3V12A

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v12A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v12A02
2W3KA 4NIVA 1HAGE 2TIOA 2WPMS 3SV8A 3UREA 3EA8A 4OGYA 4A1XA 1HXEH 3M37A 4AGJA 2H6MA 1XMNB 3PYHA 5CHAC 1GPZA 2ZQ1A 4NGAH 3A8CA 1OYQA 5JDUB 1KDQA 2FTMA 1D6WA 5AFYH 5SGAE 1SGTA 1ELEE 3MU0A 2QXGA 2HOBA 4LOYH 3L3TA 3QDZB 5EW2H 1TPPA 5A09A 2ZPSA 1W2KH 4AFQA 1P8VC 2ZU4A 1KSNA 1QURH 1NPMA 3A8BA 2FS8A 1JIRA 1LDTT 1UK4A 1YCPM 4ISHH 5E2PA 4NWKA 1NRPH 1GVKB 2BQWB 1GHAF 4YT6H 3LH1A 1W14U 1VR1H 4D9RA 1MUEB 4Q7YA 2VNTA 1O5BB 4WY3A 1EB2A 1LCYA 2PKAA 1GCTB 4OS5A 1O2TA 1Y3YA 1A46H 1NFXA 4NA7A 2PGBB 1NZQH 1O3DA 2ULLA 2J9NA 2GD4B 3QTVH 3TJOA 1V2RT 2ZECA 4JYUH 2STBE 1EKBB 4HTCH 1AD8H 1GJ5H 1DWBH 2ZFQH 1AMHA 2A4OA 2BTCE 2ZDNA 3SUGA 4IS5A 5FX5A 3SV9A 4I7YH 1EUFA 1ZHMA 3IITA 1F5RA 2STAE 1JXPA 2GTBA 2SGDE 2BD9A 3E6PH 4FUHA 1AO5A 1SLVB 4FUFA 2FOAA 5F03A 2ILNA 1AVGH 4WF8A 1FAKH 1Q3XA 2ZFTA 3PMAB 3QUMP 2ODYB 3NPSA 4KELA 1C1MA 2CJIA 2BX3A 1HGTH 1OP8A 2GT7A 3ITIA 1GJDB 2G00A 4JK6A 4TPYA 2VVCA 2SFAA 1C1VH 1YPEH 5ESTE 4ABEA 1EAIA 1C5PA 1TRNA 1S6HA 5FPYA 3S9CA 2PKSB 1GI9B 3NXPA 3OY5U 2A2XH 2UWPA 1PPZA 1YPHC 3SI3H 3M35A 3LOXA 1Y3VA 3MH4A 4A92A 5AFZH 1YPLH 1O3MA 3PLKA 1ORFA 3V3MA 1C5SA 5E0HA 4FXGH 1EASA 7LPRA 1LHDH 4OS7A 1GBHA 2KAIA 1Y59T 2TGAA 3UOUA 1BT7A 3OY6U 1ZMLA 3P70B 2QGRA 3QTOH 1LTOA 3MMGA 1HDTH 2CXVA 3M3TA 2A5KA 3TGJE 2QY0B 3IG6B 1P2KA 2RDLA 1EP5A 2AMPA 3MWIU 1TONA 3VB4A 1BBRH 1TRYA 3VGCC 2Z94A 2G4UA 2PW8H 1QA7A 4DT7B 1O5AB 3S9AA 1TMBH 1HYLA 2FO9A 3BN9A 3O8DA 3FAOA 4WH6A 5F8ZA 2QN5T 2VIVA 2WV5A 4ZKNU 3SU4A 3O8BA 1Z6JH 2P3TB 2FWWA 1UTJA 5EPNA 2HPPH 2BLVA 3U98H 1G9IE 1HAHH 3FZDA 5E2OA 4KTCA 4SGAE 4XE4A 1FXYA 5T6GA 1FONA 3UQOA 3QX5H 3PROA 1ABIH 2P16A 3NWUA 2BVXH 4B71A 3ZZ5A 1EZSC 5TJXA 1BQYA 1GBAA 1FMGA 1E38B 1S0QA 1ZRBA 1A4WH 4XSKU 2A2QH 4X6MA 3K65B 8LPRA 5DP8A 3TGKE 1SLWB 1ZTLA 2FOHA 1IQGA 1H4WA 3GCTF 3TITA 3TLOA 4ABJA 1O5EH 2G55A 5E0JA 1ID5H 1H9HE 2SGFE 2Z9JA 2XWBI 1PYTC 3U1IB 4K1SA 1YP9A 1BTYA 3KF2A 3SNAA 1GBTA 5PTPA 2Z3CA 2ZDKA 1TFXA 1QQ4A 3ZVDA 2CN0H 5DPAA 1AVXA 5BRRE 1OWJA 1BHXF 1K1IA 1Q31A 1OXGA 1K1MA 3A88A 2XNIA 1F5KU 1O3GA 1V2KT 2JH0D 2VVVA 3URCA 3LGIA 7KMEH 4UFFH 1EOJA 1HAVB 3VB3A 4X1RU 3H7TA 1NM6A 3RDZA 4JCNA 5EU8A 3PMBB 1ACBE 2VJ1A 2G8TA 1E37B 4BNRA 1WCZA 1WTHD 3CENA 2FYRA 4ISLA 2AS9A 1BRCE 1TNGA 2BOHB 1T8LA 1O2MA 1MZAA 2OD3B 4JMYA 2PTNA 2PSXA 3F9FA 3GCNA 4RN6A 5FBIA 5LGOA 1DITH 2Q6GA 1O2XA 1MKWH 4I8HA 3I29A 1EQ9A 3FP6E 4FUGA 2PTCE 4O3UA 1J9CH 4ESTE 3LGYA 1YGCH 5EGMA 4OGXA 2BY9X 2I6SA 1C5QA 1V2QT 1WAYB 5E8EH 4RSPA 3O8CA 2RA0A 2VIOA 1C1WH 3S9BA 2GDEH 1FPHH 1A3BH 4VGCC 4H6TA 1TGSZ 4ZHAA 1D3QB 2YNBA 1HAOH 5H4IB 1KIGH 2BQ7B 2QXHA 2SNWA 1PQ7A 1O3AA 1F0RA 1NFYA 1AE5A 1C5TA 1LHEH 2BQ6B 3RMNH 2GT8A 1V2WT 5JYIA 3BF6H 1LHGH 2C8ZB 3ENSB 3LDXH 2Y5HA 4F4OC 5ETXA 1KLTA 3A82A 3EGKH 1QBNA 5DJ7A 2A45B 1HJ9A 4AG1A 3E3TA 1EJAA 1WYKA 4ISOA 1KXFA 2FM2A 3U1JB 2GCHG 2F9PA 4D7FA 5EXNA 2AYWA 4ABIA 3BG8A 1T4VH 1VCWA 2V6NA 1GJ7B 4ZH8A 4YT7H 1S82A 5L6NH 2FYQA 3STJA 3SUEA 3MO6A 2BDYA 3VB6A 2OINA 3UR9A 1K9OE 1O3EA 1UJ1A 2GCTC 1TLDA 1BOQA 3BTFE 1OSSA 3KGPA 3SV7A 1PPEE 2FLRH 3SGAE 3RM0H 2UWLA 1UHBB 1CHOF 3FVFB 1SGCA 4YO9A 1XVMA 3M3SA 1OWKA 1T31A 1E36B 1EZQA 4ABAA 2CHAC 5L30H 3MHWU 1T4UH 2ZA5A 2ZIQH 4K8BA 1RJXB 4WMEA 1O32A 3ZZCA 1HJ8A 1J8AA 3ZV9A 2ZDLA 1FDPA 4NA8A 4X1PU 4NIWA 2XC0A 1DPOA 1KXAA 1FV9A 1YCPK 1YBWA 1TPOA 1PQAA 1EOLA 4ZAEA 5FCRA 4UD9H 1FN6A 1INCA 1GI3A 1DFPA 1BBRK 1F0TA 1W11U 2HGTH 1VCPA 2SGQE 1SGPE 1BDAA 1JWTA 3RMLH 3SN8A 1YPKH 3KL6A 3PMJA 1TQ7B 3QLPH 4R8TB 4IBLH 1X7AC 3KEEA 2WUCA 1THRH 2CF9H 1G3BA 2SGAA 1SI5H 4LZ1H 1QR3E 1BITA 2BB4A 1BTWA 2O8TA 2CGAA 2H5DA 5LPFA 3QZRA 4IGDA 4K2YA 4E05H 3PLPA 2OC0A 4MQAA 2ZCKP 5GDSH 1G3CA 3RXBA 1BRBE 1BTXA 4ZHLU 3RMMH 2Y5GA 3RXOA 2R2WU 4X8SH 2D2DA 2ZU3A 1HRTH 1V2TT 1D9IA 1ZSLA 1EZXC 2W26A 2FTLE 4IN2A 1AFQC 1CA0B 5FCKA 8GCHF 3RXLA 2PV9B 3NUMA 4INHA 1C2GA 1BJVA 2PUQH 3MO9A 4K5ZA 5T6FA 4FUBA 2AGIX 9LPRA 4AYVB 1GJ9B 1O2HA 1FI8A 1VITF 3A7VA 3U8OH 2OC7A 1MTNC 3PO1B 1C5XB 4Y76A 1EPTC 4B75A 5CMXH 1OWDA 1Z71A 1HAPH 1C5LH 2GP9B 2ZFPH 5F6MA 5TCCA 1P3EA 4WXVA 1XUHA 3SJKA 5EODA 2V3OH 3C1KA 5K0HA 3LGWA 1GJ6A 4O03A 3DFJA 3MO3A 1QCPA 1E0FD 1CO7E 4AG2A 4ZUHA 1TB6H 6CHAB 5A2MH 5AHGH 2IPHA 4MPVA 3SHCH 1N6XA 2Y80A 2ANMH 2ZTZA 1P04A 1C4U2 1MBMA 2ANWA 1XUFA 4Y10E 2FZZA 3MNSA 1QB6A 2VVUA 1G37A 1KXDA 5FXLA 1UTLM 1L4DA 2XBXA 5JBTA 2WINI 4IC6A 4E7RG 2TGTA 3S0NA 1OPHB 1CGHA 1DICA 1LPKB 2D1JA 5J4QA 2HVXA 3A8AA 3B9FH 3F9HA 3GY2A 2P59A 1F0SA 4I31A 4I8JA 3K6ZA 5ESBA 3PMHB 2C8YB 5GJ4B 1V2JT 2PLXA 3Q3KA 1OWEA 5CHAB 1TAWA 1XXDA 3VXFH 5FAHA 1TPSA 2Y7ZA 2ALVA 4DIHH 3ZVBA 4O9VA 4DOQA 3S7HB 2Z9KA 3ESTA 2XTTB 1GCDA 1A61H 1GBJA 4NSYA 3UWJH 2ZCLP 1VGCB 4MDSA 1O5CB 1L4ZA 1C2DA 2YOLA 1XUJA 4ABBA 3LT3A 3BEUA 5IDKA 2ZZUH 3RXUA 4U01A 4NFFA 1W7GH 2G51A 1QBVH 3TH3H 1GDUA 2A7JA 4H42U 2LPRA 3SU2A 1DVAH 4UONA 1CT0E 1BMMH 4I8KA 3RLWH 1O3FA 3F1SB 1T7CA 2FI4E 2WPIS 1MD7A 2D8WA 1D4PB 1PPBH 1O2YA 3RC4A 1YLCA 2IOTA 