4AOQA 1Y59T 2JH0D 2ZNKH 1C4U2 4B73A 2Q1JA 3ZVCA 1CA0C 1KYNA 2QV1A 1TX8A 1TNKA 1GJ4H 4YOIA 6LPRA 2J38A 3ZZ3A 9ESTA 1PJPA 1O2IA 3VFEA 1MBQA 3L33A 1GI5A 3KF2A 2BQ7B 4TY7A 1TGCA 1DWCH 7LPRA 2BD9A 2J2UA 2K1QA 2F9VA 3S9BA 2OC0A 1AB9C 1Y3UA 1Z71A 3A7TA 1T4UH 2BXTH 2TGPZ 3K6YA 2SGFE 3BTKE 1AIXH 4ZHMU 4FUIA 1GHAG 1KXEA 1DE7H 1MZDA 1A0JA 1MD7A 2R3UA 2VIVA 1Z1JA 2FOEA 3I78A 3SI4H 3ATIA 1KXFA 1C5XB 1TNIA 1OPHB 2FOBA 3SJ8A 4E7RG 1NO9H 1D3TB 4TWWA 1B0EA 1WAYB 5C20A 5B6OA 1SFQB 1GVKB 3ZVAA 1HAIH 1O5CB 2THFB 1O0DH 3UR9A 1GBLA 1TBZH 1G3CA 2G52A 2CGAA 2CF8H 1Q2WA 5TCAA 1DM4B 1UTNA 2VH0A 4YTAA 3T29A 1V2JT 3U8RH 2PW8H 3AASA 2FOMB 3VB6A 3HK6B 4X8SH 4DJZB 1INCA 2ALVA 1GJ9B 1MAXA 1O2UA 2QF0A 4NA8A 1JIMA 1XUIA 3LT3A 4CRBA 2CHAB 1NFXA 1QY6A 5FPSA 1FY3A 3SHAH 4FUCA 4YZUA 1EP6A 1IQKA 2XWAA 1DSUA 4AGJA 5FCKA 2VB0A 1C2GA 2TBSA 4JZIA 3D49H 1BMMH 2EI8A 2C3SA 1AHTH 2UUKB 4THNH 2HOBA 1TPSA 1GG6C 2Z9LA 1CBWC 3VXFH 1AY6H 1TMTH 1Y5BT 4Y0YE 1V2QT 2PHBA 1VCWA 2A7HA 4XBCA 1DY9A 1DWDH 1LQDB 1ANEA 2DE9A 4MNYA 3M5OA 2OP9A 5FBEA 1QL8A 2WYJA 3I77A 4XFQA 1O30A 1V2UT 2FYRA 1GMHG 3B23B 1Z8IB 1KXAA 2ZCHP 3ZZBA 3QDZB 4OGYA 2VWOA 4E7NA 5A8ZA 1C1SA 3K65B 2GZ9A 2GZ8A 2J9NA 1A5IA 3ZVDA 1NN6A 4U2WA 4X1PU 4BOHA 1O2NA 1D3DB 3NPSA 2WPLS 2V35A 2ZDLA 1FY5A 1YPMH 3TJUA 2SNWA 3RLWH 3TK6A 1O3HA 1O2HA 7KMEH 3ATWA 3SJKA 1ZPBA 3M5NA 3RXCA 2ZGHA 1BRUP 2FOAA 1VCQA 3EDXB 1FJSA 2A7CA 1HUTH 1UVUH 5I25A 1J14A 2VU8E 3ZZ7A 3FP7E 3RXKA 1SHYA 1O5FH 4B74A 1C9TA 4NIYA 1GGDC 1C1RA 1YLCA 4BXSA 4JMYA 3P95A 3TH2H 4NWKA 2BMGB 2P16A 2AH4X 4CH8B 1EB2A 2NU4E 3LJJA 5F8TA 1SLUB 6CHAB 3A89A 3A7WA 2ZU2A 3TITA 2BX4A 3PO1C 1QL9A 3SJ9A 1D4PB 2ZFQH 3E91A 1TWXB 2GCHF 1ORFA 1ANBA 4AG2A 3KQEA 1A5GH 2ZFTA 1EOJA 3MH4A 1NRSH 4KTUA 1AE5A 1ZYOA 2SGDE 3MU5A 2AGGX 2VWLA 3RU4E 3TK9A 2A32A 1ETRH 4MQAA 1NU9A 2KAIB 3GYMA 3GICB 1LVYA 3F9EA 7GCHF 5DP4A 3FANA 5ESBA 4J1YA 4IC5A 1GVZA 3BEUA 3TU7H 2SFAA 1EZQA 2GTBA 4GHQA 4A6LA 1A7SA 1YM0A 1IAUA 2GP9B 1OSSA 3T62A 4NA7A 1YC0A 2CN0H 1NU7B 3OYPA 2ZDMA 1MKXK 1A0HB 1BIOA 3RU4D 4X6PA 1EQ9A 1LVBA 2OINA 4I8LA 1HAZB 1ZTJA 4MVNA 1YF4A 1XKAC 2J92A 4NIWA 1HDTH 2KAIA 1SI5H 1GHZA 4AGKA 1BJVA 3NK8A 4NZQA 2JETB 5JBCS 1C5UA 2NU2E 1OP8A 3U98H 3FP8E 1XKBC 3QK1A 4DT7B 1BTWA 1F2SE 1MTNB 4KELA 1SLVB 1JXPA 1LHEH 3ZVGA 1UK3A 4K3JA 1EATA 1QHRB 4OS7A 4DIHH 1C1PA 4YLQH 1GBBA 3S9CA 1C5RA 4NZLA 2ZFFH 1MD8A 1NRRH 5DGJA 2ULLA 2ZO3H 5A2MH 1F5RA 5GWZA 1VITH 2XWBI 3V12A 5FBIA 5DP3A 1P02A 1SBWA 2XCNA 5JBTA 1L4ZA 4FU8A 2BYAX 1F0SA 1L1NA 4ZROA 3LIWA 4RSPA 1GDQA 1THRH 4YOGA 1TNLA 2OC7A 1HXEH 4DIIH 5JBAS 4LXBH 3ZVBA 2QXGA 4TYDA 1KTSB 2WUBA 3D62A 1RFNA 5LPEA 2BDBA 3FVFB 3LGUA 1DY8A 3S7KB 3SU1A 5IDKA 4JZDH 4ISOA 1XVMA 4ZHLU 2P3UB 4FXGH 2ZEBA 1IQEA 2BDAA 3KN2A 4A1VA 3BTGE 1GI0A 2W5EA 1P06A 3GYLB 1OYQA 1A3BH 2M5TA 3R3GB 4X6MA 3SV7A 3Q77A 1NPMA 2ZU5A 3B9FH 4X1NU 5DKMA 1NTPA 3MU0A 2XBYA 1BZXE 5DP6A 2EI6A 1P2NA 1TPOA 2WPJS 4INLA 2TGAA 2ZU1A 1DT2A 1KXDA 3TK5A 2CF9H 2DE8A 1Z8RA 2EI7A 2Z94A 3RMLH 2HNTE 3MO6A 4TPIZ 1KXCA 3RXDA 1FUJA 1ZGIA 4Q7YA 3ODFA 4NFEA 2AGIX 3PV4A 3FZDA 2BD8A 4B2AA 1HAYB 3LDXH 1GI4A 5EXLA 2H6MA 3QUMP 4ISIH 4X8UH 4X1QU 3RXSA 3VGCB 1O3FA 1P2IA 1H9LB 1YPLH 3QLPH 1FN6A 4X8TH 1WQSA 3NXPA 3P92A 4A7IB 1DX5M 1W13U 1A4WH 3SV9A 3RXFA 4RKJB 1LO6A 1SG8B 1O2PA 1S85A 3ZZCA 1XUGA 2GZ7A 1QBVH 2Y80A 3PLPA 2BDHA 1BA8B 1AUTC 4ABBA 4WF8A 3P70B 3I29A 1NRQH 2FX4A 1G3DA 2OLGA 5DP9A 5EQRA 4LZ1H 1BTXA 3E16B 2BM2A 3PYHA 5H4IB 1WBGB 4NCYA 4WMEA 2A5KA 2NU1E 1YPGH 4LK4A 2FYQA 1O2YA 5A0AE 1G37A 1JIRA 3DFJA 1T8MA 1L2EA 2H5CA 4DW2U 1OX1A 3GDVA 2BOKA 1D3PB 2BDIA 3BG4B 4HFPB 2A31A 3SV8A 2O8LA 3UWJH 5AF9H 3VXEH 3S69A 4GSOA 1QR3E 2FS8A 1O3EA 1ELAA 1YPEH 1EZUC 1ZSKA 3AAVA 1DVAH 4CRDA 2ZPQA 1GI6A 2I6QA 1P3EA 1ZHPA 1ZMJA 2F9NA 3MTYA 2ZCKP 3M3VA 3P8FA 2YOLA 3VB5A 1M9UA 1IQGA 1OP2A 3HGNA 4MTBA 5FX6A 1S82A 1GPZA 1MTUA 3DA9B 5FPTA 4X1RU 4AFZA 1E34B 2UUFB 1EAUA 2AMPA 1EJNA 1TFXA 4TWYA 4Q7XA 1Y3WA 2G55A 3GY6A 1O32A 1F7ZA 3E1XB 1AZ8A 3P8NA 3RXBA 5C5NA 4K8YA 4CHAC 1QURH 1A3EH 4XSKU 2HLCA 3BIVH 1BB0B 1HJAB 2UUYA 1PQ5A 1A61H 2H9EH 3ELAH 1ELDE 1HGTH 2CV3A 3SNBA 1BCUH 2HRVA 5ESTE 3SJIA 5F6MA 1SVPA 1DUAA 3N7OA 4BTTB 3GDSA 3PWBA 4K2YA 1SGTA 1HB0B 