1SGFA

Crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
228
structure length
203
Chain Sequence
NSQPWHVAVYRFNKYQCGGVLLDRNWVLTAAHCYNDKYQVWLGKEEPSDQHRLVSKAIPHPDFNMSLLPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKLGSTCLASICVNLKLLPNEDCDKAHEMKVTDAMLCAGEMDGGSYTCEHDSGGPLICDGILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMANNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Growth factor
molecule keywords NERVE GROWTH FACTOR
publication title Structure of mouse 7S NGF: a complex of nerve growth factor with four binding proteins.
pubmed doi rcsb
total genus 36
structure length 203
sequence length 228
chains with identical sequence X
ec nomenclature
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgfA01
1EB1H 5EG4A 1C1UH 3PMJA 3SI4H 1JBUH 1ZHPA 1RFNA 1O2UA 1O0DH 1Y5BT 4AFUA 2J92A 4MQAA 2QXGA 3RC4A 1E35B 3RU4E 3SU1A 1G36A 4WWYA 4DW2U 4UDWH 1KYNA 3ATLA 2FI3E 4JYVH 4TY7A 2P94A 4DVAU 5CMXH 1FONA 3CS7A 1HAOH 1V2LT 2Z9IA 4YLQH 5C5NA 1H8IH 1DOJA 3A89A 1ELVA 2P93A 1GMHF 1GL1A 1SGYE 1K1OA 2B0FA 1GJ7B 2RA0A 1W11U 1V2OT 4I8LA 4K1TA 3QTOH 1EAIA 1CSOE 1GBAA 1G37A 1HAGE 2WUBA 4XBBA 3RMLH 1HB0B 4XDEA 1BMAA 3BF6H 3UR6A 3ZZ8A 1MKWK 3HKIB 4I31A 3GISB 1D3DB 1NFYA 2G81E 2TPIZ 1O2SA 3K6YA 4KELA 1VCQA 1NRPH 1KIGH 1XMNB 1BITA 1QNJA 3P8GA 1ZZZA 2ZF0H 3FP6E 4UFDH 3T29A 2BX4A 2BQWB 3KNXA 3GDSA 4ABJA 5DO4H 3ATMA 4IW4E 1GVLA 2EA3A 3W95A 3F68H 4NGAH 3Q3KA 3SNBA 1ZOMA 4IMQA 2UUKB 2FEQH 2RG3A 1TA6A 3GDUA 2CF8H 4AG2A 3I78A 1EAUA 1L4ZA 2Z9GA 1WBGB 2BDYA 2ANWA 1W0ZU 2CV3A 4NSYA 1GBJA 1P2JA 4A1XA 1WTGH 2LPRA 1P2KA 2JETB 2CJIA 1C1PA 1K28D 3JZ1B 3BEUA 4ABGA 1PPCE 1GI9B 3KCGH 1L0ZA 1UTNA 1CVWH 3ZZ4A 1EUFA 1NFXA 4XBDA 1GHYH 2H9EH 1XUHA 2IOTA 3MNXA 3TLOA 1BMLA 1TRYA 3ODFA 4TWYA 1FNIA 3SU5A 4AFQA 1SMFE 4H6TA 1IQNA 1S5SA 1S0QA 4FUFA 2ZFPH 1AFEH 2SGQE 3U8RH 1PQAA 1OSSA 1BTYA 5JB8S 2A5AA 1QCPA 4U01A 3E6PH 2ANMH 1O2WA 2BXUH 3F9GA 3P8NA 4BAKB 2CGAA 1F0UA 2OC0A 3KGPA 3QLPH 5K7RA 3R0FA 1BB0B 2GT8A 4ABFA 2OLGA 2OQUA 2BOKA 1C5OH 5EXMA 3RXTA 1ZYOA 2Y5FA 1GGDC 1K1IA 2XCNA 2PFEA 3O8RA 2HALA 3A80A 3LH3A 3MO3A 1NT1A 3DUXH 5E8EH 3SJKA 2GCHG 3RXIA 1NESE 1EP6A 1A1RA 5FPTA 3ITIA 3O8BA 2PLXA 3UWJH 1PFXC 4TYDA 1TOCB 1NRRH 4U32A 1PYTD 1FY1A 1O33A 1YYY1 3RXDA 4AYVB 1DPOA 3K9XB 3RXMA 1YPEH 4CRCA 2EC9H 4OGYA 1GBDA 2FM2A 2Y7ZA 1HAHH 1DX5M 2PTNA 1O3BA 2C8ZB 1TGSZ 2FOBA 1EOJA 3SV9A 3VPKA 3ZVAA 4IGDA 3QK1A 4XFQA 3SNEA 1AKSB 5F8ZA 1J9CH 5I46H 1TFXA 1VITF 3RXQA 1DUEA 4ISLA 1CBWB 2FOGA 3PWBA 4AOQA 1ZSKA 1GI2A 2HNTE 2ZU4A 4Y8YA 5LPEA 1GCDA 2PKSB 1QJ6B 4X8UH 4BOHA 3LJJA 5LPRA 4MPUA 2FS8A 1C4Y2 1Q3XA 2XBXA 2ZPSA 3D62A 3MTYA 3SV7A 1O31A 1AZZA 2V3OH 1HUTH 1C1SA 2XW9A 3CENA 5HM2A 1TA2A 4XBCA 5DP5A 3SUDA 3O8DA 1UMAH 4Y7AA 3UOPA 5JBBS 1GJAB 4Y7BA 2XYAA 2NU0E 3V0XA 3F9EA 4DIHH 1XX9A 3P92A 3LJOA 3SHAH 1OKXA 1BTWA 1XUFA 1ORFA 1UTJA 5AF9H 1SFQB 2A4OA 4KKDA 2BVXH 2R9PA 1ZSLA 2ZKSA 5JB9S 3O8CA 2FDAA 2GV7A 2UUFB 5FBEA 1GL0E 1C5WB 3OY6U 1O2KA 1TPOA 1UCYE 7LPRA 1MQ5A 1VZQH 2OQ5A 1O2VA 3DA9B 1ZSJA 2SGFE 3C1KA 3GCOA 3GY4A 4JZIA 2F3CE 1AMHA 1CHGA 5FHTA 3STJA 1ZRKA 3BTTE 3B9FH 3T5FH 1CA0C 5IYTA 1NM6A 1GHBF 1SSXA 2ALPA 4DT7B 6LPRA 3QGJA 4HZHA 2TGDA 3P6ZB 1TRNA 2WPIS 3S69A 1G30B 1HAZB 1TAWA 1W12U 4ISIH 2BTCE 3MI4A 1AE5A 1AFQB 1XVMA 2IPHA 2KAIB 4HTCH 5J4QA 5T6FA 4IC6A 4DGJA 3M5NA 4X2WA 3S7HB 2QGRA 4E05H 1Z8JB 1FIZA 1MMJN 3FAOA 3LDXH 4K5ZA 3TJVA 1VCWA 1AHTH 2A4QA 2BM2A 1GHWH 5BPEA 6ESTA 4IBLH 5PTPA 3EA8A 1AVWA 1OYTH 2PKAA 3GCHC 1ABJH 3DFJA 1XXFA 2LNCA 3D65E 3PTBA 2H1UA 1QHRB 1MTSA 3RXJA 1ANDA 1FY8E 1ESTA 3BTDE 2P3FH 4IN2A 1C1QA 2CXVA 1MTVA 2VIOA 3MU0A 2UWOA 4MVNA 4UONA 3L6PA 5EW1H 1P3CA 1H4WA 1RD3B 1QA0A 1KXEA 3S9BA 2QXIA 1A5HA 3BIVH 4DJZB 3F9HA 3NWUA 1B7XB 3IG6B 5C2ZA 2ZC9H 3LGWA 3V13A 2ZFTA 2ZTYA 3T28A 1O2GH 1O3DA 4RKOB 1A5GH 1EPTA 3ZZ6A 3BTQE 3ZZ7A 5L2YH 1BCUH 1ZHRA 2Z94A 1GGDB 1SGCA 4AX9H 3SUEA 1GDNA 3ZZCA 1IQLA 1GJ8B 2G5NA 1KLIH 1LVBA 4BNRA 3ZYEA 1Q31A 1ID5H 1C5ZB 1ELFA 2ZIQH 4ZMAH 6GCHG 1XKBC 1H8DH 2OUAA 2P95A 1FY4A 5LH8A 3AW0A 3QGNB 6CHAB 3ATKA 2BB4A 2CHAB 1C5UA 3Q77A 1BA8B 3RU4T 1GJ4H 2FLRH 1RIWC 2ZDKA 4E7RG 3TH4H 4ZKOU 1O5EH 2WUCA 1Y59T 2ZO3H 4DY7B 2JKHA 3PB1E 1GG6C 2A7JA 2ZTXA 1O2LA 1PYTC 1DWBH 5A8ZA 1V2NT 2XRCA 4BAQB 1O3AA 1O3KA 4OS2A 2VB0A 1O2RA 5DP6A 1C4V2 4FUBA 5DGJA 3ZVGA 3E91A 1VJ9U 1TABE 1O3MA 1MZAA 4BXSA 1SOTA 4X1SU 4B71A 2BD5A 1V2QT 2ZCLP 1K1LA 3RMOH 5L6NH 2QY0B 1RGQA 2HNTF 2H9TH 3T2NA 4D9RA 1UTOA 3DD2H 1CO7E 1AD8H 3MNBA 1F0RA 1HBTH 1C5XB 2J2UA 2AH4X 3RM2H 2H9HA 1KXDA 2AGIX 2VGCB 3A8CA 1GI5A 4ABIA 1Y8TA 4LOYH 1CGIE 2AEIH 3GY7A 5FX5A 3TGKE 1C1VH 3BTEE 1RRKA 1LHCH 1V2UT 2FIRH 5E2OA 3GOVB 1XUGA 4Q7YA 5HXFA 1O2MA 4JCNA 5CHAC 2NU1E 1OP0A 8GCHF 1MQ6A 4ZUHA 1SGDE 1FV9A 4TPYA 2W3IA 4AG1A 1ZJDA 2G8TA 1GBTA 1S82A 3H5CB 2VIDA 3MH6A 2OC1A 4AN7A 1BBRE 2QIQA 1G3CA 3SORA 1QJ1B 1MCTA 1PQ5A 2WPKS 1Z7KA 2XC0A 2HVXA 3BTHE 3GY6A 3A8BA 1K1MA 3GY2A 2DUCA 3TJOA 4BAHB 1SC8U 2SFAA 1ETTH 1TQ7B 1CA0B 1Y3WA 3K65B 3EE0B 2BD9A 3UOUA 1TYNA 2GT7A 1PPEE 1Z1IA 4X8TH 1DITH 3ZV9A 1HAXB 2STBE 1EAWA 1BTZA 1ZJKA 3A87A 3M35A 3NXPA 1BQYA 1WUNH 4NZQA 