1SGFA

Crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
228
structure length
203
Chain Sequence
NSQPWHVAVYRFNKYQCGGVLLDRNWVLTAAHCYNDKYQVWLGKEEPSDQHRLVSKAIPHPDFNMSLLPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKLGSTCLASICVNLKLLPNEDCDKAHEMKVTDAMLCAGEMDGGSYTCEHDSGGPLICDGILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMANNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of mouse 7S NGF: a complex of nerve growth factor with four binding proteins.
pubmed doi rcsb
molecule tags Growth factor
molecule keywords NERVE GROWTH FACTOR
total genus 36
structure length 203
sequence length 228
chains with identical sequence X
ec nomenclature
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgfA01
3P6ZB 2ODYB 1QL8A 1AQ7A 1C1PA 1E38B 3KHVA 3RXEA 1BTWA 1EP5A 2JETC 5BRRE 2ZEBA 8GCHF 5HGGA 1O2TA 5A2MH 4I31A 2AS9A 3T26A 2A2QH 1C2DA 1GBDA 1Z7KA 4K8YA 2OD3B 3ATMA 5C67A 4X6PA 2XTTB 4H6TA 2BDGA 4Q2KA 3SV6A 2OC0A 1KXDA 1HUTH 3RXTA 2P3UB 1CT2E 3A8CA 3LH1A 3GY2A 2Q6DA 3T28A 4ZKNU 1THSH 3NZIA 2BDYA 5DP8A 4CH8B 2V3HH 3D62A 1ZHMA 3HATH 2FOCA 4OS1A 5F8XA 2ZA5A 8KME2 1OS8A 1GI7B 3HGNA 4Q7YA 1QGFA 1Z6JH 4WMEA 2FI5E 3BIUH 1GCTB 4KGAA 4WVPE 3KL6A 5DK1A 2BY5X 2ZU2A 1BMAA 1PFXC 3RXRA 3A80A 3SGAE 1SGFG 1C1RA 4THNH 4NIYA 1BOQA 1UTJA 1YCPK 2AIPA 4GCHG 4D9QA 3GY3A 1ABIH 4IW4E 3TK9A 1LVYA 2PW8H 3EQ0H 2I6SA 3TIUA 1GG6B 1GBJA 3VB7A 2Z9GA 5JYIA 2GT8A 4LXBH 3F9GA 3GOVB 1G2LA 3SHCH 3SUDA 1YYY1 4YT6H 1C2GA 1UTLM 3LOXA 4O9VA 1ANEA 2BVXH 1KYNA 1UCYH 8LPRA 1T8OA 1W7XH 1AVWA 1HAOH 1P3EA 1WTGH 1W8BH 3HGPA 1G3DA 3U69H 2ZFSA 2XC0A 3RLYH 3ITIA 4YLQH 1BTZA 1DSUA 2PWXA 2YNAA 1T8MA 1BBRH 1MCVA 1ZHRA 2ZECA 1TAWA 1KLTA 4D8NA 4F4OC 1V3XA 4ZHMU 3GDVA 1GBAA 2C3SA 3W95A 1DS2E 1SMFE 1DE7H 3PM3A 3TH3H 4JYTA 2ZDMA 1SLUB 4I8GA 1NY22 1IHTH 1XMNB 4NZLA 3TPIZ 2Z7FE 4Y6DA 2UWLA 6GCHG 5DP9A 1GHYH 4X1RU 4LZ1H 1ZMJA 1L1JA 1HAVA 1A7SA 2VINA 2QA9E 2J2UA 3EA7A 4K1SA 2BDCA 3LGVA 3UY9A 3ZZAA 1CA0C 2OC8A 1GI1A 1HIAA 1FPCH 1UTNA 1O2MA 2BVSH 3BTWE 5A0AE 1DUEA 2F83A 1BHXB 2QIQA 1PPCE 5EXNA 3KQCA 5B6OA 5DP6A 4NZQA 4CREA 1YBWA 2H9HA 1SGCA 1GJ6A 1ANBA 1GMHF 3T5FH 1AD8H 2G8TA 2VGCB 1YCPM 3LJJA 1VGCB 1DM4B 4ABIA 1HBTH 1DXWA 5EQRA 1OWHA 5FBIA 4BTUB 1O5EH 2UWOA 3A7WA 3TK5A 4IC5A 1GBCA 1UTPA 2BY6X 3CS0A 2BB4A 4HGCA 2ALPA 1ELVA 4X2VA 3RXVA 4DVAU 1C2FA 3UWIA 1B0EA 2B8OH 4E05H 2FS8A 1K1OA 1Y5UT 3PMBB 4MPWA 5CMXH 1MH0A 1QURH 3NXPA 1OXGA 1GBTA 1SQTA 3RC4A 2SGQE 1QTFA 2PV9B 1C5SA 3AASA 5T6DA 2DUCA 4O3UA 3M7TA 1S0QA 1O2OA 2QF0A 1N8OC 2P59A 1O5AB 5L30H 2FTMA 4F49A 1YPLH 5JB8S 3BSQA 2W26A 1SHHB 3SU0A 1ZSLA 2ZHFH 3P8FA 1ARBA 3K2UA 1YM0A 4ZHAA 5AF9H 1GJAB 5ESBA 4OS2A 2W7UA 3FZDA 3SZNA 3MFJA 3S9CA 4WXIA 1BTHH 2OQUA 4BTIB 2EI7A 4Y71A 1C1VH 2BLQA 1ZSKA 1O3CA 1AZ8A 2PTNA 1AU8A 1XKAC 4JZDH 1OSSA 1U6QA 4CHAC 5T6FA 4A6LA 3B8JA 3A7YA 3P8GA 4WH6A 1O36A 2VIOA 3K6YA 4GAWA 2BY8X 2FESH 1UTKA 5A8YA 1UVUH 3RXOA 3BEIB 2BD9A 4OS6A 1KXCA 5DGJA 5F03A 1SGFA 5C5NA 1O34A 3BIVH 3M37A 1E0FD 1WUNH 4O03A 3SU5A 1B0FA 1OP8A 1MBMA 1EJMA 1PPBH 4O3TA 2NU4E 1S0RA 1EZUC 4Y11E 6CHAC 1C2EA 1KXAA 5SGAE 1P9UA 1UHBA 3GISB 4WMFA 5E2PA 2ZKSA 4LK4A 3ZVAA 1RGQA 2BM2A 1LHEH 2FS9A 1CO7E 1RIWC 2G4UA 2R3YA 4IS5A 1OWKA 5FBEA 1W14U 1O38A 5GPIB 2AERH 2FP7B 1H1BA 1WSSH 2A4GA 2Y80A 2OTVA 3EAJA 5F8ZA 1HV7A 1BMNH 3ATKA 2VH0A 3O8BA 4A7IB 4X6MA 4VGCC 1NS3A 2V35A 2Y5GA 2YOLA 1SGTA 1G3BA 3PB1E 2LNCA 5C5OA 3SJIA 1GJ9B 1YP9A 3ZVBA 2NU1E 4U32A 3GCTF 2BMGB 3HPTB 3AW1A 2AGEX 2TGPZ 1C5NH 5I25A 1MTNB 3LU9B 3PLBA 4GCHF 4X8VH 1P57B 3SV8A 2ZFTA 1KXEA 2XNIA 3RXQA 4ASHA 1O2IA 1ZSJA 2GD4B 1EB1H 2VIVA 2R0LA 3STJA 4E7RG 4HZHA 2GMTB 2FI3E 4X1QU 4Z0KA 5JBCS 3ZVFA 3P70B 1IOEA 3DFJA 3EA8A 3MNBA 5L2ZH 1RXPA 1N8OB 1AFQC 3ESTA 1WCZA 4RN6A 2A4QA 2WPKS 3M7QA 1V2NT 1QCPA 2JH5D 2ZC9H 1AWHB 3PYHA 1XUHA 1ESTA 5EPYA 4X8UH 4J1YA 2C93B 2ZPQA 1HAHH 1V2VT 1GBIA 2FOMB 2BQ6B 2F91A 4A5TS 5DO4H 1DICA 2OP9A 1ESBA 2BXTH 1OOKB 1FV9A 3GY5A 4O97A 5EODA 5JB9S 1DT2A 1GI3A 2FWWA 2G00A 1EASA 1YPMH 1AB9B 3PMHB 1C5QA 2ZG0H 3GCOA 3GCHC 2OC1A 2Q6GA 3QTVH 1ZPCA 4AYYB 2GZ8A 1ZMLA 1GCDA 3U98H 1M9UA 3E3TA 4GPGA 1PQAA 5EGMA 1O2RA 2QN5T 1QBOA 2FLRH 1NRSH 5EW2H 1Y5AT 1GJDB 4IGDA 1OKXA 4CBOA 4ISHH 2GCHG 1TMTH 1THRH 2BD2A 1IQNA 3U8RH 2Y7XA 1SFIA 5LPEA 1SHYA 1ZPBA 1WQSA 4INHA 2Y7ZA 4IMZA 3TVJB 2GDDA 2GT7A 3P92A 3RXHA 1FIWA 3GCHB 3M36A 1QB1A 1Y3WA 1HIAB 1GVZA 4FVBA 1LO6A 1NPMA 1S85A 1V2JT 2GX4A 4Y10E 4DY7B 1GI8B 2C8XB 2HWLB 4U2WA 2GCHF 2PTCE 4AGKA 1C1QA 3RXDA 2BD8A 2ZCKP 7ESTE 1C1UH 2PKAA 1ESAA 3RMOH 4MPVA 2P93A 1GBBA 3VB6A 2FDAA 4FUBA 1KDQA 1WYKA 1GHZA 2B0FA 2BZ6H 2R2WU 2WPLS 2ZTXA 2BD4A 4MDSA 3QZQA 1O5CB 1JRSA 1BJVA 1Z8JB 1TRYA 2C4FH 5GCHF 2AEIH 3MOCA 1P2KA 1O2ZA 2WPJS 1TPPA 1O2GH 3A8BA 4I8JA 1WU1A 1OPHB 1SR5C 2SNWA 1PQ7A 3NKKA 3TH2H 2P3FH 4H42U 4JYVH 2AFQB 1GHAF 1T4UH 3A82A 4CH2B 3M5LA 2CHAC 3UTUH 4Q7XA 1V2ST 1O2QA 3KQDA 4CRBA 4B74A 1LTOA 2O8MA 1W3CA 1F0SA 1TIOA 5FPTA 4WMDA 1GI5A 1BRBE 1HDTH 1TNLA 5T6GA 2RA0A 2FLBH 4XDEA 1Q31A 3M5MA 3PROA 1LPZB 1RFNA 5EU8A 2EI8A 2Q1JA 4B75A 1LCYA 6GCHF 2BYAX 2FEQH 2TGDA 4AFQA 1D3PB 1SBWA 1SB1H 1KTSB 1G2MA 