1O2VA 3SZNA 1Z8JB 3SJ8A 1C2HA 1SQAA 4KTSA 1IQMA 2K1QA 2R3UA 2TBSA 1YLDA 2FDAA 1C5RA 5C67A 1TABE 1XM1A 5C20A 3TH2H 1UTQA 1UVOA 1UCYH 3Q77A 1GVLA 3AW0A 3MNXA 1GI4A 1GG6C 1Y8TA 3BIVH 3TK9A 1T8MA 2VH6A 1TBZH 1C9TA 2R9PA 3PV4A 1O36A 4X2XA 1IQKA 2SGPE 1UTNA 3SU1A 3SJ9A 1YPGH 3UQVA 2HALA 4X1SU 2Y82A 2P8OC 2VINA 1A3EH 2OQUA 2W3IA 1W0ZU 1HAVA 1Y5UT 3HKJB 1TRMA 4IN1A 3LONA 3PWBA 1AB9C 1O0DH 4TPIZ 3K9XB 2GMTC 1ABJH 1GBLA 4AGKA 2P3FH 1P12E 2NU1E 5L2YH 5JBCS 4ISIH 2H9EH 4X1NU 4ZXYH 1UK3A 4YLQH 1ELAA 2Z9IA 3U9AH 2DE9A 2FX4A 1DSTA 2O8LA 4FU9A 2H2ZA 4UFGH 1Y3UA 3TNSA 3SQEE 1GL0E 5DP5A 2FX6A 1ETRH 1KXEA 1Z8GA 2AGGX 4AB8A 4BAQB 1ANCA 3AW1A 4B2AA 3DD2H 2ZFRH 1YF4A 2QA9E 1UTOA 5EPYA 4MVNA 1DOJA 3HK3B 1BUIA 3RXVA 1QHRB 3A89A 1TNKA 2XCNA 1CVWH 1ZR0A 1YKTA 5L2ZH 2QYIA 4HGCA 2XW9A 3UY9A 1GHBG 3UFAA 1D3TB 2V0BA 1CU1A 1C1UH 3GCHC 1GJBB 3TPIZ 1TPAE 1Y3WA 3OTJE 3P92A 3ZYEA 3ZZ3A 1NU7B 1GHYH 1P2JA 1EJNA 1A0LA 2A7HA 1MQ5A 2ZHQH 1V2MT 1DY8A 2BDCA 2ZGJA 1W13U 4TYDA 2QF3A 1C4Y2 3BTTE 4Y0YE 3M5MA 3MH6A 2QIQA 1O2IA 1SVPA 1WTGH 3U8RH 3RM2H 2O8WA 1BMLA 3UWIA 4BTUB 5DK1A 1N6YA 2H1UA 1O2SA 1ESAA 2CMYA 3T25A 3BEFB 2UUKB 3F9EA 4UFEH 1NRNH 3I78A 3SNBA 2FOGA 2F83A 3B23B 1O2PA 1EXFA 4XBBA 3M3VA 4AN7A 2GX4A 2O8UA 1ELFA 1SMFE 4HI3A 1THSH 4OS2A 2Y6TA 1ELDE 1GCTC 1O38A 1XXFA 1K1NA 3GY4A 3ELAH 2M5TA 1SQOA 2FOFA 1ANBA 3QGJA 3AASA 4ZKSU 1GGDB 1UHBA 1YPMH 1BBRE 3RXMA 4NZLA 5DP3A 5A8YA 4HFPB 3BG4C 4HZHA 4X0WU 1O3KA 3E8LA 3HK6B 5DP7A 1FZZA 1TOCB 2XWAA 1IQIA 2VH0A 1UK2A 1JIMA 2HNTF 1GBIA 3A85A 4CBNA 1O2KA 4DW2U 1O33A 1G3DA 1K22H 1AGJA 1OYTH 3RXEA 4AZ2B 1F92A 3KQCA 1TBQH 2A5IA 3A80A 3Q76A 1AWHB 2QXJA 1SGRE 1DUEA 1OP0A 2ZEBA 2W7SA 1K1OA 1SHHB 4FUDA 1H9IE 1L1GA 3A7XA 1NO9H 4JZFH 1K28D 2FIRH 3Q00A 1PYTD 1XUGA 1C2KA 4GUXA 2BVRH 3LKWA 3SGQE 1YPHE 4TY7A 4JZIA 2ZF0H 3A7TA 1KXBA 1P9UA 2OCVB 2QXIA 1THPB 3UNSA 2ZHWH 5DKMA 3LIWA 5GXPA 2C4FH 1N1LA 3M5LA 2W7UA 2ZCHP 1WQVH 1EATA 2WPKS 1QTFA 1C5NH 3BEIB 3ZVEA 1Z6EA 2B0FA 4ABDA 1H8DH 2FLBH 3TH4H 3SBKA 2GCHF 1XUIA 3NKKA 1RTKA 1D6RA 3ATIA 4Y8ZA 4XOJA 1C5ZB 2BY7X 4Q2KA 1HIAB 3HKIB 1FY1A 1ZGIA 4CREA 2ZGXH 5EQSA 1EX3A 4VGCB 2TGDA 3S69A 1AY6H 1Z7KA 3ZVCA 5TCAA 2BD5A 5AF9H 1HLTH 5IYTA 1K1LA 1GHZA 2AIPA 2GGVB 1BMAA 5FPSA 2VU8E 1T32A 2BDHA 3SNEA 4DURA 1LMWB 1FN8A 3ZYDA 5C1UA 3MU4A 1QL7A 2TPIZ 4X6NA 2J92A 4Z6AH 3BSQA 4X1QU 1NRQH 3RXCA 2EA3A 1MKXH 2G5VA 2F9UA 1UTKA 4CRAA 4I8GA 1NESE 1UTPA 1IHSH 3I77A 1FY3A 1O3PB 2ZG0H 4CHAC 1CQQA 1GMHG 6LPRA 2G52A 3SU3A 2FOEA 3IWMA 3P8GA 1VITH 3H5CB 4WMDA 1CGIE 2XCFA 1P06A 1QB9A 3DFLA 3LC3A 5DP4A 1TWXB 2PFEA 1O2NA 2G4TA 4IC5A 2PKAB 1GMDG 4KP0A 1NRSH 1HV7A 3TGIE 1AKSA 1WBGB 4YESB 4AOQA 1O3BA 1GI2A 1ANDA 2Z3EA 1ZJKA 2BY5X 1AQ7A 1S83A 1TGCA 3KN2A 3SU0A 1CBWC 3FANA 3U8TH 5J4SA 3KIDU 2JETB 3M7UA 2HPQH 1ETSH 4M7GA 1TA2A 4FU7A 1MH0A 3LGVA 3GISB 3T5FH 3AVZA 4X8UH 2V3HH 2WPLS 1T8OA 4Y0ZE 4H6SB 1XKBC 1EAXA 5FPTA 5FX6A 8ESTE 1B5GH 2Z6BD 1WOFA 4MLFB 4NCYA 4U32A 5AVDA 1AWFH 1C2MA 2H9HA 1BTHH 3D65E 3LJOA 1O3NA 3E90B 2VGCB 2OC8A 4Y7BA 1TNHA 4Y7AA 1TMTH 1TQ0B 3S7KB 1FPCH 1RRKA 3PLBA 1BIOA 3RXRA 4YLUA 3LH3A 1SGYE 3RP2A 1GBMA 2OQ5A 4NWLA 2EEKA 2IN2A 2C8XB 4AORA 3SUFA 3ODFA 4AFZA 4Y6DA 1SC8U 2WV4A 2OLGA 2AMDA 1ELCA 2OP9A 2UUJB 3M7QA 2VB0A 4BAOB 5A0CA 1LHFH 1PQ8A 2BD3A 2ZGHA 1BA8B 3M36A 2GV7A 3TJVA 3BTKE 5JPMH 3VB7A 5HMAA 2VWOA 2FPZA 2BXTH 1NTPA 3A7ZA 1A0HB 1IHTH 1J17T 1F5LA 3BIUH 2ZDAH 1QRXA 1LPGB 2R0KA 4AFSA 2EI8A 1LVMA 1O5GH 1EAUA 1O39A 1NT1A 1AFQB 4MPXA 5A8ZA 1KY9A 2AIQA 1PPFE 3E0NB 3MH7A 2Y81A 4ZROA 3UTUH 2ODPA 1Z8RA 1GJAB 1EZUC 1GBDA 3DUXH 1RXPA 1ANEA 1JRSA 1MTNB 1C5VA 3PB1E 1HPGA 1IAUA 1EPTB 3V12A 4YOGA 1B0FA 1G2MA 2J95A 5DP9A 1H9LB 1MAYA 2J2UA 4XDEA 1V2ST 2FOBA 1AUJA 1KLIH 3SI4H 2ALPA 3D23A 3UIRA 1ZLRA 1O3CA 4YOIA 1BZXE 3GOVB 4AFUA 1DWDH 2GVFA 1FY8E 1ZZZA 5BPEA 1QBOA 1TA6A 1IQLA 1P02A 1N8OB 3SHAH 3VFEA 4ASHA 1QQUA 1XKAC 2UWOA 1DWCH 3C27B 3TVJB 1W12U 1W10U 5HM2A 1C1SA 1T8NA 2F9OA 3GY7A 4DIIH 1J14A 1UVSH 5EXLA 7GCHF 2H5CA 1TIOA 1WSSH 3VPKA 1WU1A 4GSOA 4NG9H 2VWNA 2ZWLH 3VEQB 1S5SA 6GCHG 1DM4B 3RXAA 2VIQA 1C9PA 1WQSA 3GY6A 1GDQA 3P17H 1U6QA 1B7XB 5GCHF 3E0PB 1S81A 2XBWA 1MZDA 2OBQA 3F6UH 7ESTE 3STIA 3RXQA 1SHYA 1A7SA 2AEIH 2QC2A 3ZVGA 1SG8B 1K21H 2A4QA 3T26A 2O8MA 4THNH 1MBQA 4ZKRU 1GHXH 2HNTC 1HB0B 1DDJA 4OS4A 1FY5A 2BD7A 2Z3DA 4Q7XA 5E0GA 4INLA 1RTFB 2XRCA 3GDVA 2NU4E 2DUCA 4ZXXH 1JOUB 3A7WA 1ELTA 1PPHE 2ZP0H 1SPJA 3EA9A 1SFQB 5GPIB 1SQTA 1P09A 2A4GA 5JBBS 1MKXK 1MU6B 4UDWH 1KYNA 1DE7H 1JMOH 4MNXA 2W5EA 3G01A 1BCUH 3ATLA 4ZKOU 1GBKA 1MKWK 1RIWB 1O2ZA 2PSYA 1DXPA 1ZGVA 1ZHRA 1GG6B 2FOCA 2ZHFH 4GHQA 2DE8A 1SGDE 2QV1A 2XBYA 4AB9A 4Q7ZA 4X2YA 2P93A 1HAYB 3HGPA 3RMOH 1AZZA 1W0YH 2ZC9H 4ISNA 1P2NA 4ZMAH 1Y5AT 2NWNA 2P8OB 1AN1E 1P01A 2ZGBH 4YM9A 1ZTJA 3ZZDA 1HBTH 1FIWA 4FUCA 4FVBA 2I6QA 4PROA 4O3TA 4QT8C 3PTNA 3SV2H 3MU5A 1GHBF 1OWIA 1AB9B 7GCHG 2GMTB 3KNXA 4FVDA 1ESTA 1O2UA 3RU4T 4D9QA 2PGQB 1C1RA 5A0BA 1QA0A 1ZMJA 2EI6A 1O5DH 1XVOA 4K60A 1ZHPA 3EQ0H 3GDUA 1K2I1 3JZ1B 1NC6A 1C1NA 3ZZ9A 1TOMH 1XUKA 