1SGFA

Crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
228
structure length
203
Chain Sequence
NSQPWHVAVYRFNKYQCGGVLLDRNWVLTAAHCYNDKYQVWLGKEEPSDQHRLVSKAIPHPDFNMSLLPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKLGSTCLASICVNLKLLPNEDCDKAHEMKVTDAMLCAGEMDGGSYTCEHDSGGPLICDGILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMANNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NERVE GROWTH FACTOR
publication title Structure of mouse 7S NGF: a complex of nerve growth factor with four binding proteins.
pubmed doi rcsb
molecule tags Growth factor
total genus 36
structure length 203
sequence length 228
chains with identical sequence X
ec nomenclature
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgfA01
1O3MA 1ARBA 2OC1A 1Z6JH 1WOFA 1MTUA 2H6MA 1J16A 3RXVA 2VIQA 3OY6U 1HXEH 5C1UA 4MNYA 3C27B 1HJ9A 1C1VH 2ZTZA 1HIAB 4X2VA 1FY4A 5HM2A 3SJOA 1C1WH 2RA0A 2SGFE 3MYWA 2DE8A 1VZQH 3SBKA 1S6HA 1FY3A 2VVCA 4F49A 4Y0YE 3K6YA 1P03A 4Q80A 3SUFA 3RC6A 3OTJE 1S81A 3E90B 1JRTA 3GY7A 1NRPH 4MG3A 3Q76A 5JBAS 2LPRA 1U6QA 4LK4A 2Z3CA 1BQYA 1GBFA 2AS9A 1TAWA 6GCHF 1AE5A 1BTXA 1NFYA 2PTNA 3UOUA 4HGCA 3GYMA 1XXFA 1C2KA 1OP8A 3KQCA 4H4FA 1GJBB 1FJSA 4X0WU 4R0IA 1AZZA 3EQ0H 2R3YA 2V3HH 4E7RG 1RD3B 3LGUA 3QLPH 5HXFA 2ZFRH 2F3CE 3KGPA 4OS6A 2CN0H 3T28A 5E2PA 1T4VH 3GYLB 1GBDA 1GHYH 1VR1H 1OWKA 3P95A 3EE0B 1WQSA 2A5AA 1E0FD 4JCNA 4YLQH 3U8RH 2ZFTA 1Y5UT 4YOJA 1S84A 2EC9H 1WBGB 1TRMA 2G51A 1V2VT 1DUEA 1GI3A 1W7XH 1BIOA 4TWWA 1NZQH 1XKBC 1SGEE 1HBTH 5DPAA 1A46H 1S83A 1BJUA 3B8JA 5EQQA 1GBMA 2WPLS 1TPSA 2ANYA 2ZU4A 2FS8A 3QN7A 4CHAC 3RXBA 9LPRA 1C1OA 4ZKRU 2H5DA 4FXGH 2BTCE 1QJ6B 6GCHG 2D2DA 5JBBS 1EXFA 4NZLA 2C3SA 4DCDA 3L33A 5DO4H 1AKSA 3ZV8A 2NU4E 1SBWA 4O97A 1GMHF 2QXGA 1L4ZA 4A6LA 1SB1H 1QURH 1EB2A 3O8CA 1W11U 5IDKA 3T29A 3V3MA 1O31A 1GHWH 4CRFA 4IGDA 5ESBA 1PYTD 3QTVH 2WPKS 1H4WA 4BTUB 1TGBA 1FIWA 1O3EA 4WVPE 1P05A 4ESTE 4ISHH 1ZHPA 1A2CH 1ZGIA 1V2LT 4KGAA 1KXFA 2FOGA 2ZGHA 1NN6A 2BLOA 2HWLB 1OOKB 5EODA 2ALPA 1SOTA 1FIZA 1O2QA 1TMUH 1KTTB 2ZHQH 1K9OE 1EAXA 4OGYA 2VWNA 2Z6BD 1BMLA 1CE5A 5F8TA 3SQEE 1V2NT 2BQ7B 2ZDLA 4Y8ZA 4CREA 2CGAA 3UQOA 3ZVGA 5A0AE 1S6FA 2ZQ2A 5JB9S 1GI6A 1BHXF 1JBUH 1P2KA 5DP3A 2HNTE 1TWXB 4IN1A 1C5SA 1GI1A 3K2UA 3VGCC 1O32A 3BEIB 3RXFA 4UFDH 4B2AA 4HZHA 4GHQA 2G81E 4LZ1H 3CENA 4CH8B 2I6QA 2CJIA 4RKJB 2C93B 1O2KA 1DE7H 1ZYOA 4WMFA 3O8BA 5FAHA 4AYVB 1P12E 1BTUA 2FOAA 4ZH8A 3TNTA 2JETB 4XOJA 1EOJA 4ZHAA 2LNCA 4BNRA 1RIWB 1L4DA 1ESBA 3TITA 4AZ2B 2VNTA 5C5NA 2F9NA 3AAVA 2PKAB 1TNHA 1ABIH 1K1PA 1QGFA 1O37A 1PQ5A 2OUAA 2XTTB 1LPGB 1OX1A 2Y5GA 4X2WA 1C4Y2 1EZXC 1MCVA 4JYUH 3URCA 1XM1A 5EU8A 3SU6A 1ANBA 1O3KA 2THFB 3UQVA 3ZVEA 1K1OA 5DP5A 1ESAA 1K28D 2D1JA 2STBE 1QBNA 3BG4C 1IQHA 1G3DA 4KTCA 1SR5C 4XSKU 1H9IE 3FANA 1CVWH 2QY0B 1MTNB 2KAIA 2Z94A 3WY8A 2ZIQH 1FDPA 2PV9B 3EAJA 4AG2A 4DGJA 5EXLA 1YCPH 3V12A 5C3NA 3KQBA 1BRBE 1YBWA 2FP7B 5AF9H 4FUCA 3SQHE 5H4IB 5FCKA 3TK5A 2BY5X 3KF2A 1H9LB 4D9RA 1CBWC 1C1RA 4JMYA 2BZAA 2QYIA 2W5EA 4WH8A 1C1SA 3GISB 1QNJA 2J2UA 2ZTXA 1AKSB 1MD8A 1VJAU 1JIRA 1ELBA 2WYGA 1LPKB 1MKXK 4NFFA 3LH1A 3UNRA 5C67A 3QO6A 1JXPA 5AHGH 1EP5A 2O8LA 1TABE 2FIRH 4ZMAH 4A5TS 1CA0B 2HRVA 1O3NA 1O2NA 1O3PB 3RUOA 1HDTH 2GP9B 1CSOE 2ZFPH 2VWOA 2ANKH 4LOYH 3ZVDA 1DXWA 1W0ZU 5I46H 3T2NA 7GCHG 4K8BA 2UUKB 3SNEA 1V2WT 4KKDA 3O8RA 2NU2E 3GY4A 4MLFB 3FP7E 3PMJA 3MNBA 2WPHS 1PPHE 1Y3YA 3TJNA 1Y59T 2IJOB 2BQ6B 2PGQB 5EXNA 1H8IH 4HI3A 2P3UB 1GBHA 1L0ZA 2UWLA 1BBRH 1J17T 1IQEA 3ZZDA 2SGDE 3P8GA 3R0FA 1Z7KA 2WUCA 1D3TB 2VWMA 3H5CB 3JZ2B 2Y80A 4TY7A 4OS4A 5TCAA 4X1QU 4MDSA 4XDEA 4GVUA 5CMXH 5DG6A 4FVDA 1O3HA 1RXPA 3ATLA 4X1RU 4BAHB 1XVOA 1EKBB 4J2YB 2UWPA 2V3OH 4RN6A 3QGJA 3ODFA 1O2MA 2A4RA 2AH4X 1DWBH 3BEUA 3SO3A 2V35A 5K0HA 3PMAB 1GJCB 3M5LA 4NSVA 2BD7A 1FY1A 4AORA 5EXMA 1C2HA 1MCTA 2BX3A 4AN7A 1AB9B 3MU0A 1ZPBA 1GDQA 1H1BA 1SGIB 2AFQB 4DVAU 5ETXA 4E06H 1EZSC 2FWWA 2FOHA 1TPOA 3GY5A 3E6PH 1W14U 3HK3B 3ZZ6A 7ESTE 1C5XB 3S0NA 1UCYH 1O2JA 3I29A 3RU4T 1G3CA 6LPRA 2BB4A 1TONA 1BMNH 3I78A 3SJ8A 3SV6A 1PPCE 4YTAA 2IOTA 1TE0A 2P59A 3SI4H 3A87A 4XE4A 1A5HA 2EI7A 5DP8A 1ZLRA 1AE8H 1GI2A 2PSYA 4D76A 1ID5H 1FPHH 1CGHA 5EGMA 3SN8A 4GHTA 1AGJA 1EJAA 1UK2A 1GJ8B 1YPHE 3TU7H 3ZZ9A 1BRUP 3SNCA 4UFFH 1DLKB 1IQNA 1QHRB 3NWUA 3HPTB 1QL7A 2I6SA 4I7YH 1ZSKA 1YPKH 1JMOH 1BRCE 1C5LH 1HGTH 2BDGA 2FPZA 4YZUA 2R0KA 1EAIA 1P2JA 2YOLA 5GCHG 3RXEA 4JYTA 4ISNA 1BTPA 3BEFB 3E0PB 4Z6AH 3G01A 1G37A 3P70B 4AB8A 2XC5A 3VGCB 4X8UH 1O5AB 2VIPA 1Q3XA 1O30A 4FU9A 2XNIA 4X8TH 1WQVH 5ABWA 1C2GA 1ZSJA 4CRDA 3QX5H 1XUKA 2DUCA 3MOCA 2O9QA 3MWIU 1AFQC 1MBQA 1UK4A 4AGJA 1IQKA 1BTZA 1W3CA 5E2OA 1AUJA 1C5VA 4F4OC 2NU0E 5T6DA 3CP7A 1ACBE 2XWBI 2FZZA 2O8TA 1AN1E 1T8NA 2FMJA 3SV8A 3SU5A 1V2TT 2EEKA 5FHTA 2W7SA 2ESTE 3MNSA 1DLEA 3BTKE 3ZVCA 1O33A 1S82A 3M35A 3MO9A 3TJUA 4THNH 1NM6A 4ABEA 1BDAA 2ZU1A 1DPOA 4Y79A 1O2ZA 4YOIA 4IC5A 1G2MA 2QIQA 1TBQH 4DW2U 2P95A 3GCHB 3TLOA 1GJ9B 3PLKA 4DURA 2VGCC 5FBEA 2ZU5A 3ODDA 4UE7H 4B74A 3TJVA 2WUBA 1KTSB 1T7CA 2PKSC 5I25A 7LPRA 1MMJN 1EZQA 1TNIA 1AVWA 3TIUA 1TMTH 2WPIS 