3UOPA 1BRUP 2Z3DA 1Z1JA 3MNSA 2ILNA 4ZROA 3A7ZA 1EAXA 4TYDA 3ZZ3A 1BTXA 3G01A 2Z9LA 1GJ5H 2KAIA 2FYRA 1KLIH 1C5ZB 1VCWA 2PKSB 4CRAA 3UNSA 1BBRE 1ZHPA 2XCNA 2SGDE 3U1JB 2GV7A 1A5IA 3ZV8A 1X7AC 1SQAA 4D7FA 4KKDA 2TIOA 4AB9A 5AFYH 2V6NA 1GG6C 3LKWA 4NIVA 1AKSA 2A5KA 4ABEA 3URCA 3MHWU 2ZTYA 1ETTH 2AMDA 1G37A 3T27A 4YOGA 1RTFB 4XSKU 3SUEA 3I29A 1SPJA 2XBWA 2ZQ2A 3FANA 2XWBI 3GCNA 1RD3B 2WV5A 2PGBB 4X6OA 1O5BB 1FLEE 3MH7A 1B5GH 1O5DH 4ZKSU 3RXAA 3V13A 4B76A 5FCRA 1OYTH 1BT7A 1T4VH 5J4QA 2ZU1A 4NSYA 1F7ZA 1UVSH 1GBFA 3A8DA 5DP5A 4AFUA 2CJIA 1O33A 1VITF 4AZ2B 5GWZA 3VXEH 2XRCA 3DA9B 3TJNA 2R3UA 4ISIH 3UNRA 8ESTE 4I33A 1SL3A 3D49H 1KIGH 1ELBA 1EZXC 4JZFH 1BTPA 1LKAA 1S84A 4E7NA 2Z6BD 1C2IA 1LVOA 1LPKB 3L6PA 1IQMA 2W3KA 2CHAB 1BZXE 2THFB 3RC6A 1UVTH 3ODDA 1LQEA 2VVCA 1EZQA 1IQJA 4ZKOU 1PPFE 1O3AA 1GHVH 1C5MD 1O2SA 1QA7A 5FX5A 1BRCE 3V3MA 4E06H 1ELCA 4WF8A 1P10A 1GI4A 5JPMH 3MU5A 5C20A 1J9CH 1T7CA 3A88A 1SVPA 1YLDA 4CRDA 3LGWA 8GCHG 3RU4T 3TU7H 1A0LA 2HOBA 2WYJA 4I32A 7KMEH 1A5GH 3VPKA 1O2JA 3SU6A 1GI2A 1VCPA 1IQKA 2Z94A 1EQ9A 2F3CE 3M3TA 1EP6A 4IBLH 4BAKB 4GVUA 2G81E 1C2MA 7GCHG 2BDHA 1ELEE 2GZ9A 3QK1A 3W94A 2PHBA 1IQFA 4I8LA 2ASUB 3MH5A 4ZXYH 3UR9A 2Z3EA 3E8LA 3HKJB 2VIWA 5ESTE 2BD5A 2ODPA 3BTGE 5A0CA 3TK6A 2HPQH 2O8WA 2HGTH 2AMQA 1PJPA 1UK4A 1MTVA 5EXMA 1LHDH 4JK6A 4CRCA 2FXRA 2V3OH 4R0IA 4ISLA 3GYMA 1V2PT 2G5VA 3ZZDA 4B2BA 1FY5A 1HGTH 3PWCA 3SV9A 1GJBB 1SGQE 1CGHA 2TBSA 1A5HA 3KNXA 1Y3VA 1XVOA 2B7DH 2NWNA 3V7TA 3KF2A 1ELGA 3VEQB 4Y0YE 1V2KT 5JBAS 2XC5A 4BOHA 1C2HA 3UFAA 3LIWA 1YC0A 4UE7H 3Q3YA 1O2VA 2SNVA 1NESE 1GHBF 2SGEE 1FY8E 4BANB 1L4DA 4K8BA 2BLWA 4BAMB 1QQUA 1SGNE 2Z9IA 2JH0D 4CRFA 4D9RA 1DX5M 1P2QA 5HM2A 5IYTA 3EYDA 1LDTT 1NO9H 2PGQB 2BQ7B 1AWFH 1TPOA 1BMLA 1BDAA 3PTNA 4NFEA 3A87A 1O5GH 1C4V2 1IQHA 2QC2A 3S7KB 1CVWH 1GJCB 5JBBS 3M7UA 4M7GA 1MCTA 1C1NA 2VIQA 1C4U2 1TX8A 1GGDC 1QFKH 1UCYE 3DD2H 2CV3A 5AFZH 1CT4E 1HAGE 3L33A 4JK5A 2ZGHA 4NA9H 3L3TA 3H7OA 4CRGA 1ANCA 1TMUH 2QGRA 1LKBA 2H5CA 3BV9B 3F6UH 2Y5HA 1H9LB 4YZUA 3F9HA 3QZRA 2FX4A 1QB9A 3PWBA 3UR6A 2BXUH 1JBUH 3D23A 3GDSA 4AYVB 2FO9A 2QF3A 2F9VA 1QL9A 4FUDA 1QB6A 3LGTA 3U9AH 3C27B 2HNTF 1A61H 1O2NA 1C1MA 1O3JA 2ZFRH 1TBRH 3A89A 1FDPA 3SJKA 3ZVGA 1ZTKA 2J92A 5EXLA 2GKVE 4XE4A 1C5XB 3MU4A 2ZHEH 1GI6A 1SLXB 3BTQE 1BMMH 3UQOA 1W11U 1A4WH 1IQGA 1CE5A 2J34A 4JZEH 2FI4E 2ZQ1A 2YNBA 1ELDE 5E8EH 1ORFA 4CHAB 1C9PA 3UNQA 4JYUH 1CA8B 1L2EA 5TCCA 1AFEH 2TRMA 4X1PU 4NGAH 2QXGA 3V0XA 2RDLA 1Y59T 2Z9KA 1BJUA 1AKSB 1H4WA 1O3GA 1MZDA 2PKAB 3S7HB 1AVGH 1Y3YA 3TGKE 3SI4H 1ZOMA 1Y3UA 3QX5H 1FY1A 3FP8E 1C2KA 1E34B 3TLOA 1J17T 2H2ZA 4FVDA 1KY9A 1WBGB 1F0UA 2H9EH 3M35A 3MU0A 3KQEA 1EAWA 2GMTC 1MUEB 4JZ1A 1H9HE 1DITH 1QBVH 1VZQH 3TGIE 1A3BH 1VJ9U 3UPEA 4KTUA 4MLFB 3ZZCA 3E90B 1S81A 4FXGH 1TRMA 1OWIA 1UTQA 2P95A 1W10U 2XWAA 3E0NB 2XW9A 1FN6A 3BF6H 1CHGA 3SOSA 2XBXA 3OY5U 3SV7A 4K1EA 2ZGBH 1L1GA 1O3HA 1ZR0A 1O2LA 2VH6A 4INKA 2QAAA 2H6MA 3SNEA 4IN2A 2RG3A 1C5YB 2GV6A 2P8OB 1BTUA 1WTHD 4B1TA 2OBOA 1JIRA 1TX6A 2UUJB 3Q00A 2ZTZA 2A31A 3BG8A 4X2YA 2P3TB 4BAQB 1TYNA 2BY7X 2WPHS 4A92A 3OX7U 3DT0H 1K2I1 1AE5A 4TY7A 1GVKB 2M5TA 2B5TB 3RXGA 3ZVEA 4WWYA 2A32A 1NT1A 4UONA 2J38A 4NCYA 1SGYE 2EA3A 3EA9A 1O3DA 1TRNA 3Q76A 1VGCC 1XM1A 4AFSA 1C2LA 1FAKH 1G30B 1K28D 1OYQA 1XUFA 2VWNA 2VU8E 2BQWB 2ANYA 1MKWH 4K69A 1O3OA 2FX6A 3ZZ4A 1C1WH 1GVLA 2RA3A 1FY4A 3SU2A 4B71A 2ZDKA 2CGAA 1TNKA 3SU3A 5C3NA 2VB0A 1GJ4H 3S0NA 3A7XA 4KTCA 3P8OA 1GWAA 3ZVDA 2W3IA 3RXIA 2QXIA 1P2MA 3BG4C 1PQ5A 1HJ8A 5DJ7A 1ACBE 3Q77A 1G32B 1P8VC 1O3FA 4AG1A 4UDWH 2AMPA 2Z9JA 5C1YA 2O8TA 1S82A 4NWKA 5EG4A 1P11E 3IWMA 1O3KA 1UK3A 1TPAE 3TNSA 1CSOE 3RM0H 5GIBA 5E0HA 3BTTE 3U1IB 3AW0A 1CGJE 3DHKH 1SGRE 1K1PA 3JZ1B 2WUBA 1MTUA 3FVFB 3LPRA 1LVMA 3QO6A 1RJXB 2NU0E 3BTHE 3SNDA 4OS5A 3P17H 4CBNA 5GJ4B 4UD9H 1UHBB 2BY9X 1DWCH 3UQVA 3MO9A 2ZGXH 3KGPA 1O3LA 3SNAA 1QRZA 2XBYA 1A46H 4IMQA 3SJ8A 5T3HA 2STBE 1W7GH 4FUJA 3LONA 1TQ7B 3QN7A 1EJNA 2HVXA 1UCYK 1HJ9A 2F9UA 3ZZBA 1AY6H 1NROH 1Z8GA 1GBKA 4OGXA 5PTPA 1GJ7B 1NM6A 1FXYA 1FMGA 2AGIX 2F9BH 1GMCG 1P09A 1V2TT 1V2RT 3ZZ8A 3U8OH 1L4ZA 5BPEA 2VNTA 3MMGA 2B9LA 3ATWA 2H9TH 2A4RA 1KTTB 2PR3A 2Y82A 1O2HA 2GZ7A 1XXDA 3TITA 4XBDA 3SHAH 2A2XH 3RP2A 4OS7A 1O3MA 3GYLB 2GP9B 1C1OA 4ABBA 3FAOA 5DP4A 3UREA 4ISOA 4A1TA 4DURA 3EE0B 5J4SA 1P2IA 4ABFA 1GI9B 5FCKA 4Y8ZA 2BLVA 3TNTA 1O3IA 2GVFA 1P2NA 5AHGH 1TALA 1AGJA 1EPTC 4ABHA 1HXFH 2R2MB 1AZZA 1FY3A 1GBMA 1JIMA 1XUIA 1TNHA 1V2QT 1S6HA 2G5NA 1J16A 1HAXB 1XXFA 4PROA 1F0RA 1CBWC 2BX4A 3TJUA 4QT8C 3KIDU 1SLWB 4MTBA 3QUMP 3T25A 3SN8A 3UIRA 1L1NA 4JZIA 3RDZA 2WYGA 4Y7BA 2H1UA 3IG6B 1O35A 1CT0E 1QJ6B 2ZDVH 2D26C 2ZDAH 3RMMH 5HMAA 3RXJA 1GMCF 2KAIB 1D4PB 1SSXA 1LMWB 1Q3XA 4WJG2 1LPGB 3MO3A 3SGQE 3D65E 5CHAC 3F9FA 2CMYA 3ENSB 1FN8A 2FPZA 1QRXA 1EUFA 2WUCA 4K5ZA 4K3JA 2JKHA 1FQ3A 3EGKH 2WPIS 3O8RA 1GDNA 2XYAA 2BOHB 3RM2H 4FU7A 5C1UA 3SGBE 1CBWB 1OWDA 3ZZ7A 5EPNA 2A0QB 5GCHG 5ETXA 3RMLH 1H8IH 4DT7B 1LVBA 3MTYA 4RSPA 3LGUA 4MNXA 1D3TB 1TWXB 3M3VA 5AVDA 1O3EA 1OX1A 2BHGA 3RXSA 1QHRB 3M5OA 1EB2A 1CU1A 2EC9H 2Y81A 3H7TA 1K22H 