1LVBA 4UFDH 4IW4E 4MNWA 5GCHG 1W8BH 4A1VA 3PTBA 1ZMNA 1PQ5A 3D62A 4XBDA 1PJPA 1TGNA 4GHTA 1GBBA 1A0JA 4OS6A 3KCGH 4CRFA 3SW2B 1O34A 3GYLB 1GBCA 2Q6DA 3KHVA 2BLOA 3DHKH 1G36A 4X8VH 2FESH 5FBEA 1HIAA 4J2YB 5EQRA 3MU1A 1V2LT 4CRBA 3UNQA 1V2OT 4MG3A 4BANB 3GCHB 1HJAC 1PPGE 1O3LA 3TJUA 2A4RA 2D26C 3EDXB 2H9TH 3ODDA 1OWHA 3ATMA 2GDDA 3NK8A 1AI8H 3CP7A 3RXGA 5HYOA 1O3HA 1AFEH 1EB1H 1P2IA 1RFNA 3SU5A 3BTHE 1CSOE 5HXFA 1FIZA 2JH5D 2BDIA 1P0SH 2F3CE 3LGTA 3RLYH 4BXSA 1VGCC 3SNCA 1HFDA 1BJUA 5A0AE 2FEQH 4D8NA 1VCQA 2BOKA 1MD8A 2ZU1A 1P9SA 1W7XH 3SU6A 2A32A 1UMAH 1A1RA 1KTTB 4B2CA 2C90B 4FUIA 2ZI2H 3NCLA 1GJCB 1LVYA 1SOZA 4BTTB 1CGJE 1CHGA 1QB1A 2R2MB 1IOEA 1C2LA 4AYYB 1DS2E 1GHWH 1P57B 2Q6FA 1YYY1 3ZV8A 1QFKH 5A8XA 1V2UT 4NIYA 1B0EA 1ZTKA 4YZUA 1Y3XA 4DG4A 2BDGA 2ZGCA 1G2LA 1MMJN 1MTUA 1A5IA 2A31A 1F0UA 2F9NA 5T3HA 3K6YA 4JYVH 1EAWA 1ARCA 2ASUB 2XC4A 4GCHG 3BG4B 3VGCB 4FU8A 2R3YA 1BMNH 1HAZB 1SGFG 1HAXB 1ELBA 1AVWA 1IQJA 4MPWA 5G4BA 1C5YB 2AMQA 1HXFH 1PFXC 2B7DH 4CRCA 3L6PA 2J38A 1DY9A 3MYWA 4IMQA 1C1QA 1V2NT 3QZQA 4I8LA 1D3PB 1GBFA 4DCDA 1WV7H 1TNLA 1QJ6B 2OBOA 4B1TA 4DGJA 3LC5A 1M9UA 1GHVH 4F49A 1AIXH 1LHCH 3UR6A 2FP7B 1P05A 1SGNE 3RC5A 1Y5BT 3M61U 4TY6A 3RXDA 1QY6A 1C2EA 3T2NA 2NU3E 1C1OA 5DGJA 3BTGE 3ATKA 1SGEE 1VZQH 3R0FA 5C2ZA 1CE5A 8KME2 5F8XA 3W95A 2F9BH 1NU9A 1KTSB 4DY7B 5GIBA 3URDA 1GMHF 2ZDMA 4YOJA 5JB9S 2BD2A 1PPCE 1UTMA 3GY5A 1NY22 1RS0A 2ZQ2A 2RG3A 1FNIA 3A8DA 1YCPH 3D49H 4UEHH 2NU2E 3SORA 1MCTA 2F9VA 4UE7H 3TIUA 2R0LA 1GMDF 1GHAG 4NZQA 1FUJA 1TGBA 4NIXA 1P2QA 2G81E 1SFIA 1L1JA 1C4V2 2NU0E 3VB5A 1O2JA 1QGFA 2PWXA 3K2UA 4B74A 1EPTA 3AAUA 2QCYA 5T6DA 5C5OA 2ZU5A 1MQ6A 4X6PA 1UVPA 4X2WA 1LKBA 3PM3A 4I33A 1KLJH 1HAIH 1O3JA 2ZO3H 3GCOA 4U2WA 2PKSC 5B6OA 2GZ7A 1D3DB 4CHAB 3FP7E 2HRVA 1TX8A 1FQ3A 1UO6A 3EYDA 1FAXA 3DA9B 3ZVFA 4A5TS 4Y11E 2VWLA 5DO4H 3RXHA 1BTUA 1O2QA 4NSVA 3Q3XA 1WUNH 4TWWA 3VXEH 3BTDE 3MNBA 2ZKSA 1SB1H 4Y71A 4B76A 1ZSJA 3SOSA 1OS8A 2EI7A 3P8OA 3RU4D 3SV6A 1CBWB 1AZ8A 1EJMA 2FOMB 1NFUA 2YNAA 3F9GA 4Y8YA 1O37A 1IQEA 1QRWA 3RXPA 1GGDC 5I46H 1ZPCA 1Z1JA 1UCYK 3RXJA 4A1TA 4CRGA 3LPRA 2WPHS 3SJOA 2BY8X 2B5TB 1Q2WA 4A6LA 4K3JA 2OUAA 3UUZA 1J15A 1C1TA 1KDQB 2Q1JA 1GI8B 2ZDVH 4ABFA 2IJOB 2ESTE 3A87A 1QJ7B 1DT2A 1C2JA 4AX9H 4SGBE 2OC1A 3ZVAA 1V2VT 3UNRA 2HLCA 1TX7A 2TRMA 3RUOA 1RTLA 1NN6A 4ZHMU 1LVOA 4WH8A 4FUJA 1RGQA 3BTWE 2AH4X 3DT0H 2FMJA 1DSUA 1G3EA 1FY4A 2TGPZ 4ABHA 2GCTB 1GJ8B 4D76A 1O2RA 3ZZ8A 1W3CA 3MI4A 5EOKA 3Q3YA 1ZPZA 1E35B 3QGNB 3W94A 4MNVA 2WPJS 3GY3A 3P95A 3RXTA 5EG4A 5C1XA 1O3IA 4KTUA 3N7OA 2FI3E 3CS7A 4OS1A 1C2IA 1A2CH 2J4IA 4WJG2 4I32A 3LU9B 1G32B 4MNYA 2ZFFH 2CHAB 1S0RA 2RA3A 3SNDA 1C5OH 1S6FA 3ZZAA 3BTQE 3M5OA 2WYGA 2V35A 5LH8A 2ZFSA 4DJZB 1L0ZA 1L2EA 3P8FA 1NROH 2J94A 3ZZ6A 4WWYA 1GI1A 4XBCA 2CV3A 2BLWA 1O2LA 3T29A 3MOCA 3MFJA 2VIPA 3NZIA 5CE1A 3TK5A 2QF0A 3O8RA 3GICB 2P3UB 2UUFB 1OOKB 1MTSA 1P2OA 2ANYA 2AERH 2HWLB 2VWMA 3P8NA 4INKA 2ANKH 1Z1IA 3RU4E 4LXBH 2EC9H 3KQDA 4X8TH 3GCTG 1QNJA 1DUAA 1H8IH 3SQHE 9ESTA 4J1YA 1GMCF 1MCVA 1CT2E 3WY8A 1G30B 5JB8S 6GCHF 1IQHA 1F2SE 3SO3A 3T27A 1GJ4H 1YPJH 4CRDA 3FFGA 4JZEH 1C5WB 2ZHEH 3QO6A 2BVSH 4JK5A 1C5UA 1O35A 2XBVA 2XXLA 1H1BA 5HM9A 1GL1A 4CR9A 4LZ4B 5DG6A 1TE0A 1O2WA 1A5HA 2AFQB 2Y7XA 1S85A 3MTYA 5LPEA 1CA8B 6ESTA 3BTEE 1O2OA 2QAAA 2KAIB 1SSXA 1DLEA 4XFQA 3ZZ4A 4JZDH 4CR5A 1A5GH 3V13A 5DP6A 2BY6X 2ZTXA 4H4FA 3GYMA 4Z0KA 4WXIA 3LGUA 1F7ZA 3KQBA 1MTWA 2BM2A 2Y5FA 1LPZB 2JKHA 2A1DB 3GDSA 4KGAA 1Z8IB 3TK6A 4CH8B 1UVTH 2ZPRA 4IMZA 1BRAA 3V7TA 4BAKB 2JETC 4Y8XA 1TALA 4NFEA 1GI0A 1QL9A 1QL8A 1DWEH 1AUTC 1RD3B 1O2GH 1FJSA 1VJ9U 1O5FH 3HGNA 3MU8A 2ZHDA 1V6DA 3OX7U 3KQEA 1S84A 1SBWA 1ZJDA 1HCGA 1UVUH 1TGTA 2VIDA 1P11E 4E06H 3PWCA 1LQEA 3GY8A 3A7YA 3HPTB 1ZYOA 2VGCC 2SNVA 4JYTA 1LQDB 1SLUB 4E7NA 2PR3A 4JZ1A 1ZPBA 3AAVA 4K1EA 1EP6A 3TJNA 1C2FA 4NA9H 3TNTA 1P10A 3RXSA 1SL3A 3LJJA 1DLKB 5HGGA 4CH2B 2GV6A 1ELVA 1NS3A 2FODA 1C1PA 3ATWA 1J16A 1NFWA 4LK4A 3SJIA 2FS9A 3E91A 5C3NA 1QIXB 1TMUH 2A0QB 1IQNA 4K69A 3M7TA 3E1XB 3BTME 5C5NA 3UOPA 2PUXB 2P94A 3R3GB 4Q80A 2C8WB 4GPGA 1GMCG 3E16B 1YM0A 4YTAA 3JZ2B 2BX4A 2THFB 3H7OA 3SUDA 3P6ZB 1FLEE 3QK1A 1AU8A 5LPRA 2ZU2A 3A84A 4D7GA 1CT4E 1DANH 2BDBA 4U30A 5C1YA 1IQFA 1YC0A 2BZAA 3OU0A 2BYAX 2FI5E 2GKVE 2A7CA 1KXCA 2Z9GA 5FHTA 4Y79A 2GZ9A 1NRRH 4RKOB 2UUYA 2ZTYA 1BHXB 2Z7FE 1AHTH 5EXMA 2P95A 5ABWA 1AE8H 2G5NA 2ZNKH 1ESBA 2WYJA 2LNCA 3A83A 1SGIB 2A5AA 2BMGB 2FXRA 1O3OA 3A81A 2AGEX 2BLQA 1LKAA 3CS0A 4GVUA 4MTBA 1ZRKA 1GBEA 1GVZA 2Z9LA 4X6OA 5K7RA 2C93B 1CHOG 1GWAA 1K1JA 3EAJA 1LO6A 1QJ1B 1SGQE 2F91A 3T28A 1MAXA 2GZ8A 4TWYA 1JRTA 4X2VA 1P03A 3QWCH 3UPEA 1V2PT 1BB0B 3BV9B 3RXKA 2OTVA 1BTZA 2C3SA 1N8OC 2BD4A 2B8OH 3A86A 1K1PA 3F68H 3FZZA 1TNJA 1AKSB 1TBRH 1QRZA 4BAMB 2RCEA 4B73A 4GLYA 4K1TA 1VJAU 3HATH 1HUTH 3MH5A 3T62A 1CA0C 3QN7A 1SR5C 1JBUH 1ARBA 3L33A 2J34A 1HJAB 5I25A 1DXWA 4MPUA 3RC6A 3PO1C 1GI5A 1OP2A 1ZOMA 1OX1A 3RXIA 1P3CA 1HNEE 2XYAA 3SGBE 5F8TA 1V3XA 1GDNA 3EE0B 1BRUP 1O30A 2BHGA 4BXWA 1ELGA 4BAHB 1MU8B 2O9QA 1TX6A 4RKJB 4GCHF 2BDAA 1TNIA 2HNTE 4R0IA 1TYNA 1MTVA 4FUEA 4ABGA 2CF8H 1E34B 1GI7B 1O31A 2OXSA 3OSYA 2VIWA 4DVAU 3RXFA 1L1NA 2ODQA 1SLXB 4KKDA 8GCHG 1GI6A 1UCYE 2XC5A 4A7IB 3OYPA 1P2MA 2BD8A 6CHAC 1ZSKA 3ZZBA 4K8YA 3V0XA 3FP8E 5EQQA 1ETTH 1SGFA 2JH6D 3EA7A 4WVPE 1VITG 2WUBA 1OKXA 3U69H 2SGEE 1DX5M 4BTIB 5GWZA 4CBOA 2BZ6H 3M5NA 4B2BA 3B8JA 3MNCA 1C5MD 2BXUH 4GAWA 4O97A 5JBAS 1XX9A 3ZZ7A 1SOTA 4WMFA 4BOHA 3TU7H 5EW1H 1BTPA 2ZPQA 1RIWC 2PHBA 2B9LA