1MQ6A 1AFQB 1QJ6B 1AVXA 1Y8TA 1GBAA 1W12U 2ZFSA 1VCPA 3SOSA 2Z3DA 2B9LA 1GBHA 1GJDB 1CHOF 1BMAA 3TVJB 3DHKH 4O03A 4Y76A 1O2GH 5C3NA 1GHBF 2V3OH 1FAXA 3HKIB 1THPB 1KLJH 3GCHC 2DUCA 3LPRA 1SGYE 2Z6BD 3JZ1B 3QX5H 1TA6A 1GJ7B 1GJAB 2GDEH 4WH6A 1C5MD 3Q3XA 1NM6A 2Y7ZA 2Y82A 2AIPA 1F0UA 1N6YA 4WMDA 2ESTE 2TPIZ 1FPCH 3QO6A 4FUBA 3W95A 1O2MA 1S6FA 1ZRBA 1PQ7A 1V2TT 2P3FH 5HGGA 4ZUHA 2PGQB 2ANKH 1KDQA 3PMAB 3U69H 4XOJA 1A46H 3RXUA 2AGEX 5E0GA 1OOKB 3M5MA 1PQAA 2O8MA 3A88A 4HTCH 1OP0A 2QF3A 1P2QA 2UWLA 3VB7A 3M37A 5BPEA 1WV7H 4NGAH 3UOPA 1Q3XA 1YPJH 1SL3A 2TGDA 1Z8GA 1AB9B 3UOUA 1O35A 4ABFA 1GBCA 1GDNA 5C5OA 1GI8B 1HPGA 2Z3CA 4YT7H 1C4V2 2FWWA 1IOEA 3SU6A 1C2FA 1L1GA 5JB8S 4YOJA 4UDWH 2IJOB 4MPWA 1EAXA 2D1JA 3MHWU 1OWJA 4MNVA 1DWEH 2HVXA 1GMDG 2BY7X 1YYY1 3E0PB 2VINA 2P95A 5E0JA 5AHGH 1XXFA 3OU0A 3C1KA 3RM2H 3UIRA 1TMBH 2A7JA 4X2WA 3RXMA 1LPKB 3SBKA 3OTJE 1CE5A 1DLEA 1O2SA 1C5ZB 4YT6H 2ZP0H 3TNTA 1P9UA 1SGFG 5GJ4B 3MO3A 1C5NH 2BLOA 8GCHG 2SGQE 4X2VA 3ATKA 3H5CB 1IQMA 2FOFA 1CQQA 5C1XA 3M3SA 1UTMA 4YM9A 1BTHH 5E8EH 1BJUA 1XX9A 2Y81A 1SR5C 1OWDA 1JRSA 2AERH 2A5IA 1J16A 1W8BH 2OC8A 2BZ6H 3TJNA 5A8YA 1C5SA 1TQ7B 4KGAA 1CVWH 1MUEB 1BHXB 1TQ0B 4Y71A 3SW2B 2BDCA 1TGSZ 1P8VC 1FY4A 2GCTC 5ABWA 1WSSH 1P9SA 1WYKA 2P94A 4AB8A 1SGQE 4D76A 1DFPA 4F49A 3G01A 1FAKH 3LC3A 1LQEA 1CBWB 1W0ZU 4JYVH 4MNWA 1ID5H 1H4WA 4Y8YA 2C8WB 3T5FH 3DT0H 1OWEA 2GGVB 4TY6A 1AI8H 2ZTYA 4BTIB 1CHGA 3RMOH 1C2DA 2F9UA 1BTYA 3ZZ6A 1WUNH 1BOQA 1YPHC 1GHAF 1WCZA 4GPGA 3ZV8A 1VGCC 1W10U 2OXSA 3MU8A 1A1RA 3UNQA 5FHTA 1P2JA 1TABE 4ZKNU 3MWIU 1BITA 6ESTA 2F91A 3ATMA 1QJ7B 5EPYA 3D65E 5FAHA 3NCLA 3DUXH 1GJCB 2IN2A 5TJXA 4ABGA 4Y8XA 4K60A 1W14U 1YGCH 1OWHA 3KEEA 3MH5A 3STJA 1O3AA 1D3QB 4R0IA 2R2MB 3ITIA 1YCPM 4Q2KA 1LDTT 1EASA 1RTLA 2A5AA 1TGNA 4ABHA 1NS3A 3ESTA 2H9HA 2G5NA 1V2MT 4ZXXH 2FESH 1GGDB 2Z9GA 3ZVFA 5A09A 1MU6B 1QRZA 2HPQH 1S6HA 3VEQB 4OS4A 4CRAA 3M35A 4X0WU 3SU5A 2AEIH 3LH3A 1IHTH 3O8RA 1QBOA 2J4IA 4INKA 4BAMB 1ARBA 2FLRH 2H2ZA 2TIOA 2PSXA 1O3GA 3C27B 3RXQA 1QCPA 4CBOA 3PO1B 3PB1E 2Y5GA 4MG3A 1UHBB 3ZYDA 3Q00A 4IS5A 5JYIA 3TJOA 4AZ2B 2B5TB 1AO5A 2C8ZB 4ZH8A 1GBKA 1HCGA 2SNVA 3A87A 3P17H 4H6SB 4O3TA 5EG4A 1F92A 3F68H 4IMZA 3LGVA 3M7UA 4UFFH 3SUGA 1UVPA 2V3HH 1UVSH 3UNRA 2G51A 1T8NA 2XBWA 2ZU4A 5EU8A 1G32B 1UHBA 3FZZA 3LJOA 2OBQA 1GI2A 1KXBA 3H7TA 1PPBH 2ZDKA 2BY9X 4HGCA 1TX6A 1GMHF 1SQAA 2H1UA 1AWFH 2BY5X 2Q6FA 4FUJA 1XXDA 3A81A 1AMHA 3F9GA 2NU0E 1LKAA 1E35B 1KSNA 3A7XA 5AVDA 1HJ9A 1LPZB 3HATH 3LH1A 1FY8E 1TMUH 2UWPA 3W94A 1MTSA 5EQQA 3MH7A 1AGJA 1Y3YA 4MNXA 1P10A 1ARCA 3KL6A 2ZWLH 1F0TA 1RS0A 4JZEH 2FM2A 2ZKSA 4FUFA 3MOCA 2ANWA 1QBNA 2P8OC 2SGEE 5F03A 1K1MA 2R2WU 3GY2A 1RD3B 1TBRH 1C4Y2 4GCHG 3T2NA 1F0RA 1DLKB 3GISB 4CR5A 1ANCA 4BAKB 3L3TA 1TNHA 1C1MA 1UTOA 5JBBS 2PSYA 1XMNB 2FOHA 5L6NH 3QZQA 4DG4A 2Q6GA 1MZAA 1IQHA 3BEIB 3QGNB 1HBTH 2FO9A 3M36A 3F1SB 1OWKA 4VGCC 5GCHG 3S0NA 3EYDA 1XVOA 5DG6A 1P03A 2BVRH 1AKSA 2GX4A 2YNAA 1O36A 4U32A 2FOGA 2F83A 3HPTB 3UQOA 1ZSJA 1EPTC 2FLBH 3A85A 1FDPA 1LPGB 1O3IA 3NUMA 2PUXB 2WYGA 3BTEE 3RC4A 2RCEA 2PKAA 2BVXH 4JYTA 3SJOA 2QA9E 1FXYA 2LNCA 2XTTB 1IQJA 3A80A 1SGEE 2F9PA 2R0KA 4K8BA 3E3TA 1ACBE 2OBOA 2Y7XA 4K5ZA 2FX6A 3H7OA 3OX7U 3LGYA 3RUOA 1O2JA 1U6QA 2A2XH 1EJMA 2R0LA 1TNGA 1QQUA 3VB4A 3RXEA 1SMFE 2O8UA 1C1UH 1HJ8A 1SLWB 1C1NA 1CGIE 2GVFA 3F9FA 1FPHH 4ZMAH 1S81A 1BT7A 1ZJDA 5HM9A 1PYTC 2OCVB 6CHAC 3F9HA 4IMQA 1FV9A 1ZJKA 3AW1A 1EXFA 3P8OA 1H8DH 1EKBB 1KTTB 2FP7B 1V2WT 4SGAE 1UVTH 2VWNA 1VJ9U 3LC5A 3O8BA 3KHVA 5AFYH 2RA0A 3NWUA 3K2UA 3PM3A 3SHCH 1TBQH 3EQ0H 4FUEA 1W11U 2J34A 3BTWE 1O5AB 1K1NA 5EODA 3B8JA 1BMLA 1T31A 1TRYA 4CRFA 1BRAA 4BTUB 2QXJA 2D8WA 2ZPSA 3GCOA 3QN7A 1F5LA 1BBRK 2BQWB 1O31A 3SZNA 3HK3B 4WJG2 1DXWA 3SN8A 1IQIA 1WTGH 3BG8A 1S0RA 2VVVA 1GBFA 3RLYH 1GMCG 1CT2E 5GPIB 1BRCE 3SU2A 1P2MA 1MQ5A 3OY6U 2BD2A 2W7UA 1G2LA 4D9QA 1EX3A 2SGPE 1GJBB 1O3NA 5EPNA 3TGKE 2JETC 4Y8ZA 3STIA 4JK5A 1G30B 1V2RT 2ZFPH 2F3CE 1ZHMA 1CGHA 1BTZA 3V0XA 3M61U 3NZIA 3V7TA 5A0CA 1LCYA 2XC5A 1QL7A 1E0FD 4AG1A 4A1XA 1ZSLA 3KQCA 2VGCB 1RTFB 1VJAU 4GAWA 1YP9A 4Y0ZE 1K21H 2H9TH 1S0QA 1BMNH 2GMTB 1P09A 1GCTC 1GL1A 1O3JA 2ZGBH 1E36B 1WTHD 4RKOB 1O2RA 1IQLA 1XUJA 4ZKSU 3AAUA 2ZHWH 3T26A 1TAWA 2STBE 3ZZAA 5GDSH 1FZZA 1Z6JH 2FI4E 4GVUA 4KKDA 1O5GH 1JMOH 2FMJA 2RA3A 3LGTA 3TJVA 2Z3EA 1QIXB 2G4UA 3SNCA 4CHAB 1N8OC 1HYLA 2PV9B 3OSYA 1QB6A 2A4RA 2A4GA 5JPMH 1T32A 1Y3XA 3GOVB 4CRCA 3E6PH 1DICA 4UD9H 2QCYA 3RXRA 1GI3A 3L6PA 3EAJA 2XC4A 2YNBA 3UREA 1O2VA 2QXHA 4FU9A 1TIOA 1RXPA 3SNAA 4ZHAA 2QYIA 4I32A 5IYTA 1HAHH 4UFEH 2ZTXA 2JH6D 1BTPA 4JYUH 3SO3A 5DP7A 1S5SA 1UO6A 4FVDA 3BN9A 3ODDA 3UWIA 3RXGA 4I8GA 4GUXA