4ISNA 5CHAB 1K1JA 3M61U 5F6MA 1JXPA 1ELFA 2C8YB 5HYOA 2BZAA 3RMNH 4DW2U 1C1TA 1VITH 1P2OA 1Z6EA 4X8SH 1YPHE 1JWTA 1A2CH 1A1RA 3BTKE 4Y79A 4J2YB 1PPGE 2GGVB 1TGTA 3QGNB 2ZDLA 1YPKH 2AH4X 1NFUA 1MTWA 2ZPSA 1TONA 3SORA 1HAIH 3K9XB 1J8AA 4Q80A 1VJAU 2GTBA 1F5KU 4UEHH 1O2WA 3QLPH 1E35B 2SGPE 1NFXA 2O8UA 2NU3E 3BTFE 4I8HA 1G36A 4ZKRU 1GJ8B 3NCLA 4IN1A 5DPAA 3SI3H 1ZYOA 5JBTA 1O2KA 1P12E 2VVUA 1D3DB 4NIXA 1QIXB 4NIWA 4OS4A 1MKXK 2FODA 2VVVA 3E0PB 2ZGCA 2ZWLH 2LPRA 4NFFA 1TLDA 3LT3A 3AAVA 1GL0E 1TB6H 1AUTC 1RTKA 2PLXA 1A0JA 5K0HA 4ZMAH 2ANKH 3Q3KA 1GBEA 3QGJA 4MVNA 1QJ7B 4BNRA 3RXMA 1HXEH 4FU8A 1G3CA 1C1SA 1Q2WA 2SGFE 5C1XA 4ZHLU 5GXPA 1DWBH 2OXSA 1AO5A 1OWJA 1MKWK 4FUIA 4WH8A 1UVPA 3OYPA 1EKBB 1K9OE 2A7CA 2QXHA 1SGEE 3A81A 3E1XB 1GHWH 3OU0A 1EAIA 4B2CA 1PQ8A 2D2DA 2FOEA 1THPB 1K1LA 1NU9A 1EOLA 2VJ1A 3S69A 5IDKA 2ZCLP 4K60A 1BITA 4R8TB 4BXSA 1T8LA 3BEFB 3OY6U 1N1LA 3UUZA 2FMJA 3PV4A 2ZFQH 4NA8A 1O5FH 1SGDE 3SJOA 1ZRBA 3K65B 1K1MA 3RXPA 2SGAA 1F92A 1WV7H 1ZRKA 1BQYA 1KLJH 4B73A 4DOQA 1NRQH 1TNIA 1O3NA 2P94A 5EW1H 4X1NU 2OLGA 3S9AA 2A45B 1V2MT 3T2NA 1O31A 2NU2E 3PO1C 2OC7A 1TGCA 3OTJE 2XXLA 1FZZA 1ZGIA 2C90B 5A8ZA 2Y6TA 1O3PB 3BTME 1HAZB 1YGCH 5A8XA 3CENA 4AORA 2IJOB 4ZXXH 2BOKA 3F1SB 1MD7A 1BUIA 3MH4A 1IHSH 2JETB 4FUCA 4AOQA 1HLTH 2ZDNA 1ABJH 3A83A 1MKXH 1TOCB 1CHOG 1GMDG 1GHBG 1YPJH 2OCVB 5H4IB 2W5EA 4MNYA 3GY4A 1NN6A 1C5UA 3MNCA 3TJOA 3RU4E 4ABGA 2IOTA 1LHFH 1YCPH 1TE0A 3OSYA 1NRNH 3M3SA 3Q3XA 4DIIH 4ABJA 1J15A 2ZHWH 3PLKA 4UFFH 2R0KA 1GDQA 2RCEA 1WAYB 2G51A 2CF8H 2ZIQH 3JZ2B 1RIWB 3V12A 2QYIA 2FIRH 4DGJA 2CXVA 4MG3A 3IITA 4YESB 1P9SA 5EQSA 3LGIA 1GCTC 1GGDB 1P0SH 2F9OA 4HI3A 1J14A 4X1SU 1O3BA 1SOTA 1ZTJA 3BTEE 1BBRK 3M5NA 1K21H 1SOZA 5FPSA 1FNIA 4LOYH 4YOJA 2UUKB 4X2XA 1CA0B 1SQOA 1EJAA 1S5SA 5L6NH 2ZZUH 3SNBA 4A1VA 4AB8A 2VWMA 4YM9A 1O32A 4WY3A 3SO3A 5E0JA 3STIA 3SV2H 3QTOH 1MTNC 2J4IA 3A7VA 1SG8B 4GLYA 1ZZZA 3MI4A 4SGBE 2A7HA 4AGJA 2HALA 1EATA 4X6NA 1T31A 2HLCA 2ZFPH 1QY6A 1UTOA 1W0ZU 3NK8A 2ZU5A 4OGYA 1LQDB 1F5RA 5EQQA 1GL1A 3RC5A 5FX6A 1HYLA 3HKIB 3E16B 1AFQB 3A85A 3SQHE 1O2UA 1BTYA 3KN2A 1OP2A 1GI0A 1QQ4A 1TGNA 1NRPH 1BIOA 1ARCA 4TY6A 3SQEE 2VIDA 4INLA 3ZV9A 4IC6A 3GICB 1JMOH 3AAUA 2SFAA 3C1KA 4RKJB 4WXVA 1C5TA 5LPRA 1QL7A 6CHAB 3RXKA 4Q7ZA 1HRTH 5HXFA 1CHOF 1GMDF 5G4BA 3P95A 1WOFA 1INCA 1DANH 2ESTE 3I77A 3K6ZA 2A7JA 1ZLRA 1MAXA 1OP0A 1P06A 4BXWA 1NRRH 1A0HB 1AVXA 4MNWA 2Z3CA 1EPTA 3DUXH 4HFPB 2O8LA 1TBZH 3MWIU 3PTBA 2BLOA 3BN9A 2ZP0H 1ZPZA 1XUGA 1TQ0B 1TPSA 2J95A 2OBQA 1XUJA 4JMYA 3VXFH 4I8KA 1GDUA 2A5AA 3O8CA 1EX3A 1D9IA 3SW2B 3CP7A 4H6SB 2A4OA 1Z71A 7LPRA 2PFEA 1YPGH 2XCFA 1DUAA 3RUOA 3FFGA 2P8OC 2ANWA 2FOBA 3LDXH 4TWYA 1DY9A 3U8TH 1GPZA 2PSYA 3A84A 5DG6A 4Y8XA 4AFZA 4Y8YA 5LH8A 4CR5A 1W13U 1HPGA 1KSNA 1D6WA 1UMAH 4FUGA 3P8NA 4DJZB 3F68H 1LHCH 2HNTC 2VGCC 1TNGA 2IN2A 2XBVA 4GSOA 2PUQH 4U30A 1Y5BT 2EEKA 1GBHA 1W2KH 1ZJKA 3FP7E 1YPHC 3F9EA 5F8TA 2QY0B 3FP6E 4B2AA 2BD3A 3UOUA 3HK6B 2ZNKH 1SI5H 4FUFA 5DKMA 3ELAH 1N6YA 1EXFA 3LC3A 1ZGVA 1MTSA 3KQBA 1O37A 1MBQA 1P03A 2V0BA 4D76A 1V2OT 1UTMA 4YOIA 4DG4A 3SBKA 1KXBA 1MU6B 1MQ5A 1VCQA 3LJOA 2C8ZB 3ZVCA 1V2LT 6ESTA 3GY8A 4ZAEA 1AB9C 1C5WB 3BG4B 4YO9A 1T8NA 1RRKA 3RU4D 1DPOA 4VGCB 2EI6A 4Z6AH 1OWEA 1PYTD 1W0YH 2PUXB 3GDUA 1GHAG 3LH3A 3PMJA 2ZFFH 4TPYA 5EOKA 2ZHQH 4JCNA 3ZZ9A 1FPHH 1KDQB 4UFDH 1FI8A 1TA2A 3PMAB 1BHXF 3VB4A 5E0GA 1V2WT 5FXLA 1HAVB 1QNJA 2VIPA 1K1IA 1BA8B 1MAYA 1N6XA 1C5RA 1O2PA 5A09A 3SNCA 1UK2A 1TABE 5FHTA 3E6PH 1CQQA 1DWEH 1O2XA 2TPIZ 5TCAA 4DIHH 5A0BA 3MH6A 5C2ZA 1NC6A 2ZCHP 1YPEH 1B7XB 3PLPA 4H4FA 2DE9A 4AG2A 1FONA 2BDIA 1HCGA 1ID5H 1PYTC 5K7RA 2FOFA 1HB0B 2AYWA 2R9PA 3SJ9A 1C4Y2 1P05A 1P01A 1SLVB 5TJXA 1NTPA 4ABDA 2ZF0H 3RXFA 5LPFA 2ZPRA 3KCGH 3VB3A 1TX7A 4MQAA 1S83A 1NZQH 2C8WB 1Y3XA 2FYQA 4NSVA 1UJ1A 4HTCH 4AN7A 2WV4A 2F9NA 1GBLA 4D7GA 2XC4A 2WPMS 1P04A 1O0DH 1ZTLA 1C5PA 1G9IE 2BX3A 4Y7AA 9ESTA 3DFLA 4KTSA 1C5LH 5DP3A 4BAOB 1LHGH 1XUKA 4DCDA 2FOAA 1QBNA 2BTCE 4X8TH 1ELAA 2A1DB 2FTLE 4KELA 3BEUA 4ZH8A 1Y8TA 3RXBA 2AGGX 3GY6A 3SU1A 3QDZB 1DDJA 2OQ5A 2HPPH 4XOJA 4MNVA 3ODFA 1IAUA 3SU4A 3A7TA 2I6QA 3WY8A 1IQIA 3LGYA 1MD8A 1ANDA 1DFPA 1MQ6A 3RLWH 1ELTA 3A86A 1HJAB 2G55A 5L2YH 1QR3E 2QXJA 2IPHA 3AVZA 2G52A 2D1JA 2JH6D 1DSTA 3SUGA 1TOMH 4X0WU 2QV1A 1EOJA 1DVAH 1NFYA 3NPSA 2FZZA 4UFEH 1YKTA 1TMBH 1Z8IB 1KXFA 3MO6A 2Y5FA 1F2SE 1AN1E 3TH4H 5GDSH 5JDUB 1C2JA 3A8AA 3MU8A 3O8DA 3ZYDA 1ZMNA 2ODQA 2STAE 3GY7A 1DLKB 2UUYA 5LGOA 2WINI 4MPXA 2FOGA 2G4TA 4NA7A 1E37B 3B23B 2A5IA 4ESTE 1XKBC 3ZZ5A 2PKSC 3ZYEA 3I78A 1PPZA 4XFQA 4LZ4B 1SGIB 2TGTA 4I7YH 1TFXA 7GCHF 2VWOA 5DP7A 1IQEA 3GCTG 2OUAA 2GCTB 4YTAA 5CE1A 1HAPH 4Y0ZE 1UO6A 3RXUA 1DXPA 3ATIA 1RTLA 3EDXB 2CN0H 2VWLA 1P2JA 3BTDE 9LPRA 4YLUA 1RS0A 1L0ZA 1EAUA 4RKOB 1AMHA 2BDBA 3E91A 1HNEE 1H8DH 1TNJA 1P02A 1YLCA 3VB5A 1G3EA 2FM2A 1ZJDA 4MPUA 1D3QB 1MZAA 1CGIE 1TGSZ 4NG9H 3T62A 2ANMH 2J94A 3S9BA 1EPTB 3LC5A 1NU7B 2BDAA 2ZI2H 1AE8H 2D8WA 1ETRH 1F5LA 1WQVH 1HAYB 3CS7A 1AHTH 2BD7A 3N7OA 4K1TA 4ZUHA 1C5VA 3QWCH 1BB0B 1AI8H 1D6RA 3NWUA 4FU9A 3TJVA 2ZU3A 5HM9A 2CF9H 