3V12A

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v12A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v12A02
5I46H 1BMLA 2CHAC 3QN7A 1P3EA 1TBQH 1V2LT 5HM2A 1NT1A 4AFQA 4XFQA 3SQEE 4DURA 4JZDH 5JYIA 1FIWA 1RTLA 2OQ5A 1IQKA 1CQQA 2VINA 2ZQ2A 2GCTC 2OD3B 4KTSA 1PPEE 1H8DH 2PWXA 1C5OH 3A87A 4XE4A 1GJBB 1GWAA 1O2QA 4HZHA 3RLWH 1TRYA 4X2VA 2GZ9A 3RU4D 5EPNA 2XC0A 1GJAB 1ZHRA 3TJNA 4CRCA 1QL9A 3MH4A 3GY7A 2WINI 2BDYA 4H4FA 1TGBA 2FOFA 2GMTB 2WPIS 1LVBA 1SGQE 5DPAA 2XRCA 1KYNA 1ARBA 1NTPA 1YF4A 2GV7A 1GBJA 3HKJB 3URCA 1C5RA 4UFGH 2ESTE 3M7TA 1WCZA 3RXKA 1EXFA 1V2UT 3M7UA 4BTTB 1P2KA 4YLUA 3SNCA 4NIYA 3D65E 3V0XA 2PTNA 3BV9B 1TIOA 3MYWA 3NZIA 2ASUB 3QK1A 1OWHA 5EXMA 2V0BA 1HAVA 1EASA 4DCDA 3M3TA 3SHAH 3NKKA 4X1NU 1EOJA 2AIQA 2C3SA 4X6OA 1C5TA 3MTYA 3S7KB 1ZMNA 1S83A 1WTHD 5CHAC 1MKWH 1S84A 2BDHA 1K1IA 1FAKH 2FLRH 2VIOA 3EQ0H 1O5FH 5C5NA 1ZLRA 3A7XA 2BXUH 4Q2KA 7GCHG 3SUDA 1ESBA 1GI0A 3PO1C 4X2XA 4JYTA 1UTOA 2O8MA 1EP6A 8ESTE 5SGAE 1EX3A 2ZA5A 5C1UA 3SORA 1GDNA 1Z6EA 3JZ2B 4U2WA 5EOKA 1LPZB 4RSPA 1TMBH 4OGXA 3ZVEA 5CMXH 4CH8B 7ESTE 5C2ZA 2ILNA 2PUQH 1GI6A 3VB5A 8GCHF 2H2ZA 2NWNA 3BTME 3I29A 4Y6DA 1GI8B 1SGEE 1HAIH 1GHZA 1MAXA 1PYTC 1QL8A 2IJOB 1C1SA 3ZZDA 1UTMA 3UOUA 4IBLH 1E34B 5A0AE 3TVJB 4YZUA 5TCCA 1SL3A 1A3EH 4FUJA 2BQ6B 1SGRE 1GMDF 4NFFA 4LK4A 1TWXB 4H42U 3UQVA 2BXTH 1O3JA 2XXLA 1K1PA 2SNVA 2CF9H 4E7NA 4O3TA 3BTKE 2PR3A 3BTEE 1GI2A 2R2MB 1VZQH 4Q7YA 3EA9A 3MMGA 5DJ7A 1C2DA 1KXAA 2ZG0H 1UK3A 1VGCB 3V7TA 3MO9A 1CT4E 3E6PH 1GVZA 4Y10E 5E2PA 1M9UA 5L6NH 1S85A 3A8DA 2UUFB 4FU8A 2Z9GA 3V13A 2ZU2A 1RD3B 1E38B 2FOAA 3LH3A 2RDLA 3SNDA 1HGTH 1SQTA 1LQEA 3MHWU 1DLKB 4IN1A 1OOKB 2ZDAH 1T8LA 5L30H 3QGJA 1YCPH 2QC2A 2AGEX 3P95A 4DVAU 1BRCE 1W8BH 4MPWA 4WY3A 3VXEH 2A32A 4WXIA 1LPGB 2G51A 1O2KA 1IQMA 1O5AB 4B2CA 4CHAB 5I25A 4X1RU 2Z6BD 1Y3XA 2RA3A 3LONA 2BZ6H 4NA8A 6CHAB 4FUEA 2XC5A 1ABJH 4ESTE 3MO6A 4Y7AA 3BTWE 2OINA 3BG8A 3ATLA 5E0GA 2WYJA 4FVDA 5FPTA 2P8OC 1QRXA 3U1JB 1O30A 4JYVH 1YPGH 2VWLA 4VGCC 4KELA 2OXSA 1AZ8A 1L1GA 2O9QA 2FX4A 1QA7A 3VGCC 1N8OB 3B9FH 5GWZA 1V2TT 2BTCE 1CA0B 4AN7A 3G01A 3UR6A 2BOHB 4UE7H 1O38A 1EAWA 1Z6JH 3SJKA 1PPZA 1V2PT 2PKAB 2B0FA 1ZSLA 3RXGA 3P8FA 1OWIA 2HPPH 1C1UH 2F83A 1CBWB 3L33A 4BAHB 1EAIA 4MPUA 3RC6A 3LKWA 2WV5A 2ZHQH 1V2QT 1XUIA 1ZRKA 2A1DB 1QQ4A 4Y8ZA 1GI9B 1T31A 4ZUHA 1ETSH 3SHCH 5HMAA 4WVPE 2YNAA 1V2MT 3SJOA 2F9PA 4AB8A 3V3MA 1SOZA 4X8SH 1D3TB 1AY6H 2NU0E 1EPTA 4A5TS 3EA7A 2BX4A 3SU6A 2A7CA 1K1JA 3RU4T 1MTVA 3MU1A 4CRGA 1KDQB 4JMYA 1BTYA 2BZAA 2C8XB 3M5NA 1C2GA 1QGFA 3M5OA 3TH4H 1YBWA 2W26A 1QRZA 1AVXA 1ELEE 1G3BA 1O3KA 1PPCE 1QRWA 4I32A 1AZZA 4AGJA 1NC6A 2P16A 4WWYA 3A7ZA 1XKAC 1JIMA 4NWLA 1QBOA 2CJIA 2K1QA 1J9CH 3LGYA 1FV9A 1MTNC 1C4U2 1ANEA 4KTCA 1LQDB 5T3HA 4U32A 1BA8B 3TK6A 2RCEA 1ELVA 3P92A 1JOUB 1SC8U 1AKSA 1T8NA 3SQHE 2ZU3A 3PTNA 3VXFH 4UFFH 3ZZBA 1L4DA 3HK6B 5JBBS 3TGKE 4BXWA 1FAXA 3PV4A 1SFIA 5E8EH 1HPGA 3ZZCA 3VEQB 2ALPA 1RIWC 1QJ7B 1TALA 2TRMA 3PLPA 1K28D 1GVKB 2P95A 2F9OA 3QZQA 4UEHH 1IQFA 1MAYA 1JMOH 4ZROA 3MFJA 1GMCF 1HFDA 4LXBH 4TYDA 1H9IE 2M5TA 3ESTA 3A81A 3S69A 2XBXA 4HTCH 5LH8A 4SGBE 2FI5E 2XBVA 2OTVA 1IQLA 1S0RA 4MPVA 1ZMLA 4NIXA 2FPZA 4AZ2B 1UTPA 3T27A 3DT0H 2VNTA 3RM0H 2BY9X 4X0WU 1A1RA 2H9HA 3MI4A 2BDCA 2ZI2H 5DKMA 7KMEH 4ISNA 1PPGE 2AIPA 3R3GB 1FN8A 1ZSKA 1DPOA 5JBCS 1EPTC 3KF2A 1LDTT 3ELAH 2FS8A 1ELCA 4K5ZA 1V6DA 1GHAF 1QURH 4JK5A 4NWKA 1ZR0A 1EUFA 1H9HE 1BBRE 3VFEA 1Y5UT 1G30B 3BG4B 1SLVB 1BRAA 3OSYA 3KNXA 3A80A 2R0KA 1BT7A 2JETC 4UFEH 2SGAA 2VJ1A 1UVSH 1F0TA 4DG4A 1FJSA 2C8WB 4IS5A 5F03A 2A7HA 1ZTLA 2GCHF 1FY3A 3M5LA 2BY6X 5FPSA 3EA8A 2SFAA 1LHDH 5K7RA 5J4SA 3GYLB 3LC5A 4DJZB 3NPSA 1AWFH 3BSQA 1TA6A 1J17T 1BMAA 5C20A 3ZVDA 4GCHG 3QLPH 1Y5AT 4TPYA 1GBAA 4J2YB 1K22H 1O3DA 2GGVB 2P3UB 1RGQA 2OBOA 4X2YA 1MMJN 3ZZ8A 2TGTA 5T6GA 1K21H 1GBIA 1O0DH 3M3SA 1E36B 2QV1A 1DY9A 1HXFH 1GG6C 1MBQA 3E1XB 3AVZA 3RMNH 1TOCB 1L4ZA 1YPEH 1G32B 1WQSA 2V6NA 3MU4A 4Y0YE 4NZLA 2VGCC 4YOJA 1BRUP 3GY4A 1F2SE 4ABGA 1LKBA 3UPEA 2Q1JA 3C27B 1C2IA 1PQ8A 3T26A 4X6PA 2P59A 3M7QA 1SOTA 2ZCLP 4ZKOU 2EI8A 2YOLA 3M61U 3ODDA 4THNH 1TPSA 2VU8E 1AO5A 1SGNE 3DUXH 3K65B 4IMZA 3SO3A 5IDKA 2QF3A 3RXMA 3FZZA 1O2WA 1THPB 1Z8JB 1AWHB 1O3CA 2GT7A 3V12A 1O2NA 2H6MA 3EYDA 4M7GA 3SJIA 3A82A 1LMWB 2BVRH 3SU2A 2A4QA 4ABHA 3U8RH 2AMDA 1VCWA 1D3DB 2P93A 2XCFA 3E8LA 4Q7XA 2OCVB 1O3NA 1TX8A 1LVOA 3GYMA 2O8LA 3F1SB 1TPPA 4MQAA 1OPHB 1Y5BT 2A5KA 3QO6A 4ABAA 2C90B 2R0LA 2TGPZ 3T5FH 4FUCA 2QA9E 3RXLA 3PMJA 1BZXE 1AGJA 4D76A 2ZTYA 3FP6E 3O8DA 2HWLB 1GJDB 4TY6A 1A5HA 2DE8A 5ESBA 4D7FA 1RRKA 1O2RA 1AE8H 5A8ZA 1K1LA 4ZMAH 1NFYA 1TQ0B 1DSUA 4FUDA 4AGKA 3A86A 5FX6A 1CVWH 3GCTF 2AS9A 3ATMA 3SV8A 1O2IA 4D7GA 5GPIB 3Q3YA 1EP5A 3LPRA 2TBSA 2BD4A 2A2XH 1P02A 2GTBA 1YPKH 1EJNA 2QAAA 1SB1H 1GBDA 3SGAE 2A4GA 1BTXA 3EDXB 1TOMH 1ZJDA 3KQBA 3S0NA 6ESTA 4X8UH 3SOSA 2A5IA 3OY6U 4GVUA 5AFYH 5F8XA 1WYKA 8KME2 2VVUA 2EC9H 2O8TA 4X8TH 1GBBA 4A1VA 1PYTD 1XUHA 1HIAA 4OS5A 3RC5A 1HAXB 1BBRH 1P9SA 1TGNA 