2A7HA 3O8DA 3TGKE 1A5IA 1GBEA 1ZZZA 2J9NA 2QXHA 1Y5BT 4K60A 3TPIZ 4UD9H 3MU5A 3A7VA 5FCRA 1C5OH 2FM2A 2PUXB 1QRWA 2BY8X 1SSXA 2GD4B 3BTTE 1EATA 3P8OA 2SGPE 4I8KA 2Y7XA 1GVZA 3UTUH 1ORFA 1ZTJA 1SQTA 1SC8U 4DOQA 1AWHB 4FUGA 2G5VA 3B23B 1PQ8A 1XX9A 3EA7A 1OKXA 1TIOA 3UREA 1SGRE 4OGXA 1GCTC 3OX7U 5B6OA 1NESE 2ZPRA 3V13A 2P3FH 3HK6B 3PLBA 5E8EH 2ZFSA 2QAAA 1C2LA 1NO9H 3CS7A 1QL9A 1AFEH 3PO1C 5FX5A 2ZWLH 1ZTLA 1YGCH 1G3EA 1AWFH 4K2YA 1C2EA 1SLVB 2RCEA 3RXPA 1KIGH 1QFKH 4UONA 4HFPB 4K1SA 3BF6H 3A86A 3SW2B 2ZGJA 3K6ZA 4ABDA 1MTWA 1GHBF 1YPGH 3M5NA 2XCNA 4ZROA 2FS9A 2UUFB 2ODYB 4U32A 2Z9JA 1ZGVA 1T8MA 2ALVA 2BXTH 2VIWA 3T26A 3ZYEA 2HLCA 2ZHEH 1HFDA 2FI5E 4BXWA 5JBTA 2CHAB 3LGTA 4A1XA 3MH6A 3F9HA 3AAUA 1HYLA 3PROA 2Y7ZA 1RRKA 5A8XA 3F68H 5LPFA 3SUGA 2AEIH 1ZHRA 4AB9A 2QC2A 3BTGE 1Q31A 3BG8A 4NG9H 1DWDH 1KDQA 3F9EA 5C20A 3DFLA 1HV7A 2DE9A 2A7JA 3GY8A 2A2XH 1IHSH 2P94A 1TOCB 4X1SU 4JZEH 4YESB 4U2WA 2WINI 1AO5A 4LXBH 1C5TA 1HAVA 1GHBG 1O3AA 1Z8IB 2GZ9A 1C2DA 4FVBA 1AD8H 3SNBA 3ATMA 3GY3A 4CR9A 3UR6A 1A0HB 1OS8A 4BXSA 1EPTB 2Z9GA 1JOUB 4B2CA 1HJAB 3RXJA 2GX4A 1MKWH 2BDHA 3M7QA 2BOKA 2GTBA 3T5FH 4Z0KA 3RXLA 3UWJH 1F2SE 1F0SA 2C8WB 3BTEE 1SGYE 2AERH 1ZOMA 1C1TA 2BD5A 2OQUA 2TGAA 4WY3A 1C5PA 5JB8S 1GJ5H 1EAUA 3Q3KA 4VGCC 5A0CA 4YOGA 1J9CH 3TGJE 1PQAA 1O5GH 3ITIA 1QY6A 2TRMA 1QB1A 3M37A 2J94A 5FPSA 4UEHH 2BOHB 3MU8A 1GG6C 3HGNA 4Q7ZA 5E0GA 1LVYA 1KY9A 1O2VA 1BBRE 4IN2A 1Z6EA 3PTNA 3E16B 2A1DB 3ZZ4A 4JK5A 2ZCLP 4X6NA 4D9QA 5C1XA 4AFZA 1ESTA 1LVBA 1VGCC 5J4SA 3DHKH 1NRQH 1JIMA 1KLIH 1GGDB 3KIDU 5FX6A 3RC4A 1C5QA 1YLCA 1T8LA 2FOBA 2A4OA 2BLWA 1LKAA 2OC0A 1BJVA 1O5CB 1A3BH 1V3XA 1C5YB 4Y8XA 2UUJB 1HLTH 1THRH 3E3TA 1N8OB 2ZGXH 3A7YA 3VB5A 3UWIA 2QGRA 5L6NH 3U1JB 2H5CA 2GMTB 2OC8A 1PYTC 4O3TA 2HPPH 2BVRH 1BA8B 1K2I1 1BZXE 4BTTB 1UCYE 1ZJKA 1UTKA 1TLDA 5DP6A 2XCFA 2JH5D 1OYQA 2J92A 4X2XA 1YP9A 4FUFA 3QZQA 1O38A 1GMCF 3LGYA 2FEQH 2C8ZB 5GXPA 4E05H 4BAMB 4WF8A 1CO7E 1ELTA 1SVPA 3LGVA 3ATWA 4MQAA 4U30A 5A09A 1LDTT 5CHAC 1NC6A 3NCLA 3NXPA 1BTHH 2ANWA 2F9VA 3A85A 1P2IA 4Y0ZE 3SHCH 3RU4E 4O3UA 2ZGBH 1C1PA 1UVTH 4IC6A 1FONA 1FV9A 1XMNB 3CS0A 1DANH 1OWJA 2GV7A 2FYQA 2V0BA 3BIUH 5L2YH 3BSQA 1TMBH 2NU1E 3A83A 1TYNA 3M61U 3SJ9A 3MU1A 3KCGH 2XWAA 4H6TA 1GDNA 1GJAB 3KEEA 1OWHA 2RDLA 2XC0A 3PWCA 5AFYH 3N7OA 2ZC9H 1C4V2 1SGFG 2ZEBA 1CQQA 1GMHG 4U01A 1KDQB 5JBCS 1W10U 1F5KU 1QIXB 3ZVBA 1XKAC 3RXKA 3Q3YA 4MVNA 2AIQA 5A0BA 1QR3E 1LHFH 5JPMH 1ZHMA 4FU8A 1GMCG 3DUXH 4IMZA 1SLWB 2H1UA 3ZZ8A 2OQ5A 3ESTA 1SI5H 2BDYA 2PHBA 3E91A 1K1LA 3TH2H 2P8OB 1W8BH 2GKVE 1GHVH 1MKXH 3MMGA 1O39A 5GJ4B 3KHVA 3QUMP 1C4U2 1OWEA 4CR5A 4M7GA 3Q00A 1MZDA 1C5ZB 2WPJS 3GCNA 1Q2WA 4ZKSU 2EI8A 1GI8B 1W0YH 1Y3VA 2A0QB 3M36A 1DX5M 1IQLA 1GBLA 1H9HE 2ZDMA 1G2LA 3LC3A 1MBMA 3HATH 1TNLA 1Y3WA 3VB6A 1FLEE 1HAYB 1XXDA 1IQIA 1T32A 4WXIA 2BX4A 2FX4A 5F8ZA 5GIBA 1S85A 1AVXA 5DJ7A 2Q6FA 5GDSH 4YT7H 1CT4E 1C9PA 1S5SA 4A7IB 2FDAA 1J15A 5DP9A 5ESTE 2O8WA 1VCWA 4UDWH 2A45B 2B5TB 3RMNH 1K21H 3RP2A 2ZFQH 1L2EA 1AQ7A 2Q6DA 4D8NA 1K1JA 3SU0A 3QDZB 4AFSA 3EYDA 1OYTH 2JH0D 1BUIA 4O03A 3TH4H 5FBIA 4Q7XA 2C90B 3BV9B 3FP6E 1VITF 3C1KA 3NPSA 5AFZH 5A8YA 1UJ1A 1TGNA 2HNTF 2ZHFH 2JKHA 2XRCA 5C5OA 4JZFH 2OINA 4Y71A 1LKBA 1V2ST 1HAIH 1V2KT 1H8DH 3ZVAA 4YO9A 1Z1IA 2GCTC 1DY8A 3IG6B 4KTSA 1ANDA 4NWKA 1GBJA 1A0LA 3P92A 1GBKA 1LHDH 1TPAE 2Z9LA 3S7KB 1CA8B 1ELGA 2GT8A 3L6PA 1ZRBA 1RJXB 3LC5A 4TPYA 1NY22 1A7SA 2ZU3A 3LH3A 2TIOA 1SHYA 1BMMH 2OLGA 3SJKA 1MTSA 4MNWA 1MUEB 1YPJH 1P2NA 3NZIA 2ZHDA 5BPEA 2PFEA 1GI9B 1J8AA 1EQ9A 4GAWA 1EJNA 1UVPA 3U9AH 2GVFA 1A1RA 4MPWA 1OSSA 4X1PU 2ZDVH 4J1YA 4K69A 1O36A 1BITA 1HAGE 2SGAA 1P01A 4INKA 1A5GH 1BTYA 3RMMH 1AY6H 1QCPA 2R2MB 4CRGA 3UR9A 1LQEA 1YCPK 1S0RA 5EW1H 3PM3A 1FNIA 2A5IA 3SU4A 3EDXB 4CHAB 9ESTA 2J4IA 4AFUA 5F8XA 1FY5A 1SL3A 3RXDA 3RXAA 3ZZ3A 1HRTH 5HMAA 1JWTA 1YC0A 4LZ4B 4INHA 2XYAA 1Y3UA 2Z3DA 2TGTA 2ODQA 2F9OA 2ZTYA 2A4GA 3ZZCA 2Z3EA 1EOLA 2AMPA 3SJIA 4NIYA 1MAXA 1ANEA 1TNJA 2ZKSA 5GPIB 1GHAF 5EOKA 2H9HA 4K8YA 1J14A 1XUGA 1O3FA 1NRSH 3T25A 3SZNA 1TPPA 1NS3A 1AHTH 4ISIH 1NFXA 3SGBE 1GI4A 1MD7A 4FUHA 1FAXA 1P3EA 5G4BA 3LT3A 4D7GA 2FOCA 2QF3A 2KAIB 1ZRKA 2BLQA 1TBZH 2OC7A 3BTHE 1UVSH 4YT6H 1TRNA 2ANMH 1LO6A 1HAZB 4CRCA 1ZMNA 1G9IE 2SGEE 2QXIA 5T3HA 2FO9A 3SU2A 1GJ7B 2FODA 1DDJA 1Z8JB 1L1JA 1C1MA 1QB6A 1YCPM 1BBRK 2PW8H 2JH6D 2ZNKH 3D23A 4ZAEA 1ETSH 3VXEH 4NA8A 1Y3XA 2ZZUH 4GUXA 2W26A 1WTGH 2R9PA 3RXSA 2VU8E 2F9BH 3TJOA 2ZU2A 1GHAG 2FX6A 1CGIE 2R0LA 1EX3A 3LJOA 4I31A 1O34A 5LPRA 8GCHF 2OP9A 1UTPA 2F91A 3B9FH 4NIXA 1YLDA 2ODPA 5HGGA 3BTDE 1P3CA 4X6OA 2TGPZ 1WU1A 3DA9B 3U1IB 1GPZA 3A89A 2ZPQA 3M5OA 1DS2E 1SGCA 2D8WA 4MPVA 2PGBB 4TWYA 3TH3H 1W7GH 2J38A 1QTFA 1SGPE 1G3BA 3HKIB 2ZFFH 8LPRA 1UCYK 3F1SB 1MU8B 1KLTA 3BTME 1ANCA 1G30B 3IWMA 2ZDKA 3ZZAA 1Z8RA 1VJ9U 1CT0E 1SFQB 4CBOA 1NT1A 1BOQA 1Z8GA 3BG4B 1GMDF 3VB4A 1UTQA 2FOMB 1KXEA 4MNXA 1K22H 3SI3H 2BY6X 4K5ZA 2G8TA 5IYTA 1UHBA 1NRRH 3A7ZA 4YLUA 2BVXH 1C5UA 1N6YA 8GCHG 1BHXB 1SQAA 4CRBA 3AW0A 3VXFH 3IITA 3A7WA 1CHOF 3ELAH 2QA9E 1CBWB 3PMBB 5PTPA 3ZYDA 3M3TA 5DKMA 4SGBE 2FYRA 