2H5DA 2ULLA 4SGAE 1C5OH 2K1QA 2ZO3H 2HNTE 3B9FH 3HK3B 3H5CB 4YT7H 4U01A 1TBQH 3ZZ6A 4ABAA 4BTTB 3VGCB 1V6DA 1MMJN 1YF4A 1T32A 4UFGH 4GHTA 2ZGJA 3RXCA 2HRVA 1H9IE 1HJAC 1PPHE 4AX9H 2QCYA 3ATLA 1PPEE 1MU8B 1O39A 1BRAA 1DLEA 4Y76A 4CR9A 2J9NA 2W7SA 5FPYA 1ETSH 1BCUH 1V2UT 1FIZA 2BVRH 3VFEA 1C9TA 2PSXA 1SFQB 4FUEA 5FAHA 2AIQA 1S6FA 4K2YA 1IQLA 3VGCC 4GHQA 2FOHA 2O9QA 2TGAA 1SGPE 1FJSA 5ABWA 1NFWA 1A3EH 3R0FA 1QA0A 4X2WA 3RXLA 4BAHB 2DE8A 4FUHA 1AIXH 3R3GB 1E36B 4TWWA 1HFDA 3MNXA 1GMHG 1JOUB 1F0TA 1VR1H 1FUJA 2GCTC 5E2OA 3UWJH 2P16A 1QJ1B 2GDEH 1K1NA 4GUXA 4NWLA 1DY8A 4KP0A 1P3CA 4TPIZ 1Z8RA 3T29A 2ALVA 1AUJA 2UWPA 1O2YA 2F9PA 1TA6A 3SUFA 1DWDH 5I46H 1XVMA 2ZU4A 6LPRA 3URDA 2Q6FA 1JRTA 4A1XA 2ZHDA 1DOJA 3MYWA 1QRWA 1XX9A 1Z1IA 3PO1B 3KEEA 1EZSC 1W12U 2OINA 1GHXH 2UUFB 3TGJE 1VITG 3FZZA 1UVOA 1SC8U 1TGBA 3NUMA 4XBCA 3MU1A 4XBBA 1O30A 1FAXA
chains in the Genus database with same CATH superfamily
3P6ZB 2ODYB 1QL8A 1AQ7A 1C1PA 1E38B 3KHVA 2WHXA 3RXEA 1BTWA 1EP5A 2JETC 5BRRE 2ZEBA 8GCHF 5HGGA 1O2TA 5A2MH 2KFWA 4I31A 2AS9A 3T26A 1KMHB 2A2QH 1C2DA 1GBDA 1Z7KA 4K8YA 2OD3B 3ATMA 5C67A 4X6PA 2XTTB 2HLDD 4H6TA 2BDGA 2WZQA 4Q2KA 3SV6A 2OC0A 5C0UA 1KXDA 1HUTH 3RXTA 2P3UB 1CT2E 3A8CA 3LH1A 3GY2A 2Q6DA 3T28A 4ZKNU 1THSH 3NZIA 2BDYA 5DP8A 4CH8B 2V3HH 3D62A 1ZHMA 3HATH 2FOCA 4OS1A 4B6FA 5F8XA 2ZA5A 8KME2 1OS8A 1GI7B 3HGNA 4Q7YA 1QGFA 1Z6JH 4WMEA 5C94A 2FI5E 3BIUH 1GCTB 4KGAA 4WVPE 3KL6A 5DK1A 2BY5X 2KCAA 2ZU2A 1BMAA 1PFXC 3RXRA 3A80A 3SGAE 1SGFG 1C1RA 4THNH 4NIYA 1BOQA 1UTJA 1YCPK 2AIPA 4GCHG 4D9QA 3GY3A 1ABIH 4IW4E 3TK9A 1LVYA 2PW8H 3EQ0H 2I6SA 3TIUA 1GG6B 1GBJA 3VB7A 2Z9GA 5JYIA 2CK3D 2GT8A 4LXBH 3F9GA 3GOVB 1G2LA 3SHCH 3SUDA 1YYY1 4YT6H 1C2GA 1UTLM 3LOXA 4O9VA 1ANEA 2BVXH 1KYNA 1UCYH 8LPRA 1T8OA 1W7XH 1AVWA 1HAOH 1P3EA 1WTGH 1W8BH 3HGPA 1G3DA 3U69H 2ZFSA 2XC0A 3RLYH 3ITIA 4YLQH 3FO8D 1UW7A 1BTZA 1DSUA 2PWXA 2YNAA 1T8MA 1BBRH 3SZEA 1MCVA 1ZHRA 2ZECA 1TAWA 1KLTA 4D8NA 4F4OC 1V3XA 4ACBA 4ZHMU 3GDVA 1GBAA 2C3SA 3W95A 1DS2E 1SMFE 1DE7H 3PM3A 3TH3H 3DSOA 4JYTA 2ZDMA 1SLUB 4I8GA 1NY22 1IHTH 1XMNB 4NZLA 3TPIZ 2Z7FE 2XOKD 2UWLA 4Y6DA 6GCHG 5DP9A 1GHYH 4X1RU 4LZ1H 1ZMJA 1L1JA 1HAVA 1A7SA 2VINA 2QA9E 2WSSD 2J2UA 3EA7A 4K1SA 2BDCA 3LGVA 3UY9A 3ZZAA 1CA0C 2OC8A 1GI1A 1HIAA 1FPCH 1UTNA 1O2MA 2BVSH 3BTWE 5A0AE 1DUEA 2F83A 2M2AA 1BHXB 2QIQA 1PPCE 5EXNA 3KQCA 5B6OA 5DP6A 4NZQA 4CREA 1YBWA 2H9HA 1SGCA 2IPQX 1GJ6A 1ANBA 1GMHF 3T5FH 1AD8H 1E1RD 2G8TA 2VGCB 1YCPM 3LJJA 1VGCB 1DM4B 4ABIA 1HBTH 1DXWA 5EQRA 1OWHA 5FBIA 2K0QA 2JDID 4BTUB 1O5EH 2UWOA 3A7WA 3TK5A 4IC5A 1GBCA 1UTPA 2BY6X 3CS0A 2BB4A 4HGCA 2ALPA 1ELVA 4X2VA 3RXVA 4DVAU 1C2FA 3UWIA 1B0EA 2B8OH 4E05H 2FS8A 1K1OA 1Y5UT 3PMBB 4MPWA 5CMXH 1MH0A 1QURH 3NXPA 1OXGA 1GBTA 1SQTA 3RC4A 2SGQE 1QTFA 2PV9B 1C5SA 3AASA 5T6DA 2DUCA 4O3UA 3M7TA 1S0QA 1O2OA 2QF0A 1N8OC 2P59A 1O5AB 5L30H 2FTMA 4F49A 1YPLH 5JB8S 3BSQA 2W26A 1SHHB 3SU0A 1ZSLA 2ZHFH 3P8FA 1ARBA 2J97A 3K2UA 1YM0A 4ZHAA 5AF9H 1GJAB 5ESBA 4OS2A 2W7UA 3FZDA 3SZNA 3MFJA 3S9CA 4WXIA 1BTHH 2OQUA 4BTIB 2EI7A 4Y71A 1C1VH 2BLQA 1ZSKA 1O3CA 1AZ8A 2PTNA 1AU8A 1XKAC 4JZDH 1OSSA 1U6QA 4CHAC 5T6FA 4A6LA 3B8JA 3A7YA 3P8GA 4WH6A 1O36A 2VIOA 3K6YA 4GAWA 2BY8X 2FESH 1UTKA 5EJZA 5A8YA 1UVUH 3RXOA 3BEIB 2BD9A 4OS6A 1KXCA 5DGJA 5F03A 1SGFA 5C5NA 1O34A 5HKKD 3BIVH 3M37A 1E0FD 1WUNH 4O03A 3SU5A 1B0FA 1OP8A 1MBMA 1EJMA 1PPBH 4O3TA 2NU4E 1S0RA 1EZUC 4Y11E 6CHAC 1C2EA 1KXAA 5SGAE 1P9UA 1UHBA 3GISB 4WMFA 5E2PA 2ZKSA 4LK4A 3ZVAA 1RGQA 2BM2A 1LHEH 2FS9A 1CO7E 1RIWC 2G4UA 2R3YA 3N99A 1OWKA 4IS5A 5FBEA 1W14U 1O38A 5GPIB 2AERH 2FP7B 1H1BA 1WSSH 2A4GA 2Y80A 2OTVA 3EAJA 5F8ZA 1HV7A 1BMNH 3ATKA 2VH0A 3O8BA 4A7IB 4X6MA 4VGCC 1NS3A 2V35A 2Y5GA 3WW7A 2YOLA 1SGTA 1G3BA 3PB1E 2LNCA 5C5OA 3SJIA 1GJ9B 1YP9A 3ZVBA 3F3BA 2NU1E 2RFKC 4U32A 3GCTF 2BMGB 3HPTB 3AW1A 2AGEX 2TGPZ 1C5NH 5I25A 1MTNB 3LU9B 3PLBA 4GCHF 4X8VH 1P57B 3SV8A 2ZFTA 1KXEA 2XNIA 3RXQA 4ASHA 1O2IA 1ZSJA 2GD4B 1EB1H 2VIVA 2R0LA 3STJA 4E7RG 4HZHA 1S6LA 2GMTB 2FI3E 4X1QU 4Z0KA 5JBCS 1WXRA 3ZVFA 3P70B 1IOEA 3DFJA 3EA8A 3MNBA 5L2ZH 1RXPA 3N7DA 1N8OB 1AFQC 3ESTA 1WCZA 4RN6A 2A4QA 2WPKS 3M7QA 1V2NT 1QCPA 2JH5D 2ZC9H 1AWHB 3PYHA 1XUHA 1ESTA 5EPYA 4X8UH 3FKSD 2C93B 2ZPQA 1HAHH 1V2VT 4J1YA 1GBIA 2FOMB 2BQ6B 2F91A 4HG6A 4A5TS 5DO4H 1DICA 2OP9A 2JJ2D 1ESBA 2BXTH 1OOKB 1FV9A 3GY5A 4O97A 5EODA 5JB9S 1DT2A 1GI3A 2FWWA 2G00A 1EASA 1YPMH 1AB9B 3PMHB 1C5QA 2ZG0H 3GCOA 3GCHC 2OC1A 2Q6GA 3QTVH 1ZPCA 4AYYB 2GZ8A 1ZMLA 1GCDA 3U98H 3OFND 1M9UA 2YMSC 3E3TA 4GPGA 1PQAA 5EGMA 1O2RA 2QN5T 1QBOA 2FLRH 1NRSH 5EW2H 1Y5AT 1GJDB 4IGDA 1OKXA 4CBOA 4ISHH 2GCHG 1TMTH 1THRH 2BD2A 1IQNA 3U8RH 4ACAA 2Y7XA 1SFIA 5LPEA 1SHYA 1ZPBA 1WQSA 4INHA 2Y7ZA 4IMZA 3TVJB 2GDDA 2GT7A 5GNDA 3P92A 3RXHA 1FIWA 3F2FA 3GCHB 3M36A 1QB1A 1Y3WA 1HIAB 1GVZA 4FVBA 1LO6A 1NPMA 1S85A 1V2JT 2GX4A 4Y10E 4DY7B 1GI8B 2C8XB 2HWLB 4U2WA 3VG8A 2GCHF 2PTCE 4AGKA 1C1QA 3RXDA 2BD8A 2ZCKP 4Q63A 1C1UH 2PKAA 1ESAA 7ESTE 3RMOH 4MPVA 2P93A 1GBBA 3VB6A 2FDAA 4FUBA 2V7QD 1KDQA 1WYKA 1GHZA 2B0FA 2BZ6H 2R2WU 2WPLS 2ZTXA 2BD4A 4MDSA 3QZQA 1O5CB 1JRSA 1BJVA 