4Q80A 3RXEA 3TGJE 1C2MA 2GMTC 2Y7XA 3UREA 1YF4A 4ZKSU 1O5FH 1C1TA 2BX3A 1NO9H 3ZV8A 4NA9H 1NN6A 1EPTC 1EAXA 1RTFB 2G55A 2I6SA 5FX6A 3SV6A 3TNTA 3RXSA 2HPPH 2ILNA 4OGXA 2Y81A 1ZPBA 5TCCA 2P8OC 3LPRA 2ZZUH 4O03A 4MNVA 2SGAA 5A0CA 3GCHB 5DP3A 2EI7A 1HAIH 2OBQA 1TX8A 1PPFE 4NWKA 1DVAH 2W5EA 1ESBA 1TPAE 1YCPM 1K21H 1TRMA 2F9OA 1SGIB 1OP2A 1UTPA 1P2MA 2FP7B 2SNWA 5A0AE 1ETRH 2PGBB 1HJAB 2J4IA 2ZFFH 1FY5A 3PWCA 4CRFA 1TGNA 2FMJA 2STAE 3A7WA 4YZUA 1AIXH 2OTVA 1NROH 2WPLS 1O3CA 5JYIA 2VWLA 2FS9A 2HRVA 2G4TA 1NZQH 1SGEE 2W26A 1A0JA 2VNTA 1AO5A 1JRTA 2H5CA 2Y6TA 2R0KA 4IN1A 2H5DA 1QBNA 1GHAG 3SNAA 3SQEE 1FI8A 2PUQH 1LHGH 3PMHB 1S84A 1EASA 2GKVE 1E36B 4NZLA 1FMGA 1JMOH 5LGOA 1O36A 1S0RA 2Y80A 3NUMA 4UFGH 1NRQH 1P2OA 2ZGHA 4K2YA 3RXAA 1OWIA 1T4UH 2QC2A 2WPMS 3PLPA 5ESBA 1FXYA 4O3TA 3BTFE 4MPWA 1YPKH 1TWXB 5LPFA 1OWEA 3A83A 1MKXH 1GBIA 2GVFA 2G52A 2RA3A 2ZFSA 2J95A 1DSUA 9ESTA 2GCTB 1GPZA 5A8YA 1MBQA 2BMGB 1QURH 4LZ4B 3Q3YA 1Y3XA 2ZFRH 1ZGIA 4UE7H 1H9HE 5F8XA 3TU7H 4FUGA 8LPRA 1GBLA 2VU8E 1OWDA 1SR5C 3DFLA 3E16B 1UVSH 1O3HA 1KSNA 2Z9LA 1LVMA 1PQ8A 3ZVDA 1GJ6A 3MH7A 1BDAA 3SN8A 3SGQE 2AMQA 3KQDA 1ELEE 2W7UA 2ZFQH 1T8NA 5C20A 4DOQA 2BXTH 2FODA 3VEQB 4TY6A 2FI5E 4RKJB 4GHQA 4YOJA 2FOAA 3F1SB 4ESTE 4H42U 1KXAA 1J16A 2O8MA 1H1BA 3UNQA 1QJ7B 1OYQA 2HGTH 3BTGE 5FCRA 1QIXB 1W10U 1MKXK 2IN2A 5GXPA 2O8TA 2AGGX 1ANCA 1HPGA 2PSXA 2VIPA 1YLDA 3L3TA 2Z7FE 2BVSH 3G01A 1OWHA 4GCHF 1PPGE 2B8OH 3VB6A 1ZTLA 1UCYK 2K1QA 1EP5A 3K6ZA 2OCVB 1O38A 4Y76A 5E2PA 2Z3CA 3LGVA 1YPHE 5CHAB 4Y8ZA 3MU1A 1AWFH 3ZZBA 4MNWA 4B2CA 1O3EA 1ZHMA 4TPIZ 1WYKA 1F5RA 1TGCA 3K2UA 4Y8XA 4Z0KA 5SGAE 3EAJA 4AGJA 3CS0A 2PUXB 4O97A 1DUAA 1OP8A 3BN9A 1AE8H 1ZGVA 3OU0A 2A45B 4NFEA 2PKAB 4K1SA 1E38B 4KP0A 2BLWA 3KL6A 2H6MA 3HPTB 1K22H 3OYPA 3ZZ3A 1NY22 3VFEA 4THNH 1TBQH 1ZMJA 2D2DA 4BAMB 2AERH 1HNEE 2WPHS 2XNIA 1LHDH 1LCYA 3A85A 4CRAA 2V3HH 2ZCHP 1AI8H 1YPJH 2BY6X 1JIRA 1O2XA 3KQEA 1Z6JH 2BDGA 3S7KB 1OPHB 1WSSH 2ZEBA 2ZDVH 2FXRA 2VVUA 1GVKB 1EPTB 1CE5A 5T3HA 2BZ6H 3MH5A 1S81A 1NC6A 5EPYA 1RTLA 1BHXF 2XCFA 2GV6A 1C2EA 5GCHG 2TBSA 3BV9B 1NRNH 1C9TA 4MPXA 2P8OB 1WCZA 1SLUB 8ESTE 1SI5H 1J17T 4B75A 1QBOA 4JYTA 1F7ZA 4AFZA 3E0PB 3VB3A 5JBAS 4H6SB 5C3NA 1Z6EA 4CH8B 1GMDF 1EX3A 4X2YA 1FN6A 5HYOA 3KQCA 1O2IA 3BTKE 1UHBA 3V12A 2GD4B 1P8VC 4F4OC 4TWWA 1S6HA 3B23B 3AW1A 3AVZA 2R3YA 1FY3A 2JH0D 4YLUA 4KTUA 3ZVBA 1CT0E 3LIWA 2TGAA 1GJCB 4FUEA 7GCHG 3IWMA 1T31A 1CHOF 2YNAA 4GSOA 1QL8A 3M5MA 1KXBA 3Q3XA 3VXFH 3BTME 1AVGH 2Q6DA 4K60A 1C2HA 5JBCS 3PM3A 3V3MA 1CQQA 2BD2A 5FPYA 1W7XH 2GDEH 1OWKA 4U30A 1TB6H 1CGHA 3ZZDA 4FUHA 1TBRH 4X6OA 1CA8B 2ZG0H 2GZ8A 2H2ZA 3SV2H 3A7YA 3U1JB 2P16A 1C5SA 1Z71A 2ODPA 3H7OA 4K1EA 3STIA 2WV5A 3UWIA 1P3EA 1L2EA 3M5OA 3W94A 1S85A 1C5TA 1ACBE 3E90B 3GY3A 3P17H 4JMYA 1CU1A 1NFUA 3LC5A 5EU8A 3UNRA 3PMAB 2BDAA 1EJMA 3PV4A 1BRBE 1ZPCA 2AMDA 3T25A 1C5PA 1K2I1 5B6OA 3HATH 2ZHDA 4Y0YE 4E06H 3D23A 1V2VT 1FZZA 1GMHG 2Z9JA 1F0TA 1HYLA 5C67A 2FZZA 4R8TB 2ZGXH 3C27B 3A81A 1RS0A 5CE1A 1C2DA 3URDA 4OS4A 3VGCC 1O3FA 3OSYA 3T62A 4I33A 2F9UA 3PLKA 4Y0ZE 3FVFB 2FTLE 2ZECA 1BUIA 4INHA 2ZTZA 1HCGA 1G2MA 5EQQA 2ANYA 2JH5D 4B73A 1Q2WA 1YCPK 3AAVA 1YPHC 3SQHE 1C1RA 1P09A 3VXEH 5L30H 2SGDE 1C5QA 4ISHH 1UVOA 2SGPE 1QFKH 3SBKA 4JZEH 3V7TA 1AUTC 4YOIA 1H9IE 2BLVA 2C93B 3A7TA 3ZZ9A 3TJNA 2ZDMA 2VWNA 5ETXA 2TGPZ 1O3NA 1V2TT 1RXPA 4FUDA 1SB1H 4GCHG 4VGCC 2ZWLH 1C2IA 1GBBA 1FDPA 4AB9A 4OS1A 2ZCKP 1VGCC 1QB6A 1YPLH 3MHWU 4BANB 1LKAA 4SGAE 1B0FA 1AY6H 1DLKB 1O5AB 1VITH 1LTOA 2BY8X 5F8TA 1F0SA 4B2AA 5E0JA 1V2WT 1NS3A 2PV9B 3QO6A 1LHEH 1HAYB 3OY5U 2TIOA 2A7HA 3TH3H 1DWCH 1CT2E 4KGAA 2ZDAH 1QRZA 7KMEH 3RXRA 2ZNKH 1VJAU 4ZKNU 3SNCA 1DS2E 2ZDNA 4LXBH 1C5NH 3M36A 1TNLA 3LGTA 1SGTA 1UTMA 2FO9A 1DXPA 3A86A 3UUZA 2A2XH 2RCEA 1KY9A 1WOFA 4WXVA 3I77A 2HOBA 5GDSH 1C2LA 3H7TA 4INKA 1HDTH 4I8KA 1CGJE 1SQTA 3URCA 5C1XA 4A6LA 1TNHA 4FVBA 3D49H 3E0NB 2VIVA 3A7VA 1RJXB 1ELDE 1GI4A 1OS8A 4K69A 2R2MB 1DWEH 2ZDLA 1C2GA 1HGTH 3P95A 4ABDA 3PO1C 2A5KA 2C8XB 1AGJA 2O8UA 3U8TH 1A4WH 3B8JA 4I8JA 3NKKA 3NK8A 4PROA 1G3EA 4WMFA 1S6FA 3OX7U 1TBZH 3P8OA 3ZZAA 1UTLM 3LOXA 1UK3A 1Y5UT 2TRMA 4ABEA 3UQVA 1MAYA 1C5RA 1AVXA 2CN0H 3PROA 1EJNA 1PPHE 1O37A 3LH1A 3U8OH 3M3TA 5TJXA 3S9CA 3ZVEA 1SGRE 1L4DA 4JYUH 2BY7X 1SPJA 4WJG2 1J15A 1P01A 3UIRA 4MDSA 1O3OA 1XXDA 4YT6H 3QDZB 1C1MA 1HJ9A 2ZQ1A 1UO6A 1O2JA 3MMGA 3VB7A 1KXFA 1RTKA 1F92A 3EQ0H 1NPMA 1GI8B 1THSH 1VITG 2PSYA 5GJ4B 3TJUA 2XBWA 1O3IA 1SGFG 4MNYA 2ZHEH 1ELBA 1BRUP 4AGKA 4X2VA 4GVUA 1FAKH 4GHTA 2ZU1A 3SO3A 1L1NA 3LGIA 1IQIA 4D8NA 1HAPH 4WY3A 1TNKA 3A82A 2XXLA 1T8OA 2NU2E 1MH0A 4R0IA 1HAVA 1O2QA 1U6QA 1O2NA 3TIUA 1TGBA 1ARBA 1P03A 4ZXYH 1UVUH 1A61H 3E3TA 1THRH 1YLCA 2ASUB 3BG8A 1J8AA 4SGBE 4ZAEA 3QX5H 3MNCA 3LU9B 1C2JA 1C5LH 4FU9A 1MTUA 1A3EH 4JZFH 4YM9A 2OD3B 3M61U 3VGCB 3ENSB 1IQHA 3EA9A 3KEEA 3A7XA 1BOQA 1T8MA 1O2HA 2Z3DA 1Z1JA 4MTBA 1D3TB 1V2PT 1G2LA 3KIDU 4J1YA 1JRSA 4KTCA 4Y6DA 1DXWA 3A88A 3LGUA 3E8LA 1AU8A 2PGQB 1O32A 4AZ2B 1MU6B 3M7UA 1GHBG 1QGFA 3BG4C 4IS5A 3MU4A 3MOCA 4YTAA 1TX6A 3PLBA 1IHTH 1QQUA 1D6WA 2UUJB 3QUMP 1WV7H 