chains in the Genus database with same CATH superfamily
2W3KA 4NIVA 1HAGE 2TIOA 2WPMS 3SV8A 3UREA 3EA8A 4OGYA 4A1XA 1HXEH 3M37A 4AGJA 2H6MA 1XMNB 3PYHA 5CHAC 1GPZA 2ZQ1A 4NGAH 4P00A 3A8CA 1OYQA 3W1EA 1KDQA 5JDUB 2FTMA 1D6WA 5AFYH 5SGAE 3PRBA 1SGTA 1ELEE 3MU0A 2J5UA 2QXGA 2HOBA 4LOYH 3L3TA 3QDZB 5EW2H 1TPPA 5A09A 2ZPSA 1W2KH 4AFQA 1P8VC 2ZU4A 1KSNA 1QURH 1NPMA 3A8BA 2FS8A 1JIRA 1LDTT 1UK4A 1YCPM 4ISHH 5E2PA 4NWKA 3OEED 1NRPH 1GVKB 2BQWB 1GHAF 4YT6H 3LH1A 1W14U 1VR1H 4D9RA 1MUEB 4Q7YA 2VNTA 1O5BB 4WY3A 1EB2A 1LCYA 2PKAA 1GCTB 4OS5A 1O2TA 1Y3YA 1A46H 1NFXA 4NA7A 2PGBB 1NZQH 1O3DA 2ULLA 2J9NA 2GD4B 3QTVH 3TJOA 1V2RT 2ZECA 4JYUH 2STBE 1EKBB 4HTCH 1AD8H 1GJ5H 3KYFA 1DWBH 2ZFQH 1AMHA 2A4OA 2BTCE 2ZDNA 3SUGA 4IS5A 5FX5A 3SV9A 4I7YH 1EUFA 1ZHMA 3IITA 1F5RA 2STAE 2HVYB 1JXPA 2GTBA 2SGDE 2BD9A 3E6PH 4FUHA 1AO5A 1SLVB 4FUFA 2FOAA 5KEDA 5F03A 4DT4A 2ILNA 1AVGH 4WF8A 1FAKH 1Q3XA 2ZFTA 3PMAB 2W6JD 3OEHD 3QUMP 2ODYB 3NPSA 4KELA 5HIYA 1C1MA 1WDIA 2CJIA 2BX3A 1HGTH 1OP8A 2GT7A 3ITIA 1GJDB 2G00A 4JK6A 4TPYA 2VVCA 2SFAA 1C1VH 1YPEH 5ESTE 4ABEA 1EAIA 1C5PA 1TRNA 1S6HA 5FPYA 3S9CA 2PKSB 3FO8D 1GI9B 3NXPA 3OY5U 2A2XH 2UWPA 1PPZA 1YPHC 3SI3H 3M35A 3LOXA 1Y3VA 3MH4A 4A92A 5AFZH 1YPLH 1O3MA 3PLKA 1ORFA 5GNDA 3V3MA 1C5SA 5E0HA 2AHME 4FXGH 1EASA 7LPRA 1LHDH 4OS7A 1GBHA 2KAIA 1Y59T 2TGAA 3UOUA 1BT7A 3OY6U 1ZMLA 3P70B 2QGRA 3QTOH 1LTOA 3MMGA 1HDTH 2CXVA 3M3TA 2A5KA 3TGJE 1QZ8A 2QY0B 3IG6B 1P2KA 2RDLA 1EP5A 2AMPA 3MWIU 1TONA 3VB4A 1BBRH 1TRYA 3VGCC 2GJGA 2G4UA 2Z94A 2PW8H 1QA7A 4DT7B 1O5AB 3S9AA 1TMBH 1HYLA 2FO9A 3BN9A 3O8DA 3FAOA 4WH6A 5F8ZA 2QN5T 2VIVA 2WV5A 4ZKNU 3SU4A 3O8BA 1Z6JH 2P3TB 2FWWA 1UTJA 5EPNA 2HPPH 2BLVA 3U98H 1G9IE 1HAHH 3FZDA 2M2AA 5E2OA 4KTCA 4SGAE 4XE4A 1FXYA 5T6GA 1FONA 3UQOA 3QX5H 3PROA 3KYGA 1ABIH 2P16A 3NWUA 2BVXH 5F53A 4B71A 3ZZ5A 1EZSC 5TJXA 1BQYA 1GBAA 1FMGA 1E38B 1S0QA 1ZRBA 1A4WH 2RDEA 4XSKU 2A2QH 4X6MA 3K65B 8LPRA 5DP8A 3TGKE 1SLWB 1ZTLA 2FOHA 1IQGA 1H4WA 3GCTF 3TITA 3TLOA 4ABJA 1O5EH 2G55A 5E0JA 3H09A 1ID5H 1H9HE 2SGFE 2Z9JA 2XWBI 1PYTC 3U1IB 4K1SA 1YP9A 1BTYA 3KF2A 3SNAA 1GBTA 5PTPA 2Z3CA 2ZDKA 1TFXA 1QQ4A 3ZVDA 2CN0H 2WV9A 5DPAA 1AVXA 5BRRE 1OWJA 1BHXF 1K1IA 1Q31A 1OXGA 1K1MA 3A88A 2XNIA 1F5KU 1O3GA 1V2KT 2JH0D 2VVVA 3URCA 3LGIA 7KMEH 4UFFH 1EOJA 1HAVB 3VB3A 4X1RU 3H7TA 1NM6A 3RDZA 4JCNA 5EU8A 2LP6A 3PMBB 1ACBE 2VJ1A 2G8TA 1E37B 4BNRA 1WCZA 1WTHD 5DSFA 3CENA 2FYRA 4ISLA 1E1RD 2AS9A 1BRCE 1TNGA 2BOHB 1T8LA 1O2MA 4B6EA 1MZAA 3F2FA 2OD3B 4JMYA 2PTNA 2PSXA 3F9FA 3GCNA 4RN6A 5FBIA 5LGOA 1DITH 2Q6GA 1O2XA 1MKWH 4I8HA 3I29A 1EQ9A 3FP6E 4FUGA 2PTCE 4O3UA 1J9CH 4ESTE 3LGYA 1YGCH 5EGMA 4OGXA 2BY9X 2I6SA 2QF4A 2L6OA 1C5QA 1V2QT 1WAYB 5E8EH 4RSPA 3O8CA 2RA0A 2VIOA 5IK2D 1C1WH 3S9BA 2GDEH 1FPHH 1A3BH 4VGCC 4H6TA 1TGSZ 4ZHAA 1D3QB 2YNBA 1HAOH 4F48B 5H4IB 1KIGH 2BQ7B 2QXHA 2SNWA 1PQ7A 2YMSC 1O3AA 1F0RA 1NFYA 1AE5A 1C5TA 1LHEH 2BQ6B 3RMNH 2GT8A 1V2WT 5JYIA 3BF6H 1LHGH 2C8ZB 3ENSB 3LDXH 2Y5HA 4F4OC 5ETXA 1KLTA 3A82A 3EGKH 1QBNA 5DJ7A 2A45B 1HJ9A 4AG1A 3E3TA 1EJAA 1WYKA 4ISOA 1KXFA 2FM2A 3U1JB 3OAAD 2GCHG 2F9PA 4D7FA 5EXNA 2AYWA 4ABIA 3BG8A 1T4VH 1VCWA 2V6NA 1GJ7B 4ZH8A 4YT7H 1S82A 5L6NH 2FYQA 3STJA 3SUEA 3MO6A 2BDYA 3VB6A 2OINA 3UR9A 1K9OE 1O3EA 1UJ1A 2GCTC 1TLDA 1BOQA 3BTFE 1OSSA 3KGPA 3SV7A 1PPEE 2FLRH 3SGAE 4ZCNA 3RM0H 2UWLA 1UHBB 1CHOF 3FVFB 1SGCA 4YO9A 1XVMA 3M3SA 1OWKA 1T31A 1E36B 1EZQA 4ABAA 2CHAC 5L30H 3MHWU 1T4UH 2ZA5A 2ZIQH 4K8BA 1RJXB 4WMEA 1O32A 3ZZCA 1HJ8A 1J8AA 3ZV9A 2ZDLA 1FDPA 4NA8A 4X1PU 4NIWA 5T1VA 2XC0A 1DPOA 1KXAA 1FV9A 1YCPK 1YBWA 1TPOA 1PQAA 1EOLA 4ZAEA 5FCRA 4UD9H 1FN6A 1INCA 1GI3A 3PV5A 1DFPA 1BBRK 1F0TA 5CHBA 1W11U 2KR7A 2HGTH 1VCPA 2SGQE 1SGPE 1BDAA 1JWTA 3RMLH 3SN8A 1YPKH 3KL6A 3PMJA 1TQ7B 3QLPH 4R8TB 4IBLH 1X7AC 3KEEA 4M9FA 2WUCA 1THRH 2CF9H 1G3BA 2SGAA 1SI5H 4LZ1H 1QR3E 1BITA 3SYJA 2BB4A 1BTWA 2O8TA 2CGAA 2H5DA 5LPFA 3QZRA 4IGDA 4K2YA 4E05H 3PLPA 2OC0A 4MQAA 2ZCKP 5GDSH 1G3CA 3RXBA 1BRBE 1BTXA 4ZHLU 3RMMH 2Y5GA 3RXOA 2R2WU 4X8SH 2KZ4A 2EQNA 2D2DA 2ZU3A 1HRTH 1V2TT 1D9IA 1ZSLA 1EZXC 2W26A 2FTLE 4IN2A 1AFQC 1CA0B 5FCKA 8GCHF 3RXLA 5DN6D 2PV9B 3NUMA 4INHA 1C2GA 1BJVA 2PUQH 3MO9A 4K5ZA 5T6FA 4FUBA 2AGIX 9LPRA 4AYVB 3OE7D 1GJ9B 1O2HA 1FI8A 1VITF 3A7VA 3U8OH 2OC7A 1MTNC 3PO1B 1C5XB 4Y76A 1EPTC 4B75A 5C0UA 5CMXH 1OWDA 1Z71A 1HAPH 1C5LH 2GP9B 2ZFPH 5F6MA 5TCCA 1P3EA 4WXVA 1XUHA 3SJKA 5EODA 2V3OH 3C1KA 5K0HA 3LGWA 1GJ6A 4FETA 4O03A 2KM0A 3DFJA 3EE7A 3MO3A 1QCPA 1E0FD 1CO7E 4AG2A 4ZUHA 1TB6H 6CHAB 5A2MH 5AHGH 