1O3GA 2CMYA 1KXAA 1UVUH 3FP8E 3KQEA 1HAOH 1C5NH 2UUYA 3T62A 1ETTH 4HTCH 4ABGA 1FY8E 1UTOA 2A32A 2YNBA 1KXCA 1WUNH 2Y6TA 2AYWA 3D49H 2BDCA 3QGNB 3RLYH 2TGDA 5EQSA 3V0XA 3GCTF 2A4QA 3A81A 4RKOB 5F6MA 3RM2H 1T8OA 1P09A 1PPBH 1MQ6A 4B2BA 1DXPA 1GMDG 1O2RA 1C9TA 3MHWU 1IQGA 2BDAA 1EAWA 1UVOA 1GI5A 1OPHB 3EGKH 3R3GB 1IHTH 1AUTC 3F9GA 5JDUB 2ULLA 1SGQE 2XBVA 1BMAA 1ETRH 1TGTA 4FU7A 1DOJA 2JETC 1GVKB 1WTHD 1E35B 3W94A 4BAQB 1RIWC 2H2ZA 1CHOG 5F03A 1XUHA 4K1EA 1O3LA 1P2QA 3EA9A 4OS7A 3VB3A 3PV4A 3S9CA 4ABHA 3SGAE 4NSYA 1QBOA 3KN2A 1EUFA 1PPZA 4FUBA 1TX6A 1O2GH 1SPJA 1O2LA 5FPTA 4ABIA 1O5DH 3GDVA 1UTJA 3LU9B 4R8TB 4IMQA 5DGJA 1BB0B 3OYPA 3D62A 2W3IA 1LVMA 1MTNC 1DUAA 3GICB 3S9BA 1B0FA 2PTCE 1THPB 3RXUA 1O2UA 1TRYA 1TGCA 4WWYA 2G5NA 2PR3A 4B73A 5K7RA 2PUQH 1YPMH 2EA3A 1YYY1 3DD2H 1C5WB 2AMDA 2PWXA 1RTKA 2GDDA 5C1YA 4AX9H 4H42U 3BTWE 1K1IA 5J4QA 3I77A 2O8UA 1SLUB 1E36B 1O3JA 1O2OA 3LIWA 3S9AA 1A61H 4GCHF 1DT2A 2WV4A 2ZF0H 7KMEH 3SV2H 3L3TA 4A1TA 1HJ8A 4ZHLU 3QZRA 2C8YB 2BXUH 3A8DA 2M5TA 1TFXA 3SV7A 3VPKA 2V6NA 3RXCA 2OCVB 3GY6A 2XW9A 3SU3A 2Y5HA 1HAPH 2Y5FA 1RTLA 1CA0C 1UTNA 6CHAC 4JZIA 1O3IA 1FQ3A 1P02A 1QA0A 1GL0E 3ZV9A 1ELAA 1XUFA 1UTMA 3Q3XA 3SHAH 1UHBB 1C2MA 2RA3A 2PKAA 4Y76A 5DP4A 1FMGA 1DITH 1O2SA 3OSYA 4A1VA 1W13U 3MFJA 1G32B 1INCA 3GDSA 3LGWA 1KLJH 4AGKA 4YM9A 3QWCH 1P04A 1T4UH 1HNEE 4Q2KA 1MQ5A 1QQUA 2HGTH 1D6RA 4JYVH 3U8OH 1ELEE 3Q77A 1O5BB 1BRAA 1O5FH 2QCYA 2QXJA 4X8VH 5E0HA 4B71A 1SOZA 3A82A 1Z71A 4GCHG 2BMGB 3M3SA 2IN2A 5GWZA 2SNWA 1PFXC 1NU9A 4AYYB 2VH0A 1DVAH 3RXMA 5FXLA 1LMWB 2GDEH 4TY6A 4WXVA 3M7UA 4H6SB 3LOXA 5HYOA 1IQJA 2HOBA 1EJMA 3LDXH 1AFQB 2ZCKP 1GHZA 1O2HA 4KELA 4ZKNU 1MZAA 3M7TA 1KYNA 1ZPCA 3A7TA 1LHCH 1IOEA 1P10A 1MTVA 4UFGH 4IW4E 4B75A 4RSPA 3RXGA 2A5KA 5TJXA 1D4PB 1ZTKA 1MH0A 2C8XB 1GBCA 2W7UA 2RG3A 3RXHA 1Y8TA 4AFQA 1AB9C 2CF9H 1C5MD 2J34A 2AGGX 4X6MA 1AI8H 2GV6A 1C1UH 2BZ6H 3RXQA 1C2JA 5T6FA 1PPGE 3A88A 2F9PA 2Z9IA 1F0UA 1TGSZ 2B8OH 3BTFE 2ZI2H 1MKWK 1C2FA 1Y5AT 4OS1A 3FVFB 4ZXYH 2PLXA 1F92A 4E7NA 1TB6H 4X8SH 4IBLH 2VGCB 1DSTA 4KP0A 1K1NA 2NWNA 1AIXH 1F0RA 3E1XB 3ZVFA 2PKSB 4IS5A 1RTFB 4BAKB 3KQDA 2BD9A 1E37B 1HAXB 4NCYA 1L1GA 1ZSLA 2ZDNA 1DSUA 3A84A 5FPYA 4ZXXH 3ENSB 2QV1A 2BD8A 2VINA 1O35A 2Z7FE 1O0DH 3NKKA 3LPRA 2BY7X 4B1TA 3BN9A 1F7ZA 4JK6A 1RGQA 4MNVA 5TCCA 3SNDA 1HAVB 2XBWA 4ASHA 2W3KA 2XC4A 4XBDA 2AMQA 3QK1A 1O5EH 3S69A 3UIRA 1F5LA 5E0JA 2AIPA 1NU7B 1GCTB 4CBNA 1QJ7B 1WSSH 1OWIA 3S7HB 4Y8YA 1QRZA 2OTVA 5HM9A 2UWOA 2VB0A 1FN8A 2BY9X 2GT7A 1TA6A 4I8GA 3ZZBA 3PO1B 2FLRH 3P8FA 4B76A 1HPGA 2R2WU 1TQ7B 3A8CA 1O3BA 5L2ZH 5CE1A 3HKJB 1PJPA 1GBTA 3SORA 2ZGCA 1V2JT 4BANB 2BM2A 3MI4A 1C1NA 4FUEA 1EASA 1BTWA 1DY9A 4XBCA 1NFUA 1V2UT 3VEQB 3W95A 1P9UA 2TBSA 4CRAA 3TGIE 1LVOA 1FI8A 1GHXH 4BTIB 4MPXA 1E34B 1RS0A 1V6DA 2AGIX 1OP0A 8ESTE 4FUDA 2R3UA 2FOFA 2STAE 2CV3A 3FFGA 1Z1JA 2A7CA 1ELCA 1O2XA 1WV7H 2SGQE 1GCDA 2FI4E 2F83A 1TBRH 1VCQA 3GCHC 2GZ7A 1IAUA 3JZ1B 2HVXA 2QN5T 3MH5A 3TNSA 3FZZA 4INLA 1TNGA 2HPQH 3F6UH 5LGOA 1KXBA 3TK9A 2BYAX 7GCHF 1O3DA 3UPEA 2BVSH 3UNSA 1YKTA 1YM0A 1EZUC 1PPFE 4I33A 2Q1JA 4D7FA 1XUIA 1LHEH 2FTLE 3RXRA 3K9XB 5C2ZA 1K1MA 1PQ7A 2FLBH 1O2YA 1KSNA 2FOEA 4DT7B 1QA7A 1P2MA 2VVUA 1SGFA 4Y6DA 3SGQE 1SG8B 3P17H 4O9VA 4AG1A 2ZG0H 3MNCA 1TX8A 1IQMA 3UNQA 4NGAH 3UUZA 1CHGA 1W12U 1GJ6A 3RXTA 3RM0H 1BCUH 2P16A 2XXLA 3PWBA 4FUJA 4NIVA 1DM4B 3URDA 1GVLA 1EB1H 4FUIA 2A31A 4NFEA 5EPYA 2SFAA 3KNXA 4PROA 4XBBA 2WV5A 3HGPA 4MTBA 1ELVA 4K1TA 6CHAB 1THSH 1DWEH 3A7XA 3RLWH 1O3OA 4UFEH 4VGCB 1MU6B 1GI0A 1CGJE 1P57B 1HCGA 3GOVB 4OS5A 3U98H 2A2QH 3RDZA 1OWDA 1HUTH 3AW1A 1JRSA 3DT0H 2ILNA 1GG6B 1GDUA 1VITG 2ZA5A 1P2OA 1FN6A 1ZMJA 1E38B 3VB7A 2FESH 1F5RA 4WMEA 1F0TA 1SFIA 3LGIA 4I8HA 3RU4D 5A8ZA 1CT2E 2ZQ1A 3GCOA 1D6WA 1VGCB 1MAYA 2CHAC 2G55A 5T6GA 2XBYA 4TPIZ 2B7DH 1SQOA 5DP7A 2ZO3H 2BLVA 2HNTC 6ESTA 3PTBA 3ZZ5A 4ABBA 2H9TH 4DG4A 3PYHA 5A2MH 1FUJA 1NTPA 4BOHA 2ZHWH 3SNAA 5LH8A 2BQWB 4NIWA 5AVDA 1O2WA 1QBVH 1OXGA 2Y82A 3PB1E 1WYKA 1M9UA 2BHGA 1GJ4H 1EP6A 1GWAA 1LPZB 3VFEA 3ATIA 5GCHF 3UFAA 5EW2H 3SUDA 3U8TH 4MPUA 1A0JA 1FXYA 5CHAB 4DIIH 2VIOA 1TX7A 3EA8A 2H9EH 1EPTC 1LCYA 1UTLM 2ZCHP 1AVGH 2WPMS 1LQDB 3UY9A 1HB0B 2Q6GA 1HJAC 1UK3A 4CH2B 1B7XB 1B5GH 1DICA 1QB9A 3STIA 1SMFE 3ZZ7A 3M3VA 1AZ8A 1O2IA 4DY7B 1P06A 1GJDB 2HALA 2K1QA 2OBQA 1NPMA 1C5RA 3MH7A 3MU4A 3PLPA 4NZQA 2B0FA 3SOSA 4Y10E 2GCHF 3A80A 1YF4A 2ZPSA 5LPEA 2Z9KA 3SUEA 4XFQA 8KME2 2BDIA 2EI6A 3GDUA 2BDBA 2IPHA 1SGNE 4X1NU 2SNVA 5EPNA 1AMHA 2YNAA 4OS2A 3U69H 1GBIA 3TVJB 1O2TA 1VITH 4ABAA 4GLYA 1ARCA 1TALA 3A8BA 3ATKA 1P0SH 1SLXB 3AVZA 2G52A 4Y11E 2VVVA 2VIDA 2D26C 3H7OA 1ABJH 2BD4A 4DJZB 1WCZA 4I8JA 1TQ0B 1OP2A 1GGDC 4NA9H 1IQFA 3PMHB 5BRRE 4Q7YA 3AASA 4I8LA 1BT7A 2OBOA 1NFWA 5DK1A 4GPGA 2O8MA 2VJ1A 1NRNH 3E8LA 3LJJA 1CU1A 1TNKA 1D3QB 1HIAA 2Y81A 2GGVB 1W2KH 1C2IA 1FPCH 2ZP0H 1N8OC 2G00A 3NUMA 4JZ1A 3M5MA 2AGEX 4DIHH 1KXDA 2GCHG 4SGAE 2BD2A 2GMTC 4X2YA 4Y7BA 1TA2A 4AOQA 1D9IA 2G4TA 3P8NA 4ABFA 5SGAE 5L30H 1EPTA 3F9FA 1ZPZA 1P11E 1HAHH 4KTUA 1D3DB 3H7TA 3MNXA 4JZDH 2ASUB 4X6PA 5JYIA 2NU3E 