2J9NA 5EXLA 1LHFH 4Q7ZA 4ZHMU 1HFDA 1SLXB 5E0HA 1EXFA 1VGCB 4OS7A 1SLVB 1J14A 2F83A 2ZU5A 4MG3A 2ESTE 5T6GA 3S9AA 1BMMH 3GYMA 1LQEA 1W2KH 4Y10E 1HXFH 3TGIE 3A84A 5IDKA 1WU1A 2GCHF 1A0HB 4CHAC 1QRXA 1AZ8A 1IQMA 2WYGA 4X8VH 4UD9H 1EJAA 4AB8A 1UTQA 1TLDA 4I7YH 1EZQA 3N7OA 2VIWA 3A8AA 2F9PA 1SHHB 1C1WH 1EQ9A 1SQAA 5DPAA 2QXHA 3M5LA 1E0FD 4X1PU 1GHZA 1ZTKA 2W7SA 2DE9A 5L2ZH 1UHBB 3SOSA 3GCTF 3SJIA 3UY9A 2ZGBH 3U9AH 3MO6A 1A3BH 3HK3B 1L1GA 2GDDA 3VB5A 3ATWA 1BRAA 2BOHB 3TK9A 4B76A 1M9UA 2ZHFH 1P04A 1NU7B 1UJ1A 1HJ8A 3RXKA 1C5MD 1QL9A 4NIYA 2FOCA 5ESTE 1BRCE 1N1LA 2J38A 2VJ1A 3M3SA 3FP8E 3GICB 1GBKA 4Y11E 2Q1JA 1RIWB 2ZQ2A 3I29A 5FXLA 1QB9A 4Y79A 2G5VA 1CBWC 1DY9A 1QQ4A 2OP9A 4WH6A 1TGTA 1ELGA 2A7CA 5EOKA 1GG6B 2FYQA 2P3UB 3EYDA 2HLCA 4ZROA 1MUEB 1N6XA 4ASHA 1C4U2 2R0LA 1K1PA 4X8SH 2SGEE 1UCYH 3LT3A 4CR5A 1TNGA 1D4PB 5TCAA 2VWMA 4LK4A 3M7TA 5FPSA 2OC7A 3ELAH 1LQDB 3RDZA 1TQ0B 1T4VH 5A09A 2RDLA 1O3PB 1KTSB 1TOMH 3BEIB 1UK2A 3QZQA 5C5OA 4WVPE 2QYIA 3SJ8A 3A7ZA 1GBHA 4MNXA 4QT8C 1FUJA 1HIAA 4XE4A 1G9IE 4OS6A 2QN5T 3NZIA 2OC8A 2WPJS 3LKWA 1D3QB 2AIQA 5A0BA 2OBOA 1GHVH 3KQBA 1L1JA 3L33A 2AIPA 1SFIA 1GJBB 2A0QB 1E37B 3UTUH 1W14U 2XTTB 1LMWB 3ZYDA 1O34A 2XC4A 2CF9H 1GI1A 2W3KA 1GJ9B 4ZHLU 1AB9C 2VVVA 1F5KU 1QR3E 4B2BA 2BD3A 3RUOA 3Q00A 5BRRE 1IQFA 1GI0A 1G3BA 1SGNE 4FU7A 5EPNA 2GP9B 4JZDH 1BMNH 2SNVA 1C1OA 1C5VA 1O5GH 1P2IA 1XKAC 1O39A 1O5DH 2Z9KA 3ZZ5A 3TITA 1ZRBA 5C1UA 1P02A 1SGQE 4X2XA 3ESTA 3SU6A 2F9VA 2A4GA 2VINA 2GGVB 1QL7A 1FLEE 2A4RA 4E7NA 1NU9A 1OXGA 1KLTA 5FCKA 1V2MT 2FESH 1IQKA 2UUYA 2A5IA 8GCHG 1AFQC 4YT7H 2F9BH 1K1JA 4A1VA 4FUIA 2Y5GA 1MBMA 2QV1A 2VVCA 1DWDH 1O5CB 1SBWA 3SI3H 1ESAA 3RXOA 5JBTA 1C1NA 2OXSA 1JIMA 1GDUA 4K8YA 4AORA 3MU8A 4RN6A 1EZSC 5JDUB 3U98H 2GMTB 3RC5A 3BG4B 4CRBA 1LPGB 3QN7A 2BVRH 1D9IA 2B7DH 1EATA 3M3VA 2JH6D 2ZHWH 3KN2A 4GUXA 4WXIA 3IITA 4O3UA 1SHYA 3NPSA 1ZLRA 4YO9A 5DP7A 2QXJA 1G3DA 1FPHH 5GPIB 3HGPA 1BIOA 2OINA 1AN1E 1GHXH 4NA7A 4CHAB 6GCHF 4Q7XA 4HI3A 1TMBH 1O35A 1MD7A 1A5IA 4YESB 3PTNA 1W7GH 5HM9A 2GZ7A 5A2MH 1FJSA 1C2KA 3GDVA 1C9PA 2WINI 1TNIA 4MLFB 2ALVA 4M7GA 1EZUC 1W3CA 2ULLA 1GMCF 3UR9A 1TX7A 1C5YB 4K3JA 1SQOA 3RXLA 6CHAC 2BDHA 2XBYA 2CHAC 2ZPQA 1SLWB 1MZDA 3DHKH 1LO6A 4BAOB 1HRTH 4FXGH 1N8OC 1XUJA 1IQJA 1DY8A 3SGBE 3JZ2B 2G51A 1DANH 5EW2H 1B5GH 1JOUB 1X7AC 3MWIU 3BTWE 1D3PB 4BTTB 2BY5X 3GCTG 2J34A 1TE0A 1V3XA 1GWAA 1P06A 1DT2A 2P59A 1O2TA 3MH4A 3LC3A 3ATIA 2PW8H 4A92A 3SU4A 1KDQA 4X1RU 1TPSA 3GY8A 4ISNA 4FUJA 1PQ7A 3TVJB 2EEKA 4YOGA 3RXHA 1P11E 2Y5HA 2ANKH 1YCPH 2UWLA 3EDXB 1SGPE 4CREA 1K9OE 2FI4E 1TONA 1D6RA 3NCLA 1YPMH 1WQSA 1A2CH 3PYHA 2THFB 1BBRH 5HGGA 1HAVB 4KTSA 2FLBH 5EGMA 4JK5A 3FFGA 2O8LA 2BQ6B 4A5TS 5FBIA 2VGCC 2BYAX 2DE8A 1BJVA 1THPB 4X0WU 1A0LA 1NRSH 1XUIA 4I8GA 1ZMLA 3BEFB 3TNSA 1A7SA 2BD8A 5AHGH 3MYWA 4U2WA 1GBEA 1AQ7A 4WH8A 2O8WA 1AWHB 2EI6A 1O3GA 4CRGA 2V6NA 5GIBA 1SL3A 1OX1A 1F5LA 1INCA 3HKJB 2NWNA 2AYWA 2D8WA 3OTJE 3RXUA 5ABWA 5DJ7A 2VIQA 3RP2A 4HFPB 1AB9B 1SVPA 3DT0H 3TPIZ 1C2FA 2A2QH 5E0GA 4ZXXH 4AYYB 4A7IB 1P2NA 5DKMA 3MU5A 4I8HA 1LKBA 1UTKA 4NIXA 1BBRK 5HMAA 2BLOA 4B74A 1V2KT 3M37A 1PJPA 5DG6A 1NFWA 4LZ1H 1QBVH 4WF8A 2FOHA 2D26C 4O9VA 2ZU3A 4GPGA 4JK6A 1GI3A 4J2YB 2ZP0H 3BIUH 1TPPA 1MTNC 4DIIH 2BHGA 3FANA 1S83A 1MCVA 1XVOA 1QRWA 1ZTJA 3QZRA 3MNSA 3VB4A 2BD4A 3RXGA 3TH2H 1BHXB 1EB2A 1GVZA 1V6DA 1LVYA 3RM0H 2V0BA 4K8BA 1KXCA 1QTFA 1EZXC 2YNBA 1WQVH 2A32A 1ELAA 5J4SA 5JPMH 2C8WB 3SUFA 1EKBB 1GCTC 4UFFH 1GI6A 1UK4A 5T6DA 3U69H 2HWLB 3GYLB 4ABAA 4FVDA 1BTPA 1ARCA 1ANEA 3EGKH 3ZVCA 1IQEA 1IQGA 1YC0A 2VWOA 5GWZA 4X6PA 5DP9A 1HJAC 2F9NA 1ETSH 4ZKRU 3MFJA 1P9SA 1GHAF 4INLA 2Q6GA 4D76A 2PHBA 4DCDA 2D1JA 2Z3EA 8KME2 5F03A 1P2QA 1ANBA 1WTHD 4DURA 3SHCH 2QCYA 3KF2A 3CP7A 1XM1A 2A31A 3RMNH 1YM0A 4ZH8A 3SW2B 2FTMA 2WYJA 1GI7B 4UEHH 4XOJA 3FP7E 1FN8A 1G32B 4BTUB 1T32A 4AFSA 1O3JA 3U1IB 3SNDA 4D7GA 1FAXA 3RXPA 4GAWA 3RLYH 3ZVFA 3EA7A 4Q2KA 1UVTH 3LGYA 4ABBA 4DG4A 1Y3UA 4MPVA 1TNJA 4I32A 1W0YH 1FQ3A 2ZU2A 4F49A 1V2ST 1GMDG 3QTVH 3RXCA 1DDJA 2GZ9A 1QA7A 2TGTA 1ELCA 2FPZA 3RMMH 1O5BB 1N8OB 2XWAA 2CMYA 1GMCG 1NTPA 3PMBB 2GCTC 4CBNA 1GJ5H 1WAYB 4X1QU 2PTCE 3AAUA 3TK5A 1AKSA 4CR9A 4D9QA 1DLEA 1SOZA 2XC5A 2BZAA 4NIVA 2ZHQH 4UFEH 2XWBI 2R2WU 2HNTC 5A8XA 3SU3A 1HIAB 4X6MA 4OS5A 3FZDA 1YP9A 2HPQH 1CHOG 4CH2B 2J94A 2QA9E 5G4BA 4NCYA 1P9UA 1TIOA 1AUJA 2BQ7B 1VCPA 1V2RT 2VH6A 1HLTH 3P8FA 3SUGA 1O2YA 1GBCA 3F6UH 1BTUA 2C90B 3TK6A 4D7FA 2FYRA 2EI8A 1BTXA 2ZA5A 1DSTA 1SG8B 3RLWH 3FZZA 1HXEH 3HGNA 4A1TA 1MTWA 2O9QA 3HK6B 2Z6BD 3UNSA 2FOMB 1PPBH 1A46H 1JWTA 2NU3E 3AASA 2PWXA 1TMUH 3SU0A 1O3LA 1Y3VA 1GBFA 1HV7A 1E34B 1IAUA 1OOKB 1BTHH 1V2JT 3SJOA 4CRDA 1ABIH 2BLQA 1P57B 2XBVA 5AFYH 1QY6A 5H4IB 1YBWA 2V35A 4WMEA 2JETC 2QF3A 3SZNA 3GY5A 3BSQA 5DP8A 1QB1A 2BY9X 2ODYB 3QWCH 1O2OA 4NA8A 3RXFA 1Y3YA 2AS9A 3Q76A 4BXWA 3SU2A 4H4FA 4IMZA 2VH0A 5F6MA 1T8LA 4WMDA 1Z8IB 3RXVA 4B1TA 1FPCH 4ISOA 2AGEX 4NFFA 2BDIA 2I6QA 2YOLA 1O2PA 1TMTH 3T27A 2FOEA 4ABHA 4BTIB 1CT4E 2WV4A 4VGCB 3SV8A 2NU4E 2KAIA 5DK1A 2QF0A 5I25A 1MTNB 1MU8B 1PPZA 1LDTT 2GTBA 4X1NU 5GCHF 