2IPHA 4MPVA 3SHCH 1N6XA 2Y80A 2ANMH 2ZTZA 1P04A 1C4U2 1MBMA 2ANWA 1XUFA 4Y10E 2FZZA 3MNSA 1MABB 1QB6A 2VVUA 1G37A 1KXDA 5FXLA 1UTLM 1L4DA 2XBXA 1EFRD 2WINI 4IC6A 4E7RG 2TGTA 5JBTA 3S0NA 1OPHB 1CGHA 1DICA 1LPKB 2D1JA 5J4QA 2HVXA 3A8AA 3B9FH 3F9HA 3GY2A 2P59A 1F0SA 4I31A 4I8JA 3K6ZA 5ESBA 3PMHB 2C8YB 5GJ4B 1V2JT 2PLXA 3Q3KA 4XRNA 1OWEA 5CHAB 1TAWA 1XXDA 3VXFH 5FAHA 1TPSA 2Y7ZA 2ALVA 4DIHH 3ZVBA 4O9VA 4DOQA 3S7HB 2Z9KA 3ESTA 2XTTB 1GCDA 1A61H 1GBJA 4NSYA 3UWJH 2ZCLP 1VGCB 4MDSA 1O5CB 1L4ZA 1C2DA 2YOLA 1XUJA 4ABBA 3LT3A 3BEUA 5IDKA 2ZZUH 3RXUA 4U01A 4NFFA 1W7GH 2G51A 5C17A 1QBVH 3TH3H 1GDUA 2A7JA 4H42U 2LPRA 3SU2A 1DVAH 4UONA 1CT0E 1E79D 1BMMH 4I8KA 3RLWH 1O3FA 3F1SB 1T7CA 2FI4E 2WPIS 1MD7A 2D8WA 1D4PB 1PPBH 1O2YA 3RC4A 1YLCA 2IOTA 1O2VA 3SZNA 1Z8JB 3SJ8A 1C2HA 1SQAA 4KTSA 1IQMA 2K1QA 2R3UA 2TBSA 1YLDA 2FDAA 1C5RA 5C67A 1TABE 1XM1A 5C20A 3TH2H 1UTQA 1UVOA 1UCYH 3Q77A 1GVLA 3AW0A 3MNXA 1GI4A 1GG6C 1Y8TA 3BIVH 3TK9A 1T8MA 2VH6A 1TBZH 1C9TA 2R9PA 3PV4A 1O36A 4X2XA 1IQKA 2SGPE 1UTNA 3SU1A 4HG6A 3SJ9A 1YPGH 3UQVA 2HALA 4X1SU 2Y82A 2P8OC 2VINA 1A3EH 2OQUA 2W3IA 1W0ZU 1HAVA 1Y5UT 3HKJB 1TRMA 4IN1A 3LONA 3PWBA 1AB9C 1O0DH 4TPIZ 4Z1MD 3K9XB 2GMTC 1ABJH 1GBLA 4AGKA 2P3FH 1P12E 2NU1E 5L2YH 5JBCS 4ISIH 2H9EH 4X1NU 4ZXYH 1UK3A 4YLQH 1ELAA 4P02A 2Z9IA 3U9AH 3DSOA 2DE9A 2FX4A 1DSTA 2O8LA 4FU9A 2H2ZA 4UFGH 1Y3UA 3TNSA 3SQEE 1GL0E 5DP5A 2FX6A 1ETRH 1KXEA 1Z8GA 2AGGX 4AB8A 4BAQB 1ANCA 3AW1A 3WWFA 4B2AA 3DD2H 3FN8A 2ZFRH 1YF4A 2QA9E 1UTOA 5EPYA 4MVNA 1DOJA 3HK3B 3CNRA 1BUIA 3RXVA 1QHRB 3A89A 1TNKA 2KFWA 2XCNA 1CVWH 1ZR0A 1YKTA 5L2ZH 2QYIA 4HGCA 2XW9A 3UY9A 1GHBG 3UFAA 1D3TB 2V0BA 4ACBA 3PV2A 1CU1A 3FOAA 1C1UH 3GCHC 1GJBB 3TPIZ 1TPAE 1Y3WA 3OTJE 3P92A 3ZYEA 3ZZ3A 1NU7B 1GHYH 1P2JA 1EJNA 1A0LA 2A7HA 1MQ5A 2ZHQH 1V2MT 1W0KD 1DY8A 2BDCA 2ZGJA 1W13U 4TYDA 2QF3A 1C4Y2 3BTTE 4Y0YE 3M5MA 3MH6A 2QIQA 1O2IA 1SVPA 1WTGH 3U8RH 2KCOA 1FX0B 3RM2H 2O8WA 1BMLA 3UWIA 4BTUB 5DK1A 1N6YA 2H1UA 1O2SA 4RI0A 1ESAA 2CMYA 3T25A 3BEFB 2UUKB 3F9EA 4UFEH 1NRNH 3I78A 3SNBA 2FOGA 2F83A 3B23B 1O2PA 1EXFA 2WHXA 2OK5A 4XBBA 3M3VA 4AN7A 2GX4A 2O8UA 1ELFA 1SMFE 4HI3A 1THSH 4OS2A 2Y6TA 1ELDE 1GCTC 1O38A 1XXFA 1K1NA 3GY4A 3ELAH 2M5TA 1SQOA 2FOFA 1ANBA 3QGJA 3N7EA 3AASA 4ZKSU 1GGDB 1UHBA 1YPMH 1BBRE 3RXMA 4NZLA 5DP3A 5A8YA 4XD7D 4HFPB 3BG4C 4HZHA 4X0WU 1O3KA 3E8LA 3HK6B 5DP7A 1FZZA 1TOCB 2XWAA 1IQIA 2VH0A 1UK2A 1JIMA 2HNTF 1GBIA 3A85A 4CBNA 1O2KA 4DW2U 1O33A 1G3DA 1K22H 1AGJA 1OYTH 3RXEA 4AZ2B 1F92A 3KQCA 1TBQH 2V3MA 2A5IA 3A80A 4ASUD 3Q76A 1AWHB 2QXJA 1SGRE 3AK5A 1DUEA 1OP0A 2ZEBA 2W7SA 1K1OA 1SHHB 4FUDA 1H9IE 1L1GA 3A7XA 1NO9H 4JZFH 1K28D 2FIRH 3Q00A 1PYTD 1XUGA 1C2KA 4GUXA 2BVRH 3LKWA 3SGQE 1YPHE 4TY7A 4JZIA 2ZF0H 3N7DA 3A7TA 1KXBA 1P9UA 2OCVB 2QXIA 1THPB 3UNSA 2ZHWH 5DKMA 3LIWA 5GXPA 2C4FH 1N1LA 3M5LA 2W7UA 2ZCHP 5B6LA 1WQVH 1EATA 2WPKS 1QTFA 1C5NH 3BEIB 3ZVEA 1Z6EA 2B0FA 4ABDA 1H8DH 2FLBH 3TH4H 3SBKA 2GCHF 1XUIA 3NKKA 2JJ1D 1RTKA 1D6RA 3ATIA 4Y8ZA 4XOJA 1C5ZB 2BY7X 4Q2KA 1HIAB 2WZQA 3HKIB 1FY1A 5C0TA 1ZGIA 4CREA 2ZGXH 5EQSA 1EX3A 4VGCB 2TGDA 3S69A 1AY6H 1Z7KA 3ZVCA 5TCAA 2BD5A 5AF9H 1HLTH 5IYTA 5EJ1A 2YMSB 1K1LA 1GHZA 2AIPA 2GGVB 1BMAA 5FPSA 2VU8E 1T32A 2BDHA 3SNEA 4DURA 1LMWB 1FN8A 3ZYDA 5C1UA 1K0HA 3MU4A 1QL7A 2TPIZ 4X6NA 2J92A 4Z6AH 3BSQA 2IPQX 4X1QU 1NRQH 3RXCA 5KECA 2EA3A 1MKXH 2G5VA 2F9UA 1UTKA 4CRAA 4I8GA 1NESE 1UTPA 1IHSH 2WSSD 3I77A 1FY3A 1O3PB 2ZG0H 4CHAC 1CQQA 1GMHG 6LPRA 2G52A 3SU3A 2FOEA 3IWMA 3P8GA 1OHHD 1VITH 3H5CB 4WMDA 1CGIE 2XCFA 1P06A 1QB9A 3DFLA 3LC3A 5DP4A 1TWXB 2PFEA 2PP6A 1O2NA 2G4TA 4IC5A 2PKAB 2YMSD 1GMDG 4KP0A 1NRSH 1HV7A 3TGIE 1AKSA 1WBGB 4YESB 4AOQA 1O3BA 1GI2A 1ANDA 2Z3EA 1ZJKA 2BY5X 1AQ7A 1S83A 1TGCA 3F0PA 3KN2A 3SU0A 1CBWC 3FANA 3U8TH 5J4SA 3KIDU 2QF5A 2JETB 3M7UA 2HPQH 1ETSH 4M7GA 1TA2A 4FU7A 1MH0A 3LGVA 3GISB 3T5FH 3AVZA 4X8UH 2V3HH 2WPLS 1T8OA 4Y0ZE 4H6SB 1XKBC 1EAXA 5FPTA 5FX6A 8ESTE 1B5GH 2Z6BD 1WOFA 4MLFB 4NCYA 4U32A 5AVDA 1AWFH 1C2MA 2H9HA 1BTHH 3D65E 3LJOA 1O3NA 3E90B 2VGCB 2OC8A 4Y7BA 1TNHA 4Y7AA 1TMTH 1TQ0B 3S7KB 1FPCH 1RRKA 3PLBA 1BIOA 3RXRA 3PRDA 4YLUA 3LH3A 1SGYE 3RP2A 1GBMA 2OQ5A 4NWLA 2EEKA 2IN2A 3GS9A 2C8XB 4AORA 3WW7A 3SUFA 3ODFA 4AFZA 4Y6DA 1SC8U 2WV4A 2OLGA 2AMDA 1ELCA 2OP9A 2UUJB 3M7QA 2VB0A 4BAOB 5A0CA 1LHFH 1PQ8A 2BD3A 2ZGHA 1BA8B 3M36A 2GV7A 2JJ2D 3TJVA 3BTKE 5JPMH 3VB7A 5HMAA 2VWOA 2FPZA 2BXTH 1NTPA 3A7ZA 1A0HB 1IHTH 1J17T 1F5LA 3BIUH 3DSPA 2ZDAH 1QRXA 1LPGB 2R0KA 4AFSA 2EI8A 1LVMA 1O5GH 1EAUA 1O39A 1NT1A 1AFQB 4MPXA 5A8ZA 1KY9A 2AIQA 1PPFE 3E0NB 3MH7A 2Y81A 4ZROA 3UTUH 2ODPA 1Z8RA 1GJAB 1EZUC 1GBDA 3DUXH 1RXPA 1ANEA 1JRSA 1MTNB 1C5VA 3PB1E 1HPGA 1IAUA 1EPTB 3V12A 4YOGA 1B0FA 1G2MA 2J95A 5DP9A 1H9LB 1MAYA 2J2UA 4XDEA 1V2ST 2FOBA 1AUJA 1KLIH 3KQ5A 3SI4H 2ALPA 3D23A 3UIRA 1ZLRA 1O3CA 4YOIA 1BZXE 1W0JD 3GOVB 4AFUA 1DWDH 2GVFA 1FY8E 3F2HA 1ZZZA 5BPEA 1QBOA 1TA6A 1IQLA 1P02A 4RT1A 1N8OB 3SHAH 3VFEA 4ASHA 1QQUA 1XKAC 1YLNA 2UWOA 1DWCH 3C27B 5FL7D 3TVJB 3DSGA 1W12U 1W10U 5HM2A 1C1SA 1T8NA 