2ZDAH 2G4UA 2OXSA 3A8AA 2F9UA 1O2PA 4QT8C 1C1QA 1L1NA 3T27A 1XUJA 2OD3B 3BTQE 1ELDE 1G36A 2VIVA 1WAYB 3MTYA 1B0EA 2VH6A 1A3EH 3STJA 1V2OT 3OY5U 1D3PB 2FI3E 2CF8H 2P3TB 1SGDE 3MO6A 1PPEE 5EQRA 3MO3A 3LONA 1V2RT 1GI7B 1DWCH 1T31A 1XVMA 1FZZA 4WH6A 3KL6A 3RXIA 4BAOB 1SHHB 3RXOA 1DFPA 1QL8A 1V2MT 2J95A 2GCTB 4WMDA 2VWLA 4ISOA 1AU8A 3GY2A 1QQ4A 1X7AC 3LKWA 3MH4A 2P93A 2TPIZ 1QRXA 1YPEH 2B9LA 2ZECA 4ZHMU 1P9SA 3V7TA 1A4WH 3NK8A 1LTOA 4TYDA 1S0QA 3BIVH 3FAOA 3K65B 1P8VC 3RMOH 1TOMH 4GSOA 4K3JA 2P8OC 1UO6A 4I32A 1ZJDA 2FTMA 3OU0A 3FZDA 3RMLH 3E0NB 4ZUHA 2XBXA 4A92A 2BD3A 2PSXA 1HXFH 1N6XA 1N1LA 1YPLH 3D65E 1RFNA 1YPHC 4WJG2 3QTOH 1UMAH 1GL1A 1ELFA 1QJ1B 1SGTA 1V2PT 4Y7AA 3DFJA 3SU1A 1ZMLA 2C4FH 3P6ZB 2FXRA 2CXVA 4NWLA 3GCTG 1V2QT 3UOPA 1NROH 4ISLA 1GBAA 2GZ8A 1LHGH 1VCPA 1FAKH 1GBBA 4NA7A 3SV9A 1ZR0A 3RC5A 4ZKOU 2QF0A 5EG4A 1O3CA 2WYJA 4ABJA 3TK6A
chains in the Genus database with same CATH superfamily
1O3MA 1ARBA 2OC1A 1Z6JH 1WOFA 1MTUA 2H6MA 1J16A 3RXVA 2VIQA 3OY6U 1HXEH 5C1UA 4MNYA 3C27B 1HJ9A 1C1VH 2ZTZA 3F0OA 1HIAB 4X2VA 1FY4A 5HM2A 3SJOA 1C1WH 2RA0A 2SGFE 3MYWA 2DE8A 1VZQH 3SBKA 1S6HA 1FY3A 2VVCA 4F49A 4Y0YE 3K6YA 1P03A 4Q80A 3SUFA 3RC6A 3OTJE 1S81A 3E90B 1JRTA 3GY7A 1NRPH 4MG3A 3Q76A 5JBAS 2LPRA 1U6QA 4LK4A 2Z3CA 1BQYA 1GBFA 2AS9A 1TAWA 6GCHF 1AE5A 1BTXA 1NFYA 2PTNA 3UOUA 4HGCA 3GYMA 1XXFA 1C2KA 1OP8A 3KQCA 4H4FA 1GJBB 1FJSA 4X0WU 4R0IA 1AZZA 3EQ0H 2R3YA 2V3HH 4E7RG 1RD3B 3LGUA 5EIYA 3QLPH 3FOAA 5HXFA 2ZFRH 2F3CE 3KGPA 4OS6A 2CN0H 3T28A 5E2PA 1T4VH 3GYLB 1GBDA 1GHYH 1VR1H 1OWKA 3P95A 3EE0B 1WQSA 2A5AA 1E0FD 4JCNA 4YLQH 3U8RH 2ZFTA 1Y5UT 4YOJA 1S84A 2EC9H 1WBGB 1TRMA 2G51A 1V2VT 1DUEA 1GI3A 1W7XH 1BIOA 4TWWA 1NZQH 1XKBC 1SGEE 1HBTH 5DPAA 1A46H 1S83A 1BJUA 3B8JA 5EQQA 1GBMA 2WPLS 1TPSA 2ANYA 2ZU4A 2FS8A 3QN7A 4CHAC 1SKYE 3RXBA 9LPRA 1C1OA 4ZKRU 2H5DA 4FXGH 2BTCE 1QJ6B 6GCHG 2D2DA 5JBBS 1EXFA 4NZLA 2C3SA 4DCDA 3L33A 5DO4H 1AKSA 3ZV8A 2NU4E 1SBWA 4P00A 1WDIA 4O97A 1GMHF 2QXGA 1L4ZA 4A6LA 1SB1H 1QURH 1EB2A 3O8CA 1YY3A 1W11U 5IDKA 3T29A 3V3MA 1O31A 1GHWH 4CRFA 4IGDA 5ESBA 2IJD1 5C0UA 1PYTD 3QTVH 1W0KD 2WPKS 1H4WA 4BTUB 1TGBA 1FIWA 1O3EA 4WVPE 1P05A 4ESTE 4ISHH 1ZHPA 2EY4C 1A2CH 1ZGIA 1V2LT 4KGAA 2KFWA 1KXFA 2FOGA 2ZGHA 5KGOA 1NN6A 2BLOA 2HWLB 1OOKB 5EODA 2ALPA 1SOTA 1FIZA 1O2QA 1TMUH 1KTTB 2ZHQH 1K9OE 1EAXA 4OGYA 5EJLA 2VWNA 2Z6BD 1VKYA 1BMLA 1CE5A 5F8TA 3SQEE 1V2NT 2BQ7B 2ZDLA 4Y8ZA 4CREA 2CGAA 3UQOA 3ZVGA 5A0AE 1S6FA 2ZQ2A 5JB9S 1GI6A 1BHXF 1JBUH 1P2KA 5DP3A 2HNTE 1TWXB 4IN1A 1C5SA 1GI1A 1QZ8A 3K2UA 3VGCC 1O32A 3BEIB 3RXFA 4UFDH 4B2AA 4HZHA 4GHQA 2G81E 4LZ1H 3CENA 4CH8B 2JJ2D 2I6QA 2CJIA 4RKJB 2C93B 1O2KA 1DE7H 1ZYOA 2K8IA 4WMFA 3O8BA 5FAHA 4AYVB 1P12E 1BTUA 2FOAA 4ZH8A 3TNTA 2JETB 4TSFD 4XOJA 1EOJA 4ZHAA 2LNCA 4BNRA 1RIWB 1L4DA 1ESBA 3TITA 4Q63A 4AZ2B 2VNTA 5C5NA 2F9NA 3AAVA 2PKAB 1TNHA 1ABIH 1K1PA 1QGFA 1O37A 1PQ5A 2OUAA 2XTTB 1LPGB 1OX1A 1YWUA 2Y5GA 4X2WA 1C4Y2 1EZXC 1MCVA 4JYUH 3URCA 1XM1A 5EU8A 3SU6A 1ANBA 1O3KA 2THFB 3UQVA 3ZVEA 1K1OA 5DP5A 1ESAA 1K28D 2D1JA 2STBE 1QBNA 3BG4C 1IQHA 1G3DA 4KTCA 1SR5C 4XSKU 1H9IE 3FANA 1CVWH 2QY0B 1MTNB 2KAIA 2Z94A 3WY8A 2ZIQH 1FDPA 2PV9B 3EAJA 4AG2A 4DGJA 5EXLA 1YCPH 3V12A 5C3NA 3KQBA 1BRBE 1YBWA 2FP7B 2L74A 5AF9H 4FUCA 3SQHE 5H4IB 5FCKA 3TK5A 2BY5X 3KF2A 1H9LB 3U28C 4D9RA 1CBWC 1C1RA 4JMYA 2BZAA 2QYIA 2W5EA 4WH8A 1NBME 1C1SA 3GISB 3H09A 1QNJA 2J2UA 2ZTXA 1AKSB 1MD8A 1VJAU 1JIRA 1ELBA 2WYGA 1LPKB 1MKXK 4NFFA 3LH1A 3UNRA 5C67A 3QO6A 1JXPA 5AHGH 1EP5A 2O8LA 1TABE 2FIRH 4ZMAH 4A5TS 1CA0B 2HRVA 1O3NA 1O2NA 1O3PB 3RUOA 1HDTH 2GP9B 1CSOE 2ZFPH 2VWOA 2ANKH 4LOYH 3ZVDA 1DXWA 1W0ZU 5I46H 3T2NA 7GCHG 4K8BA 2UUKB 3SNEA 1V2WT 4KKDA 3O8RA 2NU2E 3GY4A 4MLFB 2YMSD 3FP7E 3PMJA 3MNBA 2WPHS 1PPHE 1Y3YA 3TJNA 1Y59T 2IJOB 2BQ6B 2PGQB 5EXNA 1H8IH 4HI3A 2P3UB 1GBHA 1L0ZA 5F53A 2UWLA 1BBRH 1J17T 1IQEA 3ZZDA 2SGDE 3P8GA 3R0FA 1Z7KA 2WUCA 1D3TB 2VWMA 3H5CB 3JZ2B 2Y80A 4TY7A 3PV2A 4OS4A 5TCAA 4X1QU 4MDSA 4XDEA 2LELA 4GVUA 5CMXH 5DG6A 4FVDA 1O3HA 1RXPA 3ATLA 4X1RU 4BAHB 1XVOA 1EKBB 4J2YB 2UWPA 2V3OH 4RN6A 3QGJA 3ODFA 1O2MA 2A4RA 2AH4X 1DWBH 3BEUA 3SO3A 2V35A 5K0HA 3PMAB 1GJCB 3M5LA 4NSVA 2BD7A 1FY1A 3OEHD 4AORA 5EXMA 1C2HA 1MCTA 1KMHB 2BX3A 4AN7A 1AB9B 3MU0A 1ZPBA 1GDQA 1H1BA 1SGIB 2AFQB 4DVAU 5ETXA 4E06H 1EZSC 2FWWA 2FOHA 1TPOA 3GY5A 3E6PH 1W14U 3HK3B 3ZZ6A 7ESTE 1C5XB 3S0NA 1UCYH 1O2JA 3I29A 3RU4T 1G3CA 6LPRA 2BB4A 1TONA 1BMNH 3I78A 3SJ8A 3SV6A 1PPCE 4YTAA 2IOTA 1TE0A 2P59A 3SI4H 3A87A 4XE4A 1A5HA 2EI7A 5DP8A 1ZLRA 1AE8H 1GI2A 2PSYA 4D76A 1ID5H 1FPHH 1CGHA 5EGMA 3SN8A 4GHTA 1AGJA 1EJAA 1UK2A 1GJ8B 1YPHE 3TU7H 3ZZ9A 2OK5A 1BRUP 3SNCA 4UFFH 1DLKB 1IQNA 1QHRB 3NWUA 2M2AA 3HPTB 1QL7A 2I6SA 4I7YH 1ZSKA 2QF4A 5B6LA 1YPKH 1JMOH 1BRCE 1C5LH 1HGTH 4B6FA 2BDGA 2FPZA 4YZUA 2R0KA 1EAIA 2WSSD 1P2JA 2YOLA 5GCHG 3RXEA 4JYTA 4ISNA 1BTPA 3BEFB 3E0PB 4Z6AH 3G01A 1G37A 3P70B 4AB8A 2XC5A 3VGCB 4X8UH 1O5AB 2VIPA 1Q3XA 1O30A 4FU9A 2XNIA 4X8TH 1WQVH 5ABWA 1C2GA 1ZSJA 4CRDA 3QX5H 1XUKA 2DUCA 2J98A 3MOCA 2O9QA 3MWIU 1AFQC 1MBQA 1UK4A 4AGJA 1IQKA 1BTZA 1W3CA 5E2OA 1AUJA 1C5VA 