3S0NA 3KHVA 1F2SE 2Y82A 1VR1H 2BDBA 4NWLA 1DFPA 3F9FA 1P05A 3ODDA 2A1DB 2Q6FA 1Z8GA 3A8DA 4CBOA 4JZ1A 1BZXE 2GX4A 1ZPZA 4HGCA 1MAXA 1K1NA 1KTTB 2IJOB 1ZMNA 3M7QA 1LPZB 1YGCH 3P70B 3SJ9A 4RSPA 3E1XB 5EQRA 3SGAE 2G00A 1O30A 1W13U 1DM4B 7ESTE 4FU8A 3WY8A 5EODA 1GCTB 1FIWA 3T26A 1T7CA 1B0EA 2AMPA 1Y5AT 4ZHAA 2C8YB 2B5TB 1IHSH 2PR3A 4NIWA 2ZI2H 4IC5A 1Z8RA 2FX6A 3UFAA 3UPEA 2C4FH 4Z6AH 4X6NA 1W8BH 1BT7A 1BJUA 1DICA 2C3SA 1JXPA 3RC6A 1LPKB 1P12E 1O2ZA 3UQOA 3R3GB 1ELTA 1P0SH 1YKTA 2UWPA 1H9LB 7GCHF 1TALA 2B9LA 3RXBA 1GBMA 2P3TB 3PO1B 2FX4A 1P10A 5AFZH 3MO9A 1GDQA 5K0HA 5AVDA 2ZPRA 5FAHA 2QAAA 4XSKU 5DP4A 1KDQB 5EQSA 1DE7H 3RU4D 1LVOA 4FUCA 2ODQA 1N6YA 1MKWH 2FWWA 3GCNA 2ZGJA 2M5TA 4GLYA 2F91A 5EXNA 4Y71A 2G4UA 2BDCA 1YPGH 2R3UA 4NSVA 2PKSC 5C1YA 9LPRA 3LONA 4NG9H 1ZR0A 1MD8A 2FOFA 2ZGCA 1GJDB 1OWJA 1UVPA 1IOEA 2BD7A 1EOLA 1KLJH 2AFQB 1SGFA 1XUKA
chains in the Genus database with same CATH superfamily
1EB1H 5EG4A 1C1UH 3PMJA 3SI4H 1JBUH 1ZHPA 1RFNA 1O2UA 1O0DH 1Y5BT 4AFUA 2J92A 4MQAA 2QXGA 3KYGA 1E35B 3RC4A 3RU4E 3SU1A 1G36A 4WWYA 4DW2U 4UDWH 1KYNA 3ATLA 2FI3E 4JYVH 4TY7A 2P94A 4DVAU 4Q63A 5CMXH 1FONA 3CS7A 3KQ5A 1V2LT 2Z9IA 4YLQH 1HAOH 5C5NA 1H8IH 1DOJA 3A89A 1ELVA 2P93A 1GMHF 1GL1A 1SGYE 1K1OA 2B0FA 1GJ7B 2RA0A 1W11U 2QF5A 1V2OT 4I8LA 4K1TA 3QTOH 1EAIA 1CSOE 1GBAA 1G37A 1HAGE 3WWFA 2WUBA 4XBBA 3RMLH 1HB0B 4XDEA 4ACBA 1BMAA 3BF6H 3UR6A 3ZZ8A 1MKWK 3HKIB 4I31A 3GISB 5CDFE 1D3DB 1NFYA 2G81E 2TPIZ 1O2SA 3K6YA 4KELA 1VCQA 1NRPH 1KIGH 1XMNB 1BITA 1QNJA 3P8GA 1ZZZA 2ZF0H 3FP6E 4UFDH 3T29A 2BX4A 2BQWB 1UW7A 3KNXA 3GDSA 4ABJA 5DO4H 3ATMA 4IW4E 1GVLA 2EA3A 3W95A 3F68H 4NGAH 3Q3KA 3SNBA 1ZOMA 4IMQA 2UUKB 2FEQH 2RG3A 1TA6A 3GDUA 2CF8H 4AG2A 3I78A 1EAUA 1L4ZA 2Z9GA 1WBGB 2BDYA 2ANWA 3N7EA 1W0ZU 2CV3A 4NSYA 1GBJA 1P2JA 4A1XA 1WTGH 2LPRA 1P2KA 2JETB 2CJIA 1C1PA 1K28D 3JZ1B 5C94A 3BEUA 2F4LA 4ABGA 1PPCE 1GI9B 3KCGH 1L0ZA 1UTNA 1CVWH 3ZZ4A 1EUFA 1NFXA 4XBDA 1GHYH 2H9EH 1XUHA 2IOTA 3MNXA 3TLOA 1BMLA 1TRYA 3ODFA 4TWYA 1FNIA 3SU5A 4AFQA 1SMFE 4H6TA 1IQNA 1S5SA 1S0QA 4FUFA 2ZFPH 1AFEH 2SGQE 3U8RH 1PQAA 1OSSA 1BTYA 5JB8S 2A5AA 1QCPA 4U01A 5B6LA 3E6PH 2ANMH 1O2WA 2BXUH 3F9GA 3P8NA 4BAKB 2CGAA 1F0UA 2OC0A 3KGPA 3QLPH 5K7RA 3R0FA 1BB0B 2GT8A 4ABFA 2OLGA 2OQUA 2BOKA 1C5OH 5EXMA 3RXTA 1ZYOA 2Y5FA 1GGDC 1K1IA 2XCNA 2PFEA 3O8RA 2HALA 3A80A 3LH3A 5HIZA 3MO3A 1NT1A 3OTPA 3DUXH 2M2AA 5E8EH 3SJKA 2GCHG 3RXIA 1NESE 1EP6A 1A1RA 5FPTA 3ITIA 3O8BA 2PLXA 3UWJH 1PFXC 4TYDA 1TOCB 1E1RD 1NRRH 4U32A 1PYTD 1FY1A 1O33A 1YYY1 3RXDA 4AYVB 2AHME 1DPOA 3K9XB 1W0KD 3RXMA 1YPEH 4CRCA 2JIZD 2EC9H 4OGYA 1GBDA 2FM2A 2Y7ZA 1HAHH 1DX5M 2PTNA 1O3BA 2KCOA 2C8ZB 1TGSZ 2FOBA 1EOJA 3SV9A 3VPKA 3ZVAA 4IGDA 3QK1A 4XFQA 3SZEA 3SNEA 1AKSB 5F8ZA 1J9CH 5I46H 1TFXA 1VITF 3RXQA 1DUEA 4ISLA 1CBWB 2FOGA 3PWBA 4AOQA 1ZSKA 1GI2A 2HNTE 2ZU4A 4Y8YA 5LPEA 1GCDA 2PKSB 1QJ6B 4X8UH 4BOHA 3LJJA 5LPRA 4MPUA 2FS8A 1C4Y2 1Q3XA 2XBXA 2ZPSA 3D62A 3MTYA 3SV7A 1O31A 1AZZA 2V3OH 1HUTH 1C1SA 2XW9A 3CENA 5HM2A 1TA2A 4XBCA 5DP5A 3SUDA 3O8DA 1UMAH 4Y7AA 3UOPA 5JBBS 1GJAB 4Y7BA 2XYAA 2NU0E 3V0XA 3F9EA 4DIHH 1XX9A 3P92A 4TT3D 3LJOA 3SHAH 1OKXA 1BTWA 1XUFA 1ORFA 1UTJA 5AF9H 1SFQB 2A4OA 4KKDA 2BVXH 2R9PA 1ZSLA 2ZKSA 5JB9S 3O8CA 2FDAA 2GV7A 2UUFB 5FBEA 1GL0E 1C5WB 3OY6U 1O2KA 1TPOA 1UCYE 7LPRA 1MQ5A 1VZQH 2OQ5A 1O2VA 1YLNA 3DA9B 1ZSJA 2SGFE 3C1KA 3F0PA 3GCOA 3GY4A 4JZIA 2F3CE 1AMHA 1CHGA 2K8IA 5FHTA 1ZRKA 3BTTE 3PV2A 4I86A 3STJA 3B9FH 3T5FH 1CA0C 5IYTA 1NM6A 1GHBF 1SSXA 2ALPA 4DT7B 6LPRA 3QGJA 4HZHA 2TGDA 3P6ZB 1TRNA 2WPIS 3S69A 1G30B 1HAZB 1TAWA 1W12U 4ISIH 2BTCE 3MI4A 1AE5A 1AFQB 1XVMA 2IPHA 2KAIB 4HTCH 5J4QA 5T6FA 4IC6A 4DGJA 5EIYA 3M5NA 4X2WA 3S7HB 2QGRA 4E05H 1Z8JB 1FIZA 1MMJN 3FAOA 3LDXH 4K5ZA 3TJVA 1YWUA 1VCWA 1AHTH 2A4QA 2BM2A 1GHWH 5F53A 5BPEA 6ESTA 4IBLH 5PTPA 3EA8A 1AVWA 1OYTH 2PKAA 2F43B 3GCHC 1ABJH 3DFJA 1XXFA 2LNCA 3D65E 3PTBA 2H1UA 1QHRB 1MTSA 3RXJA 1ANDA 1FY8E 1ESTA 3BTDE 2P3FH 4IN2A 1C1QA 2CXVA 1MTVA 2VIOA 3MU0A 2UWOA 4MVNA 4UONA 3L6PA 5EW1H 1P3CA 1H4WA 1RD3B 1QA0A 1KXEA 3S9BA 2QXIA 1A5HA 3BIVH 4DJZB 3F9HA 3NWUA 1B7XB 3IG6B 5C2ZA 2ZC9H 3LGWA 3V13A 2ZFTA 2ZTYA 3T28A 1O2GH 1O3DA 4RKOB 1A5GH 1EPTA 3ZZ6A 3BTQE 2KM0A 3ZZ7A 5L2YH 1BCUH 1ZHRA 2Z94A 1GGDB 1SGCA 4AX9H 3SUEA 1GDNA 3ZZCA 1IQLA 1GJ8B 2G5NA 1KLIH 1LVBA 1NBMD 4BNRA 3ZYEA 1Q31A 1ID5H 3ZIAD 1C5ZB 1ELFA 2ZIQH 4ZMAH 6GCHG 1XKBC 1H8DH 2OUAA 2P95A 1FY4A 5LH8A 3AW0A 3QGNB 6CHAB 3ATKA 2BB4A 2CHAB 1C5UA 3Q77A 4Q4LA 1BA8B 3RU4T 1GJ4H 2FLRH 1RIWC 2ZDKA 4E7RG 3TH4H 4ZKOU 1O5EH 2WUCA 1Y59T 2ZO3H 4DY7B 2JKHA 1NBME 3PB1E 1GG6C 2A7JA 2ZTXA 1O2LA 1PYTC 1DWBH 5A8ZA 1V2NT 2XRCA 4BAQB 5EJ1A 1O3AA 5HIYA 1O3KA 4OS2A 2VB0A 1O2RA 5DP6A 1C4V2 4FUBA 5DGJA 3ZVGA 3E91A 1VJ9U 1TABE 1O3MA 1MZAA 4BXSA 1SOTA 4X1SU 4B71A 2BD5A 1V2QT 2ZCLP 1K1LA 3RMOH 5L6NH 2QY0B 2QF4A 1RGQA 2HNTF 2H9TH 3T2NA 4D9RA 1UTOA 3DD2H 1CO7E 1AD8H 3MNBA 1F0RA 1HBTH 1C5XB 2J2UA 2AH4X 3RM2H 2H9HA 1KXDA 2AGIX 2VGCB 3A8CA 4XRNA 1GI5A 4ABIA 1Y8TA 2L6OA 4LOYH 1CGIE 2AEIH 3GY7A 5FX5A 3TGKE 1C1VH 3BTEE 4HG6A 1RRKA 1LHCH 1V2UT 2FIRH 5E2OA 3GOVB 1XUGA 