2OC8A 3PM3A 2FYQA 1FPCH 4WMDA 2I6QA 3F9EA 1EZQA 1IHTH 1DVAH 1V2ST 2ZIQH 3UNSA 1FNIA 1KSNA 3P17H 3A7VA 4DT7B 4DIIH 1EB1H 5F8TA 3LGVA 5F6MA 4MG3A 4Q7ZA 2OP9A 1GJ8B 1DFPA 3S9CA 1WQVH 2J2UA 3GCHC 1C5WB 1FIZA 2FI4E 3ZZAA 1GDQA 1SGFG 2YNBA 2Z7FE 1P03A 4CH2B 1UCYE 4O03A 4RKJB 1HRTH 4I8HA 1YPHC 3SBKA 2BD3A 2G4TA 1C1RA 1DS2E 1C1VH 1HJAC 1C5UA 1FPHH 3BEUA 3TJVA 1F0SA 5FAHA 1KXBA 2HLCA 4X1PU 1ZGVA 2ZDMA 4SGAE 1KLJH 3E0PB 3T25A 3CENA 4HGCA 1C1NA 3Q76A 2GV6A 1UHBB 2ZZUH 1HCGA 1A5IA 2CHAB 3JZ1B 2GP9B 5DP6A 3PLKA 2D8WA 2AMPA 1Y3WA 2G52A 1P3CA 2R3YA 3UREA 1AIXH 2GCTB 2ZDVH 3H5CB 1G3EA 4MPXA 1P57B 3AAVA 2F9NA 1S5SA 3W95A 2ULLA 4MNXA 3RUOA 1HAPH 1O33A 3SUFA 3QTVH 3I77A 2BDAA 2H9TH 2AEIH 1SGPE 1ZPBA 4A6LA 4ABJA 2ZFTA 2ZFRH 4Y76A 1ZTJA 2FP7B 1KXFA 1C1WH 2GMTC 4WH6A 2ZPRA 1GI7B 3M37A 1HV7A 1F7ZA 3Q77A 1ELDE 1O2HA 1E37B 5A8XA 1W14U 2FO9A 3SU1A 4BNRA 4CRBA 3GISB 1BDAA 1MUEB 1K1NA 2ZFSA 1TX6A 5DP9A 4WXVA 3TLOA 3EGKH 2D2DA 1ANCA 1A5GH 2XWBI 1CHOG 1MTSA 3GY8A 3T29A 3K2UA 3MH5A 1SHYA 1C5MD 1KLTA 1O35A 1SSXA 2BD9A 2FOGA 2FODA 1AN1E 2VWNA 3KQCA 4K1SA 4NCYA 1BTHH 1ACBE 4GHTA 4BAMB 5BRRE 1P8VC 5CHAB 1KLIH 1GMCG 1HAHH 3MNSA 3SU3A 4O9VA 1TNLA 5EQSA 1TABE 4I8JA 1PQAA 2FX6A 1BTPA 1O39A 2Z9JA 1T8OA 3SUGA 3QZRA 1GGDB 4A1XA 3LT3A 3WY8A 1MCVA 1NU9A 1MU6B 1NFWA 2ZHWH 2W7SA 3U8TH 2W5EA 1UTQA 1C9PA 2QXJA 1JRTA 3SNAA 1J8AA 1P10A 1O3EA 3RXAA 5EW2H 3A7WA 3M36A 2G8TA 1C2LA 5DG6A 4Z6AH 4AG1A 1DM4B 4Z0KA 1S6HA 5T6DA 1GHAG 5A09A 1TNKA 3F68H 1GJ6A 1P2QA 1G37A 1BTWA 1THSH 3GDSA 1ESTA 3AW1A 2NU1E 1O31A 1C5YB 1OWJA 1O2ZA 4O97A 2ODPA 3A8BA 4XOJA 2P3TB 3ITIA 2XBWA 1OYTH 2GCHG 1ZYOA 1NPMA 2PUXB 2J4IA 1GJ4H 1O3HA 5F8ZA 1OX1A 3KN2A 1FQ3A 2J92A 1MBMA 1VGCC 5LPRA 3ZZ5A 2AGGX 1AUTC 1AFEH 3GCOA 4JZ1A 2NU3E 1UVUH 3UWJH 4I31A 1NRNH 2B9LA 1D6RA 1GJCB 3N7OA 2WUCA 1GBCA 1ETRH 1HAVB 2ZDNA 2G00A 3BTQE 2R3UA 1O3IA 1V2VT 1Z1IA 2ZP0H 5JBAS 2PKSC 1F5RA 1O3AA 2HOBA 3A84A 2J34A 1QCPA 4ZH8A 5JBTA 1UCYH 3TH2H 4IC6A 5EODA 1EATA 1ELFA 2LPRA 1DUAA 2VVVA 4BXSA 2ZKSA 6GCHF 1TFXA 1MKXH 1IQJA 2GZ8A 1UK4A 2ZPSA 5H4IB 1P01A 3IITA 1J14A 1P0SH 3VB6A 1G36A 2ZTXA 2I6SA 2B8OH 1AD8H 4E05H 2A4OA 3UOPA 1ARCA 1HUTH 2QIQA 1BMMH 2SGEE 2RA0A 1A46H 4J1YA 4YOGA 4MTBA 3MU8A 3P8NA 2BY8X 3ATIA 1O2GH 1O5BB 4VGCB 3A83A 1GBKA 1TLDA 1QIXB 5EPYA 3VB3A 1YPHE 3VGCB 1BJUA 4GLYA 1VITH 1ZSJA 4R0IA 1GMHF 4B74A 3STIA 2HNTE 4AX9H 3EAJA 3U9AH 3GDUA 4XBCA 1A0HB 1C4Y2 1BQYA 1W3CA 1EZSC 4FUFA 4DW2U 6LPRA 3P70B 3RXBA 3ZZ6A 3SI4H 5DO4H 4O3UA 1H4WA 1ANDA 5DP8A 2VH6A 2AERH 1OSSA 2BYAX 1GBEA 3SW2B 2R2WU 4ZKRU 4AG2A 4AFSA 1A3BH 3BTGE 3TPIZ 3MNCA 4UFDH 1AVWA 3TNSA 1FI8A 2BLOA 3BTTE 4X8VH 2STAE 1GBHA 2V3HH 2WUBA 3STJA 1V2OT 1O34A 4AORA 1IQGA 3NK8A 2GZ7A 2WPJS 3S7HB 1MTUA 2Y5GA 1GCTB 3R0FA 2BDGA 1QB9A 1F0RA 3E90B 1F0UA 8LPRA 3DHKH 4INHA 4B75A 3ATWA 3SV6A 3OU0A 4IC5A 3ZZ4A 1HAOH 4TY7A 1LPKB 1UJ1A 1JWTA 1X7AC 1NO9H 2XYAA 3P8GA 4Y8YA 1DE7H 1SHHB 1A7SA 3SU4A 1B0FA 4A92A 3SUEA 2SGPE 4B2BA 1GJ9B 2Y82A 4E06H 3RXQA 2VWMA 4F49A 1V2NT 3M35A 1FY5A 1LCYA 4GAWA 5LPEA 1W12U 2OLGA 1MU8B 1O2LA 1CO7E 4DY7B 5B6OA 4NIWA 1ZGIA 3UIRA 1RIWB 3HGPA 2ZECA 1ORFA 4ZKSU 2W3KA 1TYNA 2ANMH 4ISLA 3TITA 5C67A 3GY3A 2PGQB 2ZCKP 1ZRBA 3LH1A 1LHCH 2GT8A 1O3FA 5TCAA 5ABWA 1BUIA 3SJ9A 2FOEA 1O2UA 1QJ6B 2BVSH 3SV2H 5LGOA 2H5CA 3UQOA 2EEKA 2H9EH 1E35B 4RKOB 3RXJA 2GVFA 3MU0A 2BOKA 1B7XB 1OWKA 5HGGA 3ATKA 3OY5U 5GDSH 4BTUB 2FZZA 4NG9H 1HLTH 2B5TB 2DE9A 4BTIB 2THFB 5BPEA 3K6ZA 1SGFA 1W2KH 2BQ7B 4I8KA 4K2YA 3TIUA 1OKXA 1EPTB 1ELGA 1BMNH 3RXEA 1QHRB 4NZQA 5DK1A 3HATH 4XDEA 2SGQE 1DICA 3LGWA 4KGAA 2WPMS 4MNYA 4U30A 2JETB 4DGJA 4CBNA 1O5EH 4GSOA 1RTFB 3ENSB 4B73A 1AQ7A 2NU2E 1WUNH 2BD7A 2Y81A 3EE0B 4INKA 4KP0A 1ZMJA 1MCTA 2Y5HA 3DA9B 1GHXH 1KTTB 3KIDU 4GUXA 1MKWK 2SGDE 1IQIA 1MD7A 3L3TA 1XVOA 3TJUA 3PWBA 1FLEE 3GCNA 1AKSB 1TNGA 3P8OA 2R9PA 3QTOH 2G4UA 1FDPA 4IMQA 3F9FA 3ZYEA 1OYQA 5GIBA 3TJOA 1K2I1 2W3IA 2ZEBA 3MWIU 1WOFA 5JDUB 2BLVA 3MH7A 1SR5C 4TPIZ 1ZOMA 5HXFA 4OS4A 3ZYDA 2BQWB 1ZPZA 1Y59T 1B5GH 5DP3A 4HI3A 1AB9B 3MU5A 1L2EA 9LPRA 2XBYA 3KGPA 3RC4A 3ZV8A 1AHTH 4KKDA 3CP7A 3OYPA 4ZXXH 4ABEA 2F9VA 2VGCB 1YC0A 1GI3A 2Z94A 1DLEA 1SVPA 5A0CA 4Y8XA 2CXVA 1QB1A 1Y3VA 2OC1A 1CE5A 3U98H 3RMLH 4NA7A 3DFLA 1NRSH 1UVPA 1AFQC 1OP2A 2PW8H 1A2CH 3LDXH 1NZQH 4BANB 2LNCA 4ISHH 2QF0A 1JXPA 3HPTB 1D4PB 1QY6A 2VIQA 1VJ9U 1P11E 2TPIZ 3ZV9A 3M3VA 5C3NA 2FESH 2Y6TA 1C1PA 3TNTA 1RXPA 8GCHG 2ZGHA 4NA9H 1AMHA 1BHXF 1OWDA 4GPGA 1S6FA 4MLFB 1LO6A 2ZPQA 1EJAA 1MD8A 2A4RA 2ODQA 4YTAA 2UWPA 1DX5M 1UTNA 4CRAA 5EGMA 3ZVBA 4BAOB 1ZZZA 3PMBB 1QNJA 1GJ7B 1YCPK 2VVCA 5FHTA 3OX7U 4K8YA 2ZGCA 1ESAA 1GMDG 1O3LA 2XW9A 2FI3E 3KL6A 3RP2A 1SBWA 4NGAH 3D23A 1G3DA 1DDJA 1PPBH 1ZPCA 4TWYA 3ZVAA 1MZAA 1SG8B 1DSTA 1TQ7B 2ZDKA 1BOQA 1UTLM 3C1KA 1NY22 2ANWA 3E91A 4NSVA 5HYOA 1H1BA 4YT7H 4FXGH 2TGAA 3W94A 1ZHPA 4AFZA 2Y7ZA 3S9AA 2XC4A 9ESTA 3GY5A 2Z9KA 1PPHE 1Z8RA 3NWUA 5AF9H 2BY7X 1TNJA 1GL1A 1C5VA 1YYY1 2BY5X 3L6PA 2ANYA 1O3BA 2G5NA 1YLCA 2FOBA 1VCQA 3HKIB 1EZUC 1O3MA 2WPHS 2FOHA 4AYYB 4ZXYH 1SLWB 