chains in the Genus database with same CATH superfamily
1C5OH 2GJGA 1VZQH 2C4FH 4F48B 3KQBA 3VGCC 1GHXH 4YO9A 2UWOA 4IBLH 1YLNA 4Z6AH 1ZZZA 1PPFE 1MKWK 2IPHA 2K0QA 2WV4A 1ZPCA 3MNBA 5K0HA 4WH8A 1P04A 5EJ1A 2ZGCA 1ELTA 3A84A 5LPRA 1B7XB 2FTMA 2Z9JA 1O2LA 4B75A 1QGFA 1O5EH 3MFJA 4WMFA 1K28D 1UTKA 5B6LA 1RIWC 3M7TA 1T4VH 5FXLA 2XXLA 5CHAB 4K69A 3GY5A 4X6NA 3SQHE 2GV6A 2ZECA 5C1UA 1ESBA 1J17T 4A92A 1DUEA 1QZ8A 2ZDAH 1VITG 3FP6E 2BXUH 1TRMA 4I33A 1JOUB 4J2YB 1TGTA 1AU8A 2GKVE 1NC6A 1LVOA 3V13A 1NFWA 1ZMLA 8ESTE 1S83A 5DK1A 3TNSA 1MAYA 4IW4E 4NWLA 4D7GA 2IPQX 1ELVA 1MCTA 4AB9A 2G00A 1SGNE 1Z6EA 1KDQB 3GCTG 2XNDD 3BG4C 2W3KA 1SKYE 5I46H 1V6DA 1PPCE 3BF6H 2KX4A 1KLTA 5F8XA 1GI1A 4CH2B 5HKKD 3PRDA 1K9OE 1UCYH 2A45B 1O3BA 1A0LA 1C5WB 2BD4A 1WXRA 1TLDA 3GDUA 4A1TA 1TB6H 1LVMA 1GBJA 2J95A 1TOCB 1LHDH 5PTPA 2KCPA 3A8BA 2IJD1 2WPDD 1UCYE 1TOMH 2PKSC 2PR3A 3SV6A 4UONA 3SQEE 3ZVEA 5DO4H 1CA0B 3A8AA 1ELCA 1HAGE 2WINI 1HIAB 3SNDA 4B2CA 4ZAEA 3ZYEA 3TGIE 3SORA 1O2QA 3ZZDA 1O5DH 1K1OA 3P8GA 1QRXA 4MPVA 1CGJE 1O39A 2OD3B 1V2OT 2BD7A 2ZHDA 5T3HA 2ZGXH 1NFUA 2J94A 2EY4C 1G3BA 1GI9B 2ZF0H 2A2QH 4NG9H 3ZZ5A 1J8AA 4OGXA 1DPOA 3N99A 1ELGA 2J5UA 3CP7A 3FOAA 3U9AH 1QTFA 2AFQB 2GCTB 1ETTH 3GCNA 1SGRE 2NU3E 3LGWA 3PTBA 1XUFA 1HIAA 5EOKA 3BTTE 3BTFE 6GCHG 1P01A 4RT1A 3ZZ8A 5DSFA 1SGDE 1X7AC 2BX3A 2VVCA 1DXPA 4ABEA 3VPKA 2BDYA 4U01A 2XYAA 1C1QA 3DSOA 4DGJA 2OQ5A 2XRCA 1P11E 3S9AA 1B0FA 3GY3A 3U8OH 1Y5UT 3TH3H 2EC9H 1UJ1A 2W3IA 1YPKH 5EW1H 2Z9IA 4E06H 2VVUA 4X2YA 2PWXA 3RXIA 4MPXA 3EA8A 1DS2E 1YCPK 4K1SA 4IN2A 4F55A 1K22H 4FUGA 4GHTA 3T25A 3TLOA 3R0FA 2ZDVH 2HWLB 2WPMS 3RXJA 1AVGH 1NZQH 3LKWA 1RRKA 1GMDF 1OWIA 1WU1A 3K6ZA 4NA9H 2OTVA 2R9PA 4Y10E 4AN7A 5F8ZA 2YMSB 1C5YB 1O3MA 4U30A 4UE7H 1ZGVA 3T27A 5TCCA 4ABJA 1P2OA 3AVZA 1LMWB 5BRRE 1EJAA 4FVBA 1FNIA 2ZG0H 4B76A 3ZV9A 3TH4H 1HRTH 2PGBB 1DSTA 2TGTA 4AFQA 3FN8A 8GCHF 5J4SA 2XOKD 3RXAA 3SU0A 1UMAH 1GBMA 2OUAA 3OEED 1GG6B 4KTSA 8KME2 1S84A 1LHFH 2B0FA 1ELBA 3PWCA 5HYOA 1ANDA 2RDLA 3QZRA 2BLWA 1PPZA 3T28A 1JRTA 1W0YH 4GLYA 4I31A 4Q7ZA 1QB9A 4HZHA 1HFDA 4X2XA 1OYTH 4BAOB 1C5LH 5C1YA 4Y6DA 4BAHB 5C67A 4ESTE 2L6OA 3TIUA 5LPFA 1YY3A 7ESTE 1HLTH 1O2WA 1UTQA 1W7XH 1TRNA 1YKTA 4TPYA 4YLUA 2CXVA 2GT7A 1UVOA 2OQUA 2XCFA 1ZRKA 3SUEA 2A1DB 1NESE 1EUFA 1GBTA 1K1PA 3SI3H 1TPPA 2HNTC 3RMMH 4LZ4B 4AYYB 5CHBA 4MDSA 4ABDA 2ZC9H 3WWBA 4UEHH 3BV9B 3A8CA 1ZPZA 3VB3A 1D6WA 3ENSB 3RXLA 1DWBH 4X1SU 3A86A 1GBEA 1QA7A 2AIQA 5EXMA 9LPRA 4KTCA 5LH8A 1BDAA 1V2NT 1F5KU 1C9PA 2ANYA 1L4DA 1SGFA 1WOFA 2O8WA 1ZHRA 2ZQ1A 1IQFA 1A5HA 2LPRA 5DP8A 1QB1A 2FOCA 2Z7FE 3RU4T 1WQVH 3MYWA 1P3CA 3A82A 4AFSA 4ISHH 4Y7BA 3FAOA 5K7RA 2XNIA 5DP5A 1C1VH 3A83A 2P8OB 1O2XA 1O34A 4Z1MD 4ASHA 4JZFH 1FMGA 1MBMA 1Q31A 3F2GA 5A8XA 1GCDA 1G2MA 1FIWA 1HNEE 1W2KH 3MI4A 2W26A 2JH5D 5T1VA 1PPGE 2BD5A 2GD4B 2G5VA 2VIWA 3BTQE 4ACBA 4FUHA 1P12E 2G8TA 1W7GH 1TPAE 2V6NA 2FXRA 1IQNA 1P0SH 5GIBA 4IC6A 1HV7A 1YLDA 4IGDA 2O9QA 1H9HE 4VGCB 1KIGH 2F9OA 4I8HA 1GHYH 5FCRA 1CO7E 3MH6A 3RP2A 1L0ZA 4UFGH 4DCDA 1V2LT 2JJ2D 4E05H 1PPEE 3V3MA 2F43B 1O2TA 2PTCE 1NRPH 2FS9A 3BIUH 4WY3A 2OC1A 2LELA 5DJ7A 1LHGH 1EPTB 1MTWA 1P05A 4D8NA 5GXPA 5CMXH 2CHAC 2PTNA 1UTPA 3Q76A 2ODQA 2ZZUH 3MNSA 1KLIH 2GCHG 1P57B 1TE0A 4OS1A 5LGOA 3KQDA 1CT0E 2BY6X 4Y79A 3HKJB 4K1TA 2D26C 2BHGA 3SGAE 2C90B 4IN1A 2BQ6B 1N1LA 3SV2H 1JBUH 1C2HA 4XBDA 7GCHG 2K8IA 1AKSB 4PROA 1O3KA 1BRBE 1EPTA 1DANH 1G9IE 1ZR0A 4LOYH 3AK5A 4I7YH 1VR1H 1HAOH 1AZZA 3M7QA 1NT1A 3UQVA 2G81E 3A7VA 2BY8X 1V2VT 3GY7A 1ELEE 4INHA 2PKAB 3IWMA 3EA7A 3E90B 2ZFRH 5KEDA 1SPJA 2D2DA 4AX9H 2A4QA 5ETXA 1NRNH 2QIQA 1SGCA 3CNRA 1JWTA 2Q6DA 2ZA5A 5AFZH 1HAPH 4B1TA 1V2ST 1TGBA 