1Z8JB 1TRYA 2C4FH 5GCHF 2AEIH 3MOCA 1P2KA 1O2ZA 2WPJS 1TPPA 5HIZA 1O2GH 3A8BA 4I8JA 1WU1A 1OPHB 1SR5C 2SNWA 1PQ7A 3NKKA 3TH2H 2P3FH 4H42U 4JYVH 2AFQB 1GHAF 1T4UH 3A82A 4CH2B 3M5LA 2CHAC 2J98A 3UTUH 4Q7XA 1V2ST 1O2QA 3F0OA 3KQDA 4CRBA 4B74A 1LTOA 2O8MA 2VBCA 1W3CA 1F0SA 1TIOA 5FPTA 2K8IA 4WMDA 1GI5A 3UAIC 3OTPA 1BRBE 1HDTH 1TNLA 4FOUC 2RA0A 5T6GA 2FLBH 4XDEA 1Q31A 3M5MA 3PROA 1LPZB 1RFNA 5EU8A 2EI8A 2Q1JA 4B75A 1LCYA 6GCHF 2BYAX 2FEQH 2TGDA 4AFQA 1D3PB 1SBWA 1SB1H 1KTSB 1G2MA 3UOPA 1BRUP 2Z3DA 4P00A 1Z1JA 5KGOA 2J98B 3MNSA 2ILNA 4ZROA 3A7ZA 1EAXA 4TYDA 3ZZ3A 1BTXA 3G01A 2Z9LA 1GJ5H 2KAIA 2FYRA 1KLIH 1C5ZB 1VCWA 2PKSB 4CRAA 3UNSA 1BBRE 1ZHPA 2XCNA 2SGDE 3U1JB 2GV7A 1A5IA 3ZV8A 1X7AC 1SQAA 4D7FA 4KKDA 1OHHD 2TIOA 4AB9A 1FX0B 5AFYH 2V6NA 1GG6C 3LKWA 4NIVA 1AKSA 2A5KA 4ABEA 1WDIA 3URCA 3MHWU 2ZTYA 1ETTH 2AMDA 1G37A 3T27A 4YOGA 1RTFB 4XSKU 1MABB 3SUEA 3I29A 3WWFA 1SPJA 2XBWA 2ZQ2A 3FANA 2XWBI 3GCNA 1RD3B 2WV5A 2PGBB 2XNDD 4X6OA 1O5BB 1FLEE 3MH7A 1B5GH 1O5DH 4ZKSU 3RXAA 3V13A 4B76A 5FCRA 3ZIAD 1OYTH 1NBMD 1BT7A 1T4VH 5J4QA 2ZU1A 4NSYA 1F7ZA 1UVSH 1GBFA 3A8DA 5DP5A 4AFUA 2CJIA 5CDFE 5EJ1A 1O33A 1VITF 4AZ2B 5GWZA 3VXEH 2JIZD 2XRCA 3DA9B 3TJNA 2R3UA 4ISIH 3UNRA 8ESTE 4I33A 1SL3A 3D49H 3SYJA 5IK2D 1KIGH 1ELBA 1EZXC 4JZFH 1BTPA 1LKAA 1S84A 4E7NA 2Z6BD 1C2IA 1LVOA 1LPKB 3L6PA 1IQMA 2W3KA 2CHAB 1BZXE 2THFB 3RC6A 1UVTH 3ODDA 1LQEA 2VVCA 1EZQA 1IQJA 4ZKOU 1PPFE 4B6EA 1O3AA 1GHVH 1C5MD 1O2SA 1QA7A 5FX5A 1BRCE 3V3MA 4E06H 1ELCA 2KCPA 3F2GA 4WF8A 1P10A 1GI4A 5JPMH 3MU5A 5C20A 1J9CH 1T7CA 3A88A 1SVPA 1YLDA 4CRDA 3LGWA 8GCHG 3RU4T 3TU7H 1A0LA 2HOBA 2WYJA 2AHME 4I32A 7KMEH 1A5GH 3VPKA 1O2JA 3SU6A 1GI2A 1VCPA 1IQKA 2Z94A 1EQ9A 2F3CE 3M3TA 1EP6A 4IBLH 4BAKB 5KEDA 4GVUA 2G81E 1C2MA 7GCHG 2BDHA 1ELEE 2GZ9A 3QK1A 3W94A 2PHBA 1IQFA 4I8LA 2ASUB 3MH5A 4ZXYH 3UR9A 2Z3EA 3E8LA 5C0TA 3HKJB 2VIWA 5ESTE 2BD5A 2ODPA 3BTGE 5A0CA 3TK6A 2HPQH 2O8WA 2HGTH 2AMQA 1PJPA 1UK4A 1MTVA 5EXMA 1LHDH 4JK6A 4CRCA 2FXRA 2V3OH 4R0IA 4ISLA 3GYMA 1V2PT 2G5VA 3ZZDA 4B2BA 1FY5A 1HGTH 3PWCA 3SV9A 1GJBB 1SGQE 1CGHA 2TBSA 1A5HA 3KNXA 1Y3VA 1XVOA 2B7DH 2NWNA 3V7TA 3KF2A 1ELGA 3VEQB 4Y0YE 1V2KT 5JBAS 2XC5A 4BOHA 3OEED 1C2HA 3UFAA 3LIWA 1YC0A 4UE7H 3Q3YA 1O2VA 2SNVA 1NESE 1GHBF 2SGEE 1FY8E 4BANB 1L4DA 4K8BA 2BLWA 4BAMB 1QQUA 1SGNE 2Z9IA 2JH0D 4CRFA 4D9RA 1DX5M 1P2QA 5HM2A 1YLNA 5IYTA 3EYDA 1LDTT 1NO9H 2PGQB 2BQ7B 1AWFH 1TPOA 1BMLA 1BDAA 3PTNA 4NFEA 3A87A 1O5GH 1C4V2 1IQHA 2QC2A 3S7KB 1CVWH 3UB0A 1GJCB 5JBBS 3M7UA 4M7GA 5EIYA 1MCTA 1C1NA 2VIQA 1C4U2 1TX8A 1GGDC 1QFKH 1UCYE 3DD2H 2CV3A 5AFZH 1CT4E 2PP6A 1HAGE 3L33A 4JK5A 2ZGHA 4NA9H 3L3TA 3H7OA 4CRGA 1ANCA 1TMUH 2QGRA 1LKBA 2H5CA 3BV9B 3F6UH 2Y5HA 1H9LB 4YZUA 3F9HA 3QZRA 2FX4A 1QB9A 3PWBA 3UR6A 5CHBA 2BXUH 1JBUH 3D23A 3GDSA 4AYVB 2FO9A 2W6ID 2QF3A 2F9VA 1QL9A 4FUDA 1QB6A 3LGTA 3U9AH 4ZCNA 3C27B 2HNTF 1A61H 1O2NA 1C1MA 1O3JA 2ZFRH 1TBRH 3A89A 1FDPA 3SJKA 3ZVGA 1ZTKA 2J92A 5EXLA 2GKVE 4XE4A 1C5XB 3MU4A 2ZHEH 1GI6A 1SLXB 3BTQE 1BMMH 3UQOA 1W11U 1A4WH 1IQGA 1CE5A 2J34A 4JZEH 2FI4E 2ZQ1A 2YNBA 1ELDE 5E8EH 1ORFA 4CHAB 3FOAA 1C9PA 3UNQA 4JYUH 2L74A 1CA8B 1L2EA 5TCCA 1AFEH 2TRMA 4X1PU 4NGAH 2QXGA 3V0XA 2RDLA 1Y59T 2Z9KA 1BJUA 1AKSB 1H4WA 1O3GA 1MZDA 2PKAB 3S7HB 1AVGH 1Y3YA 3TGKE 3SI4H 1ZOMA 1Y3UA 3QX5H 1FY1A 3FP8E 1C2KA 1E34B 3TLOA 1J17T 2RDEA 2H2ZA 4FVDA 1KY9A 1WBGB 1F0UA 2H9EH 3M35A 3MU0A 3KQEA 1EAWA 2GMTC 1MUEB 4JZ1A 1H9HE 1DITH 1QBVH 1VZQH 3TGIE 1A3BH 1VJ9U 3UPEA 4KTUA 4MLFB 3ZZCA 3E90B 1S81A 4FXGH 1TRMA 1OWIA 1UTQA 2P95A 1W10U 2XWAA 3E0NB 2XW9A 1FN6A 3BF6H 4AC9A 1CHGA 3SOSA 2XBXA 3OY5U 3SV7A 4K1EA 2ZGBH 1L1GA 1O3HA 1ZR0A 1O2LA 2VH6A 4INKA 4TSFD 2QAAA 2H6MA 3SNEA 4IN2A 2RG3A 1C5YB 2GV6A 2P8OB 1BTUA 1WTHD 4B1TA 2OBOA 1JIRA 3F2HA 1TX6A 2UUJB 3Q00A 2ZTZA 2A31A 3BG8A 4X2YA 2P3TB 4BAQB 1TYNA 2BY7X 2WPHS 4A92A 3OX7U 3DT0H 1K2I1 1AE5A 4TY7A 1GVKB 2M5TA 2B5TB 2EQNA 3RXGA 3ZVEA 4WWYA 2A32A 1NT1A 4UONA 2J38A 2W6JD 4NCYA 1SGYE 2EA3A 3EA9A 1O3DA 1TRNA 3Q76A 1VGCC 1XM1A 2JJ1D 2L6OA 4AFSA 1C2LA 1FAKH 1G30B 1K28D 1OYQA 1XUFA 2VWNA 3DSPA 2V3MA 2VU8E 1NBME 2BQWB 2ANYA 1MKWH 4K69A 1O3OA 2FX6A 4M9FA 3ZZ4A 1C1WH 1GVLA 2RA3A 1FY4A 3SU2A 4B71A 2ZDKA 2CGAA 1TNKA 3SU3A 5C3NA 2VB0A 1GJ4H 3S0NA 3A7XA 4KTCA 3P8OA 1GWAA 3ZVDA 2W3IA 3RXIA 2QXIA 1P2MA 3BG4C 1H8HD 1PQ5A 1HJ8A 5DJ7A 1ACBE 3Q77A 1G32B 1P8VC 1O3FA 4AG1A 4UDWH 2AMPA 2Z9JA 5C1YA 2O8TA 3PRDA 1S82A 4NWKA 5EG4A 3MQKC 1P11E 3IWMA 1O3KA 1UK3A 1TPAE 3TNSA 1CSOE 3RM0H 5GIBA 5E0HA 3BTTE 3U1IB 2IJD1 3AW0A 3CNRA 1CGJE 1W0JD 3DHKH 3OEHD 1SGRE 2HVYB 1K1PA 3JZ1B 2WUBA 1MTUA 3FVFB 3LPRA 1LVMA 3QO6A 1RJXB 2NU0E 3BTHE 3SNDA 2KCOA 2F43B 4OS5A 3P17H 4CBNA 5GJ4B 4UD9H 1UHBB 2BY9X 1DWCH 3UQVA 3MO9A 2ZGXH 3KGPA 1O3LA 3SNAA 1QRZA 2XBYA 1A46H 4IMQA 3SJ8A 5T3HA 2STBE 1W7GH 4FUJA 3LONA 1TQ7B 3QN7A 1EJNA 2HVXA 1UCYK 1HJ9A 2F9UA 3ZZBA 1AY6H 1NROH 1Z8GA 1GBKA 4OGXA 5PTPA 1GJ7B 5FL7D 1NM6A 1FXYA 1FMGA 2AGIX 2F9BH 1GMCG 1P09A 1V2TT 1V2RT 3ZZ8A 3U8OH 1L4ZA 5BPEA 2VNTA 3MMGA 2B9LA 3ATWA 2H9TH 2A4RA 1KTTB 2PR3A 2Y82A 1O2HA 2GZ7A 1XXDA 3TITA 4XBDA 3SHAH 2A2XH 3RP2A 4OS7A 