2ZNKH 3O8CA 1YPJH 5ESTE 7LPRA 2ZFPH 2HRVA 2NU4E 1WV7H 1D6WA 1B0EA 3RXRA 1DY8A 1XUGA 1O3OA 3AW0A 4CRFA 4Y11E 2H5DA 3CS7A 5E0HA 2ZDLA 4JZFH 1NRQH 3D49H 2CMYA 2F91A 6GCHG 1QR3E 1EOLA 4ISIH 3D62A 3BEIB 1AI8H 2Z9IA 4ZAEA 2TIOA 2BX3A 2Z3CA 4A7IB 3FFGA 2IN2A 1UO6A 1UTJA 4RN6A 3RM2H 1HDTH 1C1TA 2Y80A 2IPHA 1LTOA 1HBTH 5EQRA 2J9NA 1CU1A 1PPFE 1W0YH 1LVYA 1C2HA 1VCPA 2O8UA 2FIRH 1H9LB 1GI5A 4Q80A 2ZWLH 1GHWH 1F5KU 3GCHB 1KIGH 1VJAU 4ABIA 1YKTA 1SGCA 4KTUA 1GJ5H 2RG3A 1SLUB 2HNTC 1CA8B 3PB1E 4CRDA 1P2IA 1GBMA 4K69A 4BAQB 1NRPH 1Z71A 3UFAA 1S0QA 2PTCE 1QTFA 3SJ8A 2A7JA 4X6NA 3DFJA 4JZIA 2DUCA 1V3XA 1FN6A 1ZHMA 2EA3A 3B23B 2FM2A 1MQ5A 1NN6A 5DP7A 2A0QB 3VB7A 1GVLA 5EW1H 1CGJE 1YM0A 5EU8A 1J16A 3LJOA 5GCHF 1O2SA 1DT2A 1EB2A 1O2OA 1BJVA 1SPJA 2KAIA 3ZVCA 1FMGA 2G55A 5DP5A 1XM1A 1P9UA 4BOHA 3VPKA 1C2MA 2BB4A 1S82A 3BTHE 2Q6FA 4B1TA 1Q31A 3ZZ3A 4K8BA 3FP8E 1UTKA 2OC7A 1YP9A 3A85A 2F9UA 1O2VA 2Z3EA 4GCHF 5FBIA 1H8IH 1A4WH 4OGYA 4X2WA 1IQEA 1THRH 2W7UA 2Z3DA 1VR1H 2FYRA 1ELAA 1DWDH 1WTGH 2QY0B 3GDVA 1TNIA 5AVDA 2CGAA 1HIAB 1NESE 4I8LA 2BD2A 3HGNA 2BMGB 1C1MA 1SGYE 1HXEH 1FY4A 1W10U 1CHGA 3SV7A 3F6UH 1EKBB 1A61H 4PROA 1IQHA 2OBQA 3F9GA 1TRNA 1OXGA 5A8YA 4B76A 1K9OE 1C2FA 2SGFE 5FCRA 1NROH 2WYGA 4K1EA 1ETTH 3RMOH 3QX5H 4WF8A 5PTPA 3QUMP 3ZZ7A 3QDZB 1YLDA 2ZU4A 2PV9B 3PO1B 1DITH 2P94A 3GY6A 3ZVFA 5AFZH 3AASA 3UTUH 1N1LA 5FBEA 1SQOA 1T32A 2FDAA 2CV3A 2FOCA 1V2JT 1HB0B 3U69H 1GHBF 1TGCA 5EQQA 5GXPA 3O8RA 1ELBA 3RXTA 3TGIE 3U1IB 1BHXB 1L0ZA 4IW4E 4ABDA 3LGIA 1GGDC 3T62A 1SGTA 1F92A 1GI4A 3LOXA 1LVMA 1SGDE 1SI5H 3RXFA 2ZO3H 5FPYA 3MO3A 2FEQH 4AB9A 1XKBC 2PKAA 1HNEE 2FLBH 2WV4A 1P12E 4MNWA 4H6TA 1DANH 3UWIA 4Y7BA 4H6SB 2KAIB 2V3OH 4WJG2 1D3QB 3GOVB 1BIOA 1TRMA 5JPMH 2AYWA 3ZVGA 2ZHDA 1LKAA 1FONA 1C4V2 4FUGA 1P09A 4QT8C 5DGJA 3A8CA 2FXRA 1JBUH 2WPKS 1AUJA 4IGDA 3F9HA 4E7RG 2ODYB 2XTTB 4YT6H 3SZNA 1N6XA 2AMQA 2UWOA 1KDQA 3AAUA 2B7DH 1P2OA 1VITF 4YOIA 2UUJB 1PQ7A 2V35A 1UVTH 3RMMH 4JCNA 1EJMA 2ZQ1A 2XNIA 4CHAC 1Z8IB 1Y3UA 4K1TA 1P2MA 3QGNB 2AH4X 1GCDA 4FU9A 3TU7H 1EZXC 3SGQE 1P06A 2ZU1A 2D1JA 1SQAA 1RTKA 4B2AA 6CHAC 2PKSB 2A45B 2JKHA 3BIUH 4NIVA 5EG4A 1FZZA 2GDEH 1O2MA 1GPZA 4XSKU 4OS7A 4MDSA 4YO9A 2BLWA 4LOYH 1O2YA 1O37A 1XMNB 2P8OB 2ZTZA 4JZEH 1ABIH 2BM2A 1N8OC 4AYVB 1AU8A 1KY9A 4I8GA 1CA0C 2VIWA 4U01A 1C5QA 2CN0H 1LHEH 4TWWA 1YPLH 1V2KT 3LGUA 4GHQA 1U6QA 1QA0A 5L2ZH 4ABFA 2ZHEH 3RDZA 2BHGA 1NS3A 1DWCH 2P3FH 4B71A 1DXPA 1CBWC 1RS0A 3LGTA 3BEFB 4YM9A 1P05A 2A31A 4FUIA 4BAKB 2C8YB 1HAZB 3B8JA 1PFXC 3SNEA 1XUKA 2ZF0H 1UMAH 1KTSB 1SLXB 3Q3XA 1SMFE 1AVGH 4D9RA 1HAYB 2XWAA 3RLYH 1IAUA 1G2LA 1E0FD 1HAGE 1O3PB 1XXDA 1TBRH 1W7GH 1MZDA 2ZCHP 2HGTH 1GBFA 4CR5A 2GX4A 3IG6B 4UONA 1ELTA 1T4UH 1Y8TA 1NRRH 1BCUH 1A0JA 1PQ5A 2AGIX 1W7XH 1GL0E 1LHFH 4AOQA 3GCTG 2FWWA 3RXSA 1BBRK 3UY9A 1GCTC 3ODFA 4FUHA 2VB0A 2IOTA 5EXNA 1C1QA 2QXIA 1QQUA 1GHYH 2WPLS 4CREA 2H1UA 1MTNB 2QN5T 3NCLA 3FP7E 1C5SA 1QBNA 4JK6A 4K60A 4ZHMU 2UUYA 2J95A 4ZKNU 5K0HA 2PHBA 4OS2A 3VB4A 3SU5A 3H7OA 3FAOA 3PWCA 5A2MH 1DUEA 1T8MA 4CR9A 2BD5A 4ZHAA 1L1JA 1TE0A 2A5AA 5C1YA 1BB0B 3RXPA 1D3PB 3PYHA 1TX7A 3O8BA 1BTUA 2OC0A 1CHOF 5CE1A 4FU7A 1TGTA 1O32A 1DWBH 1TAWA 2TGDA 4DOQA 1O5DH 2QGRA 5L2YH 2FMJA 1KXDA 5T6FA 1KXEA 7GCHF 3MOCA 3CS0A 1C5XB 3SGBE 3SU0A 1D9IA 1C2EA 1MH0A 2FTMA 1O2XA 4D8NA 2Q6DA 1L1NA 1Y3YA 3Q3KA 2ALVA 1IHSH 4YESB 5TJXA 1TBZH 1O2TA 3T2NA 2HALA 2C8ZB 1F5LA 4JYUH 1NU7B 1MQ6A 5C1XA 1FY1A 1TGSZ 5A0BA 3PMAB 4HFPB 4XBDA 4IN2A 4NFEA 2HNTF 1V2WT 2BD8A 3RXUA 4OS1A 1QB6A 3BF6H 2ANKH 2J94A 3BIVH 3BG4C 3GY2A 1DWEH 4R8TB 3RXOA 2C93B 1TNHA 2PSYA 3A89A 1TONA 3K9XB 3T28A 1C5LH 1PJPA 1INCA 1GBLA 2FS9A 1NFXA 2UWLA 4UDWH 3E0NB 2Y7XA 4WMFA 1O36A 2J38A 2VIPA 3ZZ9A 5GCHG 2AFQB 3UNQA 1SGIB 2XCNA 1TMUH 5DP4A 2FTLE 3FANA 1CGHA 5E0JA 2PGBB 1C9TA 1Z1JA 1P2NA 1CT0E 1XVMA 1YGCH 3A88A 1Q3XA 1ZJKA 2FOMB 2ZHFH 3PROA 5C5OA 3A8AA 4I33A 5IYTA 1P2JA 3TK5A 3KQDA 1GDUA 1UK2A 3E16B 1BTZA 2HVXA 2ZC9H 1GBTA 4K3JA 1K1MA 1TPAE 3RXCA 3UR9A 1LHGH 2ZU5A 1C5NH 3A7YA 3UUZA 3SV9A 1GG6B 1QFKH 3OTJE 1W13U 3RXHA 2BDBA 2VIVA 3RXVA 4DIHH 1CSOE 5HM9A 3RU4E 5JB9S 1JRSA 1AB9C 1G2MA 2Y5FA 3P6ZB 4FVBA 4Y0ZE 1G3CA 3IWMA 1HJ9A 3SNBA 1C5ZB 3K6YA 1RFNA 4MVNA 1KXCA 4YLQH 1FY8E 2UUKB 1TMTH 1W11U 3RXDA 1OP0A 2SNWA 1XXFA 2F9BH 1S81A 3M5MA 2GDDA 1EAXA 3LIWA 3PMHB 2PLXA 2Q6GA 5J4QA 1AFQB 1JIRA 3KCGH 1TA2A 1EQ9A 1N6YA 1GI1A 1A0LA 4WMEA 2STBE 4X1QU 5FX5A 3HK3B 3FVFB 2QXHA 1G9IE 1GHBG 1UVOA 1Z8GA 2ZGBH 1AE5A 2EI6A 2GKVE 1C5PA 4ABBA 2CF8H 5FXLA 3UNRA 1O3GA 1J15A 1TPOA 3LC3A 3RXIA 2JH5D 1WU1A 2JH0D 4MNVA 3S9BA 1WBGB 3NUMA 3E3TA 1C2KA 4FUBA 2G5VA 3KEEA 3Q00A 1BRBE 3PTBA 2ZGXH 3H7TA 1CT2E 2QCYA 4INLA 1OWEA 3BTFE 2A2QH 1OS8A 3MH6A 4X1SU 3SN8A 2BVXH 3SI3H 1C1OA 2OUAA 4ZHLU 1K1OA 1UCYK 4AFUA 3I78A 1DOJA 1IOEA 1UHBA 1ID5H 3TK9A 3U8OH 3A7TA 1GHVH 1QL7A 1QBVH 1T7CA 2ZFFH 1Q2WA 1MKXK 2BDIA 1O2JA 1XUJA 2VIDA 1P04A 1BITA 1O5GH 1HJ8A 1MTWA 1C2JA 3NXPA 3LU9B 4Y71A 4ISOA 2VH0A 3KHVA 4LZ4B 1OP8A 1WSSH 2F3CE 1VITG 4CBOA 4Y79A 5EXLA 2OQUA 1DXWA 3URDA 1XUFA 5ETXA 3MNBA 3FZDA 5AHGH 1YCPM 5GJ4B 1XX9A 1IQNA 2O8WA 2C4FH 4WH8A 3DD2H 1ANBA 1FXYA 4XBBA 1HYLA 1QJ1B 3TGJE 2G81E 5G4BA 1WAYB 1T4VH 4A1TA 3GICB 2ZGJA 5E2OA 2GD4B 5FCKA 1W0ZU 4I7YH 2ZFQH 1CGIE 1TB6H 5LPFA 2JH6D 1FUJA 2BLQA 1NFUA 1YPMH 4D9QA 4F4OC 2D26C 3BTDE 4OS6A 1GMHG 2PFEA 2Z9LA 2EI7A 4UD9H 3KQEA 1NM6A 1O5CB 2PSXA 2QXGA 3QWCH 1RJXB 2HPQH 5JB8S 4NSYA 1V2RT 3PLBA 1HJAB 3LJJA 3TH3H 1ZTKA 1O2PA 1Z7KA 2VWOA 4X6MA 4ASHA 2QYIA 1SFQB 3MNXA 4LZ1H 3BN9A 1EAUA