4XBBA 4YESB 1NY22 1W0JD 4GCHF 3GY8A 2VIDA 8LPRA 2Z9KA 3BSQA 3S7HB 2B7DH 1EAWA 1AWHB 1MKXH 2PFEA 4Q80A 2ZHFH 1G3EA 3EE0B 4I8KA 3LOXA 4AORA 1ABIH 2QGRA 4O97A 3RXTA 1E37B 4OS5A 3MNXA 1HAXB 1XUHA 4WWYA 4CREA 1CA8B 3SU3A 1FY1A 2CJIA 2EA3A 1TNJA 2BB4A 2P59A 5GCHF 3URDA 1Y5AT 1ZOMA 2QY0B 1GVLA 1D9IA 4I8JA 2HALA 2P93A 1W3CA 2J98B 1MU8B 3SGBE 1O33A 2Y6TA 2ZI2H 1HAVB 2FEQH 3KCGH 3PMHB 4BNRA 5JB9S 4MLFB 3OY5U 1C2EA 1THSH 2CMYA 4Z0KA 1ESTA 1Y3VA 3QGJA 1EOLA 2ANMH 1T7CA 1TONA 4M7GA 3CS7A 2ZTZA 4NFFA 4SGBE 3BTDE 3RM0H 3SYJA 1GCTB 1SLXB 1SQTA 2XBVA 1O3CA 3HGPA 1ABJH 3PTNA 2FIRH 2TRMA 2ZDNA 3BTHE 4BXWA 1MCVA 4NIXA 3SUFA 1HAVA 2ODYB 1EZSC 1AE8H 2A0QB 1ZTLA 1LKBA 2ILNA 1C5PA 4JZ1A 5C2ZA 5J4QA 3F6UH 1TA2A 4JK6A 4O9VA 1L1JA 1AUJA 4ZKOU 1BBRH 4XDEA 3UR6A 3W1EA 2ZHQH 1C2KA 3K9XB 5CE1A 2AS9A 1RGQA 1N8OB 2C8YB 1K1IA 5JDUB 1ZTKA 1O2ZA 4NSYA 5DPAA 1O3PB 2XC0A 3MU1A 4DVAU 1GJ8B 2VWMA 3U8TH 2WV9A 3SNEA 2FTLE 2BTCE 4NSVA 3RDZA 3EGKH 1Z8JB 2BVSH 3PROA 1BBRE 1MTNC 1GJ5H 1GI7B 3U1IB 1ZMNA 2VIOA 1FQ3A 1GL0E 2Y5FA 3U1JB 2FPZA 1YPHE 1C1TA 1N6XA 5L2ZH 4DOQA 1ETSH 5FX5A 2W6JD 1RJXB 3PLBA 3ATLA 4WVPE 1BQYA 3SUDA 1O3OA 3RXPA 1CU1A 1GMCF 1C1OA 2VIPA 1BUIA 1TALA 2EEKA 2ZIQH 1MTVA 1GWAA 1H1BA 3RXOA 4ISLA 4BAQB 3LGIA 2ODPA 1C5TA 2BDGA 1OS8A 1YBWA 3SGQE 1O5BB 1QNJA 3JZ2B 4FUDA 2WPHS 2P3TB 4B71A 1T8OA 2G4TA 3MNCA 3UTUH 1Z7KA 4ZXYH 4FOUC 1UTLM 1FN8A 2XBXA 4DURA 5EGMA 4MPUA 4ZKRU 2WSSD 2VH6A 3ZZ9A 4A5TS 2FI5E 3IITA 1O2KA 3CENA 1AN1E 1O3LA 1TX7A 1H9IE 3DFLA 1QJ1B 2ZQ2A 1GHVH 2YMSD 4D9RA 1D6RA 2CK3D 4DY7B 4H6TA 1RIWB 4K1EA 1CSOE 2XW9A 1C5QA 1GHWH 1XUKA 2GT8A 5T6DA 1C2MA 3TGJE 1E38B 4D7FA 3KIDU 2ZCLP 2WUCA 5DN6D 1DOJA 1AVWA 2SGAA 1QQ4A 2BLVA 2H5DA 3ZZ4A 3URCA 2FZZA 1K2I1 3EA9A 4R8TB 5T6GA 5G4BA 3AW0A 1O2OA 2BZAA 3CS0A 2ZPRA 2FDAA 1C1WH 2KCYA 1DITH 3GCHB 4CBNA 3UNSA 1UTJA 1K1JA 5L30H 1EB1H 1PFXC 1SOTA 2HGTH 4O3UA 3RMNH 3UPEA 2VGCC 2UUJB 3Q3KA 2QN5T 3A7ZA 3LONA 1H8IH 1LHCH 3PMJA 2GMTC 3A7YA 1OXGA 1EP5A 2PLXA 2W6ID 3KYFA 3Q3YA 1MKWH 4H42U 1V2PT 1C2LA 2O8TA 1QFKH 3M3TA 1BTUA 2KCOA 2WPKS 1SOZA 2PKSB 1FLEE 4HI3A 3UUZA 2R3YA 3GY4A 2F9BH 1H8ED 1C2JA 3KNXA 2ALPA 5EXNA 1O38A 1NROH 4WXVA 2GV7A 1CHOG 5L2YH 5HIZA 3DD2H 1DDJA 3UY9A 1OKXA 1FIZA 2ASUB 3MMGA 1SGIB 1C2IA 1GHBG 1UW7A 5HMAA 1RTKA 3QTVH 2VJ1A 1P2KA 1SB1H 2NWNA 1IHSH 2BLQA 1KY9A 4FU7A 1MH0A 4WXIA 2ZGJA 1K0HA 1MMJN 3P6ZB 1EZXC 3QTOH 4H4FA 3TPIZ 3A8DA 3O8DA 4AFUA 2HPPH 4CR9A 4ABAA 1V3XA 2AMDA 1B5GH 4X8VH 3RC5A 2I6SA 1PPHE 1AFEH 3KGPA 4B2BA 1UK2A 4Y7AA 4XE4A 4AYVB 3PMBB 4UFDH 3BTME 4KP0A 5SGAE 3E8LA 3NKKA 4FETA 2ZU3A 2GDDA 1VITF 4F4OC 3F0OA 1UCYK 1CT4E 1SHHB 3KQ5A 3MU4A 2VNTA 3M5LA 5EQSA 2BD3A 1ZLRA 4OS2A 5FPYA 1G36A 2HLDD 2WV5A 3GCTF 1FONA 3BEFB 2AYWA 5EW2H 2B8OH 4OS6A 3LU9B 1GDUA 1QA0A 3FKSD 5EJZA 2Y5HA 1AD8H 1LTOA 3E0NB 4Q63A 4OM9A 1ELFA 4CRGA 1EAIA 1HJAC 3QWCH 1SFIA 3WY8A 5HM2A 5E2OA 2STAE 1C5VA 1YWUA 3VG8A 1ESAA 2RG3A 2W7SA 3O8CA 1SQOA 2A4OA 1QRWA 4QT8C 4X6OA 5E0HA 2QE7D 5CHAC 4JCNA 4Y11E 2V0BA 2QXIA 2QC2A 1V2KT 1AFQC 2VIQA 2HNTF 2PUQH 1NFYA 1FI8A 4RN6A 1UK4A 4ABIA 1A2CH 4BANB 2FI3E 1T8LA 5A0BA 1GBIA 1XM1A 3IG6B 1O37A 1J9CH 1O3DA 4NIVA 2C93B 3RC6A 2IOTA 2QAAA 2C8XB 5T6FA 1PQ8A 2BOHB 1PYTD 2FODA 3FFGA 5HXFA 1GBDA 1HXFH 1Z1IA 1J15A 1GJ6A 3RXVA 1VGCB 1TYNA 4YXWD 3RXHA 2JKHA 2ZHEH 6GCHF 4ISNA 5E2PA 1BHXF 1YCPH 1SC8U 1SSXA 3MO9A 3D23A 3UFAA 3SU4A 1AQ7A 2AMQA 1K1LA 1SGPE 2WPIS 3PLKA 4AOQA 1Y59T 2JH0D 2ZNKH 1C4U2 4B73A 4XD7D 2Q1JA 3ZVCA 1CA0C 1KYNA 2QV1A 1TX8A 1TNKA 1GJ4H 2OK5A 4YOIA 6LPRA 2J38A 3ZZ3A 9ESTA 1PJPA 1O2IA 3VFEA 1MBQA 3L33A 1GI5A 3KF2A 2BQ7B 4TY7A 1TGCA 1DWCH 7LPRA 2BD9A 2J2UA 2K1QA 2F9VA 3S9BA 2OC0A 1AB9C 1Y3UA 1Z71A 3A7TA 1T4UH 2BXTH 2TGPZ 3ZIAD 3K6YA 2SGFE 3BTKE 1AIXH 2WHXA 4ZHMU 4FUIA 4P00A 1GHAG 1KXEA 1DE7H 1MZDA 1A0JA 1MD7A 2R3UA 2VIVA 4RT0A 1Z1JA 2FOEA 4TSFD 2AHME 3I78A 3SI4H 2RDEA 3ATIA 1KXFA 1C5XB 1TNIA 1OPHB 2FOBA 3SJ8A 4E7RG 1NO9H 1D3TB 3U28C 4TWWA 1WDIA 1B0EA 1WAYB 5C20A 5B6OA 1SFQB 1GVKB 3ZVAA 1HAIH 1O5CB 2THFB 1O0DH 3UR9A 1GBLA 1TBZH 1G3CA 2G52A 2CGAA 2CF8H 1Q2WA 5TCAA 1DM4B 1UTNA 3OAAD 2VH0A 4YTAA 3T29A 1V2JT 3U8RH 2PW8H 3AASA 2FOMB 3VB6A 3HK6B 4X8SH 5KGOA 4DJZB 1INCA 3OE7D 2ALVA 