1O3MA 3GYLB 2GP9B 1C1OA 4ABBA 1E1QD 3FAOA 5DP4A 3UREA 4ISOA 2KR7A 4A1TA 4DURA 3EE0B 5J4SA 1P2IA 4ABFA 1GI9B 5FCKA 4Y8ZA 2BLVA 3TNTA 1O3IA 2GVFA 1P2NA 5AHGH 1TALA 1AGJA 1EPTC 4XRNA 4ABHA 1HXFH 2R2MB 1AZZA 1FY3A 1GBMA 4F48B 1JIMA 1XUIA 1TNHA 1V2QT 1S6HA 2G5NA 1J16A 1HAXB 1XXFA 4Q4LA 4PROA 1F0RA 1CBWC 2BX4A 3TJUA 4QT8C 3KIDU 1SLWB 4MTBA 3QUMP 3T25A 3SN8A 3UIRA 1L1NA 4JZIA 3RDZA 2WYGA 4Y7BA 2H1UA 3IG6B 1O35A 1CT0E 1QJ6B 2ZDVH 2D26C 2ZDAH 3RMMH 5HMAA 3RXJA 1GMCF 2KAIB 1D4PB 1SSXA 1LMWB 1Q3XA 4WJG2 1LPGB 3MO3A 3SGQE 3D65E 5CHAC 3F9FA 2CMYA 3ENSB 4ASUD 1FN8A 2FPZA 1QRXA 1EUFA 2WUCA 5DN6D 4K5ZA 4K3JA 2JKHA 1FQ3A 3EGKH 2WPIS 3O8RA 1GDNA 2XYAA 2BOHB 3RM2H 4FU7A 5C1UA 3SGBE 1CBWB 1OWDA 3ZZ7A 5EPNA 2A0QB 5GCHG 5ETXA 3RMLH 1H8IH 4DT7B 1LVBA 3MTYA 4RSPA 3LGUA 4MNXA 1D3TB 1TWXB 3M3VA 5AVDA 1O3EA 1OX1A 2BHGA 3RXSA 4Z1MD 1QHRB 3M5OA 1EB2A 1CU1A 2EC9H 2Y81A 3H7TA 1K22H 4ISNA 5CHAB 1K1JA 3M61U 5F6MA 1JXPA 1ELFA 2C8YB 5HYOA 2BZAA 3RMNH 4DW2U 1C1TA 5HIYA 1VITH 1Z6EA 1P2OA 4X8SH 5EJLA 1YPHE 1JWTA 1A2CH 1A1RA 3BTKE 4Y79A 4J2YB 1PPGE 2GGVB 1TGTA 2KZ4A 2ZDLA 3QGNB 1YPKH 2AH4X 1NFUA 1MTWA 2ZPSA 1TONA 3SORA 1HAIH 3K9XB 1J8AA 4Q80A 1VJAU 2GTBA 1F5KU 4UEHH 1O2WA 3QLPH 1E35B 2SGPE 1NFXA 2O8UA 2NU3E 3BTFE 4I8HA 1G36A 4ZKRU 1GJ8B 3NCLA 4IN1A 5DPAA 3SI3H 1ZYOA 5JBTA 1O2KA 1P12E 2VVUA 1D3DB 4NIXA 1QIXB 4NIWA 4OS4A 1MKXK 2FODA 2VVVA 3E0PB 2ZGCA 2ZWLH 2LPRA 4NFFA 5F53A 1TLDA 3LT3A 3AAVA 1GL0E 1TB6H 1AUTC 1RTKA 2PLXA 1A0JA 5K0HA 4ZMAH 2ANKH 3Q3KA 1GBEA 3QGJA 4MVNA 1QJ7B 4BNRA 3RXMA 1HXEH 4FU8A 1G3CA 1C1SA 1Q2WA 2SGFE 5C1XA 4RI0A 4ZHLU 5GXPA 1DWBH 2OXSA 1AO5A 1OWJA 1MKWK 4OM9A 1SQRA 4FUIA 4WH8A 1UVPA 3OYPA 1EKBB 1K9OE 2A7CA 2QXHA 1SGEE 3A81A 3E1XB 1GHWH 3WWBA 3OU0A 1EAIA 4B2CA 2KCYA 1PQ8A 2D2DA 2FOEA 1THPB 1K1LA 1NU9A 1EOLA 2VJ1A 3S69A 5IDKA 2ZCLP 4K60A 1BITA 4R8TB 4BXSA 1T8LA 3BEFB 3OY6U 3OAAD 1N1LA 3UUZA 2FMJA 3PV4A 2ZFQH 4NA8A 1O5FH 1SGDE 3SJOA 1ZRBA 3K65B 1K1MA 3RXPA 4RT1A 2SGAA 1F92A 1WV7H 1ZRKA 1BQYA 1KLJH 4B73A 4DOQA 1NRQH 1TNIA 1O3NA 2P94A 5EW1H 4X1NU 2OLGA 3S9AA 1E79D 2A45B 1V2MT 3T2NA 1O31A 2NU2E 3PO1C 2OC7A 1TGCA 3OTJE 1ZGIA 1FZZA 1H8ED 2C90B 2XXLA 2YMSD 5A8ZA 2Y6TA 1O3PB 3BTME 1HAZB 1YGCH 5A8XA 3CENA 4AORA 2IJOB 4ZXXH 2BOKA 3F1SB 1MD7A 1BUIA 3MH4A 1IHSH 3DSGA 2JETB 4FUCA 4AOQA 1HLTH 2ZDNA 1ABJH 3A83A 1MKXH 1TOCB 1CHOG 1GMDG 1GHBG 1YPJH 2OCVB 5H4IB 2W5EA 4MNYA 3GY4A 1NN6A 1C5UA 3MNCA 3TJOA 3RU4E 4ABGA 2IOTA 1LHFH 1YCPH 1TE0A 3OSYA 1NRNH 3M3SA 3Q3XA 4DIIH 4ABJA 1J15A 2ZHWH 3PLKA 4UFFH 2R0KA 1GDQA 2RCEA 1WAYB 2G51A 2CF8H 2ZIQH 3JZ2B 1RIWB 3V12A 2QYIA 2FIRH 4DGJA 2CXVA 4MG3A 3IITA 4YESB 1P9SA 5EQSA 3LGIA 1GCTC 1GGDB 1P0SH 2F9OA 4HI3A 1J14A 4X1SU 4DT4A 1O3BA 1SOTA 1ZTJA 3BTEE 1BBRK 3M5NA 1K21H 1SOZA 5FPSA 1FNIA 4LOYH 4YOJA 2UUKB 4X2XA 1CA0B 1SQOA 1EJAA 2F4LA 1S5SA 5L6NH 2ZZUH 3SNBA 4A1VA 4AB8A 2VWMA 4YM9A 1O32A 4WY3A 3SO3A 5E0JA 3STIA 3SV2H 3QTOH 1MTNC 2J4IA 3A7VA 1SG8B 4GLYA 1ZZZA 3MI4A 4SGBE 2GJGA 2A7HA 4AGJA 2HALA 1EATA 4X6NA 1T31A 2HLCA 2ZFPH 1QY6A 1UTOA 1W0ZU 3W1EA 3NK8A 2ZU5A 4OGYA 1LQDB 1F5RA 5EQQA 1GL1A 3RC5A 5FX6A 1HYLA 3HKIB 3E16B 1AFQB 3A85A 3SQHE 1O2UA 1BTYA 3KN2A 1OP2A 1GI0A 1QQ4A 1TGNA 1NRPH 1BIOA 1ARCA 4TY6A 3SQEE 2VIDA 4INLA 3ZV9A 4IC6A 3GICB 1JMOH 3AAUA 2SFAA 3C1KA 4RKJB 4WXVA 1C5TA 5LPRA 1QL7A 6CHAB 3RXKA 4Q7ZA 1HRTH 5HXFA 1CHOF 1GMDF 5G4BA 3P95A 1WOFA 1INCA 1DANH 2ESTE 3I77A 3K6ZA 2A7JA 1ZLRA 2QF5A 2OK5A 1MAXA 1OP0A 3PV2A 1P06A 4BXWA 1NRRH 1A0HB 1AVXA 3OE7D 4MNWA 3KYGA 2Z3CA 1EPTA 3DUXH 4HFPB 1W0KD 2O8LA 1TBZH 3MWIU 3PTBA 2BLOA 3BN9A 2ZP0H 1ZPZA 2OBQA 1XUGA 1TQ0B 1TPSA 2J95A 1XUJA 4JMYA 3VXFH 4I8KA 1GDUA 2A5AA 3O8CA 1EX3A 1D9IA 2WPDD 3SW2B 3CP7A 4H6SB 2A4OA 1Z71A 7LPRA 2PFEA 1YPGH 2XCFA 1DUAA 3RUOA 3FFGA 2P8OC 2ANWA 2FOBA 3LDXH 4TWYA 1DY9A 3U8TH 1GPZA 2PSYA 3A84A 5DG6A 4Y8XA 4AFZA 4Y8YA 5LH8A 4CR5A 1W13U 1HPGA 1KSNA 1D6WA 1UMAH 4FUGA 3P8NA 4DJZB 3F68H 1LHCH 2HNTC 2VGCC 1TNGA 2IN2A 2XBVA 1K0HA 4GSOA 2PUQH 4U30A 1Y5BT 2EEKA 3EE7A 4TT3D 1GBHA 1W2KH 1ZJKA 3FP7E 1YPHC 3F9EA 5F8TA 2QY0B 3FP6E 4B2AA 2BD3A 3UOUA 3HK6B 2ZNKH 1SI5H 4FUFA 5DKMA 3ELAH 1N6YA 1EXFA 3LC3A 1ZGVA 1MTSA 3KQBA 1O37A 1MBQA 1EFRD 1P03A 2V0BA 4D76A 1V2OT 1UTMA 4YOIA 4DG4A 3SBKA 1KXBA 1MU6B 1MQ5A 1VCQA 4F55A 3AK5A 3LJOA 2C8ZB 2LELA 2QF4A 3ZVCA 1V2LT 6ESTA 3GY8A 4ZAEA 1AB9C 1C5WB 3BG4B 4YO9A 1T8NA 1RRKA 3RU4D 1DPOA 4VGCB 2EI6A 4Z6AH 1OWEA 4YXWD 1PYTD 1W0YH 2PUXB 3GDUA 1GHAG 3LH3A 3PMJA 2ZFFH 4TPYA 5EOKA 2ZHQH 4JCNA 3ZZ9A 1FPHH 1KDQB 2YMSB 4UFDH 2J5UA 1FI8A 1COWD 1TA2A 3PMAB 4FETA 1BHXF 3VB4A 5E0GA 1V2WT 5FXLA 1HAVB 1QNJA 2VIPA 1K1IA 1BA8B 1MAYA 1N6XA 1C5RA 1SKYE 1O2PA 5A09A 3SNCA 1UK2A 1TABE 5FHTA 3E6PH 1CQQA 1DWEH 1O2XA 2TPIZ 5TCAA 4DIHH 5A0BA 3MH6A 5C2ZA 1NC6A 2ZCHP 1YPEH 2EY4C 1QZ8A 1B7XB 3PLPA 4H4FA 2DE9A 4AG2A 1FONA 2BDIA 1HCGA 1ID5H 1PYTC 2KM0A 5K7RA 2FOFA 1HB0B 2AYWA 2R9PA 3SJ9A 1C4Y2 1P05A 1P01A 1SLVB 5TJXA 1NTPA 4ABDA 2ZF0H 3RXFA 5LPFA 2ZPRA 3KCGH 3VB3A 1TX7A 4MQAA 1S83A 1NZQH 2C8WB 1Y3XA 2FYQA 4NSVA 1UJ1A 4HTCH 4AN7A 2WV4A 2F9NA 1GBLA 4D7GA 2XC4A 2WPMS 1P04A 1O0DH 1ZTLA 1C5PA 1G9IE 2BX3A 4Y7AA 9ESTA 