chains in the Genus database with same CATH superfamily
5I46H 1BMLA 2CHAC 3QN7A 1P3EA 1TBQH 1V2LT 5HM2A 1NT1A 4AFQA 4XFQA 3SQEE 4DURA 4JZDH 5JYIA 1FIWA 1RTLA 2OQ5A 1IQKA 1CQQA 2VINA 2ZQ2A 3VG8A 2GCTC 2OD3B 4KTSA 1PPEE 3FOAA 1H8DH 2PWXA 1C5OH 3A87A 4XE4A 1GJBB 1GWAA 1O2QA 4HZHA 3RLWH 1TRYA 4X2VA 2GZ9A 2WPDD 3RU4D 5EPNA 2XC0A 1GJAB 1ZHRA 2EQNA 3TJNA 4CRCA 1QL9A 3MH4A 3GY7A 2WINI 2BDYA 4H4FA 1TGBA 2FOFA 2GMTB 2WPIS 1LVBA 1SGQE 5DPAA 2XRCA 3N7EA 1KYNA 1ARBA 1NTPA 1YF4A 2GV7A 1GBJA 3HKJB 3URCA 1C5RA 4UFGH 2ESTE 3M7TA 1WCZA 3RXKA 1EXFA 1V2UT 3M7UA 4BTTB 1P2KA 5HKKD 4YLUA 3SNCA 4NIYA 3D65E 3V0XA 2PTNA 3BV9B 1TIOA 3MYWA 3NZIA 2ASUB 3QK1A 1OWHA 5EXMA 2V0BA 1HAVA 1EASA 4DCDA 3M3TA 3SHAH 3NKKA 4X1NU 1EOJA 2AIQA 2C3SA 4X6OA 5EJLA 1C5TA 3MTYA 3S7KB 1ZMNA 1S83A 1WTHD 5CHAC 1MKWH 1S84A 2BDHA 1K1IA 1FAKH 2FLRH 2VIOA 5C0TA 2KCAA 3EQ0H 1O5FH 5C5NA 1ZLRA 3A7XA 2BXUH 4Q2KA 7GCHG 3SUDA 1ESBA 1GI0A 3PO1C 4X2XA 4JYTA 1UTOA 2O8MA 1EP6A 8ESTE 5SGAE 1EX3A 2ZA5A 5C1UA 3SORA 1GDNA 1Z6EA 3JZ2B 4U2WA 5EOKA 1LPZB 4RSPA 1TMBH 4OGXA 3ZVEA 5CMXH 4RT0A 4CH8B 7ESTE 5C2ZA 2ILNA 2PUQH 1GI6A 3VB5A 8GCHF 2H2ZA 2NWNA 3BTME 3I29A 4Y6DA 1GI8B 3WWFA 1SGEE 1HAIH 1GHZA 1MAXA 1PYTC 1QL8A 2IJOB 3W1EA 1C1SA 3ZZDA 1UTMA 3UOUA 4IBLH 1E34B 5A0AE 3TVJB 4YZUA 5TCCA 3U28C 4AC9A 1SL3A 1A3EH 4FUJA 2BQ6B 1SGRE 1GMDF 4NFFA 4LK4A 1TWXB 4H42U 3UQVA 2BXTH 1O3JA 2XXLA 1K1PA 2SNVA 2CF9H 4E7NA 4O3TA 3BTKE 2PR3A 3BTEE 1GI2A 2R2MB 1VZQH 4Q7YA 3EA9A 3MMGA 5DJ7A 1C2DA 1KXAA 2ZG0H 1UK3A 1VGCB 1E79D 3V7TA 3MO9A 1CT4E 3E6PH 1GVZA 4Y10E 3KYFA 1M9UA 5E2PA 5L6NH 1S85A 3A8DA 2UUFB 4FU8A 2Z9GA 3V13A 2ZU2A 1RD3B 1E38B 2FOAA 3LH3A 2RDLA 3SNDA 1HGTH 1SQTA 1LQEA 3MHWU 1DLKB 4IN1A 1OOKB 2ZDAH 1T8LA 5L30H 3QGJA 1YCPH 2QC2A 2AGEX 3P95A 4DVAU 1BRCE 1W8BH 5CDFE 3DSPA 4MPWA 4WY3A 3VXEH 2A32A 4WXIA 1LPGB 2G51A 1O2KA 1IQMA 1O5AB 4B2CA 1H8ED 4CHAB 5I25A 3OE7D 4X1RU 2Z6BD 1Y3XA 2RA3A 3LONA 2BZ6H 4NA8A 6CHAB 4FUEA 2XC5A 1ABJH 4ESTE 5EJZA 3MO6A 2VBCA 4Y7AA 3BTWE 2OINA 3BG8A 2M2AA 3ATLA 2QF5A 5E0GA 2WYJA 4FVDA 5FPTA 2P8OC 1QRXA 3U1JB 1O30A 4JYVH 1YPGH 2VWLA 4VGCC 4KELA 2OXSA 1AZ8A 1L1GA 2O9QA 2FX4A 1QA7A 3VGCC 1N8OB 3B9FH 2WSSD 5GWZA 1V2TT 2BTCE 1CA0B 4AN7A 3G01A 3UR6A 2BOHB 4UE7H 1O38A 1EAWA 1Z6JH 3SJKA 1PPZA 1V2PT 2PKAB 2B0FA 1ZSLA 3RXGA 3P8FA 1OWIA 2HPPH 1C1UH 2F83A 1CBWB 3L33A 4BAHB 4XRNA 1EAIA 4MPUA 2L6OA 3RC6A 3LKWA 2WV5A 2ZHQH 1V2QT 1XUIA 1ZRKA 2A1DB 1QQ4A 4Y8ZA 1GI9B 1T31A 4ZUHA 1ETSH 3SHCH 5HMAA 4WVPE 2YNAA 1V2MT 3SJOA 2F9PA 4AB8A 3V3MA 1SOZA 4X8SH 1D3TB 1AY6H 4YXWD 2NU0E 1EPTA 4A5TS 3EA7A 2BX4A 3SU6A 2A7CA 1K1JA 2F4LA 3RU4T 1MTVA 3MU1A 1W0KD 4CRGA 1KDQB 4JMYA 1BTYA 2BZAA 2C8XB 3M5NA 1C2GA 1QGFA 3M5OA 3TH4H 1YBWA 3CNRA 2W26A 1QRZA 1AVXA 1ELEE 1G3BA 1O3KA 1PPCE 1QRWA 4I32A 1AZZA 4AGJA 1NC6A 2P16A 4WWYA 3A7ZA 1XKAC 1JIMA 4NWLA 1QBOA 2CJIA 2K1QA 1J9CH 3LGYA 1FV9A 1MTNC 1C4U2 1ANEA 4KTCA 1LQDB 5T3HA 4U32A 1BA8B 3TK6A 2RCEA 1ELVA 1QZ8A 3P92A 1JOUB 1SC8U 1AKSA 1T8NA 3SQHE 2ZU3A 3PTNA 3VXFH 4UFFH 3ZZBA 1L4DA 3HK6B 5JBBS 3TGKE 4BXWA 1FAXA 3PV4A 1SFIA 5E8EH 1HPGA 3ZZCA 3VEQB 2ALPA 2JJ2D 1RIWC 2QF4A 1QJ7B 1TALA 2TRMA 2CK3D 1K28D 1GVKB 2P95A 3PLPA 2F9OA 3QZQA 4UEHH 1IQFA 2JIZD 2AHME 1MAYA 1JMOH 4ZROA 3MFJA 1GMCF 1HFDA 4LXBH 4TYDA 1H9IE 2M5TA 3ESTA 3A81A 4XD7D 3S69A 2XBXA 4HTCH 5LH8A 4SGBE 4Z1MD 2FI5E 2XBVA 2OTVA 1IQLA 1S0RA 4MPVA 1ZMLA 4NIXA 2FPZA 4AZ2B 1UTPA 3T27A 3DT0H 2VNTA 3RM0H 2BY9X 4X0WU 1A1RA 2H9HA 2KCPA 3MI4A 2BDCA 5EJ1A 2ZI2H 5DKMA 7KMEH 4ISNA 1PPGE 2KM0A 2AIPA 3R3GB 1FN8A 1ZSKA 1DPOA 5JBCS 1EPTC 3KF2A 1LDTT 3ELAH 2FS8A 1ELCA 4K5ZA 1V6DA 1GHAF 1QURH 4JK5A 4NWKA 1ZR0A 1EUFA 1H9HE 1BBRE 3VFEA 1Y5UT 1G30B 3BG4B 1SLVB 1BRAA 3OSYA 3KNXA 3A80A 2R0KA 1BT7A 2JETC 4UFEH 2SGAA 2VJ1A 1UVSH 1F0TA 4DG4A 1FJSA 2C8WB 4IS5A 5F03A 2A7HA 1ZTLA 2GCHF 1FY3A 3M5LA 2BY6X 5FPSA 3EA8A 2SFAA 1LHDH 5K7RA 5J4SA 3GYLB 3LC5A 4DJZB 3NPSA 1AWFH 3BSQA 1K0HA 1TA6A 1J17T 1BMAA 4M9FA 5C20A 3ZVDA 4GCHG 3QLPH 2GJGA 3EE7A 1Y5AT 4TPYA 4Q63A 1GBAA 4J2YB 1K22H 1O3DA 2GGVB 2P3UB 1RGQA 2OBOA 3PV5A 4X2YA 1MMJN 3ZZ8A 2TGTA 5T6GA 2LELA 1K21H 1GBIA 1O0DH 3M3SA 1E36B 2QV1A 1DY9A 1HXFH 1GG6C 1MBQA 3E1XB 3AVZA 3RMNH 1TOCB 3WWBA 1L4ZA 1YPEH 1G32B 1WQSA 2V6NA 3MU4A 4Y0YE 4NZLA 2VGCC 1YLNA 4YOJA 1BRUP 3GY4A 1F2SE 4ABGA 1LKBA 3UPEA 2Q1JA 3C27B 1C2IA 1PQ8A 3T26A 3FKSD 4X6PA 2P59A 3M7QA 1SOTA 2ZCLP 1BMFD 4ZKOU 2EI8A 2YOLA 3M61U 3ODDA 4ZCNA 4THNH 1TPSA 2VU8E 1AO5A 1SGNE 3DUXH 3K65B 4IMZA 3SO3A 3N99A 5IDKA 2QF3A 3RXMA 2V3MA 3FZZA 1O2WA 1THPB 1Z8JB 1AWHB 