1GJ9B 1MAXA 1O2UA 2QF0A 4NA8A 1JIMA 1XUIA 2QF5A 2YMSC 3LT3A 4CRBA 3PRBA 2CHAB 1NFXA 1QY6A 5FPSA 1FY3A 3SHAH 4FUCA 4YZUA 1EP6A 3GS9A 1IQKA 5IK2D 2XWAA 1DSUA 4AGJA 5FCKA 2VB0A 1C2GA 2TBSA 4JZIA 3D49H 1BMMH 2EI8A 2C3SA 1AHTH 2UUKB 4THNH 2HOBA 1TPSA 1GG6C 2Z9LA 1CBWC 3VXFH 1AY6H 1TMTH 1Y5BT 4Y0YE 1V2QT 2PHBA 1E79D 1VCWA 2A7HA 2RFKC 4XBCA 1DY9A 1DWDH 1LQDB 1ANEA 2DE9A 4MNYA 3M5OA 2OP9A 5FBEA 1QL8A 2WYJA 3I77A 4XFQA 1O30A 1V2UT 2FYRA 2KZ4A 1GMHG 3B23B 1Z8IB 1KXAA 2ZCHP 3ZZBA 3QDZB 4OGYA 2VWOA 4E7NA 5A8ZA 1C1SA 3K65B 2GZ9A 2GZ8A 2J9NA 3F0PA 1A5IA 3ZVDA 1NN6A 4U2WA 4X1PU 2J97A 1O2NA 4XRNA 1D3DB 3NPSA 4BOHA 2WPLS 2V35A 2ZDLA 1FY5A 1YPMH 3TJUA 2SNWA 3RLWH 3TK6A 1O3HA 1FX0B 1O2HA 4I86A 7KMEH 3ATWA 3SJKA 1ZPBA 3M5NA 3RXCA 3F2HA 2ZGHA 1BRUP 2FOAA 1VCQA 3EDXB 1FJSA 2A7CA 1HUTH 1UVUH 5I25A 1J14A 2VU8E 3ZZ7A 3FP7E 3RXKA 1SHYA 1O5FH 4B74A 1C9TA 4NIYA 1GGDC 1C1RA 1YLCA 4BXSA 4JMYA 3P95A 3TH2H 4NWKA 2BMGB 2P16A 2AH4X 4CH8B 1EB2A 2NU4E 3LJJA 3OFND 1SLUB 5F8TA 3A89A 3DCLA 3A7WA 2ZU2A 3TITA 6CHAB 2BX4A 3PO1C 1QL9A 3SJ9A 1D4PB 2ZFQH 3E91A 1TWXB 2GCHF 1ORFA 1ANBA 4AG2A 3KQEA 1A5GH 2ZFTA 1EOJA 3MH4A 1NRSH 4KTUA 1AE5A 1ZYOA 2SGDE 3MU5A 2AGGX 2VWLA 3RU4E 3TK9A 2A32A 1ETRH 4MQAA 1NU9A 2KAIB 3GYMA 3GICB 1LVYA 3OEHD 3F9EA 7GCHF 5DP4A 5C94A 3FANA 5ESBA 4J1YA 4IC5A 1EFRD 1GVZA 3BEUA 3TU7H 2SFAA 1EZQA 2GTBA 4GHQA 4A6LA 1A7SA 1YM0A 3N7DA 1IAUA 4RI0A 4B6FA 2GP9B 1OSSA 3T62A 4NA7A 1YC0A 2CN0H 1NU7B 3OYPA 2ZDMA 1MKXK 1A0HB 1BIOA 3RU4D 4X6PA 1EQ9A 1LVBA 2OINA 2M2AA 4I8LA 1HAZB 1ZTJA 4MVNA 1YF4A 1XKAC 2J92A 4NIWA 1HDTH 2KAIA 1SI5H 1GHZA 4AGKA 1BJVA 3NK8A 4NZQA 2JETB 5JBCS 1C5UA 2NU2E 1OP8A 3U98H 3FP8E 1XKBC 3QK1A 4DT7B 1BTWA 1F2SE 1MTNB 4KELA 1SLVB 1JXPA 1LHEH 3ZVGA 1UK3A 4K3JA 1EATA 1QHRB 4OS7A 4DIHH 1C1PA 4YLQH 1GBBA 3S9CA 1C5RA 4NZLA 2ZFFH 1MD8A 1NRRH 5DGJA 2ULLA 2ZO3H 5A2MH 1F5RA 5GWZA 1VITH 2XWBI 3V12A 5FBIA 5DP3A 1P02A 1SBWA 2XCNA 5JBTA 1L4ZA 4FU8A 2BYAX 1F0SA 3KYGA 1L1NA 4ZROA 3LIWA 4RSPA 1GDQA 1THRH 4YOGA 1TNLA 2OC7A 1HXEH 4DIIH 5JBAS 4LXBH 3ZVBA 2QXGA 3H09A 4TYDA 1KTSB 2WUBA 3D62A 1RFNA 5LPEA 2BDBA 3FVFB 3LGUA 1DY8A 3S7KB 3SU1A 5IDKA 4JZDH 4ISOA 2JIZD 1XVMA 4ZHLU 2P3UB 4FXGH 2ZEBA 1IQEA 2BDAA 3KN2A 4A1VA 3BTGE 1GI0A 2W5EA 1P06A 3GYLB 1OYQA 2L74A 1A3BH 2M5TA 3R3GB 4X6MA 3SV7A 3Q77A 2HVYB 1NPMA 2ZU5A 3B9FH 4X1NU 5DKMA 1NTPA 3MU0A 2XBYA 1BZXE 5DP6A 2EI6A 1P2NA 1TPOA 2WPJS 4INLA 2TGAA 2ZU1A 1DT2A 1KXDA 3TK5A 2CF9H 2DE8A 1Z8RA 2EI7A 2Z94A 3RMLH 2HNTE 3MO6A 4TPIZ 1KXCA 3RXDA 1FUJA 1ZGIA 4Q7YA 3ODFA 4NFEA 2AGIX 3PV4A 3FZDA 2BD8A 4B2AA 1HAYB 3LDXH 1GI4A 5EXLA 2H6MA 3QUMP 4M9FA 4ISIH 4X8UH 4X1QU 3RXSA 3VGCB 1O3FA 1P2IA 1H9LB 1YPLH 3QLPH 1FN6A 4X8TH 1WQSA 3NXPA 3P92A 4A7IB 1DX5M 1W13U 1A4WH 3SV9A 3RXFA 4RKJB 1LO6A 1SG8B 1O2PA 1S85A 3ZZCA 1XUGA 2GZ7A 1QBVH 2Y80A 3PLPA 2BDHA 3OTPA 1BA8B 1AUTC 4ABBA 4WF8A 3P70B 3I29A 1NRQH 2FX4A 1G3DA 2OLGA 5DP9A 5EQRA 4LZ1H 1BTXA 3E16B 2BM2A 3PYHA 5H4IB 1WBGB 4NCYA 4WMEA 2A5KA 2NU1E 1YPGH 4LK4A 2FYQA 1O2YA 5A0AE 1G37A 1JIRA 3DFJA 3NRLA 1T8MA 1L2EA 2H5CA 4DW2U 1OX1A 3GDVA 2BOKA 1D3PB 2BDIA 3BG4B 4HFPB 2A31A 3SV8A 2O8LA 3UWJH 5AF9H 3VXEH 3S69A 4GSOA 1QR3E 2FS8A 1O3EA 1ELAA 1YPEH 1EZUC 1ZSKA 3AAVA 1DVAH 4CRDA 2ZPQA 1GI6A 2I6QA 1P3EA 1ZHPA 1ZMJA 2F9NA 3MTYA 2ZCKP 3M3VA 3P8FA 2YOLA 3VB5A 1M9UA 1IQGA 1OP2A 3HGNA 4MTBA 5FX6A 1S82A 1GPZA 1MTUA 3DA9B 1VKYA 5FPTA 4X1RU 4AFZA 1E34B 2UUFB 1EAUA 2AMPA 1EJNA 1TFXA 4TWYA 4Q7XA 1Y3WA 2G55A 3GY6A 1O32A 1F7ZA 3E1XB 1AZ8A 3P8NA 3N7EA 3RXBA 5C5NA 4K8YA 4CHAC 1QURH 1A3EH 4XSKU 2HLCA 3BIVH 1BB0B 1HJAB 2UUYA 1PQ5A 1A61H 2H9EH 3ELAH 1ELDE 1HGTH 2CV3A 3SNBA 1BCUH 2HRVA 5ESTE 3SJIA 5F6MA 1SVPA 1DUAA 3N7OA 4BTTB 3GDSA 3PWBA 4K2YA 1SGTA 1HB0B 1MQ6A 1AFQB 1QJ6B 1AVXA 1Y8TA 2LP6A 5C0UA 1GBAA 1W12U 2ZFSA 3MQKC 1VCPA 3SOSA 2Z3DA 2B9LA 1GBHA 1GJDB 5KECA 1CHOF 1BMAA 3TVJB 3DHKH 4O03A 4Y76A 1O2GH 4ZCNA 1GHBF 2V3OH 5C3NA 1FAXA 3HKIB 1THPB 1KLJH 3GCHC 2DUCA 3LPRA 3UB0A 1SGYE 2Z6BD 3DSGA 3JZ1B 3QX5H 1TA6A 1GJ7B 1GJAB 2GDEH 4WH6A 1C5MD 3Q3XA 1NM6A 2Y7ZA 2Y82A 2AIPA 1F0UA 1N6YA 3PV2A 4WMDA 1W0KD 2ESTE 2TPIZ 1FPCH 3QO6A 4FUBA 4ASUD 3W95A 1O2MA 4Q4LA 1S6FA 1ZRBA 1PQ7A 1V2TT 2P3FH 5HGGA 2JJ1D 4ZUHA 2PGQB 