4F4OC 2NU0E 5T6DA 3CP7A 1ACBE 2XWBI 3WWFA 2FZZA 2O8TA 1AN1E 1BMFD 1T8NA 2FMJA 3SV8A 3SU5A 1V2TT 2EEKA 5FHTA 2W7SA 2ESTE 3MNSA 1DLEA 3BTKE 3ZVCA 1O33A 1S82A 3M35A 3MO9A 3TJUA 4M9FA 4THNH 1NM6A 4ABEA 1BDAA 2ZU1A 1DPOA 4Y79A 1O2ZA 4YOIA 3OE7D 4IC5A 1G2MA 2QIQA 1TBQH 4DW2U 2P95A 3GCHB 3TLOA 1GJ9B 3PLKA 4DURA 2VGCC 5FBEA 2ZU5A 3ODDA 4UE7H 2GJGA 4B74A 1SQRA 3TJVA 2WUBA 1KTSB 1T7CA 2PKSC 5I25A 7LPRA 1MMJN 1EZQA 4ACAA 2QF5A 1TNIA 3GS9A 1AVWA 3TIUA 1TMTH 2WPIS 2A7HA 3O8DA 3TGKE 1A5IA 1GBEA 1ZZZA 2J9NA 2QXHA 1Y5BT 4K60A 3TPIZ 4UD9H 3MU5A 3A7VA 5FCRA 1C5OH 2FM2A 2PUXB 1QRWA 2BY8X 1SSXA 2GD4B 3BTTE 1EATA 3P8OA 2SGPE 4I8KA 2Y7XA 1GVZA 3UTUH 1ORFA 1ZTJA 1SQTA 1SC8U 4DOQA 1AWHB 4FUGA 2G5VA 3B23B 1PQ8A 1XX9A 3EA7A 1OKXA 1TIOA 3UREA 1SGRE 4OGXA 1GCTC 3OX7U 5B6OA 1NESE 2ZPRA 3V13A 2P3FH 3HK6B 3PLBA 5E8EH 2ZFSA 2QAAA 1H8ED 1C2LA 1NO9H 3CS7A 1QL9A 1AFEH 3PO1C 5FX5A 2ZWLH 1ZTLA 1YGCH 1G3EA 1AWFH 4K2YA 1C2EA 1SLVB 4AC9A 2RCEA 3RXPA 1KIGH 1QFKH 4UONA 4HFPB 4K1SA 3BF6H 3A86A 3SW2B 2ZGJA 3K6ZA 4ABDA 1MTWA 1GHBF 1YPGH 3M5NA 2XCNA 4ZROA 2FS9A 2UUFB 2ODYB 4U32A 2Z9JA 5T1VA 1ZGVA 1T8MA 2ALVA 2BXTH 2VIWA 3T26A 3ZYEA 2HLCA 2ZHEH 1HFDA 2FI5E 4BXWA 2J5UA 5JBTA 2CHAB 3LGTA 4A1XA 2KCOA 3MH6A 3F9HA 3AAUA 1HYLA 3PROA 5CDFE 2Y7ZA 1RRKA 5A8XA 3F68H 5LPFA 3SUGA 2AEIH 1ZHRA 4AB9A 2QC2A 3BTGE 1Q31A 3BG8A 4NG9H 1DWDH 1KDQA 3OAAD 3F9EA 5C20A 3DFLA 1HV7A 2DE9A 2J98B 2A7JA 3GY8A 2A2XH 1IHSH 2P94A 1TOCB 4X1SU 4JZEH 4YESB 4U2WA 2WINI 1AO5A 4RI0A 4LXBH 2EQNA 1C5TA 1HAVA 1GHBG 1O3AA 1Z8IB 2GZ9A 1C2DA 4FVBA 1AD8H 3SNBA 3ATMA 3GY3A 4CR9A 3UR6A 1A0HB 1OS8A 4BXSA 1EPTB 2Z9GA 1JOUB 2F43B 4B2CA 1HJAB 3RXJA 2GX4A 1MKWH 2BDHA 3M7QA 2BOKA 2GTBA 3T5FH 4Z0KA 3RXLA 3UWJH 1F2SE 1F0SA 2C8WB 3BTEE 1SGYE 2AERH 1ZOMA 1C1TA 2BD5A 2OQUA 2TGAA 4WY3A 1C5PA 5JB8S 1GJ5H 1EAUA 3Q3KA 4VGCC 5A0CA 4YOGA 1J9CH 3TGJE 1PQAA 1O5GH 3ITIA 1QY6A 2TRMA 1QB1A 3M37A 2J94A 5FPSA 4UEHH 2BOHB 3MU8A 1GG6C 3HGNA 4Q7ZA 4DT4A 5E0GA 1LVYA 1KY9A 1O2VA 1BBRE 4IN2A 1Z6EA 3PTNA 3E16B 2A1DB 3ZZ4A 4JK5A 2ZCLP 4X6NA 4D9QA 5C1XA 4AFZA 1ESTA 1LVBA 2JIZD 1VGCC 5J4SA 3DHKH 1NRQH 1JIMA 1KLIH 1GGDB 3KIDU 5FX6A 3RC4A 1C5QA 1YLCA 1T8LA 2FOBA 2A4OA 2BLWA 1LKAA 2OC0A 1BJVA 1O5CB 1A3BH 1V3XA 1C5YB 4Y8XA 5C94A 2UUJB 1HLTH 1THRH 3E3TA 1N8OB 2ZGXH 3A7YA 3VB5A 3UWIA 2QGRA 5L6NH 3U1JB 2H5CA 2GMTB 2OC8A 2XOKD 1K0HA 1PYTC 4O3TA 2HPPH 2BVRH 1BA8B 1K2I1 1BZXE 4ASUD 4BTTB 1UCYE 1ZJKA 1UTKA 1TLDA 5DP6A 2XCFA 2JH5D 1OYQA 2J92A 4X2XA 1YP9A 2JDID 3QZQA 1O38A 1GMCF 3LGYA 4FUFA 2FEQH 2C8ZB 5GXPA 4E05H 4BAMB 4WF8A 1CO7E 1ELTA 1SVPA 3LGVA 3ATWA 4MQAA 4U30A 5A09A 1LDTT 5CHAC 1NC6A 3NCLA 3NXPA 1BTHH 2ANWA 2F9VA 3A85A 1P2IA 4Y0ZE 3SHCH 3RU4E 4O3UA 2ZGBH 1C1PA 1UVTH 4IC6A 1FONA 1FV9A 1XMNB 3CS0A 1DANH 1OWJA 2GV7A 2FYQA 2V0BA 3BIUH 5L2YH 3BSQA 1TMBH 2NU1E 3A83A 1TYNA 2AHME 3M61U 2LP6A 3SJ9A 3MU1A 3KCGH 2XWAA 4H6TA 1GDNA 1GJAB 3KEEA 1OWHA 2RDLA 2KCAA 2XC0A 3PWCA 5AFYH 3N7OA 3NRLA 2ZC9H 1C4V2 1SGFG 2ZEBA 1CQQA 1GMHG 4U01A 1KDQB 5JBCS 1W10U 1F5KU 1QIXB 3ZVBA 1XKAC 3RXKA 3Q3YA 4MVNA 2AIQA 5A0BA 4I86A 1QR3E 1LHFH 5JPMH 1ZHMA 4FU8A 4YXWD 1GMCG 3DUXH 5HKKD 4IMZA 1SLWB 2H1UA 3ZZ8A 2OQ5A 3ESTA 1SI5H 2BDYA 2PHBA 3E91A 1K1LA 3TH2H 1W8BH 2P8OB 2GKVE 1GHVH 1MKXH 3MMGA 4FETA 1O39A 5GJ4B 3KHVA 3QUMP 1C4U2 1OWEA 4CR5A 4M7GA 2W6JD 3Q00A 1MZDA 1C5ZB 2WPJS 3GCNA 1Q2WA 4ZKSU 2EI8A 1GI8B 1W0YH 1Y3VA 2A0QB 3M36A 1DX5M 1IQLA 1GBLA 1H9HE 2ZDMA 1G2LA 3LC3A 1MBMA 3HATH 1E79D 1TNLA 1Y3WA 3VB6A 1FLEE 1HAYB 1XXDA 1IQIA 1T32A 4WXIA 2BX4A 2FX4A 3N7DA 5F8ZA 5GIBA 1S85A 1AVXA 5DJ7A 2Q6FA 5GDSH 4YT7H 1CT4E 1C9PA 1S5SA 4A7IB 2FDAA 1J15A 5DP9A 5ESTE 2O8WA 1VCWA 4UDWH 2A45B 2B5TB 3RMNH 1K21H 3RP2A 2ZFQH 1L2EA 1AQ7A 2Q6DA 4D8NA 1K1JA 3SU0A 3QDZB 4AFSA 5IK2D 3EYDA 1OYTH 2JH0D 1BUIA 4O03A 3TH4H 5FBIA 4Q7XA 2C90B 3BV9B 3FP6E 1VITF 3C1KA 3NPSA 5AFZH 5A8YA 1UJ1A 1TGNA 2HNTF 2ZHFH 2JKHA 2XRCA 5C5OA 4JZFH 2OINA 4Y71A 1LKBA 1V2ST 1HAIH 1V2KT 1W0JD 1H8DH 3ZVAA 4YO9A 1Z1IA 2GCTC 1DY8A 3IG6B 4KTSA 1ANDA 4NWKA 1GBJA 1A0LA 3P92A 1GBKA 1LHDH 1UW7A 1TPAE 2Z9LA 3S7KB 1CA8B 1ELGA 2GT8A 3L6PA 1ZRBA 1RJXB 2YMSC 3LC5A 4TPYA 1NY22 1A7SA 2ZU3A 3LH3A 2TIOA 1SHYA 1BMMH 2OLGA 3SJKA 1MTSA 4MNWA 1MUEB 1YPJH 1P2NA 3NZIA 2ZHDA 5BPEA 2PFEA 1GI9B 1J8AA 3VG8A 1EQ9A 4GAWA 1EJNA 1UVPA 3U9AH 2GVFA 1A1RA 4MPWA 1OSSA 4X1PU 2ZDVH 4J1YA 4K69A 1O36A 1BITA 1HAGE 1OHHD 2SGAA 2KM0A 1P01A 4INKA 1A5GH 1BTYA 3RMMH 1AY6H 1QCPA 2R2MB 4CRGA 3UR9A 1LQEA 3OTPA 1YCPK 1S0RA 5EW1H 3PM3A 1FNIA 2A5IA 3SU4A 3EDXB 4CHAB 9ESTA 2J4IA 4AFUA 5F8XA 1FY5A 1SL3A 3RXDA 3RXAA 3ZZ3A 1HRTH 5HMAA 1JWTA 1YC0A 4LZ4B 4INHA 2XYAA 1Y3UA 2Z3DA 2TGTA 2ODQA 2F9OA 2ZTYA 2A4GA 3ZZCA 2Z3EA 1EOLA 2AMPA 3SJIA 2RFKC 4NIYA 1MAXA 1ANEA 1TNJA 2ZKSA 5GPIB 1GHAF 5EOKA 2H9HA 4K8YA 1J14A 1XUGA 1O3FA 1NRSH 3T25A 3SZNA 1TPPA 1NS3A 1AHTH 4ACBA 4ISIH 1NFXA 3SGBE 1GI4A 1MD7A 4FUHA 1FAXA 1P3EA 5G4BA 3LT3A 4D7GA 2FOCA 2QF3A 2KAIB 1ZRKA 2BLQA 1TBZH 3EE7A 2OC7A 3KYGA 3BTHE 2KX4A 1UVSH 4YT6H 1TRNA 2RDEA 2ANMH 1LO6A 1HAZB 4CRCA 1ZMNA 1G9IE 2SGEE 2QXIA 5T3HA 2FO9A 3SU2A 1GJ7B 2FODA 1DDJA 1Z8JB 1L1JA 1C1MA 1QB6A 1YCPM 1BBRK 2PW8H 