1O3CA 2GT7A 3V12A 1O2NA 2H6MA 3EYDA 4M7GA 3SJIA 3A82A 1LMWB 2BVRH 3SU2A 2A4QA 4ABHA 3U8RH 2AMDA 1VCWA 1D3DB 2P93A 2XCFA 3E8LA 4Q7XA 2OCVB 1O3NA 1TX8A 1LVOA 3GYMA 2O8LA 3F1SB 1TPPA 5GNDA 4MQAA 1OPHB 1Y5BT 2A5KA 1NBME 3QO6A 4ABAA 2C90B 2R0LA 2TGPZ 3T5FH 4FUCA 2QE7D 2QA9E 3RXLA 3PMJA 1BZXE 1AGJA 4D76A 2ZTYA 3FP6E 3O8DA 1UW7A 2HWLB 1GJDB 4TY6A 1A5HA 2DE8A 5ESBA 4D7FA 1RRKA 1O2RA 1AE8H 5A8ZA 1K1LA 4ZMAH 1NFYA 1TQ0B 1DSUA 4FUDA 4AGKA 3A86A 5FX6A 1CVWH 3GCTF 5HIZA 2AS9A 2K0QA 3ATMA 3SV8A 1O2IA 4D7GA 5GPIB 3Q3YA 1EP5A 3LPRA 2TBSA 2BD4A 2A2XH 1P02A 2GTBA 1YPKH 1EJNA 2QAAA 1SB1H 1GBDA 3SGAE 2A4GA 1BTXA 3EDXB 1TOMH 1ZJDA 3KQBA 3S0NA 6ESTA 4X8UH 3SOSA 2A5IA 3OY6U 4GVUA 5AFYH 5F8XA 1WYKA 8KME2 2VVUA 2EC9H 2O8TA 4X8TH 1GBBA 4A1VA 1PYTD 1XUHA 1HIAA 4OS5A 3RC5A 1HAXB 1BBRH 1P9SA 1TGNA 2OC8A 3PM3A 2FYQA 1FPCH 4WMDA 2I6QA 3F9EA 1EZQA 1IHTH 1DVAH 1V2ST 2ZIQH 3UNSA 1FNIA 1KSNA 3P17H 3A7VA 4DT7B 4DIIH 1EB1H 2RFKC 5F8TA 3LGVA 5F6MA 4MG3A 4Q7ZA 2OP9A 1GJ8B 1DFPA 3S9CA 1WQVH 2J2UA 3GCHC 1C5WB 1FIZA 2FI4E 3ZZAA 1GDQA 1SGFG 2YNBA 2Z7FE 1P03A 4CH2B 1UCYE 4O03A 4RKJB 1HRTH 4I8HA 1YPHC 3DSGA 3SBKA 2BD3A 2G4TA 1C1RA 1DS2E 1C1VH 1HJAC 1C5UA 1FPHH 3BEUA 3TJVA 1F0SA 5FAHA 1KXBA 2HLCA 4X1PU 1ZGVA 2ZDMA 4SGAE 1KLJH 3E0PB 3T25A 3CENA 4HGCA 1C1NA 2W6JD 3Q76A 2GV6A 1UHBB 2ZZUH 1HCGA 1A5IA 2CHAB 3JZ1B 2GP9B 5DP6A 3PLKA 2D8WA 2AMPA 1Y3WA 2G52A 1P3CA 2R3YA 3UREA 1AIXH 2GCTB 2ZDVH 3H5CB 1G3EA 4MPXA 1P57B 3AAVA 2F9NA 1S5SA 3W95A 2ULLA 4MNXA 3RUOA 1HAPH 1O33A 3SUFA 3QTVH 3I77A 2BDAA 2H9TH 2AEIH 1SGPE 1ZPBA 4A6LA 4ABJA 2ZFTA 2ZFRH 4Y76A 1ZTJA 2FP7B 1KXFA 1C1WH 2GMTC 4WH6A 2ZPRA 1GI7B 3M37A 1HV7A 1F7ZA 3Q77A 1ELDE 1O2HA 1E37B 5A8XA 1W14U 2FO9A 3SU1A 4P02A 4BNRA 4CRBA 3GISB 1BDAA 1MUEB 1K1NA 2ZFSA 1TX6A 5DP9A 4WXVA 3TLOA 3EGKH 2D2DA 1ANCA 1A5GH 2XWBI 4P00A 1CHOG 1MTSA 3GY8A 3T29A 3K2UA 3MH5A 1SHYA 1C5MD 1KLTA 1O35A 1SSXA 2BD9A 2FOGA 2FODA 1AN1E 2VWNA 3KQCA 4K1SA 5DSFA 4NCYA 1BTHH 1ACBE 4GHTA 4BAMB 5BRRE 1P8VC 5CHAB 1KLIH 1GMCG 1HAHH 3MNSA 4OM9A 3SU3A 4O9VA 1TNLA 5EQSA 2L74A 2HVYB 1TABE 4I8JA 1PQAA 1NBMD 2OK5A 2FX6A 1BTPA 1O39A 2Z9JA 1T8OA 3SUGA 3QZRA 1VKYA 1GGDB 4A1XA 3LT3A 3WY8A 1MCVA 1NU9A 1MU6B 1NFWA 2ZHWH 2W7SA 3U8TH 2W5EA 1UTQA 1C9PA 2QXJA 1JRTA 3SNAA 1J8AA 1P10A 1O3EA 3RXAA 5EW2H 3A7WA 3M36A 2G8TA 1C2LA 5DG6A 4Z6AH 4AG1A 4ASUD 1DM4B 4Z0KA 1S6HA 5T6DA 1GHAG 5A09A 1TNKA 3F68H 1GJ6A 1P2QA 1YY3A 4RI0A 1G37A 3PRDA 1BTWA 1THSH 3GDSA 1ESTA 3AW1A 2NU1E 1O31A 1C5YB 1OWJA 2YMSB 1O2ZA 4O97A 2ODPA 3A8BA 4XOJA 2P3TB 3ITIA 2XBWA 1OYTH 2GCHG 4ACBA 1ZYOA 1NPMA 2PUXB 2J4IA 1GJ4H 1O3HA 5F8ZA 1OX1A 3KN2A 1FQ3A 2J92A 1MBMA 1VGCC 5LPRA 2J97A 3ZZ5A 2AGGX 1AUTC 1AFEH 3GCOA 4JZ1A 2NU3E 1UVUH 3UWJH 4I31A 1NRNH 2B9LA 1D6RA 1GJCB 3N7OA 2WUCA 1GBCA 1ETRH 1HAVB 2ZDNA 2G00A 3BTQE 2R3UA 1O3IA 1V2VT 1Z1IA 2ZP0H 5JBAS 2PKSC 1F5RA 1O3AA 2HOBA 3A84A 2J34A 1QCPA 4ZH8A 5JBTA 1UCYH 3TH2H 4IC6A 5EODA 1EATA 1ELFA 2LPRA 1DUAA 2VVVA 4BXSA 2ZKSA 6GCHF 1TFXA 1MKXH 1IQJA 2GZ8A 1UK4A 2ZPSA 3KQ5A 5H4IB 1P01A 3IITA 2IJD1 1J14A 1P0SH 3NRLA 3VB6A 1G36A 2ZTXA 2I6SA 2B8OH 1AD8H 4E05H 2A4OA 3UOPA 1ARCA 1HUTH 2QIQA 1BMMH 2SGEE 2RA0A 1A46H 4J1YA 4YOGA 4MTBA 3FO8D 3MU8A 3P8NA 2BY8X 3ATIA 1O2GH 1O5BB 2XOKD 4VGCB 3A83A 1GBKA 1TLDA 1QIXB 5EPYA 3VB3A 1YPHE 3VGCB 1BJUA 4GLYA 3OAAD 1VITH 1ZSJA 4R0IA 1GMHF 4B74A 3STIA 2HNTE 4AX9H 3EAJA 3U9AH 3GDUA 4XBCA 1A0HB 1C4Y2 4B6FA 1BQYA 1W3CA 1EZSC 4FUFA 4DW2U 6LPRA 3P70B 3RXBA 3ZZ6A 3SI4H 5DO4H 4O3UA 1H4WA 1ANDA 5DP8A 2VH6A 2AERH 1OSSA 2BYAX 1GBEA 3SW2B 2R2WU 4ZKRU 4AG2A 4AFSA 1A3BH 3BTGE 3TPIZ 3MNCA 4UFDH 1AVWA 3TNSA 1FI8A 2BLOA 3BTTE 4X8VH 2STAE 1GBHA 2V3HH 2WUBA 3STJA 1V2OT 1O34A 4AORA 1IQGA 3NK8A 2GZ7A 2WPJS 3S7HB 1MTUA 2Y5GA 1GCTB 3R0FA 2BDGA 1QB9A 2KCYA 3PV2A 1F0RA 3E90B 1F0UA 8LPRA 3DHKH 4INHA 4B75A 3ATWA 3SV6A 3OU0A 4IC5A 3ZZ4A 1HAOH 4TY7A 1LPKB 1UJ1A 1JWTA 1X7AC 1NO9H 2XYAA 2JDID 3P8GA 4Y8YA 1DE7H 1SHHB 1A7SA 3SU4A 1B0FA 4A92A 3SUEA 2SGPE 4B2BA 1GJ9B 2Y82A 4E06H 3RXQA 2VWMA 4F49A 1V2NT 2XNDD 3M35A 1FY5A 1LCYA 4GAWA 5LPEA 1W12U 2OLGA 1MU8B 1O2LA 1CO7E 4DY7B 5B6OA 4NIWA 1ZGIA 4RT1A 3UIRA 1RIWB 3HGPA 2ZECA 1ORFA 4ZKSU 2W3KA 1TYNA 2ANMH 4ISLA 3TITA 5C67A 3GY3A 2PGQB 2ZCKP 1ZRBA 3LH1A 1LHCH 2GT8A 1O3FA 5TCAA 5ABWA 1BUIA 3SJ9A 2FOEA 1O2UA 1QJ6B 2BVSH 3SV2H 5LGOA 2H5CA 3UQOA 2EEKA 2H9EH 1E35B 4RKOB 3RXJA 2GVFA 3MU0A 2BOKA 1B7XB 1OWKA 1OHHD 5HGGA 3ATKA 3OY5U 5GDSH 4BTUB 2FZZA 4NG9H 4TSFD 1HLTH 2B5TB 2DE9A 4BTIB 2THFB 5BPEA 3OEED 2V7QD 3K6ZA 1SGFA 1W2KH 2BQ7B 4I8KA 4K2YA 3TIUA 1OKXA 1EPTB 1ELGA 1BMNH 3RXEA 1QHRB 4NZQA 5DK1A 3HATH 4XDEA 2SGQE 1DICA 3LGWA 4KGAA 2WPMS 4MNYA 4U30A 2JETB 4DGJA 4CBNA 1O5EH 4GSOA 1RTFB 3ENSB 4B73A 1AQ7A 2NU2E 1WUNH 2BD7A 2Y81A 3EE0B 4INKA 4KP0A 1ZMJA 1MCTA 2Y5HA 3DA9B 1GHXH 1KTTB 3KIDU 4GUXA 1MKWK 2SGDE 1IQIA 1MD7A 3AK5A 3L3TA 1XVOA 3TJUA 3PWBA 1FLEE 3GCNA 1AKSB 1TNGA 3P8OA 4B6EA 2R9PA 3QTOH 2G4UA 1FDPA 4IMQA 3F9FA 3ZYEA 3SYJA 1OYQA 5GIBA 3TJOA 1K2I1 2W3IA 2ZEBA 3MWIU 1WOFA 2WZQA 5JDUB 5C0UA 2BLVA 3MH7A 1SR5C 4TPIZ 