2ANKH 1KDQA 1S6LA 3PMAB 3U69H 4XOJA 1A46H 3RXUA 2AGEX 5E0GA 1OOKB 3M5MA 1PQAA 2O8MA 3A88A 4HTCH 1OP0A 2QF3A 1P2QA 2UWLA 3VB7A 3DSPA 3M37A 5BPEA 1WV7H 4NGAH 3UOPA 1Q3XA 1YPJH 1SL3A 2TGDA 1Z8GA 1AB9B 3UOUA 1O35A 3WWFA 4ABFA 1GBCA 1GDNA 5C5OA 1GI8B 5HIYA 1HPGA 2Z3CA 4YT7H 1C4V2 2FWWA 1IOEA 3SU6A 1C2FA 1L1GA 5JB8S 4YOJA 4UDWH 2IJOB 4MPWA 1EAXA 1H8HD 2D1JA 3MHWU 1OWJA 4MNVA 1DWEH 2HVXA 1GMDG 2BY7X 1YYY1 3E0PB 2VINA 2P95A 5E0JA 5AHGH 1XXFA 3OU0A 3C1KA 3RM2H 3UIRA 1TMBH 2A7JA 4X2WA 3RXMA 1LPKB 3SBKA 1E1RD 1CE5A 3OTJE 1DLEA 1O2SA 1C5ZB 2F4LA 4YT6H 2ZP0H 3TNTA 1P9UA 1SGFG 5GJ4B 3MO3A 1C5NH 2BLOA 8GCHG 2SGQE 4X2VA 3ATKA 3H5CB 1IQMA 3FO8D 2FOFA 1CQQA 5C1XA 3M3SA 1UTMA 4YM9A 1BTHH 5E8EH 1BJUA 1XX9A 2Y81A 1SR5C 1OWDA 1JRSA 2AERH 2A5IA 1J16A 1W8BH 2OC8A 4ACAA 2BZ6H 3TJNA 5A8YA 1C5SA 1TQ7B 4KGAA 1CVWH 1MUEB 1BHXB 1TQ0B 3F2FA 4Y71A 3SW2B 2BDCA 1TGSZ 1P8VC 1FY4A 2GCTC 5ABWA 1WSSH 1P9SA 1WYKA 2P94A 4AB8A 1SGQE 4D76A 1DFPA 4F49A 3G01A 1FAKH 3LC3A 1LQEA 1CBWB 1W0ZU 4JYVH 4MNWA 1ID5H 1H4WA 4Y8YA 2C8WB 3T5FH 3DT0H 1OHHD 1OWEA 2GGVB 4TY6A 1AI8H 2ZTYA 4BTIB 3UAIC 1CHGA 3RMOH 1C2DA 2F9UA 1BTYA 3ZZ6A 1WUNH 1BOQA 1SQRA 1YPHC 1GHAF 1WCZA 4GPGA 3ZV8A 1VGCC 1W10U 2OXSA 3MU8A 1A1RA 3UNQA 5FHTA 1P2JA 1TABE 4ZKNU 3MWIU 1BITA 6ESTA 2F91A 1BMFD 1QJ7B 3ATMA 5EIYA 5EPYA 2KM0A 3D65E 5FAHA 3NCLA 3DUXH 1GJCB 2IN2A 5TJXA 4ABGA 4Y8XA 4K60A 1W14U 1YGCH 1OWHA 3KEEA 3MH5A 3STJA 1O3AA 1D3QB 4R0IA 2R2MB 3ITIA 1YCPM 4Q2KA 1LDTT 1EASA 1RTLA 2A5AA 1TGNA 4ABHA 1NS3A 3ESTA 2H9HA 2G5NA 1V2MT 4ZXXH 2FESH 2QF4A 1GGDB 2Z9GA 3ZVFA 5A09A 1MU6B 1QRZA 2HPQH 5EJLA 1S6HA 3VEQB 4OS4A 4CRAA 3M35A 4X0WU 3SU5A 1MABB 2AEIH 3LH3A 1IHTH 3O8RA 1QBOA 2J4IA 4INKA 4BAMB 1ARBA 2FLRH 2H2ZA 2TIOA 2PSXA 1O3GA 3C27B 3RXQA 1QCPA 4CBOA 3PO1B 3PB1E 2Y5GA 4MG3A 1UHBB 4P02A 3ZYDA 3Q00A 2VBCA 4IS5A 5JYIA 3TJOA 2EQNA 2PP6A 2B5TB 4AZ2B 1AO5A 2C8ZB 4ZH8A 1GBKA 1HCGA 2SNVA 3A87A 3P17H 4H6SB 4O3TA 5EG4A 1F92A 3F68H 4IMZA 3LGVA 3M7UA 4UFFH 3SUGA 1UVPA 2V3HH 1UVSH 3UNRA 2G51A 1T8NA 2XBWA 2ZU4A 5EU8A 1E1QD 1G32B 1UHBA 3FZZA 3LJOA 2OBQA 1GI2A 1KXBA 3H7TA 1PPBH 2ZDKA 2BY9X 4HGCA 1TX6A 1GMHF 1SQAA 2H1UA 1AWFH 2BY5X 2Q6FA 4FUJA 1XXDA 3A81A 1AMHA 3F9GA 2NU0E 1LKAA 1E35B 1KSNA 3A7XA 5AVDA 1HJ9A 1LPZB 3HATH 3LH1A 1FY8E 1TMUH 2UWPA 3W94A 1MTSA 5EQQA 3MH7A 1AGJA 1Y3YA 4MNXA 1P10A 1ARCA 3KL6A 2ZWLH 1F0TA 1RS0A 4JZEH 2FM2A 2ZKSA 4FUFA 3MOCA 2ANWA 1QBNA 2P8OC 2SGEE 5F03A 1K1MA 2R2WU 3GY2A 1RD3B 1TBRH 1C4Y2 4GCHG 3T2NA 1F0RA 1DLKB 3GISB 4CR5A 1ANCA 4BAKB 3L3TA 1TNHA 1C1MA 1UTOA 5JBBS 2PSYA 1XMNB 2FOHA 5L6NH 3QZQA 4DG4A 2Q6GA 2V7QD 1MZAA 1IQHA 3BEIB 3QGNB 1HBTH 2FO9A 3M36A 3F1SB 1OWKA 4VGCC 5GCHG 3S0NA 3EYDA 1XVOA 5DG6A 3F3BA 4AC9A 1P03A 5C0TA 2BVRH 1AKSA 2GX4A 2YNAA 1O36A 4U32A 2FOGA 2F83A 3HPTB 3UQOA 1ZSJA 1EPTC 2FLBH 3A85A 1FDPA 1LPGB 1O3IA 3NUMA 2PUXB 2WYGA 3BTEE 3RC4A 2RCEA 2PKAA 2BVXH 5FL7D 4JYTA 3SJOA 2QA9E 1FXYA 2LNCA 2XTTB 1IQJA 3A80A 1SGEE 2F9PA 2R0KA 4K8BA 3E3TA 1ACBE 2OBOA 2Y7XA 4K5ZA 2FX6A 3H7OA 3OX7U 3LGYA 3RUOA 1O2JA 1U6QA 2A2XH 1EJMA 2R0LA 1TNGA 1QQUA 3VB4A 3RXEA 1SMFE 1COWD 2O8UA 1C1UH 1HJ8A 1SLWB 1C1NA 1CGIE 2GVFA 3F9FA 1FPHH 4ZMAH 1S81A 1BT7A 1ZJDA 5HM9A 1PYTC 2OCVB 6CHAC 3F9HA 4IMQA 1FV9A 1ZJKA 3AW1A 1EXFA 3P8OA 2KFWA 1H8DH 1EKBB 1KTTB 2FP7B 1V2WT 4SGAE 1UVTH 2VWNA 1VJ9U 3LC5A 3O8BA 3KHVA 5AFYH 2RA0A 3NWUA 3K2UA 3PM3A 3SHCH 1TBQH 3EQ0H 4FUEA 1W11U 2J34A 3BTWE 3SZEA 1O5AB 1K1NA 5EODA 3B8JA 1BMLA 1T31A 1TRYA 2J98A 4CRFA 1BRAA 4BTUB 2QXJA 2D8WA 2ZPSA 3GCOA 3QN7A 1NBME 1F5LA 1BBRK 2BQWB 1O31A 3WW7A 3SZNA 5GNDA 3HK3B 4WJG2 1DXWA 3SN8A 2WZQA 1IQIA 1WTGH 3BG8A 1S0RA 2VVVA 1GBFA 3RLYH 1GMCG 1CT2E 5GPIB 1BRCE 3SU2A 1P2MA 1MQ5A 3OY6U 2BD2A 2W7UA 4TT3D 1G2LA 4D9QA 1EX3A 2SGPE 1GJBB 1O3NA 5EPNA 3TGKE 2JETC 4Y8ZA 3STIA 4JK5A 1G30B 1V2RT 2KCAA 2ZFPH 1NBMD 2F3CE 1ZHMA 1CGHA 1BTZA 3EE7A 3V0XA 3M61U 3NZIA 3V7TA 5A0CA 1LCYA 2XC5A 1QL7A 4DT4A 1E0FD 4AG1A 4A1XA 1ZSLA 3KQCA 2VGCB 1RTFB 1VJAU 4GAWA 1YP9A 4HG6A 4Y0ZE 1K21H 2H9TH 1S0QA 1BMNH 2GMTB 1P09A 1GCTC 2KR7A 1GL1A 1O3JA 2ZGBH 1E36B 1WTHD 4RKOB 1O2RA 1IQLA 1XUJA 4ZKSU 3AAUA 2ZHWH 3T26A 1TAWA 2STBE 3ZZAA 5GDSH 1FZZA 1Z6JH 2FI4E 4GVUA 4KKDA 1O5GH 1JMOH 2FMJA 2RA3A 3LGTA 3TJVA 2V3MA 2Z3EA 1QIXB 2G4UA 3SNCA 4CHAB 1N8OC 1HYLA 2PV9B 3OSYA 1QB6A 2A4RA 4B6EA 2A4GA 5JPMH 1T32A 1Y3XA 3GOVB 4CRCA 3E6PH 1DICA 4UD9H 2QCYA 3RXRA 1GI3A 3L6PA 3EAJA 2XC4A 2YNBA 5CDFE 3UREA 1O2VA 2QXHA 4FU9A 1TIOA 1KMHB 1RXPA 3PV5A 5F53A 3SNAA 4ZHAA 5C17A 2QYIA 4I32A 5IYTA 1HAHH 4UFEH 2ZTXA 2JH6D 1BTPA 4JYUH 2JDID 3SO3A 5DP7A 1S5SA 1UO6A 4FVDA 3BN9A 3ODDA 3UWIA 3RXGA 4I8GA 4GUXA