3DFLA 4KTSA 1C5LH 5DP3A 4BAOB 1LHGH 1XUKA 4DCDA 2FOAA 1QBNA 2BTCE 4X8TH 1ELAA 2A1DB 2FTLE 4KELA 3BEUA 4ZH8A 1Y8TA 3KYFA 3RXBA 2AGGX 3GY6A 3SU1A 3QDZB 1DDJA 2OQ5A 2HPPH 4XOJA 4MNVA 3ODFA 1IAUA 4P02A 3SU4A 3A7TA 2I6QA 3WY8A 1IQIA 3LGYA 1MD8A 1ANDA 1DFPA 1MQ6A 1VKYA 3RLWH 1ELTA 3A86A 1HJAB 2G55A 5L2YH 1QR3E 2QXJA 2IPHA 3AVZA 2G52A 2D1JA 1BMFD 1DSTA 2JH6D 3SUGA 1TOMH 4X0WU 2QV1A 1EOJA 1DVAH 1NFYA 3NPSA 2FZZA 4UFEH 1YKTA 1TMBH 1Z8IB 1KXFA 3MO6A 2Y5FA 3N7EA 1F2SE 1AN1E 3KQ5A 3TH4H 5GDSH 5JDUB 1C2JA 3A8AA 3MU8A 3O8DA 3ZYDA 1ZMNA 2ODQA 2STAE 3GY7A 1DLKB 5T1VA 2UUYA 5LGOA 2WINI 4MPXA 2FOGA 2G4TA 4NA7A 5KECA 1E37B 3B23B 2A5IA 4ESTE 1XKBC 3ZZ5A 2PKSC 3ZYEA 3I78A 1PPZA 4XFQA 4LZ4B 1SGIB 2TGTA 4I7YH 1TFXA 7GCHF 2VWOA 5DP7A 1IQEA 3GCTG 2OUAA 2GCTB 4YTAA 5CE1A 1HAPH 4Y0ZE 1UO6A 3RXUA 1DXPA 3H09A 3ATIA 1RTLA 3EDXB 2CN0H 3NRLA 2VWLA 1P2JA 3BTDE 9LPRA 4YLUA 1RS0A 1L0ZA 1EAUA 4RKOB 1AMHA 2BDBA 3PV5A 3E91A 1HNEE 1H8DH 1TNJA 1P02A 1YLCA 3VB5A 1G3EA 1YY3A 2FM2A 1ZJDA 3F0PA 4MPUA 1D3QB 1MZAA 1CGIE 1TGSZ 4NG9H 3T62A 2ANMH 2J94A 3S9BA 1EPTB 3LC5A 1NU7B 2BDAA 2ZI2H 1AE8H 2D8WA 1ETRH 1F5LA 1WQVH 1HAYB 3CS7A 1AHTH 2BD7A 3N7OA 4K1TA 4ZUHA 1C5VA 3FN8A 3QWCH 1BB0B 1AI8H 1D6RA 3NWUA 4FU9A 3TJVA 2ZU3A 5HM9A 2CF9H 2H5DA 2ULLA 4SGAE 2KX4A 1C5OH 2K1QA 2ZO3H 2HNTE 3B9FH 3HK3B 3H5CB 4YT7H 4U01A 4XD7D 1TBQH 3ZZ6A 2WV9A 4ABAA 4BTTB 3VGCB 1V6DA 1MMJN 1YF4A 3U28C 1T32A 4UFGH 4GHTA 2ZGJA 3RXCA 2HRVA 1H9IE 1HJAC 3GS9A 1PPHE 4AX9H 2QCYA 3ATLA 1PPEE 1MU8B 1O39A 1BRAA 1DLEA 4Y76A 4CR9A 2J9NA 2W7SA 3DCLA 5FPYA 1ETSH 1BCUH 1V2UT 1FIZA 5C17A 2BVRH 3VFEA 1C9TA 2PSXA 1SFQB 4FUEA 5FAHA 5DSFA 2AIQA 1S6FA 4K2YA 1IQLA 3VGCC 1YWUA 4GHQA 2FOHA 2O9QA 2TGAA 1SGPE 1FJSA 5ABWA 1NFWA 3PRBA 1A3EH 3R0FA 1QA0A 4X2WA 3RXLA 4BAHB 2DE8A 4FUHA 1AIXH 3R3GB 1E36B 4TWWA 1HFDA 3MNXA 1GMHG 5B6LA 1JOUB 1F0TA 1VR1H 1FUJA 2GCTC 5E2OA 3UWJH 2P16A 1QJ1B 2GDEH 1K1NA 4GUXA 4NWLA 1DY8A 4KP0A 1P3CA 4TPIZ 1Z8RA 3T29A 2ALVA 1AUJA 2UWPA 1O2YA 2F9PA 1TA6A 3SUFA 1DWDH 5I46H 1XVMA 2ZU4A 6LPRA 3URDA 2QE7D 2Q6FA 1JRTA 4A1XA 2ZHDA 1DOJA 3MYWA 1QRWA 1XX9A 1Z1IA 3PO1B 3KEEA 1EZSC 1W12U 2OINA 1GHXH 2UUFB 4I86A 3TGJE 1VITG 3FZZA 1UVOA 1SC8U 1TGBA 3NUMA 4XBCA 4RT0A 2LP6A 3MU1A 4XBBA 1O30A 1FAXA
chains in the Genus database with same CATH topology
3P6ZB 2ODYB 1QL8A 1AQ7A 1C1PA 1E38B 3KHVA 3RXEA 1BTWA 1EP5A 2JETC 5BRRE 2ZEBA 8GCHF 5HGGA 1O2TA 5A2MH 4I31A 2AS9A 3T26A 2A2QH 1C2DA 1GBDA 1Z7KA 4K8YA 2OD3B 3ATMA 5C67A 4X6PA 2XTTB 4H6TA 2BDGA 4Q2KA 3SV6A 2OC0A 1KXDA 1HUTH 3RXTA 2P3UB 1CT2E 3A8CA 3LH1A 3GY2A 2Q6DA 3T28A 4ZKNU 1THSH 3NZIA 2BDYA 5DP8A 4CH8B 2V3HH 3D62A 1ZHMA 3HATH 2FOCA 4OS1A 5F8XA 2ZA5A 8KME2 1OS8A 1GI7B 3HGNA 4Q7YA 1QGFA 1Z6JH 4WMEA 2FI5E 3BIUH 1GCTB 4KGAA 4WVPE 3KL6A 5DK1A 2BY5X 2ZU2A 1BMAA 1PFXC 3RXRA 3A80A 3SGAE 1SGFG 1C1RA 4THNH 4NIYA 1BOQA 1UTJA 1YCPK 2AIPA 4GCHG 4D9QA 3GY3A 1ABIH 4IW4E 3TK9A 1LVYA 2PW8H 3EQ0H 2I6SA 3TIUA 1GG6B 1GBJA 3VB7A 2Z9GA 5JYIA 2GT8A 4LXBH 3F9GA 3GOVB 1G2LA 3SHCH 3SUDA 1YYY1 4YT6H 1C2GA 1UTLM 3LOXA 4O9VA 1ANEA 2BVXH 1KYNA 1UCYH 8LPRA 1T8OA 1W7XH 1AVWA 1HAOH 1P3EA 1WTGH 1W8BH 3HGPA 1G3DA 3U69H 2ZFSA 2XC0A 3RLYH 3ITIA 4YLQH 1BTZA 1DSUA 2PWXA 2YNAA 1T8MA 1BBRH 1MCVA 1ZHRA 2ZECA 1TAWA 1KLTA 4D8NA 4F4OC 1V3XA 4ZHMU 3GDVA 1GBAA 2C3SA 3W95A 1DS2E 1SMFE 1DE7H 3PM3A 3TH3H 4JYTA 2ZDMA 1SLUB 4I8GA 1NY22 1IHTH 1XMNB 4NZLA 3TPIZ 2Z7FE 4Y6DA 2UWLA 6GCHG 5DP9A 1GHYH 4X1RU 4LZ1H 1ZMJA 1L1JA 1HAVA 1A7SA 2VINA 2QA9E 2J2UA 3EA7A 4K1SA 2BDCA 3LGVA 3UY9A 3ZZAA 1CA0C 2OC8A 1GI1A 1HIAA 1FPCH 1UTNA 1O2MA 2BVSH 3BTWE 5A0AE 1DUEA 2F83A 1BHXB 2QIQA 1PPCE 5EXNA 3KQCA 5B6OA 5DP6A 4NZQA 4CREA 1YBWA 2H9HA 1SGCA 1GJ6A 1ANBA 1GMHF 3T5FH 1AD8H 2G8TA 2VGCB 1YCPM 3LJJA 1VGCB 1DM4B 4ABIA 1HBTH 1DXWA 5EQRA 1OWHA 5FBIA 4BTUB 1O5EH 2UWOA 3A7WA 3TK5A 4IC5A 1GBCA 1UTPA 2BY6X 3CS0A 2BB4A 4HGCA 2ALPA 1ELVA 4X2VA 3RXVA 4DVAU 1C2FA 3UWIA 1B0EA 2B8OH 4E05H 2FS8A 1K1OA 1Y5UT 3PMBB 4MPWA 5CMXH 1MH0A 1QURH 3NXPA 1OXGA 1GBTA 1SQTA 3RC4A 2SGQE 1QTFA 2PV9B 1C5SA 3AASA 5T6DA 2DUCA 4O3UA 3M7TA 1S0QA 1O2OA 2QF0A 1N8OC 2P59A 1O5AB 5L30H 2FTMA 4F49A 1YPLH 5JB8S 3BSQA 2W26A 1SHHB 3SU0A 1ZSLA 2ZHFH 3P8FA 1ARBA 3K2UA 1YM0A 4ZHAA 5AF9H 1GJAB 5ESBA 4OS2A 2W7UA 3FZDA 3SZNA 3MFJA 3S9CA 4WXIA 1BTHH 2OQUA 4BTIB 2EI7A 4Y71A 1C1VH 2BLQA 1ZSKA 1O3CA 1AZ8A 2PTNA 1AU8A 1XKAC 4JZDH 1OSSA 1U6QA 4CHAC 5T6FA 4A6LA 3B8JA 3A7YA 3P8GA 4WH6A 1O36A 2VIOA 3K6YA 4GAWA 2BY8X 2FESH 1UTKA 5A8YA 1UVUH 3RXOA 3BEIB 2BD9A 4OS6A 1KXCA 5DGJA 5F03A 1SGFA 5C5NA 1O34A 3BIVH 3M37A 1E0FD 1WUNH 4O03A 3SU5A 1B0FA 1OP8A 1MBMA 1EJMA 1PPBH 4O3TA 2NU4E 1S0RA 1EZUC 4Y11E 6CHAC 1C2EA 1KXAA 5SGAE 1P9UA 1UHBA 3GISB 4WMFA 5E2PA 2ZKSA 4LK4A 3ZVAA 1RGQA 2BM2A 1LHEH 2FS9A 1CO7E 1RIWC 2G4UA 2R3YA 4IS5A 1OWKA 5FBEA 1W14U 1O38A 5GPIB 2AERH 2FP7B 1H1BA 1WSSH 2A4GA 2Y80A 2OTVA 3EAJA 5F8ZA 1HV7A 1BMNH 3ATKA 2VH0A 3O8BA 4A7IB 4X6MA 4VGCC 1NS3A 2V35A 2Y5GA 2YOLA 1SGTA 1G3BA 3PB1E 2LNCA 5C5OA 3SJIA 1GJ9B 1YP9A 3ZVBA 2NU1E 4U32A 3GCTF 2BMGB 3HPTB 3AW1A 2AGEX 2TGPZ 1C5NH 5I25A 1MTNB 3LU9B 3PLBA 4GCHF 4X8VH 1P57B 3SV8A 2ZFTA 1KXEA 