2F9OA 3GY7A 4DIIH 1J14A 1UVSH 5EXLA 7GCHF 5EJLA 2H5CA 1TIOA 1WSSH 3VPKA 1WU1A 4GSOA 4NG9H 2VWNA 2ZWLH 3VEQB 1S5SA 6GCHG 1DM4B 3RXAA 2VIQA 1C9PA 1WQSA 3GY6A 1GDQA 3P17H 1U6QA 1B7XB 5GCHF 3E0PB 1S81A 2XBWA 1MZDA 2OBQA 3F6UH 7ESTE 3STIA 3RXQA 1SHYA 1A7SA 2AEIH 2QC2A 3ZVGA 1SG8B 1K21H 2A4QA 3T26A 2O8MA 4THNH 1MBQA 4ZKRU 1GHXH 2HNTC 1HB0B 1DDJA 4OS4A 1FY5A 2BD7A 2Z3DA 4Q7XA 5E0GA 4INLA 1RTFB 2XRCA 3GDVA 2NU4E 2DUCA 4ZXXH 1JOUB 3A7WA 1ELTA 1PPHE 2ZP0H 1SPJA 3EA9A 1SFQB 5GPIB 1SQTA 1P09A 2A4GA 5JBBS 1MKXK 1MU6B 2XNDD 4UDWH 1KYNA 1DE7H 1JMOH 4MNXA 1YY3A 2JIZD 2W5EA 3G01A 1WXRA 1BCUH 3ATLA 3SZEA 4ZKOU 1GBKA 1MKWK 1RIWB 3VG8A 1O2ZA 2PSYA 1DXPA 1ZGVA 1VKYA 1ZHRA 1GG6B 2FOCA 2ZHFH 4GHQA 2DE8A 3UB0A 1SGDE 2KCPA 2QV1A 2XBYA 4AB9A 4Q7ZA 4X2YA 2P93A 1HAYB 3HGPA 3RMOH 4TT3D 1AZZA 1W0YH 2ZC9H 4ISNA 1P2NA 4ZMAH 1Y5AT 2NWNA 2P8OB 1AN1E 1P01A 2ZGBH 4YM9A 1H8ED 1ZTJA 3ZZDA 1HBTH 1FIWA 4FUCA 4FVBA 2I6QA 4PROA 4F55A 4O3TA 4QT8C 3PTNA 3SV2H 3MU5A 1GHBF 1OWIA 1AB9B 7GCHG 2GMTB 3KNXA 4FVDA 1ESTA 1H8HD 1O2UA 3RU4T 4D9QA 3WWBA 2PGQB 1C1RA 5A0BA 1QA0A 1ZMJA 2EI6A 1O5DH 1XVOA 4K60A 1ZHPA 3EQ0H 3GDUA 1K2I1 3JZ1B 1NC6A 3F0OA 1C1NA 3OFND 3ZZ9A 1TOMH 1XUKA 1LVBA 4UFDH 4IW4E 4MNWA 5GCHG 1W8BH 4A1VA 3PTBA 1ZMNA 1PQ5A 3D62A 4XBDA 2J98B 1PJPA 1TGNA 4GHTA 1GBBA 1A0JA 4OS6A 3KCGH 4CRFA 3SW2B 1O34A 3GYLB 1GBCA 2Q6DA 2V7QD 3KHVA 2BLOA 3DHKH 1G36A 4X8VH 2FESH 5FBEA 1HIAA 4J2YB 1SQRA 5EQRA 3MU1A 1V2LT 4CRBA 3UNQA 1V2OT 4MG3A 4BANB 3GCHB 1HJAC 1PPGE 1O3LA 3TJUA 2A4RA 2D26C 3EDXB 3MQKC 2H9TH 3ODDA 1OWHA 3ATMA 2GDDA 3NK8A 1AI8H 3CP7A 3RXGA 5HYOA 1O3HA 1AFEH 1EB1H 1P2IA 1RFNA 3SU5A 3BTHE 1CSOE 5HXFA 2JDID 1FIZA 2JH5D 2BDIA 1P0SH 2CK3D 2F3CE 3LGTA 3RLYH 4BXSA 1VGCC 3SNCA 1HFDA 1BJUA 5A0AE 2FEQH 4D8NA 1VCQA 2BOKA 1MD8A 2ZU1A 1P9SA 1W7XH 3SU6A 2A32A 1UMAH 1A1RA 1KTTB 4B2CA 2C90B 4FUIA 2ZI2H 4Q4LA 3NCLA 1GJCB 1LVYA 4TSFD 1SOZA 4BTTB 1CGJE 1CHGA 1QB1A 2R2MB 1IOEA 1BMFD 1C2LA 4AYYB 1DS2E 1GHWH 1P57B 2Q6FA 1YYY1 3UAIC 3ZV8A 1QFKH 5A8XA 1V2UT 4NIYA 1B0EA 1ZTKA 4YZUA 1Y3XA 4DG4A 2BDGA 2ZGCA 1G2LA 1MMJN 1MTUA 1A5IA 1YWUA 2A31A 1F0UA 2F9NA 5T3HA 3K6YA 4JYVH 1EAWA 1ARCA 2ASUB 2XC4A 4GCHG 3BG4B 3VGCB 4FU8A 2R3YA 1BMNH 1HAZB 1SGFG 1HAXB 1ELBA 1AVWA 1IQJA 4MPWA 5G4BA 1C5YB 2AMQA 1HXFH 4RT0A 1PFXC 2B7DH 4CRCA 3L6PA 2J38A 1DY9A 3MYWA 4IMQA 1C1QA 1V2NT 3QZQA 4I8LA 1D3PB 1GBFA 4DCDA 1WV7H 1TNLA 1QJ6B 2OBOA 4B1TA 4DGJA 3LC5A 1M9UA 1GHVH 4F49A 1AIXH 1LHCH 3UR6A 2FP7B 1P05A 1SGNE 3RC5A 1Y5BT 3M61U 4TY6A 3RXDA 1QY6A 1C2EA 2VBCA 3T2NA 2NU3E 1C1OA 5DGJA 3BTGE 3ATKA 1SGEE 1VZQH 3R0FA 4I86A 5C2ZA 1CE5A 8KME2 5F8XA 3W95A 2F9BH 1NU9A 1KTSB 4DY7B 1NBMD 5GIBA 3URDA 4OM9A 1GMHF 1KMHB 2ZDMA 4YOJA 5JB9S 2BD2A 1PPCE 1UTMA 3GY5A 1NY22 1RS0A 2ZQ2A 2RG3A 1FNIA 3A8DA 2K0QA 1YCPH 3D49H 4UEHH 2NU2E 3SORA 1MCTA 2F9VA 4UE7H 3TIUA 2R0LA 1GMDF 1GHAG 4NZQA 1FUJA 1TGBA 4NIXA 3U28C 1P2QA 2G81E 1SFIA 1L1JA 1C4V2 2NU0E 2K8IA 3VB5A 1O2JA 1QGFA 2PWXA 3K2UA 4B74A 1EPTA 3AAUA 2QCYA 5T6DA 5C5OA 2ZU5A 1MQ6A 4X6PA 1UVPA 4X2WA 1LKBA 3PM3A 4I33A 1KLJH 1HAIH 1O3JA 2ZO3H 3GCOA 4U2WA 2PKSC 5B6OA 2GZ7A 1D3DB 2KCAA 4CHAB 3FP7E 2HRVA 1TX8A 1FQ3A 1UO6A 3EYDA 1FAXA 3DA9B 3ZVFA 4A5TS 4Y11E 2VWLA 4B6FA 5DO4H 3RXHA 1BTUA 1O2QA 4NSVA 3Q3XA 1WUNH 4TWWA 3VXEH 3BTDE 3MNBA 2ZKSA 1SB1H 4Y71A 4B76A 1ZSJA 3SOSA 1OS8A 2EI7A 3P8OA 3RU4D 2QE7D 4AC9A 3SV6A 1CBWB 2HLDD 1AZ8A 1EJMA 2FOMB 1NFUA 2YNAA 3F9GA 2W6ID 4Y8YA 1O37A 1IQEA 1QRWA 3RXPA 1GGDC 5I46H 1ZPCA 1Z1JA 1UCYK 3RXJA 4A1TA 4CRGA 3LPRA 2WPHS 3NRLA 3SJOA 5KGOA 2BY8X 2B5TB 1Q2WA 4A6LA 4K3JA 1UW7A 2OUAA 3UUZA 1J15A 1C1TA 1KDQB 2Q1JA 1GI8B 2ZDVH 5EJZA 4ABFA 2F43B 2IJOB 2ESTE 3A87A 1QJ7B 1NBME 1DT2A 1C2JA 2IJD1 4AX9H 4SGBE 2OC1A 3ZVAA 1V2VT 3UNRA 2HLCA 1TX7A 2TRMA 3RUOA 1RTLA 1NN6A 4ZHMU 1LVOA 4WH8A 4FUJA 1RGQA 3BTWE 2AH4X 3DT0H 2FMJA 1DSUA 1G3EA 1FY4A 2TGPZ 4ABHA 4Q63A 2GCTB 1GJ8B 4D76A 1O2RA 3ZZ8A 1W3CA 3MI4A 5EOKA 3Q3YA 1S6LA 1ZPZA 1E35B 3QGNB 3W94A 4MNVA 2WPJS 3GY3A 3P95A 3RXTA 5EG4A 5C1XA 1O3IA 4KTUA 3N7OA 2FI3E 3CS7A 4OS1A 1C2IA 1A2CH 2J4IA 4WJG2 4I32A 3LU9B 1G32B 4MNYA 2ZFFH 2CHAB 1S0RA 2RA3A 3SNDA 1C5OH 1S6FA 3ZZAA 2RFKC 3BTQE 3M5OA 2WYGA 2V35A 5LH8A 2ZFSA 4DJZB 1L0ZA 1L2EA 3P8FA 1NROH 2J94A 3ZZ6A 2LELA 4WWYA 1GI1A 4XBCA 2CV3A 2EY4C 2BLWA 1O2LA 2L74A 3T29A 3MOCA 3MFJA 2VIPA 3NZIA 5CE1A 3TK5A 2QF0A 3O8RA 3GICB 2P3UB 2UUFB 1OOKB 1MTSA 1P2OA 2ANYA 2AERH 2HWLB 2VWMA 3P8NA 4INKA 2ANKH 1Z1IA 3RU4E 4LXBH 2EC9H 3KQDA 4YXWD 4X8TH 3GCTG 1QNJA 1DUAA 1H8IH 3SQHE 9ESTA 2XOKD 1GMCF 1MCVA 3N99A 1CT2E 4J1YA 3WY8A 1G30B 5JB8S 6GCHF 1IQHA 1F2SE 3SO3A 3T27A 1GJ4H 1YPJH 4CRDA 3FFGA 4JZEH 1C5WB 2ZHEH 3QO6A 2BVSH 4JK5A 1C5UA 1O35A 2XBVA 2XXLA 1H1BA 5HM9A 1GL1A 4CR9A 4LZ4B 5DG6A 1TE0A 1O2WA 1A5HA 2AFQB 2J98A 1S85A 2Y7XA 3MTYA 5LPEA 1CA8B 6ESTA 3BTEE 1O2OA 2QAAA 2KAIB 1SSXA 1DLEA 4XFQA 1E1QD 3ZZ4A 4JZDH 4CR5A 1A5GH 3V13A 5DP6A 2F4LA 2BY6X 2ZTXA 4H4FA 3GYMA 4Z0KA 4WXIA 3LGUA 1F7ZA 3KQBA 1MTWA 2BM2A 2Y5FA 1LPZB 2JKHA 2A1DB 3GDSA 4KGAA 1Z8IB 3TK6A 4CH8B 1UVTH 2ZPRA 4IMZA 1BRAA 