1ZOMA 5HXFA 4OS4A 3ZYDA 2BQWB 1ZPZA 1Y59T 1B5GH 5DP3A 5F53A 4HI3A 1AB9B 3MU5A 1L2EA 9LPRA 2XBYA 3KGPA 3RC4A 3ZV8A 1AHTH 4KKDA 3CP7A 3OYPA 3KYGA 3OFND 4ZXXH 3H09A 4ABEA 2F9VA 2VGCB 1YC0A 1GI3A 2Z94A 1WXRA 1DLEA 1SVPA 5A0CA 4Y8XA 1KMHB 2CXVA 1QB1A 1Y3VA 2OC1A 1CE5A 3U98H 3RMLH 4NA7A 3DFLA 1W0JD 1NRSH 1UVPA 3OEHD 1AFQC 1OP2A 2PW8H 1A2CH 3LDXH 1NZQH 4BANB 2LNCA 4ISHH 2QF0A 1JXPA 3HPTB 1D4PB 1QY6A 2VIQA 1VJ9U 1P11E 2TPIZ 3ZV9A 3M3VA 5C3NA 2FESH 2Y6TA 1C1PA 3DSOA 3TNTA 2KX4A 1RXPA 8GCHG 2ZGHA 4NA9H 1AMHA 1BHXF 5T1VA 1OWDA 4GPGA 1S6FA 4MLFB 1LO6A 2ZPQA 1EJAA 1MD8A 2A4RA 2ODQA 4YTAA 2RDEA 2UWPA 1DX5M 1UTNA 3F3BA 4CRAA 5EGMA 3ZVBA 2KZ4A 4BAOB 1ZZZA 3PMBB 1QNJA 1GJ7B 1YCPK 2VVCA 5FHTA 3OX7U 4K8YA 2ZGCA 1ESAA 1GMDG 1O3LA 2WV9A 2XW9A 2FI3E 2HLDD 3KL6A 3RP2A 1SBWA 4NGAH 3D23A 1G3DA 1DDJA 1PPBH 1ZPCA 4TWYA 3ZVAA 1MZAA 1SG8B 1DSTA 1TQ7B 2ZDKA 1BOQA 1UTLM 3C1KA 1NY22 2ANWA 3E91A 4NSVA 5HYOA 1H1BA 4YT7H 4FXGH 2TGAA 3W94A 1ZHPA 4AFZA 2Y7ZA 3S9AA 2XC4A 2J98A 9ESTA 3GY5A 2Z9KA 1PPHE 1Z8RA 3NWUA 5AF9H 2BY7X 1TNJA 1GL1A 1C5VA 1YYY1 2BY5X 3L6PA 2ANYA 1O3BA 2G5NA 1WDIA 1YLCA 2FOBA 1VCQA 5IK2D 3HKIB 1EZUC 1O3MA 2WPHS 2FOHA 4AYYB 4ZXYH 1SLWB 2ZNKH 3O8CA 1YPJH 5ESTE 7LPRA 2ZFPH 2HRVA 2NU4E 1WV7H 1D6WA 1B0EA 3RXRA 1DY8A 1XUGA 3WW7A 1O3OA 3AW0A 4CRFA 4Y11E 2H5DA 3CS7A 5E0HA 2ZDLA 4JZFH 1NRQH 3D49H 2CMYA 2F91A 6GCHG 1QR3E 1EOLA 4ISIH 2EY4C 3D62A 3BEIB 1AI8H 2Z9IA 4ZAEA 2TIOA 2BX3A 4FETA 2Z3CA 4A7IB 3FFGA 2IN2A 1UO6A 1UTJA 4RN6A 3RM2H 1HDTH 1C1TA 2Y80A 2IPHA 1LTOA 1HBTH 5EQRA 2J9NA 1CU1A 1PPFE 1W0YH 1LVYA 1C2HA 1VCPA 2O8UA 2FIRH 1H9LB 1GI5A 4Q80A 2ZWLH 1GHWH 1F5KU 3GCHB 1KIGH 1VJAU 4ABIA 1YKTA 1SGCA 4KTUA 1GJ5H 2RG3A 1SLUB 2HNTC 1CA8B 3PB1E 4CRDA 1P2IA 1GBMA 4K69A 4BAQB 1NRPH 1Z71A 3UFAA 1S0QA 2PTCE 1QTFA 3SJ8A 2A7JA 4X6NA 3DFJA 4JZIA 5HIYA 2DUCA 1V3XA 1FN6A 1ZHMA 2EA3A 3B23B 4FOUC 2FM2A 1MQ5A 1NN6A 5DP7A 2A0QB 3VB7A 1GVLA 5EW1H 1CGJE 1YM0A 5EU8A 5CHBA 1J16A 3LJOA 5GCHF 1MABB 1O2SA 1DT2A 1EB2A 1O2OA 1BJVA 1SPJA 2KAIA 3ZVCA 1FMGA 2G55A 5DP5A 1XM1A 1P9UA 2J98B 4BOHA 3VPKA 1C2MA 2BB4A 1S82A 3BTHE 2Q6FA 4B1TA 1Q31A 3ZZ3A 4K8BA 3FP8E 1UTKA 2OC7A 1YP9A 3A85A 2F9UA 1O2VA 2Z3EA 4GCHF 5FBIA 1H8IH 1A4WH 4OGYA 4X2WA 1IQEA 1THRH 2LP6A 2W7UA 1VR1H 2FYRA 1ELAA 2Z3DA 1DWDH 1E1QD 1WTGH 2QY0B 3GDVA 1TNIA 5AVDA 5FL7D 2CGAA 1HIAB 1NESE 4I8LA 2BD2A 3HGNA 2BMGB 1C1MA 1SGYE 1HXEH 1FY4A 1W10U 5KEDA 1CHGA 3SV7A 3F6UH 1EKBB 1A61H 4PROA 1IQHA 2OBQA 3F9GA 1TRNA 1OXGA 5A8YA 4B76A 1K9OE 1C2FA 2JJ1D 2SGFE 5FCRA 1NROH 2WYGA 4K1EA 1ETTH 3RMOH 3QX5H 4WF8A 5PTPA 3QUMP 3ZZ7A 3QDZB 1YLDA 2ZU4A 2PV9B 3PO1B 1DITH 2P94A 3GY6A 3ZVFA 5AFZH 3AASA 3UTUH 1N1LA 5FBEA 1SQOA 1T32A 2FDAA 2CV3A 2FOCA 1V2JT 1HB0B 3U69H 1GHBF 1TGCA 5EQQA 5GXPA 3O8RA 1ELBA 3RXTA 3TGIE 3FN8A 3U1IB 1BHXB 1L0ZA 2W6ID 4IW4E 4ABDA 3LGIA 1GGDC 3T62A 1SGTA 1F92A 1GI4A 3LOXA 1LVMA 1SGDE 1SI5H 3RXFA 2ZO3H 5FPYA 3MO3A 2FEQH 4AB9A 1XKBC 2PKAA 1HNEE 3F0OA 2FLBH 2WV4A 1P12E 4MNWA 4H6TA 1DANH 3UWIA 4Y7BA 4H6SB 2KAIB 2V3OH 4WJG2 1D3QB 3GOVB 1BIOA 1TRMA 5JPMH 2YMSC 2AYWA 2KR7A 3ZVGA 1E1RD 2ZHDA 1LKAA 1FONA 1C4V2 4FUGA 1P09A 4QT8C 5DGJA 3A8CA 2FXRA 1JBUH 2WPKS 1AUJA 4IGDA 3F9HA 4E7RG 2ODYB 2XTTB 4YT6H 3SZNA 1N6XA 2AMQA 2UWOA 1KDQA 3AAUA 2B7DH 1P2OA 1VITF 4YOIA 2UUJB 1PQ7A 2V35A 1UVTH 3RMMH 4JCNA 1EJMA 2ZQ1A 2XNIA 4CHAC 1Z8IB 1Y3UA 4K1TA 1P2MA 3QGNB 2AH4X 3OTPA 1GCDA 4FU9A 3TU7H 1EZXC 3SGQE 1P06A 2ZU1A 2D1JA 1SQAA 1RTKA 4B2AA 6CHAC 2PKSB 2A45B 2JKHA 3BIUH 1S6LA 4NIVA 5EG4A 1FZZA 2GDEH 1O2MA 1GPZA 4XSKU 4OS7A 4MDSA 4YO9A 2BLWA 3F2HA 3F2FA 4LOYH 1O2YA 1O37A 1XMNB 2P8OB 2ZTZA 4JZEH 1ABIH 4HG6A 2BM2A 1N8OC 4AYVB 1AU8A 1KY9A 4I8GA 1CA0C 2VIWA 4U01A 1C5QA 2CN0H 1LHEH 4TWWA 1YPLH 1V2KT 3LGUA 4GHQA 4F55A 1U6QA 1QA0A 5L2ZH 4ABFA 2ZHEH 3RDZA 2BHGA 1NS3A 1DWCH 2P3FH 4B71A 5C94A 1DXPA 2J5UA 1CBWC 1RS0A 3LGTA 3BEFB 4YM9A 1P05A 2A31A 4FUIA 4BAKB 2C8YB 5DN6D 1COWD 1HAZB 3UB0A 3B8JA 1PFXC 3SNEA 1XUKA 2ZF0H 1UMAH 1KTSB 1SLXB 3Q3XA 1SMFE 1AVGH 4D9RA 1HAYB 2XWAA 3RLYH 1IAUA 1G2LA 1E0FD 1HAGE 1O3PB 1XXDA 1TBRH 1W7GH 1MZDA 2ZCHP 2HGTH 1EFRD 1GBFA 4CR5A 2GX4A 3IG6B 4UONA 1ELTA 1T4UH 1Y8TA 1NRRH 1BCUH 1A0JA 1PQ5A 2AGIX 1W7XH 1GL0E 1LHFH 4AOQA 3MQKC 3GCTG 2FWWA 3RXSA 1BBRK 3UY9A 1GCTC 5C17A 3ODFA 4FUHA 2VB0A 2IOTA 5EXNA 1C1QA 2QXIA 1QQUA 1GHYH 2WPLS 4CREA 2H1UA 1MTNB 2QN5T 3NCLA 3F2GA 3FP7E 2F43B 1C5SA 1QBNA 4JK6A 4K60A 4ZHMU 2UUYA 2J95A 4ZKNU 5K0HA 2KFWA 2PHBA 4OS2A 4ACAA 3VB4A 3SU5A 3H7OA 3FAOA 3PWCA 5A2MH 1DUEA 1T8MA 4CR9A 2BD5A 4F48B 4ZHAA 1L1JA 1TE0A 2A5AA 5C1YA 1BB0B 3RXPA 1D3PB 3PYHA 1TX7A 3O8BA 5KGOA 1BTUA 2OC0A 3ZIAD 1CHOF 5CE1A 4FU7A 1TGTA 1O32A 1DWBH 3F0PA 1TAWA 3DCLA 2TGDA 4DOQA 1O5DH 2QGRA 5L2YH 2FMJA 1KXDA 5T6FA 1KXEA 7GCHF 3MOCA 3CS0A 1C5XB 3SGBE 3SU0A 1D9IA 1C2EA 1MH0A 2FTMA 1O2XA 4D8NA 2Q6DA 1L1NA 1Y3YA 3Q3KA 2ALVA 1IHSH 4YESB 5TJXA 3UAIC 1TBZH 1O2TA 3T2NA 2HALA 2C8ZB 1F5LA 4JYUH 1NU7B 1MQ6A 5C1XA 1FY1A 1TGSZ 5A0BA 3PMAB 4HFPB 4XBDA 4IN2A 4NFEA 2HNTF 1V2WT 2BD8A 3RXUA 4OS1A 1QB6A 3BF6H 2ANKH 2J94A 3BIVH 