chains in the Genus database with same CATH topology
1C5OH 1VZQH 2C4FH 3KQBA 3VGCC 1GHXH 4YO9A 2UWOA 4IBLH 4Z6AH 1ZZZA 1PPFE 1MKWK 2IPHA 2WV4A 1ZPCA 3MNBA 5K0HA 4WH8A 1P04A 2ZGCA 1ELTA 3A84A 5LPRA 1B7XB 2FTMA 2Z9JA 1O2LA 4B75A 1QGFA 1O5EH 3MFJA 4WMFA 1K28D 1UTKA 1RIWC 3M7TA 1T4VH 5FXLA 2XXLA 5CHAB 4K69A 3GY5A 4X6NA 3SQHE 2GV6A 2ZECA 5C1UA 1ESBA 1J17T 4A92A 1DUEA 2ZDAH 1VITG 3FP6E 2BXUH 1TRMA 4I33A 1JOUB 4J2YB 1TGTA 1AU8A 2GKVE 1NC6A 1LVOA 3V13A 1NFWA 1ZMLA 8ESTE 1S83A 5DK1A 3TNSA 1MAYA 4IW4E 4NWLA 4D7GA 1ELVA 1MCTA 4AB9A 2G00A 1SGNE 1Z6EA 1KDQB 3GCTG 3BG4C 2W3KA 5I46H 1V6DA 1PPCE 3BF6H 1KLTA 5F8XA 1GI1A 4CH2B 1K9OE 1UCYH 2A45B 1O3BA 1A0LA 1C5WB 2BD4A 1TLDA 3GDUA 4A1TA 1TB6H 1LVMA 1GBJA 2J95A 1TOCB 1LHDH 5PTPA 3A8BA 1UCYE 1TOMH 2PKSC 2PR3A 3SV6A 4UONA 3SQEE 3ZVEA 5DO4H 1CA0B 3A8AA 1ELCA 1HAGE 2WINI 1HIAB 3SNDA 4B2CA 4ZAEA 3ZYEA 3TGIE 3SORA 1O2QA 3ZZDA 1O5DH 1K1OA 3P8GA 1QRXA 4MPVA 1CGJE 1O39A 2OD3B 1V2OT 2BD7A 2ZHDA 5T3HA 2ZGXH 1NFUA 2J94A 1G3BA 1GI9B 2ZF0H 2A2QH 4NG9H 3ZZ5A 1J8AA 4OGXA 1DPOA 1ELGA 3CP7A 3U9AH 1QTFA 2AFQB 2GCTB 1ETTH 3GCNA 1SGRE 2NU3E 3LGWA 3PTBA 1XUFA 1HIAA 5EOKA 3BTTE 3BTFE 6GCHG 1P01A 3ZZ8A 1SGDE 1X7AC 2BX3A 2VVCA 1DXPA 4ABEA 3VPKA 2BDYA 4U01A 2XYAA 1C1QA 4DGJA 2OQ5A 2XRCA 1P11E 3S9AA 1B0FA 3GY3A 3U8OH 1Y5UT 3TH3H 2EC9H 1UJ1A 2W3IA 1YPKH 5EW1H 2Z9IA 4E06H 2VVUA 4X2YA 2PWXA 3RXIA 4MPXA 3EA8A 1DS2E 1YCPK 4K1SA 4IN2A 1K22H 4FUGA 4GHTA 3T25A 3TLOA 3R0FA 2ZDVH 2HWLB 2WPMS 3RXJA 1AVGH 1NZQH 3LKWA 1RRKA 1GMDF 1OWIA 1WU1A 3K6ZA 4NA9H 2OTVA 2R9PA 4Y10E 4AN7A 5F8ZA 1C5YB 1O3MA 4U30A 4UE7H 1ZGVA 3T27A 5TCCA 4ABJA 1P2OA 3AVZA 1LMWB 5BRRE 1EJAA 4FVBA 1FNIA 2ZG0H 4B76A 3ZV9A 3TH4H 1HRTH 2PGBB 1DSTA 2TGTA 4AFQA 8GCHF 5J4SA 3RXAA 3SU0A 1UMAH 1GBMA 2OUAA 4KTSA 1GG6B 8KME2 1S84A 1LHFH 2B0FA 1ELBA 3PWCA 5HYOA 1ANDA 2RDLA 3QZRA 2BLWA 1PPZA 3T28A 1JRTA 1W0YH 4GLYA 4I31A 4Q7ZA 1QB9A 4HZHA 1HFDA 4X2XA 1OYTH 4BAOB 1C5LH 5C1YA 4Y6DA 4BAHB 5C67A 4ESTE 3TIUA 5LPFA 7ESTE 1HLTH 1O2WA 1UTQA 1W7XH 1TRNA 1YKTA 4TPYA 4YLUA 2CXVA 2GT7A 1UVOA 2OQUA 2XCFA 1ZRKA 3SUEA 2A1DB 1NESE 1EUFA 1GBTA 1K1PA 3SI3H 1TPPA 2HNTC 3RMMH 4LZ4B 4AYYB 4MDSA 4ABDA 2ZC9H 4UEHH 3BV9B 3A8CA 1ZPZA 3VB3A 1D6WA 3ENSB 3RXLA 1DWBH 4X1SU 3A86A 1GBEA 1QA7A 2AIQA 5EXMA 9LPRA 4KTCA 5LH8A 1BDAA 1V2NT 1F5KU 1C9PA 2ANYA 1L4DA 1SGFA 1WOFA 2O8WA 1ZHRA 2ZQ1A 1IQFA 1A5HA 2LPRA 5DP8A 1QB1A 2FOCA 2Z7FE 3RU4T 1WQVH 3MYWA 1P3CA 3A82A 4AFSA 4ISHH 4Y7BA 3FAOA 5K7RA 2XNIA 5DP5A 1C1VH 3A83A 2P8OB 1O2XA 1O34A 4ASHA 4JZFH 1FMGA 1MBMA 1Q31A 5A8XA 1GCDA 1G2MA 1FIWA 1HNEE 1W2KH 3MI4A 2W26A 2JH5D 1PPGE 2BD5A 2GD4B 2G5VA 2VIWA 3BTQE 4FUHA 1P12E 2G8TA 1W7GH 1TPAE 2V6NA 2FXRA 1IQNA 1P0SH 5GIBA 4IC6A 1HV7A 1YLDA 4IGDA 2O9QA 1H9HE 4VGCB 1KIGH 2F9OA 4I8HA 1GHYH 5FCRA 1CO7E 3MH6A 3RP2A 1L0ZA 4UFGH 4DCDA 1V2LT 4E05H 1PPEE 3V3MA 1O2TA 2PTCE 1NRPH 2FS9A 3BIUH 4WY3A 2OC1A 5DJ7A 1LHGH 1EPTB 1MTWA 1P05A 4D8NA 5GXPA 5CMXH 2CHAC 2PTNA 1UTPA 3Q76A 2ODQA 2ZZUH 3MNSA 1KLIH 2GCHG 1P57B 1TE0A 4OS1A 5LGOA 3KQDA 1CT0E 2BY6X 4Y79A 3HKJB 4K1TA 2D26C 2BHGA 3SGAE 2C90B 4IN1A 2BQ6B 1N1LA 3SV2H 1JBUH 1C2HA 4XBDA 7GCHG 1AKSB 4PROA 1O3KA 1BRBE 1EPTA 1DANH 1G9IE 1ZR0A 4LOYH 4I7YH 1VR1H 1HAOH 1AZZA 3M7QA 1NT1A 3UQVA 2G81E 3A7VA 2BY8X 1V2VT 3GY7A 1ELEE 4INHA 2PKAB 3IWMA 3EA7A 3E90B 2ZFRH 1SPJA 2D2DA 4AX9H 2A4QA 5ETXA 1NRNH 2QIQA 1SGCA 1JWTA 2Q6DA 2ZA5A 5AFZH 1HAPH 4B1TA 1V2ST 1TGBA 4XBBA 4YESB 1NY22 4GCHF 3GY8A 2VIDA 8LPRA 2Z9KA 3BSQA 3S7HB 2B7DH 1EAWA 1AWHB 1MKXH 2PFEA 4Q80A 2ZHFH 1G3EA 3EE0B 4I8KA 3LOXA 4AORA 1ABIH 2QGRA 4O97A 3RXTA 1E37B 4OS5A 3MNXA 1HAXB 1XUHA 4WWYA 4CREA 1CA8B 3SU3A 1FY1A 2CJIA 2EA3A 1TNJA 2BB4A 2P59A 5GCHF 3URDA 1Y5AT 1ZOMA 2QY0B 1GVLA 1D9IA 4I8JA 2HALA 2P93A 1W3CA 1MU8B 3SGBE 1O33A 2Y6TA 