4Q7YA 2QE7D 5HXFA 1O2MA 4JCNA 5CHAC 2NU1E 1OP0A 8GCHF 1MQ6A 4ZUHA 1SGDE 1FV9A 4TPYA 2W3IA 4AG1A 1ZJDA 2G8TA 1GBTA 1S82A 3H5CB 2VIDA 3MH6A 2OC1A 4AN7A 1BBRE 2QIQA 1G3CA 3SORA 1QJ1B 1MCTA 1PQ5A 2WPKS 1Z7KA 2XC0A 2HVXA 3BTHE 3GY6A 3A8BA 1K1MA 3GY2A 2DUCA 3TJOA 4BAHB 1SC8U 2SFAA 1ETTH 1TQ7B 1CA0B 1Y3WA 3K65B 3EE0B 2BD9A 3UOUA 1TYNA 2GT7A 3DSPA 1PPEE 1Z1IA 4X8TH 1DITH 3ZV9A 1HAXB 2STBE 1EAWA 1BTZA 1ZJKA 3A87A 3M35A 3NXPA 1BQYA 1WUNH 4NZQA 4Q80A 3RXEA 3TGJE 1C2MA 2GMTC 2Y7XA 3UREA 1YF4A 4ZKSU 1O5FH 1C1TA 2BX3A 1NO9H 3ZV8A 4NA9H 1NN6A 1EPTC 1EAXA 1RTFB 2G55A 2I6SA 5FX6A 3SV6A 3TNTA 3H09A 3RXSA 3UB0A 2HPPH 2ILNA 4OGXA 2Y81A 1ZPBA 5TCCA 2P8OC 3LPRA 2ZZUH 4O03A 4MNVA 2SGAA 2KFWA 3GCHB 5DP3A 5A0CA 2EI7A 1HAIH 2OBQA 1TX8A 1PPFE 4NWKA 1DVAH 2W5EA 1ESBA 1TPAE 1YCPM 1K21H 1TRMA 2F9OA 1SGIB 1OP2A 1UTPA 1P2MA 2FP7B 2SNWA 5A0AE 1ETRH 2PGBB 1HJAB 2J4IA 2ZFFH 1FY5A 3PWCA 4CRFA 1TGNA 2FMJA 2STAE 3A7WA 4YZUA 1AIXH 2OTVA 1NROH 2WPLS 2RFKC 1OHHD 1O3CA 5JYIA 2VWLA 2FS9A 2HRVA 2G4TA 1NZQH 1SGEE 2W26A 1A0JA 2VNTA 1AO5A 1JRTA 2H5CA 2Y6TA 2R0KA 4IN1A 2H5DA 1QBNA 1GHAG 3SNAA 3SQEE 1FI8A 2PUQH 1LHGH 3PMHB 1S84A 1EASA 2GKVE 1E36B 4NZLA 4RI0A 1FMGA 1JMOH 5LGOA 1O36A 1S0RA 2Y80A 3F2GA 3NUMA 4UFGH 1NRQH 1P2OA 2ZGHA 4K2YA 3RXAA 1OWIA 1T4UH 2QC2A 2WPMS 2EQNA 3PLPA 5ESBA 1FXYA 4O3TA 3BTFE 4MPWA 1YPKH 1TWXB 5LPFA 1OWEA 3A83A 2LELA 2IJD1 1MKXH 1GBIA 2GVFA 4P00A 2G52A 2RA3A 2ZFSA 2J95A 1DSUA 9ESTA 2GCTB 1GPZA 5A8YA 3OFND 1MBQA 2BMGB 1QURH 4LZ4B 3Q3YA 1Y3XA 2ZFRH 1ZGIA 2V3MA 4UE7H 1H9HE 5F8XA 3TU7H 4FUGA 8LPRA 1GBLA 2VU8E 1OWDA 1SR5C 3DFLA 3E16B 1UVSH 1O3HA 1KSNA 2Z9LA 1LVMA 1PQ8A 3ZVDA 1GJ6A 3MH7A 1BDAA 3SN8A 3SGQE 2AMQA 3KQDA 1ELEE 2W7UA 2ZFQH 1T8NA 5C20A 4DOQA 2BXTH 2FODA 3VEQB 4TY6A 2FI5E 4RKJB 4GHQA 4YOJA 2FOAA 3F1SB 4ESTE 4H42U 1KXAA 1J16A 2O8MA 1H1BA 3UNQA 1QJ7B 1OYQA 2HGTH 3BTGE 5FCRA 1QIXB 1W10U 1MKXK 2IN2A 2XOKD 5GXPA 2O8TA 2AGGX 1ANCA 1HPGA 2PSXA 2VIPA 1YLDA 3L3TA 2Z7FE 2BVSH 3G01A 1OWHA 4GCHF 1PPGE 2B8OH 3VB6A 1ZTLA 1UCYK 2K1QA 1EP5A 3K6ZA 2OCVB 1O38A 4Y76A 5E2PA 2Z3CA 3LGVA 1YPHE 5CHAB 4Y8ZA 3MU1A 1AWFH 3ZZBA 4MNWA 4B2CA 1O3EA 2JDID 1ZHMA 4TPIZ 1COWD 1WYKA 1F5RA 1TGCA 3K2UA 4Y8XA 4Z0KA 5SGAE 2XNDD 3EAJA 4AGJA 3CS0A 2PUXB 4O97A 1DUAA 1OP8A 3BN9A 1AE8H 1ZGVA 3OU0A 2A45B 1BMFD 2PKAB 4NFEA 4K1SA 1E38B 4KP0A 2BLWA 3KL6A 2H6MA 3HPTB 1K22H 3OYPA 3ZZ3A 1NY22 3VFEA 4THNH 1TBQH 1ZMJA 2D2DA 4BAMB 2AERH 1HNEE 2WPHS 2XNIA 1LHDH 1LCYA 3A85A 4CRAA 5EJLA 2V3HH 2ZCHP 1AI8H 1YPJH 2BY6X 1JIRA 1O2XA 3KQEA 1Z6JH 2BDGA 3S7KB 1OPHB 1WSSH 2ZEBA 2ZDVH 2FXRA 4F48B 2VVUA 1GVKB 1EPTB 1CE5A 5T3HA 2BZ6H 3MH5A 1S81A 1NC6A 5EPYA 1RTLA 1BHXF 2XCFA 2GV6A 5C0UA 1C2EA 5GCHG 2TBSA 3BV9B 1NRNH 1C9TA 4MPXA 2P8OB 1WCZA 1SLUB 8ESTE 1SI5H 1J17T 4B75A 1QBOA 4JYTA 1F7ZA 4AFZA 3E0PB 3VB3A 5JBAS 4H6SB 5C3NA 1Z6EA 2KX4A 4CH8B 1GMDF 1EX3A 4X2YA 3SYJA 4FOUC 1FN6A 5HYOA 3KQCA 1O2IA 3BTKE 1UHBA 3V12A 2GD4B 1P8VC 4F4OC 3F2HA 2EY4C 4TWWA 1S6HA 3B23B 3AW1A 3AVZA 2R3YA 5GNDA 1FY3A 2JH0D 4YLUA 4KTUA 3ZVBA 3W1EA 1CT0E 3LIWA 2TGAA 1GJCB 4FUEA 7GCHG 3IWMA 1T31A 1CHOF 2YNAA 4GSOA 1QL8A 3M5MA 1KXBA 3Q3XA 3VXFH 3BTME 1AVGH 4M9FA 2Q6DA 4K60A 1C2HA 5JBCS 3PM3A 3V3MA 1CQQA 2BD2A 5FPYA 1W7XH 2GDEH 1OWKA 4U30A 1TB6H 1CGHA 3ZZDA 4FUHA 1TBRH 4X6OA 1CA8B 2ZG0H 2GZ8A 1KMHB 2H2ZA 3A7YA 3DSGA 2P16A 1C5SA 3SV2H 3U1JB 1Z71A 2ODPA 3H7OA 4K1EA 3STIA 2WV5A 3UWIA 1P3EA 1L2EA 3M5OA 5DN6D 3W94A 1S85A 1C5TA 1ACBE 3E90B 3GY3A 3P17H 4JMYA 1CU1A 4B6FA 1NFUA 3LC5A 5EU8A 3UNRA 3PMAB 2BDAA 1EJMA 3PV4A 1BRBE 5C17A 1ZPCA 2AMDA 3T25A 1C5PA 1K2I1 5B6OA 3HATH 2ZHDA 4Y0YE 4E06H 3D23A 1V2VT 1FZZA 1GMHG 2Z9JA 1F0TA 1HYLA 5C67A 2FZZA 4R8TB 2ZGXH 3WWBA 3C27B 3F0OA 3A81A 1RS0A 5CE1A 1C2DA 3URDA 4OS4A 3VGCC 1O3FA 3OSYA 3T62A 4I33A 2F9UA 3PLKA 4Y0ZE 3FVFB 2FTLE 2ZECA 1BUIA 4INHA 2ZTZA 1HCGA 1G2MA 5EQQA 2ANYA 2JH5D 4B73A 1Q2WA 1YCPK 3AAVA 1YPHC 3SQHE 1C1RA 1P09A 2WPDD 3VXEH 5L30H 2SGDE 1C5QA 4ISHH 1UVOA 2SGPE 1QFKH 3SBKA 4JZEH 3V7TA 1AUTC 4YOIA 1H9IE 2BLVA 2C93B 1E79D 3A7TA 3ZZ9A 3TJNA 2ZDMA 2VWNA 5ETXA 2TGPZ 1O3NA 1V2TT 1RXPA 4FUDA 1SB1H 4GCHG 4VGCC 2ZWLH 1C2IA 1GBBA 1FDPA 4AB9A 4OS1A 2ZCKP 1VGCC 1QB6A 1YPLH 3MHWU 4BANB 1LKAA 4SGAE 1B0FA 1AY6H 1DLKB 1O5AB 1VITH 1LTOA 2BY8X 5F8TA 1F0SA 4B2AA 5E0JA 1V2WT 2KCAA 1NS3A 2PV9B 3PV5A 3QO6A 1LHEH 1HAYB 3OY5U 2TIOA 2A7HA 3TH3H 1DWCH 1CT2E 3VG8A 4KGAA 2ZDAH 1QRZA 7KMEH 3RXRA 5KEDA 2ZNKH 1VJAU 4ZKNU 3SNCA 1DS2E 2ZDNA 4LXBH 1C5NH 3M36A 3FOAA 1TNLA 3LGTA 1SGTA 1UTMA 2FO9A 1DXPA 3A86A 3UUZA 2A2XH 2RCEA 4B6EA 1KY9A 1WOFA 4WXVA 3I77A 2WSSD 2HOBA 5GDSH 1WXRA 1C2LA 3H7TA 4INKA 1HDTH 4I8KA 1CGJE 1SQTA 3URCA 5C1XA 4A6LA 1SQRA 1TNHA 4FVBA 3D49H 3E0NB 2VIVA 3A7VA 2KZ4A 1RJXB 1ELDE 1GI4A 1OS8A 4K69A 2R2MB 1DWEH 2ZDLA 1C2GA 1HGTH 4F55A 3P95A 4ABDA 3PO1C 2A5KA 2C8XB 1AGJA 2O8UA 3U8TH 1A4WH 3B8JA 4I8JA 3NKKA 3NK8A 4PROA 1G3EA 4WMFA 1S6FA 3OX7U 1TBZH 3P8OA 5IK2D 3ZZAA 4DT4A 1UTLM 3LOXA 1UK3A 1Y5UT 2TRMA 4ABEA 3UQVA 1MAYA 1C5RA 1AVXA 2CN0H 4OM9A 3PROA 1EJNA 1PPHE 1O37A 4RT0A 3LH1A 3U8OH 2IPQX 3M3TA 5TJXA 3S9CA 3ZVEA 1SGRE 1L4DA 4JYUH 2BY7X 1SPJA 4WJG2 1J15A 1P01A 