3BG4C 3GY2A 1DWEH 4R8TB 3RXOA 2C93B 1TNHA 2PSYA 3A89A 1TONA 3K9XB 3T28A 1C5LH 1PJPA 1INCA 1GBLA 2FS9A 1NFXA 2UWLA 4UDWH 3E0NB 2Y7XA 4WMFA 1O36A 2J38A 2VIPA 3ZZ9A 5GCHG 2AFQB 3UNQA 1SGIB 2XCNA 1TMUH 5DP4A 2FTLE 3FANA 1CGHA 5E0JA 2PGBB 1C9TA 1Z1JA 1P2NA 1CT0E 1XVMA 1YGCH 3SZEA 3A88A 1Q3XA 1ZJKA 2FOMB 2ZHFH 3PROA 5C5OA 3A8AA 4I33A 1YWUA 5IYTA 1P2JA 3TK5A 3KQDA 1GDUA 1UK2A 3E16B 1BTZA 2HVXA 2ZC9H 1GBTA 4K3JA 1K1MA 1TPAE 3RXCA 3UR9A 1LHGH 2ZU5A 1C5NH 3A7YA 3UUZA 3SV9A 1GG6B 1QFKH 3OTJE 1W13U 3RXHA 2BDBA 2VIVA 3RXVA 4DIHH 2IPQX 1CSOE 5HM9A 3RU4E 5JB9S 1JRSA 1AB9C 1G2MA 2Y5FA 3P6ZB 4FVBA 4Y0ZE 1G3CA 3IWMA 1HJ9A 3SNBA 1C5ZB 2K8IA 3K6YA 4Q4LA 1RFNA 4MVNA 1KXCA 4YLQH 1FY8E 2UUKB 1TMTH 1W11U 3RXDA 1OP0A 2SNWA 1XXFA 2F9BH 1S81A 3M5MA 2GDDA 1EAXA 3LIWA 3PMHB 2PLXA 2Q6GA 5J4QA 1AFQB 1JIRA 3KCGH 1TA2A 2KCOA 1EQ9A 1N6YA 1GI1A 1A0LA 4WMEA 2STBE 4X1QU 5FX5A 3HK3B 3FVFB 2QXHA 1G9IE 1GHBG 1UVOA 3PRBA 1Z8GA 2ZGBH 3GS9A 1AE5A 2EI6A 2GKVE 1C5PA 4ABBA 2CF8H 5FXLA 3UNRA 1O3GA 1J15A 1TPOA 3LC3A 3RXIA 2JH5D 1WU1A 2JH0D 4MNVA 3S9BA 1H8HD 1WBGB 3NUMA 3E3TA 1C2KA 4FUBA 2G5VA 3KEEA 3Q00A 1BRBE 3PTBA 2ZGXH 3H7TA 1CT2E 2QCYA 4INLA 1OWEA 3BTFE 2A2QH 1OS8A 3MH6A 4X1SU 3SN8A 2BVXH 3SI3H 1C1OA 2OUAA 4ZHLU 1K1OA 1UCYK 4AFUA 4I86A 1SQRA 3I78A 1DOJA 1IOEA 1UHBA 1ID5H 3TK9A 3U8OH 3A7TA 1GHVH 1QL7A 1QBVH 1T7CA 2ZFFH 1Q2WA 1MKXK 2BDIA 1O2JA 1XUJA 2VIDA 5B6LA 1P04A 1BITA 1O5GH 1HJ8A 1MTWA 1C2JA 3NXPA 3LU9B 4Y71A 4ISOA 2VH0A 3KHVA 4LZ4B 1OP8A 1WSSH 2F3CE 1VITG 4CBOA 4Y79A 2PP6A 5EXLA 2OQUA 1DXWA 3URDA 1XUFA 5ETXA 3MNBA 3FZDA 5AHGH 1YCPM 5GJ4B 3N7DA 4DT4A 1XX9A 1IQNA 5EIYA 2O8WA 2C4FH 4WH8A 3DD2H 1ANBA 1FXYA 4XBBA 1HYLA 1QJ1B 3TGJE 2G81E 5G4BA 1WAYB 1T4VH 4A1TA 3GICB 1SKYE 2ZGJA 5E2OA 2WHXA 2GD4B 5FCKA 1W0ZU 4I7YH 2ZFQH 1CGIE 1TB6H 5LPFA 2JH6D 1FUJA 2BLQA 1NFUA 1YPMH 4D9QA 2YMSD 4F4OC 4TT3D 2D26C 3BTDE 4OS6A 1GMHG 2PFEA 2Z9LA 2EI7A 4UD9H 3KQEA 1NM6A 1O5CB 2PSXA 2QXGA 3QWCH 1RJXB 2HPQH 5JB8S 1FX0B 4NSYA 5KECA 1V2RT 3PLBA 1HJAB 3LJJA 3TH3H 1ZTKA 1O2PA 1Z7KA 2VWOA 4X6MA 4ASHA 2QYIA 1SFQB 3MNXA 4LZ1H 3BN9A 1EAUA
chains in the Genus database with same CATH topology
5I46H 1BMLA 2CHAC 3QN7A 1P3EA 1TBQH 1V2LT 5HM2A 1NT1A 4AFQA 4XFQA 3SQEE 4DURA 4JZDH 5JYIA 1FIWA 1RTLA 2OQ5A 1IQKA 1CQQA 2VINA 2ZQ2A 2GCTC 2OD3B 4KTSA 1PPEE 1H8DH 2PWXA 1C5OH 3A87A 4XE4A 1GJBB 1GWAA 1O2QA 4HZHA 3RLWH 1TRYA 4X2VA 2GZ9A 3RU4D 5EPNA 2XC0A 1GJAB 1ZHRA 3TJNA 4CRCA 1QL9A 3MH4A 3GY7A 2WINI 2BDYA 4H4FA 1TGBA 2FOFA 2GMTB 2WPIS 1LVBA 1SGQE 5DPAA 2XRCA 1KYNA 1ARBA 1NTPA 1YF4A 2GV7A 1GBJA 3HKJB 3URCA 1C5RA 4UFGH 2ESTE 3M7TA 1WCZA 3RXKA 1EXFA 1V2UT 3M7UA 4BTTB 1P2KA 4YLUA 3SNCA 4NIYA 3D65E 3V0XA 2PTNA 3BV9B 1TIOA 3MYWA 3NZIA 2ASUB 3QK1A 1OWHA 5EXMA 2V0BA 1HAVA 1EASA 4DCDA 3M3TA 3SHAH 3NKKA 4X1NU 1EOJA 2AIQA 2C3SA 4X6OA 1C5TA 3MTYA 3S7KB 1ZMNA 1S83A 1WTHD 5CHAC 1MKWH 1S84A 2BDHA 1K1IA 1FAKH 2FLRH 2VIOA 3EQ0H 1O5FH 5C5NA 1ZLRA 3A7XA 2BXUH 4Q2KA 7GCHG 3SUDA 1ESBA 1GI0A 3PO1C 4X2XA 4JYTA 1UTOA 2O8MA 1EP6A 8ESTE 5SGAE 1EX3A 2ZA5A 5C1UA 3SORA 1GDNA 1Z6EA 3JZ2B 4U2WA 5EOKA 1LPZB 4RSPA 1TMBH 4OGXA 3ZVEA 5CMXH 4CH8B 7ESTE 5C2ZA 2ILNA 2PUQH 1GI6A 3VB5A 8GCHF 2H2ZA 2NWNA 3BTME 3I29A 4Y6DA 1GI8B 1SGEE 1HAIH 1GHZA 1MAXA 1PYTC 1QL8A 2IJOB 1C1SA 3ZZDA 1UTMA 3UOUA 4IBLH 1E34B 5A0AE 3TVJB 4YZUA 5TCCA 1SL3A 1A3EH 4FUJA 2BQ6B 1SGRE 1GMDF 4NFFA 4LK4A 1TWXB 4H42U 3UQVA 2BXTH 1O3JA 2XXLA 1K1PA 2SNVA 2CF9H 4E7NA 4O3TA 3BTKE 2PR3A 3BTEE 1GI2A 2R2MB 1VZQH 4Q7YA 3EA9A 3MMGA 5DJ7A 1C2DA 1KXAA 2ZG0H 1UK3A 1VGCB 3V7TA 3MO9A 1CT4E 3E6PH 1GVZA 4Y10E 5E2PA 1M9UA 5L6NH 1S85A 3A8DA 2UUFB 4FU8A 2Z9GA 3V13A 2ZU2A 1RD3B 1E38B 2FOAA 3LH3A 2RDLA 3SNDA 1HGTH 1SQTA 1LQEA 3MHWU 1DLKB 4IN1A 1OOKB 2ZDAH 1T8LA 5L30H 3QGJA 1YCPH 2QC2A 2AGEX 3P95A 4DVAU 1BRCE 1W8BH 4MPWA 4WY3A 3VXEH 2A32A 4WXIA 1LPGB 2G51A 1O2KA 1IQMA 1O5AB 4B2CA 4CHAB 5I25A 4X1RU 2Z6BD 1Y3XA 2RA3A 3LONA 2BZ6H 4NA8A 6CHAB 4FUEA 2XC5A 1ABJH 4ESTE 3MO6A 4Y7AA 3BTWE 2OINA 3BG8A 3ATLA 5E0GA 2WYJA 4FVDA 5FPTA 2P8OC 1QRXA 3U1JB 1O30A 4JYVH 1YPGH 2VWLA 4VGCC 4KELA 2OXSA 1AZ8A 1L1GA 2O9QA 2FX4A 1QA7A 3VGCC 1N8OB 3B9FH 5GWZA 1V2TT 2BTCE 1CA0B 4AN7A 3G01A 3UR6A 2BOHB 4UE7H 1O38A 1EAWA 1Z6JH 3SJKA 1PPZA 1V2PT 2PKAB 2B0FA 1ZSLA 3RXGA 3P8FA 1OWIA 2HPPH 1C1UH 2F83A 1CBWB 3L33A 4BAHB 1EAIA 4MPUA 3RC6A 3LKWA 2WV5A 2ZHQH 1V2QT 1XUIA 1ZRKA 2A1DB 1QQ4A 4Y8ZA 1GI9B 1T31A 4ZUHA 1ETSH 3SHCH 5HMAA 4WVPE 2YNAA 1V2MT 3SJOA 2F9PA 4AB8A 3V3MA 1SOZA 4X8SH 1D3TB 1AY6H 2NU0E 1EPTA 4A5TS 3EA7A 2BX4A 3SU6A 2A7CA 1K1JA 3RU4T 1MTVA 3MU1A 4CRGA 1KDQB 4JMYA 1BTYA 2BZAA 2C8XB 3M5NA 1C2GA 1QGFA 3M5OA 3TH4H 1YBWA 2W26A 1QRZA 1AVXA 1ELEE 1G3BA 1O3KA 1PPCE 1QRWA 4I32A 1AZZA 4AGJA 1NC6A 2P16A 4WWYA 3A7ZA 1XKAC 1JIMA 4NWLA 1QBOA 2CJIA 2K1QA 1J9CH 3LGYA 1FV9A 1MTNC 1C4U2 1ANEA 4KTCA 1LQDB 5T3HA 4U32A 1BA8B 3TK6A 2RCEA 1ELVA 3P92A 1JOUB 1SC8U 1AKSA 1T8NA 3SQHE 2ZU3A 3PTNA 3VXFH 4UFFH 3ZZBA 1L4DA 3HK6B 5JBBS 3TGKE 4BXWA 1FAXA 3PV4A 1SFIA 5E8EH 1HPGA 3ZZCA 3VEQB 2ALPA 1RIWC 1QJ7B 1TALA 2TRMA 