2XNIA 3RXQA 4ASHA 1O2IA 1ZSJA 2GD4B 1EB1H 2VIVA 2R0LA 3STJA 4E7RG 4HZHA 2GMTB 2FI3E 4X1QU 4Z0KA 5JBCS 3ZVFA 3P70B 1IOEA 3DFJA 3EA8A 3MNBA 5L2ZH 1RXPA 1N8OB 1AFQC 3ESTA 1WCZA 4RN6A 2A4QA 2WPKS 3M7QA 1V2NT 1QCPA 2JH5D 2ZC9H 1AWHB 3PYHA 1XUHA 1ESTA 5EPYA 4X8UH 4J1YA 2C93B 2ZPQA 1HAHH 1V2VT 1GBIA 2FOMB 2BQ6B 2F91A 4A5TS 5DO4H 1DICA 2OP9A 1ESBA 2BXTH 1OOKB 1FV9A 3GY5A 4O97A 5EODA 5JB9S 1DT2A 1GI3A 2FWWA 2G00A 1EASA 1YPMH 1AB9B 3PMHB 1C5QA 2ZG0H 3GCOA 3GCHC 2OC1A 2Q6GA 3QTVH 1ZPCA 4AYYB 2GZ8A 1ZMLA 1GCDA 3U98H 1M9UA 3E3TA 4GPGA 1PQAA 5EGMA 1O2RA 2QN5T 1QBOA 2FLRH 1NRSH 5EW2H 1Y5AT 1GJDB 4IGDA 1OKXA 4CBOA 4ISHH 2GCHG 1TMTH 1THRH 2BD2A 1IQNA 3U8RH 2Y7XA 1SFIA 5LPEA 1SHYA 1ZPBA 1WQSA 4INHA 2Y7ZA 4IMZA 3TVJB 2GDDA 2GT7A 3P92A 3RXHA 1FIWA 3GCHB 3M36A 1QB1A 1Y3WA 1HIAB 1GVZA 4FVBA 1LO6A 1NPMA 1S85A 1V2JT 2GX4A 4Y10E 4DY7B 1GI8B 2C8XB 2HWLB 4U2WA 2GCHF 2PTCE 4AGKA 1C1QA 3RXDA 2BD8A 2ZCKP 7ESTE 1C1UH 2PKAA 1ESAA 3RMOH 4MPVA 2P93A 1GBBA 3VB6A 2FDAA 4FUBA 1KDQA 1WYKA 1GHZA 2B0FA 2BZ6H 2R2WU 2WPLS 2ZTXA 2BD4A 4MDSA 3QZQA 1O5CB 1JRSA 1BJVA 1Z8JB 1TRYA 2C4FH 5GCHF 2AEIH 3MOCA 1P2KA 1O2ZA 2WPJS 1TPPA 1O2GH 3A8BA 4I8JA 1WU1A 1OPHB 1SR5C 2SNWA 1PQ7A 3NKKA 3TH2H 2P3FH 4H42U 4JYVH 2AFQB 1GHAF 1T4UH 3A82A 4CH2B 3M5LA 2CHAC 3UTUH 4Q7XA 1V2ST 1O2QA 3KQDA 4CRBA 4B74A 1LTOA 2O8MA 1W3CA 1F0SA 1TIOA 5FPTA 4WMDA 1GI5A 1BRBE 1HDTH 1TNLA 5T6GA 2RA0A 2FLBH 4XDEA 1Q31A 3M5MA 3PROA 1LPZB 1RFNA 5EU8A 2EI8A 2Q1JA 4B75A 1LCYA 6GCHF 2BYAX 2FEQH 2TGDA 4AFQA 1D3PB 1SBWA 1SB1H 1KTSB 1G2MA 3UOPA 1BRUP 2Z3DA 1Z1JA 3MNSA 2ILNA 4ZROA 3A7ZA 1EAXA 4TYDA 3ZZ3A 1BTXA 3G01A 2Z9LA 1GJ5H 2KAIA 2FYRA 1KLIH 1C5ZB 1VCWA 2PKSB 4CRAA 3UNSA 1BBRE 1ZHPA 2XCNA 2SGDE 3U1JB 2GV7A 1A5IA 3ZV8A 1X7AC 1SQAA 4D7FA 4KKDA 2TIOA 4AB9A 5AFYH 2V6NA 1GG6C 3LKWA 4NIVA 1AKSA 2A5KA 4ABEA 3URCA 3MHWU 2ZTYA 1ETTH 2AMDA 1G37A 3T27A 4YOGA 1RTFB 4XSKU 3SUEA 3I29A 1SPJA 2XBWA 2ZQ2A 3FANA 2XWBI 3GCNA 1RD3B 2WV5A 2PGBB 4X6OA 1O5BB 1FLEE 3MH7A 1B5GH 1O5DH 4ZKSU 3RXAA 3V13A 4B76A 5FCRA 1OYTH 1BT7A 1T4VH 5J4QA 2ZU1A 4NSYA 1F7ZA 1UVSH 1GBFA 3A8DA 5DP5A 4AFUA 2CJIA 1O33A 1VITF 4AZ2B 5GWZA 3VXEH 2XRCA 3DA9B 3TJNA 2R3UA 4ISIH 3UNRA 8ESTE 4I33A 1SL3A 3D49H 1KIGH 1ELBA 1EZXC 4JZFH 1BTPA 1LKAA 1S84A 4E7NA 2Z6BD 1C2IA 1LVOA 1LPKB 3L6PA 1IQMA 2W3KA 2CHAB 1BZXE 2THFB 3RC6A 1UVTH 3ODDA 1LQEA 2VVCA 1EZQA 1IQJA 4ZKOU 1PPFE 1O3AA 1GHVH 1C5MD 1O2SA 1QA7A 5FX5A 1BRCE 3V3MA 4E06H 1ELCA 4WF8A 1P10A 1GI4A 5JPMH 3MU5A 5C20A 1J9CH 1T7CA 3A88A 1SVPA 1YLDA 4CRDA 3LGWA 8GCHG 3RU4T 3TU7H 1A0LA 2HOBA 2WYJA 4I32A 7KMEH 1A5GH 3VPKA 1O2JA 3SU6A 1GI2A 1VCPA 1IQKA 2Z94A 1EQ9A 2F3CE 3M3TA 1EP6A 4IBLH 4BAKB 4GVUA 2G81E 1C2MA 7GCHG 2BDHA 1ELEE 2GZ9A 3QK1A 3W94A 2PHBA 1IQFA 4I8LA 2ASUB 3MH5A 4ZXYH 3UR9A 2Z3EA 3E8LA 3HKJB 2VIWA 5ESTE 2BD5A 2ODPA 3BTGE 5A0CA 3TK6A 2HPQH 2O8WA 2HGTH 2AMQA 1PJPA 1UK4A 1MTVA 5EXMA 1LHDH 4JK6A 4CRCA 2FXRA 2V3OH 4R0IA 4ISLA 3GYMA 1V2PT 2G5VA 3ZZDA 4B2BA 1FY5A 1HGTH 3PWCA 3SV9A 1GJBB 1SGQE 1CGHA 2TBSA 1A5HA 3KNXA 1Y3VA 1XVOA 2B7DH 2NWNA 3V7TA 3KF2A 1ELGA 3VEQB 4Y0YE 1V2KT 5JBAS 2XC5A 4BOHA 1C2HA 3UFAA 3LIWA 1YC0A 4UE7H 3Q3YA 1O2VA 2SNVA 1NESE 1GHBF 2SGEE 1FY8E 4BANB 1L4DA 4K8BA 2BLWA 4BAMB 1QQUA 1SGNE 2Z9IA 2JH0D 4CRFA 4D9RA 1DX5M 1P2QA 5HM2A 5IYTA 3EYDA 1LDTT 1NO9H 2PGQB 2BQ7B 1AWFH 1TPOA 1BMLA 1BDAA 3PTNA 4NFEA 3A87A 1O5GH 1C4V2 1IQHA 2QC2A 3S7KB 1CVWH 1GJCB 5JBBS 3M7UA 4M7GA 1MCTA 1C1NA 2VIQA 1C4U2 1TX8A 1GGDC 1QFKH 1UCYE 3DD2H 2CV3A 5AFZH 1CT4E 1HAGE 3L33A 4JK5A 2ZGHA 4NA9H 3L3TA 3H7OA 4CRGA 1ANCA 1TMUH 2QGRA 1LKBA 2H5CA 3BV9B 3F6UH 2Y5HA 1H9LB 4YZUA 3F9HA 3QZRA 2FX4A 1QB9A 3PWBA 3UR6A 2BXUH 1JBUH 3D23A 3GDSA 4AYVB 2FO9A 2QF3A 2F9VA 1QL9A 4FUDA 1QB6A 3LGTA 3U9AH 3C27B 2HNTF 1A61H 1O2NA 1C1MA 1O3JA 2ZFRH 1TBRH 3A89A 1FDPA 3SJKA 3ZVGA 1ZTKA 2J92A 5EXLA 2GKVE 4XE4A 1C5XB 3MU4A 2ZHEH 1GI6A 1SLXB 3BTQE 1BMMH 3UQOA 1W11U 1A4WH 1IQGA 1CE5A 2J34A 4JZEH 2FI4E 2ZQ1A 2YNBA 1ELDE 5E8EH 1ORFA 4CHAB 1C9PA 3UNQA 4JYUH 1CA8B 1L2EA 5TCCA 1AFEH 2TRMA 4X1PU 4NGAH 2QXGA 3V0XA 2RDLA 1Y59T 2Z9KA 1BJUA 1AKSB 1H4WA 1O3GA 1MZDA 2PKAB 3S7HB 1AVGH 1Y3YA 3TGKE 3SI4H 1ZOMA 1Y3UA 3QX5H 1FY1A 3FP8E 1C2KA 1E34B 3TLOA 1J17T 2H2ZA 4FVDA 1KY9A 1WBGB 1F0UA 2H9EH 3M35A 3MU0A 3KQEA 1EAWA 2GMTC 1MUEB 4JZ1A 1H9HE 1DITH 1QBVH 1VZQH 3TGIE 1A3BH 1VJ9U 3UPEA 4KTUA 4MLFB 3ZZCA 3E90B 1S81A 4FXGH 1TRMA 1OWIA 1UTQA 2P95A 1W10U 2XWAA 3E0NB 2XW9A 1FN6A 3BF6H 1CHGA 3SOSA 2XBXA 3OY5U 3SV7A 4K1EA 2ZGBH 1L1GA 1O3HA 1ZR0A 1O2LA 2VH6A 4INKA 2QAAA 2H6MA 3SNEA 4IN2A 2RG3A 1C5YB 2GV6A 2P8OB 1BTUA 1WTHD 4B1TA 2OBOA 1JIRA 1TX6A 2UUJB 3Q00A 2ZTZA 2A31A 3BG8A 4X2YA 2P3TB 4BAQB 1TYNA 2BY7X 2WPHS 4A92A 3OX7U 3DT0H 1K2I1 1AE5A 4TY7A 1GVKB 2M5TA 2B5TB 3RXGA 3ZVEA 4WWYA 2A32A 1NT1A 4UONA 2J38A 4NCYA 1SGYE 2EA3A 3EA9A 1O3DA 1TRNA 3Q76A 1VGCC 1XM1A 4AFSA 1C2LA 1FAKH 1G30B 1K28D 1OYQA 1XUFA 2VWNA 2VU8E 2BQWB 2ANYA 1MKWH 4K69A 1O3OA 2FX6A 3ZZ4A 1C1WH 1GVLA 2RA3A 1FY4A 3SU2A 4B71A 2ZDKA 2CGAA 1TNKA 3SU3A 5C3NA 2VB0A 1GJ4H 3S0NA 3A7XA 4KTCA 3P8OA 1GWAA 3ZVDA 2W3IA 3RXIA 2QXIA 1P2MA 3BG4C 1PQ5A 1HJ8A 5DJ7A 1ACBE 3Q77A 1G32B