3UIRA 4MDSA 1O3OA 1XXDA 4YT6H 3QDZB 2WZQA 1C1MA 1HJ9A 2ZQ1A 1UO6A 1O2JA 3MMGA 3VB7A 1KXFA 1RTKA 1F92A 3EQ0H 1NPMA 1GI8B 1THSH 1VITG 2PSYA 5GJ4B 3TJUA 2XBWA 1O3IA 1SGFG 4MNYA 2ZHEH 1ELBA 2JJ1D 1BRUP 5DSFA 4AGKA 4X2VA 4GVUA 1FAKH 4GHTA 2ZU1A 3SO3A 1QZ8A 1L1NA 3LGIA 1IQIA 4D8NA 1HAPH 4WY3A 1TNKA 3A82A 2XXLA 1T8OA 5KGOA 2NU2E 1MH0A 4R0IA 1HAVA 1O2QA 1U6QA 1O2NA 2V7QD 3TIUA 1TGBA 1ARBA 1P03A 4ZXYH 1UVUH 1A61H 3E3TA 1THRH 1YLCA 2ASUB 3BG8A 1J8AA 4SGBE 3FN8A 4TSFD 4ZAEA 3QX5H 3MNCA 3LU9B 1C2JA 1YY3A 1C5LH 3PRBA 4FU9A 1MTUA 1A3EH 4JZFH 4YM9A 2JJ2D 1S6LA 3F2FA 2OD3B 3M61U 3VGCB 3ENSB 1IQHA 3EA9A 3KEEA 1W0JD 3A7XA 1BOQA 1T8MA 1O2HA 2Z3DA 1Z1JA 4MTBA 1D3TB 1V2PT 1G2LA 3KIDU 4J1YA 1JRSA 4KTCA 2KCYA 4Y6DA 5CHBA 1DXWA 3A88A 3LGUA 3E8LA 1AU8A 2PGQB 1O32A 4AZ2B 1MU6B 3M7UA 2YMSD 1GHBG 1QGFA 3BG4C 4IS5A 3MU4A 3MOCA 4YTAA 1TX6A 3PLBA 2RDEA 1IHTH 1QQUA 1D6WA 2UUJB 3QUMP 1WV7H 2J9NA 5EXLA 1LHFH 4Q7ZA 4ZHMU 1HFDA 1SLXB 5E0HA 1EXFA 1VGCB 3MQKC 4OS7A 1SLVB 1J14A 2F83A 2ZU5A 4MG3A 2ESTE 5T6GA 2WV9A 3S9AA 4ASUD 1BMMH 3GYMA 1LQEA 1W2KH 4Y10E 1HXFH 3TGIE 3A84A 5IDKA 1WU1A 2GCHF 1A0HB 4CHAC 1QRXA 1AZ8A 1IQMA 2WYGA 4X8VH 4UD9H 1EJAA 4AB8A 1UTQA 1TLDA 4I7YH 1EZQA 3N7OA 2VIWA 3A8AA 2F9PA 1SHHB 1C1WH 4Z1MD 1EQ9A 2HVYB 1SQAA 5DPAA 1E1QD 2QXHA 3M5LA 1E0FD 4X1PU 1GHZA 1ZTKA 2W7SA 2DE9A 5L2ZH 1UHBB 3SOSA 3GCTF 3SJIA 3UY9A 2ZGBH 3U9AH 3MO6A 1A3BH 3HK3B 3OEHD 1L1GA 2GDDA 3VB5A 3ATWA 1BRAA 2BOHB 3TK9A 4B76A 1M9UA 2ZHFH 1P04A 1NU7B 1UJ1A 1HJ8A 3RXKA 4ZCNA 1C5MD 1QL9A 4NIYA 2FOCA 5ESTE 1BRCE 1N1LA 2J38A 2VJ1A 3M3SA 3FP8E 3GICB 1GBKA 4Y11E 2Q1JA 1RIWB 2ZQ2A 3DSOA 3I29A 3KYFA 5FXLA 1QB9A 4Y79A 2G5VA 1CBWC 2GJGA 1DY9A 1QQ4A 2OP9A 4WH6A 1TGTA 1ELGA 2A7CA 5EOKA 1GG6B 2FYQA 4RT1A 2P3UB 3EYDA 2HLCA 4ZROA 1MUEB 1N6XA 4ASHA 1C4U2 2R0LA 1K1PA 4X8SH 2SGEE 1UCYH 2CK3D 3LT3A 4CR5A 1TNGA 2J97A 1D4PB 5TCAA 2VWMA 4LK4A 3M7TA 5FPSA 2OC7A 3ELAH 1LQDB 3RDZA 1TQ0B 3NRLA 1T4VH 5A09A 2RDLA 1O3PB 1KTSB 3F3BA 1TOMH 3BEIB 1UK2A 3QZQA 5C5OA 4WVPE 2QYIA 3SJ8A 3A7ZA 1GBHA 4MNXA 4QT8C 1FUJA 1HIAA 4XE4A 1G9IE 4OS6A 2QN5T 3NZIA 2OC8A 2WPJS 3LKWA 1D3QB 2AIQA 5A0BA 2OBOA 1GHVH 3KQBA 1L1JA 3L33A 3OE7D 2AIPA 1SFIA 1GJBB 2A0QB 1E37B 3UTUH 1W14U 2XTTB 1LMWB 3ZYDA 1O34A 2XC4A 2CF9H 4ACAA 1GI1A 2W3KA 1GJ9B 4ZHLU 1AB9C 2VVVA 1F5KU 5HKKD 1QR3E 4B2BA 2BD3A 3RUOA 3Q00A 5BRRE 1IQFA 1GI0A 1G3BA 1SGNE 4FU7A 5EPNA 2GP9B 4JZDH 1BMNH 2SNVA 1C1OA 1C5VA 1O5GH 1P2IA 1XKAC 1O39A 1O5DH 2Z9KA 4FETA 3TITA 1ZRBA 3ZZ5A 2PP6A 1P02A 1SGQE 4X2XA 3ESTA 3SU6A 2F9VA 2A4GA 2VINA 2GGVB 1QL7A 1FLEE 2A4RA 4E7NA 1NU9A 1OXGA 1KLTA 5FCKA 1V2MT 2FESH 1IQKA 2UUYA 2A5IA 8GCHG 1AFQC 4YT7H 2F9BH 1K1JA 4A1VA 4FUIA 2Y5GA 1MBMA 2QV1A 2VVCA 1DWDH 1O5CB 1SBWA 3SI3H 2W6JD 1ESAA 3RXOA 5JBTA 1C1NA 2OXSA 1JIMA 1GDUA 4K8YA 4AORA 3MU8A 4RN6A 1EZSC 5JDUB 3U98H 2GMTB 3RC5A 3BG4B 4CRBA 1LPGB 3QN7A 2BVRH 3N7DA 1D9IA 2B7DH 1EATA 3M3VA 2JH6D 2ZHWH 3KN2A 4GUXA 4WXIA 5C1UA 3IITA 4O3UA 1SHYA 2YMSC 3NPSA 1ZLRA 4YO9A 5DP7A 2QXJA 1G3DA 1FPHH 5GPIB 2J98A 3HGPA 1BIOA 2OINA 1AN1E 1GHXH 4NA7A 4CHAB 6GCHF 4Q7XA 4HI3A 1TMBH 1O35A 1MD7A 1A5IA 4YESB 3PTNA 1W7GH 5HM9A 2GZ7A 5A2MH 1FJSA 5T1VA 1C2KA 3GDVA 1C9PA 2WINI 3AK5A 1TNIA 4MLFB 2ALVA 4M7GA 1EZUC 1W3CA 2ULLA 1GMCF 3UR9A 1TX7A 1C5YB 4K3JA 1SQOA 3RXLA 6CHAC 2BDHA 2KCPA 2XBYA 2CHAC 3FKSD 2ZPQA 1SLWB 1MZDA 3DHKH 1LO6A 4BAOB 1HRTH 4FXGH 1N8OC 1XUJA 1IQJA 1DY8A 3SGBE 3JZ2B 2G51A 1DANH 5EW2H 1B5GH 1JOUB 1X7AC 3MWIU 5EJZA 3BTWE 1D3PB 4BTTB 2BY5X 3GCTG 2J34A 1TE0A 1V3XA 1GWAA 1P06A 1DT2A 2P59A 1O2TA 3MH4A 3LC3A 3ATIA 2PW8H 4A92A 3SU4A 1KDQA 4X1RU 1TPSA 3GY8A 4ISNA 3WW7A 4FUJA 1PQ7A 3TVJB 2EEKA 4YOGA 3RXHA 1P11E 2Y5HA 2ANKH 3UAIC 1YCPH 2UWLA 3EDXB 1SGPE 4CREA 1K9OE 2FI4E 1TONA 1D6RA 3NCLA 1YPMH 1WQSA 1A2CH 3PYHA 2THFB 1BBRH 5HGGA 1HAVB 4KTSA 2FLBH 5EGMA 4JK5A 3FFGA 2O8LA 5C0TA 2BQ6B 4A5TS 5KECA 5FBIA 2VGCC 2BYAX 2DE8A 1BJVA 1THPB 4X0WU 1A0LA 1NRSH 1XUIA 4I8GA 1ZMLA 3BEFB 3TNSA 2HLDD 1A7SA 2BD8A 5AHGH 3MYWA 4U2WA 1GBEA 1AQ7A 3OEED 4WH8A 2O8WA 1AWHB 2EI6A 1FX0B 1O3GA 4CRGA 2V6NA 5GIBA 1SL3A 1OX1A 1F5LA 1INCA 3HKJB 2NWNA 2AYWA 2D8WA 3OTJE 3RXUA 5ABWA 5DJ7A 2VIQA 3RP2A 1EFRD 4HFPB 1AB9B 1SVPA 3DT0H 3TPIZ 1C2FA 2A2QH 5E0GA 4ZXXH 4XD7D 4A7IB 4AYYB 1P2NA 5DKMA 3MU5A 4I8HA 1LKBA 1UTKA 4NIXA 1BBRK 5HMAA 2BLOA 4B74A 1V2KT 3M37A 1PJPA 5DG6A 1NFWA 4LZ1H 1QBVH 4WF8A 2FOHA 2D26C 4O9VA 2ZU3A 4GPGA 4JK6A 1GI3A 4J2YB 2ZP0H 3BIUH 1TPPA 3CNRA 1MTNC 4DIIH 2BHGA 3FANA 1S83A 2J5UA 1MCVA 1XVOA 1QRWA 1ZTJA 3QZRA 3MNSA 3VB4A 2BD4A 3RXGA 3TH2H 1BHXB 1EB2A 1GVZA 1V6DA 1LVYA 4P02A 3RM0H 2V0BA 4K8BA 1KXCA 1QTFA 1EZXC 2YNBA 1WQVH 2A32A 1ELAA 5J4SA 5JPMH 2C8WB 3SUFA 1EKBB 1GCTC 4UFFH 1GI6A 1UK4A 5T6DA 3U69H 2HWLB 3GYLB 4ABAA 4FVDA 1BTPA 1ARCA 1ANEA 2W6ID 3EGKH 3ZVCA 4AC9A 1IQEA 1IQGA 1YC0A 2VWOA 5GWZA 4X6PA 2K0QA 5DP9A 1HJAC 3GS9A 2F9NA 1ETSH 4ZKRU 2YMSB 3MFJA 1P9SA 1GHAF 4INLA 2Q6GA 4D76A 2PHBA 4DCDA 2D1JA 2Z3EA 8KME2 5F03A 1P2QA 1ANBA 1WTHD 4DURA 3SHCH 2QCYA 3KF2A 3CP7A 1XM1A 2A31A 3RMNH 1YM0A 4ZH8A 3SW2B 2FTMA 2KR7A 2WYJA 1GI7B 4UEHH 4XOJA 3FP7E 1FN8A 1G32B 4BTUB 1T32A 4AFSA 1O3JA 3U1IB 