3V7TA 4BAKB 2JETC 4Y8XA 1TALA 4NFEA 1GI0A 1QL9A 1QL8A 1DWEH 1AUTC 1RD3B 1O2GH 1FJSA 1VJ9U 1O5FH 3HGNA 3MU8A 2ZHDA 2KCYA 1V6DA 3OX7U 3KQEA 1S84A 1SBWA 1ZJDA 1HCGA 1UVUH 1TGTA 2VIDA 1P11E 4E06H 3PWCA 1LQEA 3GY8A 3A7YA 3HPTB 1ZYOA 2VGCC 2SNVA 4JYTA 1LQDB 1SLUB 4E7NA 2PR3A 4JZ1A 1ZPBA 3AAVA 3FKSD 4K1EA 1EP6A 3TJNA 1C2FA 4NA9H 3TNTA 1P10A 3RXSA 3F3BA 1SL3A 3LJJA 1DLKB 5HGGA 4CH2B 2GV6A 1ELVA 1NS3A 2FODA 1C1PA 3ATWA 1J16A 1NFWA 3F2GA 4LK4A 3SJIA 2FS9A 3E91A 5EIYA 5C3NA 1QIXB 1TMUH 2A0QB 1IQNA 4K69A 3M7TA 3E1XB 3BTME 5C5NA 3UOPA 2PUXB 2P94A 3R3GB 4Q80A 2C8WB 4GPGA 1GMCG 3E16B 1YM0A 4YTAA 3JZ2B 2BX4A 2THFB 3H7OA 3SUDA 3P6ZB 1FLEE 3QK1A 1AU8A 5LPRA 2ZU2A 3A84A 4D7GA 1CT4E 1DANH 2BDBA 4U30A 5C1YA 1IQFA 1YC0A 2BZAA 3OU0A 2BYAX 2FI5E 2GKVE 1SKYE 1KXCA 2A7CA 2Z9GA 5FHTA 4Y79A 2GZ9A 1NRRH 4RKOB 2UUYA 2ZTYA 1BHXB 2Z7FE 1AHTH 5EXMA 2P95A 5ABWA 1AE8H 2G5NA 2ZNKH 1ESBA 2WYJA 2LNCA 3A83A 1SGIB 2A5AA 2BMGB 2FXRA 1O3OA 3A81A 2AGEX 2BLQA 2WPDD 1LKAA 3CS0A 4GVUA 4MTBA 1ZRKA 1GBEA 1GVZA 2Z9LA 4X6OA 5K7RA 2C93B 1CHOG 1GWAA 1K1JA 3EAJA 5HIZA 1LO6A 1QJ1B 1SGQE 2F91A 3T28A 1MAXA 2GZ8A 4TWYA 1JRTA 4X2VA 1P03A 3QWCH 3UPEA 1V2PT 1BB0B 3BV9B 3RXKA 2OTVA 1BTZA 2C3SA 1N8OC 2BD4A 3DCLA 2B8OH 3A86A 1K1PA 3F68H 3FZZA 3OTPA 1TNJA 1AKSB 1TBRH 1QRZA 4BAMB 2RCEA 4B73A 3ZIAD 4GLYA 4K1TA 1VJAU 3HATH 1HUTH 3MH5A 2KX4A 3T62A 1CA0C 3QN7A 1SR5C 1JBUH 1COWD 1ARBA 3L33A 2J34A 1HJAB 5I25A 4ACAA 1DXWA 4MPUA 3RC6A 3PO1C 1GI5A 1OP2A 1ZOMA 1OX1A 3RXIA 1P3CA 1HNEE 2XYAA 5CDFE 3SGBE 5F8TA 4FOUC 1V3XA 1GDNA 3EE0B 1BRUP 1O30A 2BHGA 4BXWA 1ELGA 4BAHB 1MU8B 2O9QA 1TX6A 4RKJB 4GCHF 2BDAA 1TNIA 2HNTE 4R0IA 1TYNA 1MTVA 4FUEA 4ABGA 2CF8H 1E34B 1GI7B 1O31A 2OXSA 3OSYA 2VIWA 4DVAU 3RXFA 1L1NA 2ODQA 1SLXB 4KKDA 8GCHG 1GI6A 1UCYE 2XC5A 4A7IB 3OYPA 1P2MA 2BD8A 6CHAC 1ZSKA 3ZZBA 4K8YA 3V0XA 3FP8E 5EQQA 1ETTH 1SGFA 2JH6D 3EA7A 4WVPE 1VITG 2WUBA 1OKXA 3U69H 2SGEE 1DX5M 4BTIB 2J97A 5GWZA 4CBOA 2BZ6H 5HKKD 3M5NA 4B2BA 3B8JA 3MNCA 1C5MD 2BXUH 4GAWA 4O97A 5JBAS 1XX9A 3ZZ7A 1SOTA 4WMFA 4BOHA 3TU7H 5EW1H 1BTPA 2ZPQA 1RIWC 2PHBA 5C94A 2B9LA
chains in the Genus database with same CATH topology
2W3KA 4NIVA 1HAGE 2TIOA 2WPMS 3SV8A 3UREA 3EA8A 4OGYA 4A1XA 1HXEH 3M37A 4AGJA 2H6MA 1XMNB 3PYHA 5CHAC 1GPZA 2ZQ1A 4NGAH 3A8CA 1OYQA 5JDUB 1KDQA 2FTMA 1D6WA 5AFYH 5SGAE 1SGTA 1ELEE 3MU0A 2QXGA 2HOBA 4LOYH 3L3TA 3QDZB 5EW2H 1TPPA 5A09A 2ZPSA 1W2KH 4AFQA 1P8VC 2ZU4A 1KSNA 1QURH 1NPMA 3A8BA 2FS8A 1JIRA 1LDTT 1UK4A 1YCPM 4ISHH 5E2PA 4NWKA 1NRPH 1GVKB 2BQWB 1GHAF 4YT6H 3LH1A 1W14U 1VR1H 4D9RA 1MUEB 4Q7YA 2VNTA 1O5BB 4WY3A 1EB2A 1LCYA 2PKAA 1GCTB 4OS5A 1O2TA 1Y3YA 1A46H 1NFXA 4NA7A 2PGBB 1NZQH 1O3DA 2ULLA 2J9NA 2GD4B 3QTVH 3TJOA 1V2RT 2ZECA 4JYUH 2STBE 1EKBB 4HTCH 1AD8H 1GJ5H 1DWBH 2ZFQH 1AMHA 2A4OA 2BTCE 2ZDNA 3SUGA 4IS5A 5FX5A 3SV9A 4I7YH 1EUFA 1ZHMA 3IITA 1F5RA 2STAE 1JXPA 2GTBA 2SGDE 2BD9A 3E6PH 4FUHA 1AO5A 1SLVB 4FUFA 2FOAA 5F03A 2ILNA 1AVGH 4WF8A 1FAKH 1Q3XA 2ZFTA 3PMAB 3QUMP 2ODYB 3NPSA 4KELA 1C1MA 2CJIA 2BX3A 1HGTH 1OP8A 2GT7A 3ITIA 1GJDB 2G00A 4JK6A 4TPYA 2VVCA 2SFAA 1C1VH 1YPEH 5ESTE 4ABEA 1EAIA 1C5PA 1TRNA 1S6HA 5FPYA 3S9CA 2PKSB 1GI9B 3NXPA 3OY5U 2A2XH 2UWPA 1PPZA 1YPHC 3SI3H 3M35A 3LOXA 1Y3VA 3MH4A 4A92A 5AFZH 1YPLH 1O3MA 3PLKA 1ORFA 3V3MA 1C5SA 5E0HA 4FXGH 1EASA 7LPRA 1LHDH 4OS7A 1GBHA 2KAIA 1Y59T 2TGAA 3UOUA 1BT7A 3OY6U 1ZMLA 3P70B 2QGRA 3QTOH 1LTOA 3MMGA 1HDTH 2CXVA 3M3TA 2A5KA 3TGJE 2QY0B 3IG6B 1P2KA 2RDLA 1EP5A 2AMPA 3MWIU 1TONA 3VB4A 1BBRH 1TRYA 3VGCC 2Z94A 2G4UA 2PW8H 1QA7A 4DT7B 1O5AB 3S9AA 1TMBH 1HYLA 2FO9A 3BN9A 3O8DA 3FAOA 4WH6A 5F8ZA 2QN5T 2VIVA 2WV5A 4ZKNU 3SU4A 3O8BA 1Z6JH 2P3TB 2FWWA 1UTJA 5EPNA 2HPPH 2BLVA 3U98H 1G9IE 1HAHH 3FZDA 5E2OA 4KTCA 4SGAE 4XE4A 1FXYA 5T6GA 1FONA 3UQOA 3QX5H 3PROA 1ABIH 2P16A 3NWUA 2BVXH 4B71A 3ZZ5A 1EZSC 5TJXA 1BQYA 1GBAA 1FMGA 1E38B 1S0QA 1ZRBA 1A4WH 4XSKU 2A2QH 4X6MA 3K65B 8LPRA 5DP8A 3TGKE 1SLWB 1ZTLA 2FOHA 1IQGA 1H4WA 3GCTF 3TITA 3TLOA 4ABJA 1O5EH 2G55A 5E0JA 1ID5H 1H9HE 2SGFE 2Z9JA 2XWBI 1PYTC 3U1IB 4K1SA 1YP9A 1BTYA 3KF2A 3SNAA 1GBTA 5PTPA 2Z3CA 2ZDKA 1TFXA 1QQ4A 3ZVDA 2CN0H 5DPAA 1AVXA 5BRRE 1OWJA 1BHXF 1K1IA 1Q31A 1OXGA 1K1MA 3A88A 2XNIA 1F5KU 1O3GA 1V2KT 2JH0D 2VVVA 3URCA 3LGIA 7KMEH 4UFFH 1EOJA 1HAVB 3VB3A 4X1RU 3H7TA 1NM6A 3RDZA 4JCNA 5EU8A 3PMBB 1ACBE 2VJ1A 2G8TA 1E37B 4BNRA 1WCZA 1WTHD 3CENA 2FYRA 4ISLA 2AS9A 1BRCE 1TNGA 2BOHB 1T8LA 1O2MA 1MZAA 2OD3B 4JMYA 2PTNA 2PSXA 3F9FA 3GCNA 4RN6A 5FBIA 5LGOA 1DITH 2Q6GA 1O2XA 1MKWH 4I8HA 3I29A 1EQ9A 3FP6E 4FUGA 2PTCE 4O3UA 1J9CH 4ESTE 3LGYA 1YGCH 5EGMA 4OGXA 2BY9X 2I6SA 1C5QA 1V2QT 1WAYB 5E8EH 4RSPA 3O8CA 2RA0A 2VIOA 1C1WH 3S9BA 2GDEH 1FPHH 1A3BH 4VGCC 4H6TA 1TGSZ 4ZHAA 1D3QB 2YNBA 1HAOH 5H4IB 1KIGH 2BQ7B 2QXHA 2SNWA 1PQ7A 1O3AA 1F0RA 1NFYA 1AE5A 1C5TA 1LHEH 2BQ6B 3RMNH 2GT8A 1V2WT 5JYIA 3BF6H 1LHGH 2C8ZB 3ENSB 3LDXH 2Y5HA 4F4OC 5ETXA 1KLTA 3A82A 3EGKH 1QBNA 5DJ7A 2A45B 1HJ9A 4AG1A 3E3TA 1EJAA 1WYKA 4ISOA 1KXFA 2FM2A 3U1JB 2GCHG 2F9PA 4D7FA 5EXNA 2AYWA 4ABIA 3BG8A 1T4VH 