3PLPA 1K28D 1GVKB 2P95A 2F9OA 3QZQA 4UEHH 1IQFA 1MAYA 1JMOH 4ZROA 3MFJA 1GMCF 1HFDA 4LXBH 4TYDA 1H9IE 2M5TA 3ESTA 3A81A 3S69A 2XBXA 4HTCH 5LH8A 4SGBE 2FI5E 2XBVA 2OTVA 1IQLA 1S0RA 4MPVA 1ZMLA 4NIXA 2FPZA 4AZ2B 1UTPA 3T27A 3DT0H 2VNTA 3RM0H 2BY9X 4X0WU 1A1RA 2H9HA 3MI4A 2BDCA 2ZI2H 5DKMA 7KMEH 4ISNA 1PPGE 2AIPA 3R3GB 1FN8A 1ZSKA 1DPOA 5JBCS 1EPTC 3KF2A 1LDTT 3ELAH 2FS8A 1ELCA 4K5ZA 1V6DA 1GHAF 1QURH 4JK5A 4NWKA 1ZR0A 1EUFA 1H9HE 1BBRE 3VFEA 1Y5UT 1G30B 3BG4B 1SLVB 1BRAA 3OSYA 3KNXA 3A80A 2R0KA 1BT7A 2JETC 4UFEH 2SGAA 2VJ1A 1UVSH 1F0TA 4DG4A 1FJSA 2C8WB 4IS5A 5F03A 2A7HA 1ZTLA 2GCHF 1FY3A 3M5LA 2BY6X 5FPSA 3EA8A 2SFAA 1LHDH 5K7RA 5J4SA 3GYLB 3LC5A 4DJZB 3NPSA 1AWFH 3BSQA 1TA6A 1J17T 1BMAA 5C20A 3ZVDA 4GCHG 3QLPH 1Y5AT 4TPYA 1GBAA 4J2YB 1K22H 1O3DA 2GGVB 2P3UB 1RGQA 2OBOA 4X2YA 1MMJN 3ZZ8A 2TGTA 5T6GA 1K21H 1GBIA 1O0DH 3M3SA 1E36B 2QV1A 1DY9A 1HXFH 1GG6C 1MBQA 3E1XB 3AVZA 3RMNH 1TOCB 1L4ZA 1YPEH 1G32B 1WQSA 2V6NA 3MU4A 4Y0YE 4NZLA 2VGCC 4YOJA 1BRUP 3GY4A 1F2SE 4ABGA 1LKBA 3UPEA 2Q1JA 3C27B 1C2IA 1PQ8A 3T26A 4X6PA 2P59A 3M7QA 1SOTA 2ZCLP 4ZKOU 2EI8A 2YOLA 3M61U 3ODDA 4THNH 1TPSA 2VU8E 1AO5A 1SGNE 3DUXH 3K65B 4IMZA 3SO3A 5IDKA 2QF3A 3RXMA 3FZZA 1O2WA 1THPB 1Z8JB 1AWHB 1O3CA 2GT7A 3V12A 1O2NA 2H6MA 3EYDA 4M7GA 3SJIA 3A82A 1LMWB 2BVRH 3SU2A 2A4QA 4ABHA 3U8RH 2AMDA 1VCWA 1D3DB 2P93A 2XCFA 3E8LA 4Q7XA 2OCVB 1O3NA 1TX8A 1LVOA 3GYMA 2O8LA 3F1SB 1TPPA 4MQAA 1OPHB 1Y5BT 2A5KA 3QO6A 4ABAA 2C90B 2R0LA 2TGPZ 3T5FH 4FUCA 2QA9E 3RXLA 3PMJA 1BZXE 1AGJA 4D76A 2ZTYA 3FP6E 3O8DA 2HWLB 1GJDB 4TY6A 1A5HA 2DE8A 5ESBA 4D7FA 1RRKA 1O2RA 1AE8H 5A8ZA 1K1LA 4ZMAH 1NFYA 1TQ0B 1DSUA 4FUDA 4AGKA 3A86A 5FX6A 1CVWH 3GCTF 2AS9A 3ATMA 3SV8A 1O2IA 4D7GA 5GPIB 3Q3YA 1EP5A 3LPRA 2TBSA 2BD4A 2A2XH 1P02A 2GTBA 1YPKH 1EJNA 2QAAA 1SB1H 1GBDA 3SGAE 2A4GA 1BTXA 3EDXB 1TOMH 1ZJDA 3KQBA 3S0NA 6ESTA 4X8UH 3SOSA 2A5IA 3OY6U 4GVUA 5AFYH 5F8XA 1WYKA 8KME2 2VVUA 2EC9H 2O8TA 4X8TH 1GBBA 4A1VA 1PYTD 1XUHA 1HIAA 4OS5A 3RC5A 1HAXB 1BBRH 1P9SA 1TGNA 2OC8A 3PM3A 2FYQA 1FPCH 4WMDA 2I6QA 3F9EA 1EZQA 1IHTH 1DVAH 1V2ST 2ZIQH 3UNSA 1FNIA 1KSNA 3P17H 3A7VA 4DT7B 4DIIH 1EB1H 5F8TA 3LGVA 5F6MA 4MG3A 4Q7ZA 2OP9A 1GJ8B 1DFPA 3S9CA 1WQVH 2J2UA 3GCHC 1C5WB 1FIZA 2FI4E 3ZZAA 1GDQA 1SGFG 2YNBA 2Z7FE 1P03A 4CH2B 1UCYE 4O03A 4RKJB 1HRTH 4I8HA 1YPHC 3SBKA 2BD3A 2G4TA 1C1RA 1DS2E 1C1VH 1HJAC 1C5UA 1FPHH 3BEUA 3TJVA 1F0SA 5FAHA 1KXBA 2HLCA 4X1PU 1ZGVA 2ZDMA 4SGAE 1KLJH 3E0PB 3T25A 3CENA 4HGCA 1C1NA 3Q76A 2GV6A 1UHBB 2ZZUH 1HCGA 1A5IA 2CHAB 3JZ1B 2GP9B 5DP6A 3PLKA 2D8WA 2AMPA 1Y3WA 2G52A 1P3CA 2R3YA 3UREA 1AIXH 2GCTB 2ZDVH 3H5CB 1G3EA 4MPXA 1P57B 3AAVA 2F9NA 1S5SA 3W95A 2ULLA 4MNXA 3RUOA 1HAPH 1O33A 3SUFA 3QTVH 3I77A 2BDAA 2H9TH 2AEIH 1SGPE 1ZPBA 4A6LA 4ABJA 2ZFTA 2ZFRH 4Y76A 1ZTJA 2FP7B 1KXFA 1C1WH 2GMTC 4WH6A 2ZPRA 1GI7B 3M37A 1HV7A 1F7ZA 3Q77A 1ELDE 1O2HA 1E37B 5A8XA 1W14U 2FO9A 3SU1A 4BNRA 4CRBA 3GISB 1BDAA 1MUEB 1K1NA 2ZFSA 1TX6A 5DP9A 4WXVA 3TLOA 3EGKH 2D2DA 1ANCA 1A5GH 2XWBI 1CHOG 1MTSA 3GY8A 3T29A 3K2UA 3MH5A 1SHYA 1C5MD 1KLTA 1O35A 1SSXA 2BD9A 2FOGA 2FODA 1AN1E 2VWNA 3KQCA 4K1SA 4NCYA 1BTHH 1ACBE 4GHTA 4BAMB 5BRRE 1P8VC 5CHAB 1KLIH 1GMCG 1HAHH 3MNSA 3SU3A 4O9VA 1TNLA 5EQSA 1TABE 4I8JA 1PQAA 2FX6A 1BTPA 1O39A 2Z9JA 1T8OA 3SUGA 3QZRA 1GGDB 4A1XA 3LT3A 3WY8A 1MCVA 1NU9A 1MU6B 1NFWA 2ZHWH 2W7SA 3U8TH 2W5EA 1UTQA 1C9PA 2QXJA 1JRTA 3SNAA 1J8AA 1P10A 1O3EA 3RXAA 5EW2H 3A7WA 3M36A 2G8TA 1C2LA 5DG6A 4Z6AH 4AG1A 1DM4B 4Z0KA 1S6HA 5T6DA 1GHAG 5A09A 1TNKA 3F68H 1GJ6A 1P2QA 1G37A 1BTWA 1THSH 3GDSA 1ESTA 3AW1A 2NU1E 1O31A 1C5YB 1OWJA 1O2ZA 4O97A 2ODPA 3A8BA 4XOJA 2P3TB 3ITIA 2XBWA 1OYTH 2GCHG 1ZYOA 1NPMA 2PUXB 2J4IA 1GJ4H 1O3HA 5F8ZA 1OX1A 3KN2A 1FQ3A 2J92A 1MBMA 1VGCC 5LPRA 3ZZ5A 2AGGX 1AUTC 1AFEH 3GCOA 4JZ1A 2NU3E 1UVUH 3UWJH 4I31A 1NRNH 2B9LA 1D6RA 1GJCB 3N7OA 2WUCA 1GBCA 1ETRH 1HAVB 2ZDNA 2G00A 3BTQE 2R3UA 1O3IA 1V2VT 1Z1IA 2ZP0H 5JBAS 2PKSC 1F5RA 1O3AA 2HOBA 3A84A 2J34A 1QCPA 4ZH8A 5JBTA 1UCYH 3TH2H 4IC6A 5EODA 1EATA 1ELFA 2LPRA 1DUAA 2VVVA 4BXSA 2ZKSA 6GCHF 1TFXA 1MKXH 1IQJA 2GZ8A 1UK4A 2ZPSA 5H4IB 1P01A 3IITA 1J14A 1P0SH 3VB6A 1G36A 2ZTXA 2I6SA 2B8OH 1AD8H 4E05H 2A4OA 3UOPA 1ARCA 1HUTH 2QIQA 1BMMH 2SGEE 2RA0A 1A46H 4J1YA 4YOGA 4MTBA 3MU8A 3P8NA 2BY8X 3ATIA 1O2GH 1O5BB 4VGCB 3A83A 1GBKA 1TLDA 1QIXB 5EPYA 3VB3A 1YPHE 3VGCB 1BJUA 4GLYA 1VITH 1ZSJA 4R0IA 1GMHF 4B74A 3STIA 2HNTE 4AX9H 3EAJA 3U9AH 3GDUA 4XBCA 1A0HB 1C4Y2 1BQYA 1W3CA 1EZSC 4FUFA 4DW2U 6LPRA 3P70B 3RXBA 3ZZ6A 3SI4H 5DO4H 4O3UA 1H4WA 1ANDA 5DP8A 2VH6A 2AERH 1OSSA 2BYAX 1GBEA 3SW2B 2R2WU 4ZKRU 4AG2A 4AFSA 1A3BH 3BTGE 3TPIZ 3MNCA 4UFDH 1AVWA 3TNSA 1FI8A 2BLOA 3BTTE 4X8VH 2STAE 1GBHA 2V3HH 2WUBA 3STJA 1V2OT 1O34A 4AORA 1IQGA 3NK8A 2GZ7A 2WPJS 3S7HB 1MTUA 2Y5GA 1GCTB 3R0FA 2BDGA 1QB9A 1F0RA 3E90B 1F0UA 8LPRA 3DHKH 4INHA 4B75A 3ATWA 3SV6A 3OU0A 4IC5A 3ZZ4A 1HAOH 4TY7A 1LPKB 1UJ1A 1JWTA 1X7AC 1NO9H 2XYAA 3P8GA 4Y8YA 1DE7H 1SHHB 1A7SA 3SU4A 1B0FA 4A92A 3SUEA 2SGPE 4B2BA 1GJ9B 2Y82A 4E06H 3RXQA 2VWMA 4F49A