3SNDA 4D7GA 3PRDA 1FAXA 3RXPA 4GAWA 3RLYH 3ZVFA 3EA7A 4Q2KA 2VBCA 1UVTH 3LGYA 4ABBA 4DG4A 1Y3UA 2L74A 4MPVA 1TNJA 4I32A 1W0YH 1FQ3A 2ZU2A 4F49A 1V2ST 1GMDG 3QTVH 3RXCA 1DDJA 2GZ9A 1QA7A 2TGTA 1ELCA 2FPZA 3RMMH 1O5BB 1N8OB 2XWAA 2CMYA 1GMCG 1NTPA 3PMBB 2GCTC 4CBNA 1GJ5H 1WAYB 4X1QU 2PTCE 4YXWD 3AAUA 3TK5A 1AKSA 4CR9A 4D9QA 1DLEA 1SOZA 2XC5A 2BZAA 4NIVA 2ZHQH 4UFEH 2XWBI 2R2WU 2HNTC 5A8XA 3SU3A 1HIAB 4X6MA 4OS5A 3FZDA 1YP9A 2HPQH 1CHOG 4CH2B 2J94A 2QA9E 5G4BA 4NCYA 1P9UA 1TIOA 1AUJA 2BQ7B 1VCPA 1V2RT 2VH6A 1HLTH 3P8FA 3SUGA 1O2YA 1GBCA 3F6UH 1BTUA 2C90B 3TK6A 4D7FA 2FYRA 2EI8A 1BTXA 2ZA5A 1DSTA 1SG8B 3RLWH 3FZZA 1HXEH 3HGNA 4A1TA 1MTWA 2O9QA 3HK6B 2Z6BD 3UNSA 2FOMB 3FO8D 1PPBH 1A46H 1JWTA 2NU3E 3AASA 2PWXA 1TMUH 3SU0A 1O3LA 1Y3VA 1GBFA 1HV7A 1E34B 1IAUA 1OOKB 1BTHH 1V2JT 3SJOA 4CRDA 1ABIH 2BLQA 1P57B 2XBVA 5AFYH 1QY6A 5H4IB 1YBWA 2V35A 4WMEA 3DCLA 2JETC 1H8ED 2QF3A 3SZNA 3GY5A 3BSQA 5DP8A 1QB1A 2BY9X 2ODYB 3QWCH 1O2OA 4NA8A 3RXFA 1Y3YA 2AS9A 3Q76A 4BXWA 3SU2A 4H4FA 4IMZA 3EE7A 2VH0A 5F6MA 1T8LA 4WMDA 1Z8IB 3RXVA 4B1TA 1FPCH 4ISOA 2AGEX 4NFFA 2BDIA 2I6QA 2YOLA 1O2PA 1TMTH 1SKYE 3T27A 2FOEA 3N99A 4ABHA 4BTIB 1CT4E 2WV4A 4VGCB 3SV8A 2NU4E 2KAIA 5DK1A 1VKYA 2QF0A 5I25A 1MTNB 1MU8B 1PPZA 1LDTT 2GTBA 4X1NU 5GCHF 3S0NA 3KHVA 1F2SE 2Y82A 1VR1H 2BDBA 4NWLA 1DFPA 3F9FA 1P05A 2J98B 3ODDA 2A1DB 2Q6FA 1Z8GA 3A8DA 4CBOA 4JZ1A 1BZXE 2GX4A 2OK5A 1ZPZA 4HGCA 1K0HA 1MAXA 1K1NA 1KTTB 2IJOB 1ZMNA 3M7QA 1LPZB 1YGCH 3P70B 3SJ9A 4RSPA 3E1XB 5EQRA 3SGAE 2G00A 1O30A 1W13U 1DM4B 7ESTE 4FU8A 3WY8A 1WDIA 5EODA 1GCTB 1FIWA 3T26A 1T7CA 1B0EA 2AMPA 1Y5AT 4ZHAA 2C8YB 2B5TB 1IHSH 2LP6A 2PR3A 4NIWA 2ZI2H 4IC5A 1Z8RA 2FX6A 3UFAA 3UPEA 2C4FH 4Z6AH 4X6NA 1W8BH 1BT7A 1BJUA 1DICA 3OAAD 2C3SA 1JXPA 3RC6A 1LPKB 1P12E 3U28C 1O2ZA 3UQOA 3R3GB 1ELTA 1P0SH 1YKTA 2UWPA 1H9LB 7GCHF 1TALA 2B9LA 3RXBA 1GBMA 2P3TB 3PO1B 2FX4A 1P10A 5AFZH 3MO9A 1GDQA 5K0HA 5AVDA 2ZPRA 5FAHA 2QAAA 4XSKU 5DP4A 1KDQB 5EQSA 1DE7H 3RU4D 1LVOA 4FUCA 2ODQA 1N6YA 1MKWH 2FWWA 2WHXA 2ZGJA 3GCNA 2M5TA 4GLYA 2F91A 5EXNA 4Y71A 2G4UA 2BDCA 1YPGH 2R3UA 4NSVA 2PKSC 5FL7D 5C1YA 9LPRA 3LONA 4NG9H 1ZR0A 1MD8A 2FOFA 2ZGCA 1GJDB 1OWJA 1UVPA 1IOEA 2BD7A 1EOLA 1MABB 1KLJH 1H8HD 2AFQB 1SGFA 1XUKA
chains in the Genus database with same CATH topology
1EB1H 5EG4A 1C1UH 3PMJA 3SI4H 1JBUH 1ZHPA 1RFNA 1O2UA 1O0DH 1Y5BT 4AFUA 2J92A 4MQAA 2QXGA 3RC4A 1E35B 3RU4E 3SU1A 1G36A 4WWYA 4DW2U 4UDWH 1KYNA 3ATLA 2FI3E 4JYVH 4TY7A 2P94A 4DVAU 5CMXH 1FONA 3CS7A 1HAOH 1V2LT 2Z9IA 4YLQH 5C5NA 1H8IH 1DOJA 3A89A 1ELVA 2P93A 1GMHF 1GL1A 1SGYE 1K1OA 2B0FA 1GJ7B 2RA0A 1W11U 1V2OT 4I8LA 4K1TA 3QTOH 1EAIA 1CSOE 1GBAA 1G37A 1HAGE 2WUBA 4XBBA 3RMLH 1HB0B 4XDEA 1BMAA 3BF6H 3UR6A 3ZZ8A 1MKWK 3HKIB 4I31A 3GISB 1D3DB 1NFYA 2G81E 2TPIZ 1O2SA 3K6YA 4KELA 1VCQA 1NRPH 1KIGH 1XMNB 1BITA 1QNJA 3P8GA 1ZZZA 2ZF0H 3FP6E 4UFDH 3T29A 2BX4A 2BQWB 3KNXA 3GDSA 4ABJA 5DO4H 3ATMA 4IW4E 1GVLA 2EA3A 3W95A 3F68H 4NGAH 3Q3KA 3SNBA 1ZOMA 4IMQA 2UUKB 2FEQH 2RG3A 1TA6A 3GDUA 2CF8H 4AG2A 3I78A 1EAUA 1L4ZA 2Z9GA 1WBGB 2BDYA 2ANWA 1W0ZU 2CV3A 4NSYA 1GBJA 1P2JA 4A1XA 1WTGH 2LPRA 1P2KA 2JETB 2CJIA 1C1PA 1K28D 3JZ1B 3BEUA 4ABGA 1PPCE 1GI9B 3KCGH 1L0ZA 1UTNA 1CVWH 3ZZ4A 1EUFA 1NFXA 4XBDA 1GHYH 2H9EH 1XUHA 2IOTA 3MNXA 3TLOA 1BMLA 1TRYA 3ODFA 4TWYA 1FNIA 3SU5A 4AFQA 1SMFE 4H6TA 1IQNA 1S5SA 1S0QA 4FUFA 2ZFPH 1AFEH 2SGQE 3U8RH 1PQAA 1OSSA 1BTYA 5JB8S 2A5AA 1QCPA 4U01A 3E6PH 2ANMH 1O2WA 2BXUH 3F9GA 3P8NA 4BAKB 2CGAA 1F0UA 2OC0A 3KGPA 3QLPH 5K7RA 3R0FA 1BB0B 2GT8A 4ABFA 2OLGA 2OQUA 2BOKA 1C5OH 5EXMA 3RXTA 1ZYOA 2Y5FA 1GGDC 1K1IA 2XCNA 2PFEA 3O8RA 2HALA 3A80A 3LH3A 3MO3A 1NT1A 3DUXH 5E8EH 3SJKA 2GCHG 3RXIA 1NESE 1EP6A 1A1RA 5FPTA 3ITIA 3O8BA 2PLXA 3UWJH 1PFXC 4TYDA 1TOCB 1NRRH 4U32A 1PYTD 1FY1A 1O33A 1YYY1 3RXDA 4AYVB 1DPOA 3K9XB 3RXMA 1YPEH 4CRCA 2EC9H 4OGYA 1GBDA 2FM2A 2Y7ZA 1HAHH 1DX5M 2PTNA 1O3BA 2C8ZB 1TGSZ 2FOBA 1EOJA 3SV9A 3VPKA 3ZVAA 4IGDA 3QK1A 4XFQA 3SNEA 1AKSB 5F8ZA 1J9CH 5I46H 1TFXA 1VITF 3RXQA 1DUEA 4ISLA 1CBWB 2FOGA 3PWBA 4AOQA 1ZSKA 1GI2A 2HNTE 2ZU4A 4Y8YA 5LPEA 1GCDA 2PKSB 1QJ6B 4X8UH 4BOHA 3LJJA 5LPRA 4MPUA 2FS8A 1C4Y2 1Q3XA 2XBXA 2ZPSA 3D62A 3MTYA 3SV7A 1O31A 1AZZA 2V3OH 1HUTH 1C1SA 2XW9A 3CENA 5HM2A 1TA2A 4XBCA 5DP5A 3SUDA 3O8DA 1UMAH 4Y7AA 3UOPA 5JBBS 1GJAB 4Y7BA 2XYAA 2NU0E 3V0XA 3F9EA 4DIHH 1XX9A 3P92A 3LJOA 3SHAH 1OKXA 1BTWA 1XUFA 1ORFA 1UTJA 5AF9H 1SFQB 2A4OA 4KKDA 2BVXH 2R9PA 1ZSLA 2ZKSA 5JB9S 3O8CA 2FDAA 2GV7A 2UUFB 5FBEA 1GL0E 1C5WB 3OY6U 1O2KA 1TPOA 1UCYE 7LPRA 1MQ5A 1VZQH 2OQ5A 1O2VA 3DA9B 1ZSJA 2SGFE 3C1KA 3GCOA 3GY4A 4JZIA 2F3CE 1AMHA 1CHGA 5FHTA 3STJA 1ZRKA 3BTTE 3B9FH 3T5FH 1CA0C 5IYTA 1NM6A 1GHBF 1SSXA 2ALPA 4DT7B 6LPRA 3QGJA 4HZHA 2TGDA 3P6ZB 1TRNA 2WPIS 3S69A 1G30B 1HAZB 1TAWA 1W12U 4ISIH 2BTCE 3MI4A 1AE5A 1AFQB 1XVMA 2IPHA 2KAIB 4HTCH 5J4QA 5T6FA 4IC6A 4DGJA 3M5NA 4X2WA 3S7HB 2QGRA 4E05H 1Z8JB 1FIZA 1MMJN 3FAOA 3LDXH 4K5ZA 3TJVA 1VCWA 1AHTH 2A4QA 2BM2A 1GHWH 5BPEA 6ESTA 4IBLH 5PTPA 3EA8A 1AVWA 1OYTH 2PKAA 3GCHC 1ABJH 3DFJA 1XXFA 2LNCA 3D65E 3PTBA 2H1UA 1QHRB 1MTSA 3RXJA 1ANDA 1FY8E 