1VCWA 2V6NA 1GJ7B 4ZH8A 4YT7H 1S82A 5L6NH 2FYQA 3STJA 3SUEA 3MO6A 2BDYA 3VB6A 2OINA 3UR9A 1K9OE 1O3EA 1UJ1A 2GCTC 1TLDA 1BOQA 3BTFE 1OSSA 3KGPA 3SV7A 1PPEE 2FLRH 3SGAE 3RM0H 2UWLA 1UHBB 1CHOF 3FVFB 1SGCA 4YO9A 1XVMA 3M3SA 1OWKA 1T31A 1E36B 1EZQA 4ABAA 2CHAC 5L30H 3MHWU 1T4UH 2ZA5A 2ZIQH 4K8BA 1RJXB 4WMEA 1O32A 3ZZCA 1HJ8A 1J8AA 3ZV9A 2ZDLA 1FDPA 4NA8A 4X1PU 4NIWA 2XC0A 1DPOA 1KXAA 1FV9A 1YCPK 1YBWA 1TPOA 1PQAA 1EOLA 4ZAEA 5FCRA 4UD9H 1FN6A 1INCA 1GI3A 1DFPA 1BBRK 1F0TA 1W11U 2HGTH 1VCPA 2SGQE 1SGPE 1BDAA 1JWTA 3RMLH 3SN8A 1YPKH 3KL6A 3PMJA 1TQ7B 3QLPH 4R8TB 4IBLH 1X7AC 3KEEA 2WUCA 1THRH 2CF9H 1G3BA 2SGAA 1SI5H 4LZ1H 1QR3E 1BITA 2BB4A 1BTWA 2O8TA 2CGAA 2H5DA 5LPFA 3QZRA 4IGDA 4K2YA 4E05H 3PLPA 2OC0A 4MQAA 2ZCKP 5GDSH 1G3CA 3RXBA 1BRBE 1BTXA 4ZHLU 3RMMH 2Y5GA 3RXOA 2R2WU 4X8SH 2D2DA 2ZU3A 1HRTH 1V2TT 1D9IA 1ZSLA 1EZXC 2W26A 2FTLE 4IN2A 1AFQC 1CA0B 5FCKA 8GCHF 3RXLA 2PV9B 3NUMA 4INHA 1C2GA 1BJVA 2PUQH 3MO9A 4K5ZA 5T6FA 4FUBA 2AGIX 9LPRA 4AYVB 1GJ9B 1O2HA 1FI8A 1VITF 3A7VA 3U8OH 2OC7A 1MTNC 3PO1B 1C5XB 4Y76A 1EPTC 4B75A 5CMXH 1OWDA 1Z71A 1HAPH 1C5LH 2GP9B 2ZFPH 5F6MA 5TCCA 1P3EA 4WXVA 1XUHA 3SJKA 5EODA 2V3OH 3C1KA 5K0HA 3LGWA 1GJ6A 4O03A 3DFJA 3MO3A 1QCPA 1E0FD 1CO7E 4AG2A 4ZUHA 1TB6H 6CHAB 5A2MH 5AHGH 2IPHA 4MPVA 3SHCH 1N6XA 2Y80A 2ANMH 2ZTZA 1P04A 1C4U2 1MBMA 2ANWA 1XUFA 4Y10E 2FZZA 3MNSA 1QB6A 2VVUA 1G37A 1KXDA 5FXLA 1UTLM 1L4DA 2XBXA 5JBTA 2WINI 4IC6A 4E7RG 2TGTA 3S0NA 1OPHB 1CGHA 1DICA 1LPKB 2D1JA 5J4QA 2HVXA 3A8AA 3B9FH 3F9HA 3GY2A 2P59A 1F0SA 4I31A 4I8JA 3K6ZA 5ESBA 3PMHB 2C8YB 5GJ4B 1V2JT 2PLXA 3Q3KA 1OWEA 5CHAB 1TAWA 1XXDA 3VXFH 5FAHA 1TPSA 2Y7ZA 2ALVA 4DIHH 3ZVBA 4O9VA 4DOQA 3S7HB 2Z9KA 3ESTA 2XTTB 1GCDA 1A61H 1GBJA 4NSYA 3UWJH 2ZCLP 1VGCB 4MDSA 1O5CB 1L4ZA 1C2DA 2YOLA 1XUJA 4ABBA 3LT3A 3BEUA 5IDKA 2ZZUH 3RXUA 4U01A 4NFFA 1W7GH 2G51A 1QBVH 3TH3H 1GDUA 2A7JA 4H42U 2LPRA 3SU2A 1DVAH 4UONA 1CT0E 1BMMH 4I8KA 3RLWH 1O3FA 3F1SB 1T7CA 2FI4E 2WPIS 1MD7A 2D8WA 1D4PB 1PPBH 1O2YA 3RC4A 1YLCA 2IOTA 1O2VA 3SZNA 1Z8JB 3SJ8A 1C2HA 1SQAA 4KTSA 1IQMA 2K1QA 2R3UA 2TBSA 1YLDA 2FDAA 1C5RA 5C67A 1TABE 1XM1A 5C20A 3TH2H 1UTQA 1UVOA 1UCYH 3Q77A 1GVLA 3AW0A 3MNXA 1GI4A 1GG6C 1Y8TA 3BIVH 3TK9A 1T8MA 2VH6A 1TBZH 1C9TA 2R9PA 3PV4A 1O36A 4X2XA 1IQKA 2SGPE 1UTNA 3SU1A 3SJ9A 1YPGH 3UQVA 2HALA 4X1SU 2Y82A 2P8OC 2VINA 1A3EH 2OQUA 2W3IA 1W0ZU 1HAVA 1Y5UT 3HKJB 1TRMA 4IN1A 3LONA 3PWBA 1AB9C 1O0DH 4TPIZ 3K9XB 2GMTC 1ABJH 1GBLA 4AGKA 2P3FH 1P12E 2NU1E 5L2YH 5JBCS 4ISIH 2H9EH 4X1NU 4ZXYH 1UK3A 4YLQH 1ELAA 2Z9IA 3U9AH 2DE9A 2FX4A 1DSTA 2O8LA 4FU9A 2H2ZA 4UFGH 1Y3UA 3TNSA 3SQEE 1GL0E 5DP5A 2FX6A 1ETRH 1KXEA 1Z8GA 2AGGX 4AB8A 4BAQB 1ANCA 3AW1A 4B2AA 3DD2H 2ZFRH 1YF4A 2QA9E 1UTOA 5EPYA 4MVNA 1DOJA 3HK3B 1BUIA 3RXVA 1QHRB 3A89A 1TNKA 2XCNA 1CVWH 1ZR0A 1YKTA 5L2ZH 2QYIA 4HGCA 2XW9A 3UY9A 1GHBG 3UFAA 1D3TB 2V0BA 1CU1A 1C1UH 3GCHC 1GJBB 3TPIZ 1TPAE 1Y3WA 3OTJE 3P92A 3ZYEA 3ZZ3A 1NU7B 1GHYH 1P2JA 1EJNA 1A0LA 2A7HA 1MQ5A 2ZHQH 1V2MT 1DY8A 2BDCA 2ZGJA 1W13U 4TYDA 2QF3A 1C4Y2 3BTTE 4Y0YE 3M5MA 3MH6A 2QIQA 1O2IA 1SVPA 1WTGH 3U8RH 3RM2H 2O8WA 1BMLA 3UWIA 4BTUB 5DK1A 1N6YA 2H1UA 1O2SA 1ESAA 2CMYA 3T25A 3BEFB 2UUKB 3F9EA 4UFEH 1NRNH 3I78A 3SNBA 2FOGA 2F83A 3B23B 1O2PA 1EXFA 4XBBA 3M3VA 4AN7A 2GX4A 2O8UA 1ELFA 1SMFE 4HI3A 1THSH 4OS2A 2Y6TA 1ELDE 1GCTC 1O38A 1XXFA 1K1NA 3GY4A 3ELAH 2M5TA 1SQOA 2FOFA 1ANBA 3QGJA 3AASA 4ZKSU 1GGDB 1UHBA 1YPMH 1BBRE 3RXMA 4NZLA 5DP3A 5A8YA 4HFPB 3BG4C 4HZHA 4X0WU 1O3KA 3E8LA 3HK6B 5DP7A 1FZZA 1TOCB 2XWAA 1IQIA 2VH0A 1UK2A 1JIMA 2HNTF 1GBIA 3A85A 4CBNA 1O2KA 4DW2U 1O33A 1G3DA 1K22H 1AGJA 1OYTH 3RXEA 4AZ2B 1F92A 3KQCA 1TBQH 2A5IA 3A80A 3Q76A 1AWHB 2QXJA 1SGRE 1DUEA 1OP0A 2ZEBA 2W7SA 1K1OA 1SHHB 4FUDA 1H9IE 1L1GA 3A7XA 1NO9H 4JZFH 1K28D 2FIRH 3Q00A 1PYTD 1XUGA 1C2KA 4GUXA 2BVRH 3LKWA 3SGQE 1YPHE 4TY7A 4JZIA 2ZF0H 3A7TA 1KXBA 1P9UA 2OCVB 2QXIA 1THPB 3UNSA 2ZHWH 5DKMA 3LIWA 5GXPA 2C4FH 1N1LA 3M5LA 2W7UA 2ZCHP 1WQVH 1EATA 2WPKS 1QTFA 1C5NH 3BEIB 3ZVEA 1Z6EA 2B0FA 4ABDA 1H8DH 2FLBH 3TH4H 3SBKA 2GCHF 1XUIA 3NKKA 1RTKA 1D6RA 3ATIA 4Y8ZA 4XOJA 1C5ZB 2BY7X 4Q2KA 1HIAB 3HKIB 1FY1A 1ZGIA 4CREA 2ZGXH 5EQSA 1EX3A 4VGCB 2TGDA 3S69A 1AY6H 1Z7KA 3ZVCA 5TCAA 2BD5A 5AF9H 1HLTH 5IYTA 1K1LA 1GHZA 2AIPA 2GGVB 1BMAA 5FPSA 2VU8E 1T32A 2BDHA 3SNEA 4DURA 1LMWB 1FN8A 3ZYDA 5C1UA 3MU4A 1QL7A 2TPIZ 4X6NA 2J92A 4Z6AH 3BSQA 4X1QU 1NRQH 3RXCA 2EA3A 1MKXH 2G5VA 2F9UA 1UTKA 4CRAA 4I8GA 1NESE 1UTPA 1IHSH 3I77A 1FY3A 1O3PB 2ZG0H 4CHAC 1CQQA 1GMHG 6LPRA 2G52A 3SU3A 2FOEA 3IWMA 3P8GA 1VITH 3H5CB 4WMDA 1CGIE 2XCFA 1P06A 1QB9A 3DFLA 3LC3A 5DP4A 1TWXB 2PFEA 1O2NA 2G4TA 4IC5A 2PKAB 1GMDG 4KP0A 1NRSH 1HV7A 3TGIE 1AKSA 1WBGB 4YESB 4AOQA 1O3BA 1GI2A 1ANDA 2Z3EA 1ZJKA 2BY5X 1AQ7A 1S83A 1TGCA 3KN2A 3SU0A 1CBWC 3FANA 3U8TH 5J4SA 3KIDU 2JETB 3M7UA 2HPQH 1ETSH 4M7GA 1TA2A 4FU7A 1MH0A 3LGVA 3GISB 3T5FH 3AVZA 4X8UH 2V3HH 2WPLS 1T8OA 4Y0ZE 4H6SB 1XKBC 1EAXA 5FPTA 5FX6A 8ESTE 1B5GH 2Z6BD 1WOFA 4MLFB 4NCYA 4U32A 5AVDA 1AWFH 1C2MA 2H9HA 1BTHH 3D65E 3LJOA