2JH6D 2ZNKH 3F3BA 3D23A 4ZAEA 1ETSH 3VXEH 4NA8A 1Y3XA 2ZZUH 4GUXA 2W26A 1WTGH 2R9PA 3RXSA 2VU8E 2F9BH 3TJOA 3AK5A 2ZU2A 1GHAG 2FX6A 1CGIE 2R0LA 1EX3A 3LJOA 4I31A 1O34A 5LPRA 8GCHF 2OP9A 1UTPA 2F91A 3B9FH 4NIXA 1YLDA 2ODPA 5HGGA 3F2GA 3BTDE 1P3CA 4X6OA 2TGPZ 1WU1A 3DA9B 1WXRA 3U1IB 1GPZA 3A89A 2ZPQA 1NBMD 2K0QA 3M5OA 1DS2E 1SGCA 2D8WA 4MPVA 2PGBB 4TWYA 3TH3H 1W7GH 2J38A 1QTFA 1SGPE 1G3BA 3HKIB 2ZFFH 8LPRA 1UCYK 4B6EA 3F1SB 1MU8B 1KLTA 3BTME 1ANCA 1G30B 3IWMA 2ZDKA 1S6LA 2XNDD 3ZZAA 1Z8RA 1VJ9U 1CT0E 1SFQB 2V3MA 4CBOA 1NT1A 1BOQA 1Z8GA 3BG4B 1GMDF 3VB4A 1UTQA 1EFRD 2FOMB 1KXEA 4MNXA 1K22H 3SI3H 2BY6X 4K5ZA 2G8TA 5IYTA 1UHBA 1NRRH 3A7ZA 4RT1A 4YLUA 2BVXH 1C5UA 1N6YA 8GCHG 1BHXB 1SQAA 4CRBA 2WV9A 3AW0A 3VXFH 3IITA 3A7WA 1CHOF 3ELAH 2QA9E 1YLNA 1CBWB 3PMBB 5PTPA 3ZYDA 3M3TA 5DKMA 4SGBE 2FYRA 1O3GA 2CMYA 1KXAA 1UVUH 3FP8E 3KQEA 1HAOH 1C5NH 2UUYA 3T62A 1ETTH 4HTCH 4ABGA 1FY8E 1UTOA 2A32A 2YNBA 4XRNA 1KXCA 4OM9A 1WUNH 2Y6TA 1FX0B 2AYWA 3D49H 3PV5A 2WPDD 2BDCA 3QGNB 3RLYH 2TGDA 5EQSA 3V0XA 3GCTF 2A4QA 3A81A 4RKOB 5F6MA 3RM2H 1T8OA 1P09A 1PPBH 1MQ6A 4B2BA 1DXPA 1GMDG 1O2RA 1C9TA 3MHWU 1IQGA 2WZQA 2BDAA 1EAWA 2V7QD 1UVOA 1GI5A 1OPHB 3EGKH 3R3GB 1IHTH 1AUTC 3F9GA 5JDUB 2ULLA 1SGQE 2XBVA 1BMAA 1ETRH 1TGTA 4FU7A 1DOJA 2JETC 1GVKB 1WTHD 1E35B 3W94A 4BAQB 1RIWC 2H2ZA 1CHOG 5F03A 1XUHA 4K1EA 1O3LA 1P2QA 3EA9A 4OS7A 3VB3A 3PV4A 3S9CA 4ABHA 3SGAE 4NSYA 1QBOA 3KN2A 1EUFA 1PPZA 4FUBA 1TX6A 1O2GH 1SPJA 3WWBA 1O2LA 5FPTA 4ABIA 1O5DH 3GDVA 1UTJA 3LU9B 4R8TB 4IMQA 5DGJA 1BB0B 3OYPA 3D62A 2W3IA 1LVMA 1MTNC 1DUAA 3GICB 3S9BA 1B0FA 2PTCE 1THPB 3RXUA 1O2UA 1TRYA 1TGCA 4WWYA 2G5NA 2PR3A 4B73A 5K7RA 2PUQH 1YPMH 2EA3A 1YYY1 3DD2H 5DN6D 1C5WB 2AMDA 2PWXA 1RTKA 2GDDA 5C1YA 4AX9H 2CK3D 4H42U 3BTWE 1K1IA 5J4QA 3I77A 2O8UA 1SLUB 1E36B 1O3JA 1O2OA 3LIWA 3S9AA 1A61H 4GCHF 1DT2A 2WV4A 2ZF0H 7KMEH 3SV2H 3L3TA 4A1TA 1HJ8A 4ZHLU 3QZRA 2C8YB 2BXUH 3A8DA 2M5TA 1TFXA 3SV7A 3VPKA 2V6NA 3RXCA 2OCVB 3GY6A 3W1EA 4P02A 2XW9A 3SU3A 2Y5HA 1HAPH 2Y5FA 1RTLA 1CA0C 1UTNA 4TT3D 6CHAC 4JZIA 1O3IA 1FQ3A 1P02A 1QA0A 1GL0E 3OEED 3ZV9A 1ELAA 1XUFA 1UTMA 3Q3XA 3SHAH 1UHBB 1C2MA 2RA3A 2PKAA 4Y76A 5DP4A 2J97A 1FMGA 1DITH 1O2SA 3OSYA 4A1VA 1W13U 3MFJA 3PRBA 1G32B 1INCA 3GDSA 3LGWA 1KLJH 4AGKA 4YM9A 3QWCH 1P04A 1T4UH 2KCYA 1HNEE 1H8HD 3MQKC 2KZ4A 4Q2KA 1MQ5A 1QQUA 2HGTH 1D6RA 4JYVH 3U8OH 1ELEE 3Q77A 1O5BB 1BRAA 1O5FH 2QCYA 2QXJA 4X8VH 5E0HA 4B71A 1SOZA 3A82A 1Z71A 4GCHG 2BMGB 3M3SA 2IN2A 5GWZA 2SNWA 1PFXC 1NU9A 4AYYB 2VH0A 1DVAH 3RXMA 5FXLA 1LMWB 2GDEH 4TY6A 4WXVA 3M7UA 4H6SB 3LOXA 5HYOA 1IQJA 2HOBA 5EJZA 1EJMA 3LDXH 1AFQB 2ZCKP 1GHZA 1O2HA 4KELA 3PRDA 1E1RD 4ZKNU 1MZAA 2WHXA 3M7TA 1KYNA 3FKSD 1ZPCA 3A7TA 1LHCH 1IOEA 1P10A 1MTVA 4UFGH 4IW4E 4B75A 4RSPA 3RXGA 2A5KA 5TJXA 5EJ1A 1D4PB 1ZTKA 1MH0A 2C8XB 1GBCA 2W7UA 2RG3A 3RXHA 1Y8TA 4AFQA 1AB9C 2CF9H 1C5MD 2J34A 2AGGX 4X6MA 1AI8H 2GV6A 1C1UH 2BZ6H 3RXQA 1C2JA 5T6FA 1PPGE 3A88A 2F9PA 2Z9IA 1F0UA 1TGSZ 2B8OH 3BTFE 2ZI2H 5CHBA 1MKWK 1C2FA 1Y5AT 4OS1A 3FVFB 4ZXYH 2PLXA 3N99A 1F92A 4E7NA 1TB6H 4X8SH 4IBLH 2VGCB 1DSTA 4KP0A 1K1NA 2NWNA 1AIXH 1F0RA 3E1XB 3ZVFA 2PKSB 4IS5A 1RTFB 4BAKB 3KQDA 2BD9A 1E37B 1HAXB 4NCYA 1L1GA 1ZSLA 2ZDNA 1DSUA 3A84A 5FPYA 4ZXXH 3ENSB 2QV1A 2BD8A 2VINA 1O35A 2Z7FE 2KR7A 1O0DH 3NKKA 3LPRA 2BY7X 4B1TA 3BN9A 1F7ZA 4XD7D 4JK6A 3DCLA 1RGQA 3KYFA 4MNVA 5TCCA 3SNDA 1HAVB 2XBWA 4ASHA 2W3KA 2XC4A 4XBDA 2AMQA 3QK1A 1O5EH 3S69A 3UIRA 1F5LA 5E0JA 2AIPA 1NU7B 1GCTB 4CBNA 1QJ7B 1WSSH 1OWIA 3S7HB 4Y8YA 1QRZA 2OTVA 5HM9A 2UWOA 2VB0A 1FN8A 2BY9X 2GT7A 1TA6A 4I8GA 3ZZBA 3PO1B 2FLRH 3P8FA 4B76A 1HPGA 2R2WU 3F0PA 1TQ7B 3A8CA 1O3BA 5L2ZH 5CE1A 3HKJB 1PJPA 1GBTA 3SORA 2ZGCA 1V2JT 4BANB 2BM2A 3MI4A 1C1NA 4FUEA 1EASA 1BTWA 1DY9A 4XBCA 1NFUA 1V2UT 3VEQB 3W95A 1P9UA 2TBSA 4CRAA 2W6ID 3TGIE 1LVOA 1FI8A 1GHXH 4BTIB 4MPXA 1E34B 1RS0A 1V6DA 2AGIX 1OP0A 8ESTE 5FL7D 4FUDA 2R3UA 2FOFA 2STAE 2CV3A 2HLDD 1Z1JA 3FFGA 2A7CA 1ELCA 1O2XA 1WV7H 2SGQE 1GCDA 2FI4E 2F83A 1TBRH 1VCQA 3GCHC 2GZ7A 1IAUA 3FN8A 2HVXA 2QN5T 3JZ1B 3MH5A 3FZZA 3TNSA 5KEDA 4INLA 1TNGA 2HPQH 3F6UH 5LGOA 1KXBA 3TK9A 2BYAX 7GCHF 1O3DA 3UPEA 2BVSH 3UNSA 1YKTA 1YM0A 1EZUC 1PPFE 4I33A 2Q1JA 4D7FA 1XUIA 1LHEH 2FTLE 3RXRA 3K9XB 5C2ZA 1K1MA 1PQ7A 2FLBH 3DSOA 1O2YA 2F4LA 1KSNA 2FOEA 4DT7B 1QA7A 1P2MA 2VVUA 1SGFA 4Y6DA 2IPQX 3SGQE 1SG8B 3P17H 4O9VA 4AG1A 5GNDA 2ZG0H 3MNCA 1TX8A 1IQMA 3UNQA 4NGAH 3UUZA 1CHGA 1W12U 1GJ6A 3RXTA 3RM0H 1BCUH 2P16A 2XXLA 3PWBA 4FUJA 4NIVA 1DM4B 3URDA 1COWD 1GVLA 1EB1H 3F2FA 4FUIA 2A31A 4NFEA 5EPYA 2SFAA 3KNXA 4PROA 4XBBA 2WV5A 3HGPA 4MTBA 1ELVA 4K1TA 6CHAB 1THSH 1DWEH 3A7XA 1MABB 3RLWH 1O3OA 4UFEH 4VGCB 1MU6B 1GI0A 1CGJE 1P57B 1HCGA 3GOVB 4OS5A 3U98H 2A2QH 3RDZA 1OWDA 1HUTH 3AW1A 1JRSA 3DT0H 2ILNA 1GG6B 1GDUA 1VITG 2ZA5A 1P2OA 1FN6A 1ZMJA 1E38B 3VB7A 2FESH 1F5RA 4WMEA 1F0TA 1SFIA 3LGIA 4I8HA 3RU4D 5A8ZA 5HIYA 1CT2E 2ZQ1A 3GCOA 1D6WA 1VGCB 1MAYA 2CHAC 2G55A 5T6GA 2XBYA 4TPIZ 2B7DH 1SQOA 5DP7A 2ZO3H 2BLVA 2HNTC 6ESTA 3PTBA 3ZZ5A 4ABBA 3SZEA 2H9TH 4DG4A 3PYHA 5A2MH 1FUJA 1NTPA 4BOHA 2ZHWH 3SNAA 5LH8A 2BQWB 