1ESTA 3BTDE 2P3FH 4IN2A 1C1QA 2CXVA 1MTVA 2VIOA 3MU0A 2UWOA 4MVNA 4UONA 3L6PA 5EW1H 1P3CA 1H4WA 1RD3B 1QA0A 1KXEA 3S9BA 2QXIA 1A5HA 3BIVH 4DJZB 3F9HA 3NWUA 1B7XB 3IG6B 5C2ZA 2ZC9H 3LGWA 3V13A 2ZFTA 2ZTYA 3T28A 1O2GH 1O3DA 4RKOB 1A5GH 1EPTA 3ZZ6A 3BTQE 3ZZ7A 5L2YH 1BCUH 1ZHRA 2Z94A 1GGDB 1SGCA 4AX9H 3SUEA 1GDNA 3ZZCA 1IQLA 1GJ8B 2G5NA 1KLIH 1LVBA 4BNRA 3ZYEA 1Q31A 1ID5H 1C5ZB 1ELFA 2ZIQH 4ZMAH 6GCHG 1XKBC 1H8DH 2OUAA 2P95A 1FY4A 5LH8A 3AW0A 3QGNB 6CHAB 3ATKA 2BB4A 2CHAB 1C5UA 3Q77A 1BA8B 3RU4T 1GJ4H 2FLRH 1RIWC 2ZDKA 4E7RG 3TH4H 4ZKOU 1O5EH 2WUCA 1Y59T 2ZO3H 4DY7B 2JKHA 3PB1E 1GG6C 2A7JA 2ZTXA 1O2LA 1PYTC 1DWBH 5A8ZA 1V2NT 2XRCA 4BAQB 1O3AA 1O3KA 4OS2A 2VB0A 1O2RA 5DP6A 1C4V2 4FUBA 5DGJA 3ZVGA 3E91A 1VJ9U 1TABE 1O3MA 1MZAA 4BXSA 1SOTA 4X1SU 4B71A 2BD5A 1V2QT 2ZCLP 1K1LA 3RMOH 5L6NH 2QY0B 1RGQA 2HNTF 2H9TH 3T2NA 4D9RA 1UTOA 3DD2H 1CO7E 1AD8H 3MNBA 1F0RA 1HBTH 1C5XB 2J2UA 2AH4X 3RM2H 2H9HA 1KXDA 2AGIX 2VGCB 3A8CA 1GI5A 4ABIA 1Y8TA 4LOYH 1CGIE 2AEIH 3GY7A 5FX5A 3TGKE 1C1VH 3BTEE 1RRKA 1LHCH 1V2UT 2FIRH 5E2OA 3GOVB 1XUGA 4Q7YA 5HXFA 1O2MA 4JCNA 5CHAC 2NU1E 1OP0A 8GCHF 1MQ6A 4ZUHA 1SGDE 1FV9A 4TPYA 2W3IA 4AG1A 1ZJDA 2G8TA 1GBTA 1S82A 3H5CB 2VIDA 3MH6A 2OC1A 4AN7A 1BBRE 2QIQA 1G3CA 3SORA 1QJ1B 1MCTA 1PQ5A 2WPKS 1Z7KA 2XC0A 2HVXA 3BTHE 3GY6A 3A8BA 1K1MA 3GY2A 2DUCA 3TJOA 4BAHB 1SC8U 2SFAA 1ETTH 1TQ7B 1CA0B 1Y3WA 3K65B 3EE0B 2BD9A 3UOUA 1TYNA 2GT7A 1PPEE 1Z1IA 4X8TH 1DITH 3ZV9A 1HAXB 2STBE 1EAWA 1BTZA 1ZJKA 3A87A 3M35A 3NXPA 1BQYA 1WUNH 4NZQA 4Q80A 3RXEA 3TGJE 1C2MA 2GMTC 2Y7XA 3UREA 1YF4A 4ZKSU 1O5FH 1C1TA 2BX3A 1NO9H 3ZV8A 4NA9H 1NN6A 1EPTC 1EAXA 1RTFB 2G55A 2I6SA 5FX6A 3SV6A 3TNTA 3RXSA 2HPPH 2ILNA 4OGXA 2Y81A 1ZPBA 5TCCA 2P8OC 3LPRA 2ZZUH 4O03A 4MNVA 2SGAA 5A0CA 3GCHB 5DP3A 2EI7A 1HAIH 2OBQA 1TX8A 1PPFE 4NWKA 1DVAH 2W5EA 1ESBA 1TPAE 1YCPM 1K21H 1TRMA 2F9OA 1SGIB 1OP2A 1UTPA 1P2MA 2FP7B 2SNWA 5A0AE 1ETRH 2PGBB 1HJAB 2J4IA 2ZFFH 1FY5A 3PWCA 4CRFA 1TGNA 2FMJA 2STAE 3A7WA 4YZUA 1AIXH 2OTVA 1NROH 2WPLS 1O3CA 5JYIA 2VWLA 2FS9A 2HRVA 2G4TA 1NZQH 1SGEE 2W26A 1A0JA 2VNTA 1AO5A 1JRTA 2H5CA 2Y6TA 2R0KA 4IN1A 2H5DA 1QBNA 1GHAG 3SNAA 3SQEE 1FI8A 2PUQH 1LHGH 3PMHB 1S84A 1EASA 2GKVE 1E36B 4NZLA 1FMGA 1JMOH 5LGOA 1O36A 1S0RA 2Y80A 3NUMA 4UFGH 1NRQH 1P2OA 2ZGHA 4K2YA 3RXAA 1OWIA 1T4UH 2QC2A 2WPMS 3PLPA 5ESBA 1FXYA 4O3TA 3BTFE 4MPWA 1YPKH 1TWXB 5LPFA 1OWEA 3A83A 1MKXH 1GBIA 2GVFA 2G52A 2RA3A 2ZFSA 2J95A 1DSUA 9ESTA 2GCTB 1GPZA 5A8YA 1MBQA 2BMGB 1QURH 4LZ4B 3Q3YA 1Y3XA 2ZFRH 1ZGIA 4UE7H 1H9HE 5F8XA 3TU7H 4FUGA 8LPRA 1GBLA 2VU8E 1OWDA 1SR5C 3DFLA 3E16B 1UVSH 1O3HA 1KSNA 2Z9LA 1LVMA 1PQ8A 3ZVDA 1GJ6A 3MH7A 1BDAA 3SN8A 3SGQE 2AMQA 3KQDA 1ELEE 2W7UA 2ZFQH 1T8NA 5C20A 4DOQA 2BXTH 2FODA 3VEQB 4TY6A 2FI5E 4RKJB 4GHQA 4YOJA 2FOAA 3F1SB 4ESTE 4H42U 1KXAA 1J16A 2O8MA 1H1BA 3UNQA 1QJ7B 1OYQA 2HGTH 3BTGE 5FCRA 1QIXB 1W10U 1MKXK 2IN2A 5GXPA 2O8TA 2AGGX 1ANCA 1HPGA 2PSXA 2VIPA 1YLDA 3L3TA 2Z7FE 2BVSH 3G01A 1OWHA 4GCHF 1PPGE 2B8OH 3VB6A 1ZTLA 1UCYK 2K1QA 1EP5A 3K6ZA 2OCVB 1O38A 4Y76A 5E2PA 2Z3CA 3LGVA 1YPHE 5CHAB 4Y8ZA 3MU1A 1AWFH 3ZZBA 4MNWA 4B2CA 1O3EA 1ZHMA 4TPIZ 1WYKA 1F5RA 1TGCA 3K2UA 4Y8XA 4Z0KA 5SGAE 3EAJA 4AGJA 3CS0A 2PUXB 4O97A 1DUAA 1OP8A 3BN9A 1AE8H 1ZGVA 3OU0A 2A45B 4NFEA 2PKAB 4K1SA 1E38B 4KP0A 2BLWA 3KL6A 2H6MA 3HPTB 1K22H 3OYPA 3ZZ3A 1NY22 3VFEA 4THNH 1TBQH 1ZMJA 2D2DA 4BAMB 2AERH 1HNEE 2WPHS 2XNIA 1LHDH 1LCYA 3A85A 4CRAA 2V3HH 2ZCHP 1AI8H 1YPJH 2BY6X 1JIRA 1O2XA 3KQEA 1Z6JH 2BDGA 3S7KB 1OPHB 1WSSH 2ZEBA 2ZDVH 2FXRA 2VVUA 1GVKB 1EPTB 1CE5A 5T3HA 2BZ6H 3MH5A 1S81A 1NC6A 5EPYA 1RTLA 1BHXF 2XCFA 2GV6A 1C2EA 5GCHG 2TBSA 3BV9B 1NRNH 1C9TA 4MPXA 2P8OB 1WCZA 1SLUB 8ESTE 1SI5H 1J17T 4B75A 1QBOA 4JYTA 1F7ZA 4AFZA 3E0PB 3VB3A 5JBAS 4H6SB 5C3NA 1Z6EA 4CH8B 1GMDF 1EX3A 4X2YA 1FN6A 5HYOA 3KQCA 1O2IA 3BTKE 1UHBA 3V12A 2GD4B 1P8VC 4F4OC 4TWWA 1S6HA 3B23B 3AW1A 3AVZA 2R3YA 1FY3A 2JH0D 4YLUA 4KTUA 3ZVBA 1CT0E 3LIWA 2TGAA 1GJCB 4FUEA 7GCHG 3IWMA 1T31A 1CHOF 2YNAA 4GSOA 1QL8A 3M5MA 1KXBA 3Q3XA 3VXFH 3BTME 1AVGH 2Q6DA 4K60A 1C2HA 5JBCS 3PM3A 3V3MA 1CQQA 2BD2A 5FPYA 1W7XH 2GDEH 1OWKA 4U30A 1TB6H 1CGHA 3ZZDA 4FUHA 1TBRH 4X6OA 1CA8B 2ZG0H 2GZ8A 2H2ZA 3SV2H 3A7YA 3U1JB 2P16A 1C5SA 1Z71A 2ODPA 3H7OA 4K1EA 3STIA 2WV5A 3UWIA 1P3EA 1L2EA 3M5OA 3W94A 1S85A 1C5TA 1ACBE 3E90B 3GY3A 3P17H 4JMYA 1CU1A 1NFUA 3LC5A 5EU8A 3UNRA 3PMAB 2BDAA 1EJMA 3PV4A 1BRBE 1ZPCA 2AMDA 3T25A 1C5PA 1K2I1 5B6OA 3HATH 2ZHDA 4Y0YE 4E06H 3D23A 1V2VT 1FZZA 1GMHG 2Z9JA 1F0TA 1HYLA 5C67A 2FZZA 4R8TB 2ZGXH 3C27B 3A81A 1RS0A 5CE1A 1C2DA 3URDA 4OS4A 3VGCC 1O3FA 3OSYA 3T62A 4I33A 2F9UA 3PLKA 4Y0ZE 3FVFB 2FTLE 2ZECA 1BUIA 4INHA 2ZTZA 1HCGA 1G2MA 5EQQA 2ANYA 2JH5D 4B73A 1Q2WA 1YCPK 3AAVA 1YPHC 3SQHE 1C1RA 1P09A 3VXEH 5L30H 2SGDE 1C5QA 4ISHH 1UVOA 2SGPE 1QFKH 3SBKA 4JZEH 3V7TA 1AUTC 4YOIA 1H9IE 2BLVA 2C93B 3A7TA 3ZZ9A 3TJNA 2ZDMA 2VWNA 5ETXA 2TGPZ 1O3NA 1V2TT 1RXPA 4FUDA 1SB1H 4GCHG 4VGCC 2ZWLH 1C2IA 1GBBA 1FDPA 4AB9A 4OS1A 2ZCKP 1VGCC 1QB6A 1YPLH 3MHWU 4BANB 1LKAA 4SGAE 1B0FA 1AY6H 1DLKB 1O5AB 1VITH 1LTOA 2BY8X 5F8TA 1F0SA 4B2AA 5E0JA 1V2WT 1NS3A