2ZI2H 1HAVB 2FEQH 3KCGH 3PMHB 4BNRA 5JB9S 4MLFB 3OY5U 1C2EA 1THSH 2CMYA 4Z0KA 1ESTA 1Y3VA 3QGJA 1EOLA 2ANMH 1T7CA 1TONA 4M7GA 3CS7A 2ZTZA 4NFFA 4SGBE 3BTDE 3RM0H 1GCTB 1SLXB 1SQTA 2XBVA 1O3CA 3HGPA 1ABJH 3PTNA 2FIRH 2TRMA 2ZDNA 3BTHE 4BXWA 1MCVA 4NIXA 3SUFA 1HAVA 2ODYB 1EZSC 1AE8H 2A0QB 1ZTLA 1LKBA 2ILNA 1C5PA 4JZ1A 5C2ZA 5J4QA 3F6UH 1TA2A 4JK6A 4O9VA 1L1JA 1AUJA 4ZKOU 1BBRH 4XDEA 3UR6A 2ZHQH 1C2KA 3K9XB 5CE1A 2AS9A 1RGQA 1N8OB 2C8YB 1K1IA 5JDUB 1ZTKA 1O2ZA 4NSYA 5DPAA 1O3PB 2XC0A 3MU1A 4DVAU 1GJ8B 2VWMA 3U8TH 3SNEA 2FTLE 2BTCE 4NSVA 3RDZA 3EGKH 1Z8JB 2BVSH 3PROA 1BBRE 1MTNC 1GJ5H 1GI7B 3U1IB 1ZMNA 2VIOA 1FQ3A 1GL0E 2Y5FA 3U1JB 2FPZA 1YPHE 1C1TA 1N6XA 5L2ZH 4DOQA 1ETSH 5FX5A 1RJXB 3PLBA 3ATLA 4WVPE 1BQYA 3SUDA 1O3OA 3RXPA 1CU1A 1GMCF 1C1OA 2VIPA 1BUIA 1TALA 2EEKA 2ZIQH 1MTVA 1GWAA 1H1BA 3RXOA 4ISLA 4BAQB 3LGIA 2ODPA 1C5TA 2BDGA 1OS8A 1YBWA 3SGQE 1O5BB 1QNJA 3JZ2B 4FUDA 2WPHS 2P3TB 4B71A 1T8OA 2G4TA 3MNCA 3UTUH 1Z7KA 4ZXYH 1UTLM 1FN8A 2XBXA 4DURA 5EGMA 4MPUA 4ZKRU 2VH6A 3ZZ9A 4A5TS 2FI5E 3IITA 1O2KA 3CENA 1AN1E 1O3LA 1TX7A 1H9IE 3DFLA 1QJ1B 2ZQ2A 1GHVH 4D9RA 1D6RA 4DY7B 4H6TA 1RIWB 4K1EA 1CSOE 2XW9A 1C5QA 1GHWH 1XUKA 2GT8A 5T6DA 1C2MA 3TGJE 1E38B 4D7FA 3KIDU 2ZCLP 2WUCA 1DOJA 1AVWA 2SGAA 1QQ4A 2BLVA 2H5DA 3ZZ4A 3URCA 2FZZA 1K2I1 3EA9A 4R8TB 5T6GA 5G4BA 3AW0A 1O2OA 2BZAA 3CS0A 2ZPRA 2FDAA 1C1WH 1DITH 3GCHB 4CBNA 3UNSA 1UTJA 1K1JA 5L30H 1EB1H 1PFXC 1SOTA 2HGTH 4O3UA 3RMNH 3UPEA 2VGCC 2UUJB 3Q3KA 2QN5T 3A7ZA 3LONA 1H8IH 1LHCH 3PMJA 2GMTC 3A7YA 1OXGA 1EP5A 2PLXA 3Q3YA 1MKWH 4H42U 1V2PT 1C2LA 2O8TA 1QFKH 3M3TA 1BTUA 2WPKS 1SOZA 2PKSB 1FLEE 4HI3A 3UUZA 2R3YA 3GY4A 2F9BH 1C2JA 3KNXA 2ALPA 5EXNA 1O38A 1NROH 4WXVA 2GV7A 1CHOG 5L2YH 3DD2H 1DDJA 3UY9A 1OKXA 1FIZA 2ASUB 3MMGA 1SGIB 1C2IA 1GHBG 5HMAA 1RTKA 3QTVH 2VJ1A 1P2KA 1SB1H 2NWNA 1IHSH 2BLQA 1KY9A 4FU7A 1MH0A 4WXIA 2ZGJA 1MMJN 3P6ZB 1EZXC 3QTOH 4H4FA 3TPIZ 3A8DA 3O8DA 4AFUA 2HPPH 4CR9A 4ABAA 1V3XA 2AMDA 1B5GH 4X8VH 3RC5A 2I6SA 1PPHE 1AFEH 3KGPA 4B2BA 1UK2A 4Y7AA 4XE4A 4AYVB 3PMBB 4UFDH 3BTME 4KP0A 5SGAE 3E8LA 3NKKA 2ZU3A 2GDDA 1VITF 4F4OC 1UCYK 1CT4E 1SHHB 3MU4A 2VNTA 3M5LA 5EQSA 2BD3A 1ZLRA 4OS2A 5FPYA 1G36A 2WV5A 3GCTF 1FONA 3BEFB 2AYWA 5EW2H 2B8OH 4OS6A 3LU9B 1GDUA 1QA0A 2Y5HA 1AD8H 1LTOA 3E0NB 1ELFA 4CRGA 1EAIA 1HJAC 3QWCH 1SFIA 3WY8A 5HM2A 5E2OA 2STAE 1C5VA 1ESAA 2RG3A 2W7SA 3O8CA 1SQOA 2A4OA 1QRWA 4QT8C 4X6OA 5E0HA 5CHAC 4JCNA 4Y11E 2V0BA 2QXIA 2QC2A 1V2KT 1AFQC 2VIQA 2HNTF 2PUQH 1NFYA 1FI8A 4RN6A 1UK4A 4ABIA 1A2CH 4BANB 2FI3E 1T8LA 5A0BA 1GBIA 1XM1A 3IG6B 1O37A 1J9CH 1O3DA 4NIVA 2C93B 3RC6A 2IOTA 2QAAA 2C8XB 5T6FA 1PQ8A 2BOHB 1PYTD 2FODA 3FFGA 5HXFA 1GBDA 1HXFH 1Z1IA 1J15A 1GJ6A 3RXVA 1VGCB 1TYNA 3RXHA 2JKHA 2ZHEH 6GCHF 4ISNA 5E2PA 1BHXF 1YCPH 1SC8U 1SSXA 3MO9A 3D23A 3UFAA 3SU4A 1AQ7A 2AMQA 1K1LA 1SGPE 2WPIS 3PLKA 4AOQA 1Y59T 2JH0D 2ZNKH 1C4U2 4B73A 2Q1JA 3ZVCA 1CA0C 1KYNA 2QV1A 1TX8A 1TNKA 1GJ4H 4YOIA 6LPRA 2J38A 3ZZ3A 9ESTA 1PJPA 1O2IA 3VFEA 1MBQA 3L33A 1GI5A 3KF2A 2BQ7B 4TY7A 1TGCA 1DWCH 7LPRA 2BD9A 2J2UA 2K1QA 2F9VA 3S9BA 2OC0A 1AB9C 1Y3UA 1Z71A 3A7TA 1T4UH 2BXTH 2TGPZ 3K6YA 2SGFE 3BTKE 1AIXH 4ZHMU 4FUIA 1GHAG 1KXEA 1DE7H 1MZDA 1A0JA 1MD7A 2R3UA 2VIVA 1Z1JA 2FOEA 3I78A 3SI4H 3ATIA 1KXFA 1C5XB 1TNIA 1OPHB 2FOBA 3SJ8A 4E7RG 1NO9H 1D3TB 4TWWA 1B0EA 1WAYB 5C20A 5B6OA 1SFQB 1GVKB 3ZVAA 1HAIH 1O5CB 2THFB 1O0DH 3UR9A 1GBLA 1TBZH 1G3CA 2G52A 2CGAA 2CF8H 1Q2WA 5TCAA 1DM4B 1UTNA 2VH0A 4YTAA 3T29A 1V2JT 3U8RH 2PW8H 3AASA 2FOMB 3VB6A 3HK6B 4X8SH 4DJZB 1INCA 2ALVA 1GJ9B 1MAXA 1O2UA 2QF0A 4NA8A 1JIMA 1XUIA 3LT3A 4CRBA 2CHAB 1NFXA 1QY6A 5FPSA 1FY3A 3SHAH 4FUCA 4YZUA 1EP6A 1IQKA 2XWAA 1DSUA 4AGJA 5FCKA 2VB0A 1C2GA 2TBSA 4JZIA 3D49H 1BMMH 2EI8A 2C3SA 1AHTH 2UUKB 4THNH 2HOBA 1TPSA 1GG6C 2Z9LA 1CBWC 3VXFH 1AY6H 1TMTH 1Y5BT 4Y0YE 1V2QT 2PHBA 1VCWA 2A7HA 4XBCA 1DY9A 1DWDH 1LQDB 1ANEA 2DE9A 4MNYA 3M5OA 2OP9A 5FBEA 1QL8A 2WYJA 3I77A 4XFQA 1O30A 1V2UT 2FYRA 1GMHG 3B23B 1Z8IB 1KXAA 2ZCHP 3ZZBA 3QDZB 4OGYA 2VWOA 4E7NA 5A8ZA 1C1SA 3K65B 2GZ9A 2GZ8A 2J9NA 1A5IA 3ZVDA 1NN6A 4U2WA 4X1PU 4BOHA 1O2NA 1D3DB 3NPSA 2WPLS 2V35A 2ZDLA 1FY5A 1YPMH 3TJUA 2SNWA 3RLWH 3TK6A 1O3HA 1O2HA 7KMEH