4NIWA 5AVDA 1O2WA 1QBVH 1OXGA 2Y82A 3PB1E 1WYKA 1M9UA 2BHGA 1GJ4H 1EP6A 1GWAA 1LPZB 3VFEA 3ATIA 5GCHF 3UFAA 5EW2H 3SUDA 3U8TH 4MPUA 1A0JA 1FXYA 5CHAB 3SYJA 4DIIH 2VIOA 1TX7A 3EA8A 2H9EH 1EPTC 1LCYA 1UTLM 2ZCHP 4ZCNA 1AVGH 3N7EA 3WW7A 2WPMS 1LQDB 3UY9A 1HB0B 2Q6GA 4RT0A 1HJAC 1UK3A 4CH2B 1B7XB 1B5GH 1DICA 1QB9A 3STIA 1SMFE 3ZZ7A 3M3VA 1AZ8A 1O2IA 4DY7B 1P06A 1GJDB 2HALA 2K1QA 2OBQA 1NPMA 2PP6A 1C5RA 3MH7A 3MU4A 3PLPA 4NZQA 2B0FA 3SOSA 4Y10E 2GCHF 3A80A 4F48B 1YF4A 2ZPSA 5LPEA 2Z9KA 3SUEA 4XFQA 8KME2 2BDIA 2EI6A 3GDUA 2BDBA 2IPHA 1SGNE 4X1NU 2SNVA 3DSPA 3UAIC 5EPNA 1AMHA 2YNAA 4OS2A 3U69H 4Q4LA 1GBIA 3TVJB 1O2TA 1VITH 4ABAA 4GLYA 1ARCA 1TALA 3A8BA 3ATKA 1P0SH 1SLXB 2HVYB 3AVZA 2G52A 4Y11E 2VVVA 2VIDA 2D26C 3H7OA 1ABJH 2BD4A 4DJZB 1WCZA 4F55A 4I8JA 1TQ0B 1OP2A 4Z1MD 1GGDC 4NA9H 1IQFA 3PMHB 5BRRE 4Q7YA 3AASA 4I8LA 2L6OA 1BT7A 2OBOA 1NFWA 5DK1A 4GPGA 2O8MA 2VJ1A 1NRNH 3E8LA 3LJJA 1CU1A 1TNKA 1D3QB 3ZIAD 5C17A 1HIAA 2Y81A 2GGVB 1W2KH 1C2IA 3FO8D 1FPCH 2ZP0H 1N8OC 2G00A 3NUMA 4JZ1A 3M5MA 2AGEX 4DIHH 1KXDA 2GCHG 4SGAE 2BD2A 2GMTC 4X2YA 4Y7BA 1TA2A 4AOQA 1D9IA 2G4TA 3P8NA 4ABFA 5SGAE 5L30H 1EPTA 3F9FA 1ZPZA 1P11E 1HAHH 4KTUA 1D3DB 3H7TA 3MNXA 4JZDH 2ASUB 4X6PA 5JYIA 2NU3E 2ZDAH 2G4UA 2OXSA 3A8AA 2KCPA 3KQ5A 2F9UA 1O2PA 4QT8C 1C1QA 1L1NA 3T27A 1XUJA 5KECA 2OD3B 3BTQE 1ELDE 1G36A 2VIVA 1WAYB 3MTYA 1B0EA 2VH6A 1A3EH 3STJA 1V2OT 3OY5U 1D3PB 2FI3E 2CF8H 2P3TB 1SGDE 3MO6A 1PPEE 5EQRA 3MO3A 3LONA 1V2RT 1GI7B 1DWCH 1T31A 1XVMA 1FZZA 4WH6A 3KL6A 2QE7D 3RXIA 4BAOB 1SHHB 3RXOA 1DFPA 1QL8A 1V2MT 2J95A 2GCTB 4WMDA 2VWLA 4ISOA 1AU8A 3GY2A 1QQ4A 1X7AC 3LKWA 3OFND 3MH4A 5DSFA 2P93A 2TPIZ 1E1QD 1QRXA 1YPEH 2B9LA 2ZECA 4ZHMU 1P9SA 3V7TA 1A4WH 2YMSB 3NK8A 1LTOA 4TYDA 1S0QA 3BIVH 3TK6A 3FAOA 3K65B 3UB0A 3F2HA 1P8VC 3RMOH 1TOMH 4GSOA 4K3JA 2P8OC 1UO6A 4I32A 1ZJDA 2FTMA 3OU0A 3FZDA 2VBCA 3RMLH 3E0NB 4ZUHA 2XBXA 3CNRA 2JJ1D 4A92A 2BD3A 2PSXA 1HXFH 1N6XA 1N1LA 3DSGA 1YPLH 3D65E 1RFNA 1YPHC 5HIZA 4WJG2 3QTOH 5C0TA 1UMAH 1GL1A 1ELFA 1QJ1B 1SGTA 1V2PT 4Y7AA 3DFJA 3SU1A 1ZMLA 2C4FH 3P6ZB 2FXRA 2CXVA 4NWLA 4FOUC 3GCTG 1V2QT 3UOPA 1NROH 4ISLA 1GBAA 2GZ8A 1LHGH 1VCPA 1FAKH 1GBBA 4NA7A 3SV9A 1ZR0A 3RC5A 4ZKOU 2QF0A 5EG4A 1O3CA 2WYJA 4ABJA 4HG6A
chains in the Genus database with same CATH topology
1O3MA 1ARBA 2OC1A 1Z6JH 1WOFA 1MTUA 2H6MA 1J16A 3RXVA 2VIQA 3OY6U 1HXEH 5C1UA 4MNYA 3C27B 1HJ9A 1C1VH 2ZTZA 1HIAB 4X2VA 1FY4A 5HM2A 3SJOA 1C1WH 2RA0A 2SGFE 3MYWA 2DE8A 1VZQH 3SBKA 1S6HA 1FY3A 2VVCA 4F49A 4Y0YE 3K6YA 1P03A 4Q80A 3SUFA 3RC6A 3OTJE 1S81A 3E90B 1JRTA 3GY7A 1NRPH 4MG3A 3Q76A 5JBAS 2LPRA 1U6QA 4LK4A 2Z3CA 1BQYA 1GBFA 2AS9A 1TAWA 6GCHF 1AE5A 1BTXA 1NFYA 2PTNA 3UOUA 4HGCA 3GYMA 1XXFA 1C2KA 1OP8A 3KQCA 4H4FA 1GJBB 1FJSA 4X0WU 4R0IA 1AZZA 3EQ0H 2R3YA 2V3HH 4E7RG 1RD3B 3LGUA 3QLPH 5HXFA 2ZFRH 2F3CE 3KGPA 4OS6A 2CN0H 3T28A 5E2PA 1T4VH 3GYLB 1GBDA 1GHYH 1VR1H 1OWKA 3P95A 3EE0B 1WQSA 2A5AA 1E0FD 4JCNA 4YLQH 3U8RH 2ZFTA 1Y5UT 4YOJA 1S84A 2EC9H 1WBGB 1TRMA 2G51A 1V2VT 1DUEA 1GI3A 1W7XH 1BIOA 4TWWA 1NZQH 1XKBC 1SGEE 1HBTH 5DPAA 1A46H 1S83A 1BJUA 3B8JA 5EQQA 1GBMA 2WPLS 1TPSA 2ANYA 2ZU4A 2FS8A 3QN7A 4CHAC 3RXBA 9LPRA 1C1OA 4ZKRU 2H5DA 4FXGH 2BTCE 1QJ6B 6GCHG 2D2DA 5JBBS 1EXFA 4NZLA 2C3SA 4DCDA 3L33A 5DO4H 1AKSA 3ZV8A 2NU4E 1SBWA 4O97A 1GMHF 2QXGA 1L4ZA 4A6LA 1SB1H 1QURH 1EB2A 3O8CA 1W11U 5IDKA 3T29A 3V3MA 1O31A 1GHWH 4CRFA 4IGDA 5ESBA 1PYTD 3QTVH 2WPKS 1H4WA 4BTUB 1TGBA 1FIWA 1O3EA 4WVPE 1P05A 4ESTE 4ISHH 1ZHPA 1A2CH 1ZGIA 1V2LT 4KGAA 1KXFA 2FOGA 2ZGHA 1NN6A 2BLOA 2HWLB 1OOKB 5EODA 2ALPA 1SOTA 1FIZA 1O2QA 1TMUH 1KTTB 2ZHQH 1K9OE 1EAXA 4OGYA 2VWNA 2Z6BD 1BMLA 1CE5A 5F8TA 3SQEE 1V2NT 2BQ7B 2ZDLA 4Y8ZA 4CREA 2CGAA 3UQOA 3ZVGA 5A0AE 1S6FA 2ZQ2A 5JB9S 1GI6A 1BHXF 1JBUH 1P2KA 5DP3A 2HNTE 1TWXB 4IN1A 1C5SA 1GI1A 3K2UA 3VGCC 1O32A 3BEIB 3RXFA 4UFDH 4B2AA 4HZHA 4GHQA 2G81E 4LZ1H 3CENA 4CH8B 2I6QA 2CJIA 4RKJB 2C93B 1O2KA 1DE7H 1ZYOA 4WMFA 3O8BA 5FAHA 4AYVB 1P12E 1BTUA 2FOAA 4ZH8A 3TNTA 2JETB 4XOJA 1EOJA 4ZHAA 2LNCA 4BNRA 1RIWB 1L4DA 1ESBA 3TITA 4AZ2B 2VNTA 5C5NA 2F9NA 3AAVA 2PKAB 1TNHA 1ABIH 1K1PA 1QGFA 1O37A 1PQ5A 2OUAA 2XTTB 1LPGB 1OX1A 2Y5GA 4X2WA 1C4Y2 1EZXC 1MCVA 4JYUH 3URCA 1XM1A 5EU8A 3SU6A 1ANBA 1O3KA 2THFB 3UQVA 3ZVEA 1K1OA 5DP5A 1ESAA 1K28D 2D1JA 2STBE 1QBNA 3BG4C 1IQHA 1G3DA 4KTCA 1SR5C 4XSKU 1H9IE 3FANA 1CVWH 2QY0B 1MTNB 2KAIA 2Z94A 3WY8A 2ZIQH 1FDPA 2PV9B 3EAJA 4AG2A 4DGJA 5EXLA 1YCPH 3V12A 5C3NA 3KQBA 1BRBE 1YBWA 2FP7B 5AF9H 4FUCA 3SQHE 5H4IB 5FCKA 3TK5A 2BY5X 3KF2A 1H9LB 4D9RA 1CBWC 1C1RA 4JMYA 2BZAA 2QYIA 2W5EA 4WH8A 1C1SA 3GISB 1QNJA 2J2UA 2ZTXA 1AKSB 1MD8A 1VJAU 1JIRA 1ELBA 2WYGA 1LPKB 1MKXK 4NFFA 3LH1A 3UNRA 5C67A 3QO6A 1JXPA 5AHGH 1EP5A 2O8LA 1TABE 2FIRH 4ZMAH 4A5TS 1CA0B 2HRVA 1O3NA 1O2NA 1O3PB 3RUOA 1HDTH 2GP9B 1CSOE 2ZFPH 2VWOA 2ANKH 4LOYH 3ZVDA 1DXWA 1W0ZU 5I46H 3T2NA 7GCHG 4K8BA 2UUKB 3SNEA 1V2WT 4KKDA 3O8RA 2NU2E 3GY4A 4MLFB 3FP7E 3PMJA 3MNBA 2WPHS 1PPHE 1Y3YA 3TJNA 1Y59T 2IJOB 2BQ6B 2PGQB 5EXNA 1H8IH 4HI3A 2P3UB 1GBHA 1L0ZA 2UWLA 1BBRH 1J17T 1IQEA 3ZZDA 2SGDE 3P8GA 3R0FA 1Z7KA 2WUCA 1D3TB 2VWMA 3H5CB 3JZ2B 2Y80A 4TY7A 4OS4A 5TCAA 4X1QU 4MDSA 4XDEA 4GVUA 5CMXH 5DG6A 4FVDA 1O3HA 1RXPA 3ATLA 4X1RU 4BAHB 1XVOA 1EKBB 4J2YB 2UWPA 2V3OH 4RN6A 3QGJA 3ODFA 1O2MA 2A4RA 2AH4X 1DWBH 3BEUA 3SO3A 2V35A 5K0HA 3PMAB 1GJCB 3M5LA 4NSVA 2BD7A 1FY1A 4AORA 5EXMA 1C2HA 1MCTA 2BX3A 4AN7A 1AB9B 3MU0A 1ZPBA 1GDQA 1H1BA 1SGIB 2AFQB 4DVAU 5ETXA 4E06H 1EZSC 2FWWA 2FOHA 1TPOA 3GY5A 3E6PH 1W14U 3HK3B 3ZZ6A 7ESTE 1C5XB 3S0NA 1UCYH 1O2JA 3I29A 3RU4T 1G3CA 6LPRA 2BB4A 1TONA 1BMNH 3I78A 3SJ8A 3SV6A 1PPCE 4YTAA 2IOTA 1TE0A 2P59A 3SI4H 3A87A 4XE4A 1A5HA 2EI7A 5DP8A 1ZLRA 1AE8H 1GI2A 2PSYA 4D76A 1ID5H 1FPHH 1CGHA 5EGMA 3SN8A 4GHTA 1AGJA 1EJAA 1UK2A 1GJ8B 1YPHE 3TU7H 3ZZ9A 1BRUP 3SNCA 4UFFH 1DLKB 1IQNA 1QHRB 3NWUA 3HPTB 1QL7A 2I6SA 4I7YH 1ZSKA 1YPKH 1JMOH 1BRCE 1C5LH 1HGTH 2BDGA 2FPZA 4YZUA 2R0KA 1EAIA 1P2JA 2YOLA 5GCHG 3RXEA 4JYTA 4ISNA 1BTPA 3BEFB 3E0PB 4Z6AH 3G01A 1G37A 3P70B 4AB8A 2XC5A 3VGCB 4X8UH 1O5AB 2VIPA 1Q3XA 1O30A 4FU9A 2XNIA 4X8TH 1WQVH 5ABWA 1C2GA 1ZSJA 4CRDA 3QX5H 1XUKA 2DUCA 3MOCA 2O9QA 3MWIU 1AFQC 1MBQA 1UK4A 4AGJA 1IQKA 1BTZA 1W3CA 5E2OA 1AUJA 1C5VA 4F4OC 2NU0E 5T6DA 3CP7A 1ACBE 2XWBI 2FZZA 2O8TA 1AN1E 1T8NA 2FMJA 3SV8A 3SU5A 1V2TT 2EEKA 5FHTA 2W7SA 2ESTE 3MNSA 1DLEA 3BTKE 3ZVCA 1O33A 1S82A 3M35A 3MO9A 3TJUA 4THNH 1NM6A 4ABEA 1BDAA 2ZU1A 1DPOA 4Y79A 1O2ZA 4YOIA 4IC5A 1G2MA 2QIQA 1TBQH 4DW2U 2P95A 3GCHB 3TLOA 1GJ9B 3PLKA 4DURA 2VGCC 5FBEA 2ZU5A 3ODDA 4UE7H 4B74A 3TJVA 2WUBA 1KTSB 1T7CA 2PKSC 5I25A 7LPRA 1MMJN 1EZQA 1TNIA 1AVWA 3TIUA 1TMTH 2WPIS 2A7HA 3O8DA 3TGKE 1A5IA 1GBEA 1ZZZA 2J9NA 2QXHA 1Y5BT 4K60A 3TPIZ 4UD9H 3MU5A 3A7VA 5FCRA 1C5OH 2FM2A 2PUXB 1QRWA 2BY8X 1SSXA 2GD4B 3BTTE 1EATA 3P8OA 2SGPE 4I8KA 2Y7XA 1GVZA 3UTUH 1ORFA 1ZTJA 1SQTA 1SC8U 4DOQA 1AWHB 4FUGA 2G5VA 3B23B 1PQ8A 1XX9A 3EA7A 1OKXA 1TIOA 3UREA 1SGRE 4OGXA 1GCTC 3OX7U 5B6OA 1NESE 2ZPRA 3V13A 2P3FH 3HK6B 3PLBA 5E8EH 2ZFSA 2QAAA 1C2LA 1NO9H 3CS7A 1QL9A 1AFEH 3PO1C 5FX5A 2ZWLH 1ZTLA 1YGCH 1G3EA 1AWFH 4K2YA 1C2EA 1SLVB 2RCEA 3RXPA 1KIGH 1QFKH 4UONA 4HFPB 4K1SA 3BF6H 3A86A 3SW2B 2ZGJA 3K6ZA 4ABDA 1MTWA 1GHBF 1YPGH 3M5NA 2XCNA 4ZROA 2FS9A 2UUFB 2ODYB 4U32A 2Z9JA 1ZGVA 1T8MA 2ALVA 2BXTH 2VIWA 3T26A 3ZYEA 2HLCA 2ZHEH 1HFDA 2FI5E 4BXWA 5JBTA 2CHAB 3LGTA 4A1XA 3MH6A 3F9HA 3AAUA 1HYLA 3PROA 2Y7ZA 1RRKA 5A8XA 3F68H 5LPFA 3SUGA 2AEIH 1ZHRA 4AB9A 2QC2A 3BTGE 1Q31A 3BG8A 4NG9H 1DWDH 1KDQA 3F9EA 5C20A 3DFLA 1HV7A 2DE9A 2A7JA 3GY8A 2A2XH 1IHSH 2P94A 1TOCB 4X1SU 4JZEH 4YESB 4U2WA 2WINI 1AO5A 4LXBH 1C5TA 1HAVA 1GHBG 1O3AA 1Z8IB 2GZ9A 1C2DA 4FVBA 1AD8H 3SNBA 3ATMA 3GY3A 4CR9A 3UR6A 1A0HB 1OS8A 4BXSA 1EPTB 2Z9GA 1JOUB 4B2CA 1HJAB 3RXJA 2GX4A 1MKWH 2BDHA 3M7QA 2BOKA 2GTBA 3T5FH 4Z0KA 3RXLA 3UWJH 1F2SE 1F0SA 2C8WB 3BTEE 1SGYE 2AERH 1ZOMA 1C1TA 2BD5A 2OQUA 2TGAA 4WY3A 1C5PA 5JB8S 1GJ5H 1EAUA 3Q3KA 4VGCC 5A0CA 4YOGA 1J9CH 3TGJE 1PQAA 1O5GH 3ITIA 1QY6A 2TRMA 1QB1A 3M37A 2J94A 5FPSA 4UEHH 2BOHB 3MU8A 1GG6C 3HGNA 4Q7ZA 5E0GA 1LVYA 1KY9A 1O2VA 1BBRE 4IN2A 1Z6EA 3PTNA 3E16B 2A1DB 3ZZ4A 4JK5A 2ZCLP 4X6NA 4D9QA 5C1XA 4AFZA 1ESTA 1LVBA 1VGCC 5J4SA 3DHKH 1NRQH 1JIMA 1KLIH 1GGDB 3KIDU 5FX6A 3RC4A 1C5QA 1YLCA 1T8LA 2FOBA 2A4OA 2BLWA 1LKAA 2OC0A 1BJVA 1O5CB 1A3BH 1V3XA 1C5YB 4Y8XA 2UUJB 1HLTH 1THRH 3E3TA 1N8OB 2ZGXH 3A7YA 3VB5A 3UWIA 2QGRA 5L6NH 3U1JB 2H5CA 2GMTB 2OC8A 1PYTC 4O3TA 2HPPH 2BVRH 1BA8B 1K2I1 1BZXE 4BTTB 1UCYE 1ZJKA 1UTKA 1TLDA 5DP6A 2XCFA 2JH5D 1OYQA 2J92A 4X2XA 1YP9A 4FUFA 3QZQA 1O38A 1GMCF 3LGYA 2FEQH 2C8ZB 5GXPA 4E05H 4BAMB 4WF8A 1CO7E 1ELTA 1SVPA 3LGVA 3ATWA 4MQAA 4U30A 5A09A 1LDTT 5CHAC 1NC6A 3NCLA 3NXPA 1BTHH 2ANWA 2F9VA 3A85A 1P2IA 4Y0ZE 3SHCH 3RU4E 4O3UA 2ZGBH 1C1PA 1UVTH 4IC6A 1FONA 1FV9A 1XMNB 3CS0A 1DANH 1OWJA 2GV7A 2FYQA 2V0BA 3BIUH 5L2YH 3BSQA 1TMBH 2NU1E 3A83A 1TYNA 3M61U 3SJ9A 3MU1A 3KCGH 2XWAA 4H6TA 1GDNA 1GJAB 3KEEA 1OWHA 2RDLA 2XC0A 3PWCA 5AFYH 3N7OA 2ZC9H 1C4V2 1SGFG 2ZEBA 1CQQA 1GMHG 4U01A 1KDQB 5JBCS 1W10U 1F5KU 1QIXB 3ZVBA 1XKAC 3RXKA 3Q3YA 4MVNA 2AIQA 5A0BA 1QR3E 1LHFH 5JPMH 1ZHMA 4FU8A 1GMCG 3DUXH 4IMZA 1SLWB 2H1UA 3ZZ8A 2OQ5A 3ESTA 1SI5H 2BDYA 2PHBA 3E91A 1K1LA 3TH2H 2P8OB 1W8BH 2GKVE 1GHVH 1MKXH 3MMGA 1O39A 5GJ4B 3KHVA 3QUMP 1C4U2 1OWEA 4CR5A 4M7GA 3Q00A 1MZDA 1C5ZB 2WPJS 3GCNA 1Q2WA 4ZKSU 2EI8A 1GI8B 1W0YH 1Y3VA 2A0QB 3M36A 1DX5M 1IQLA 1GBLA 1H9HE 2ZDMA 1G2LA 3LC3A 1MBMA 3HATH 1TNLA 1Y3WA 3VB6A 1FLEE 1HAYB 1XXDA 1IQIA 1T32A 4WXIA 2BX4A 2FX4A 5F8ZA 5GIBA 1S85A 1AVXA 5DJ7A 2Q6FA 5GDSH 4YT7H 1CT4E 1C9PA 1S5SA 4A7IB 2FDAA 1J15A 5DP9A 5ESTE 2O8WA 1VCWA 4UDWH 2A45B 2B5TB 3RMNH 1K21H 3RP2A 2ZFQH 1L2EA 1AQ7A 2Q6DA 4D8NA 1K1JA 3SU0A 3QDZB 4AFSA 3EYDA 1OYTH 2JH0D 1BUIA 4O03A 3TH4H 5FBIA 4Q7XA 2C90B 3BV9B 3FP6E 1VITF 3C1KA 3NPSA 5AFZH 5A8YA 1UJ1A 1TGNA 2HNTF 2ZHFH 2JKHA 2XRCA 5C5OA 4JZFH 2OINA 4Y71A 1LKBA 1V2ST 1HAIH 1V2KT 1H8DH 3ZVAA 4YO9A 1Z1IA 2GCTC 1DY8A 3IG6B 4KTSA 1ANDA 4NWKA 1GBJA 1A0LA 3P92A 1GBKA 1LHDH 1TPAE 2Z9LA 3S7KB 1CA8B 1ELGA 2GT8A 3L6PA 1ZRBA 1RJXB 3LC5A 4TPYA 1NY22 1A7SA 2ZU3A 3LH3A 2TIOA 1SHYA 1BMMH 2OLGA 3SJKA 1MTSA 4MNWA 1MUEB 1YPJH 1P2NA 3NZIA 2ZHDA 5BPEA 2PFEA 1GI9B 1J8AA 1EQ9A 4GAWA