3V12A

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v12A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v12A02
3GCTG 2SNWA 2AIPA 4A92A 2FPZA 2XWAA 1S6FA 1GMHF 1Y5BT 5ESTE 5A2MH 1ZTKA 3SQEE 2Q6FA 2ZHQH 3A81A 4YZUA 1GGDC 2ZHEH 3A7XA 1CBWB 2HNTE 2K1QA 3FP7E 3KF2A 2ANMH 3AAUA 4AGJA 1C4Y2 2FOEA 3RXCA 6GCHF 1W7XH 1N8OC 1KXEA 1VJAU 2PTCE 1V2PT 1DLEA 3UOUA 2GCHG 4TWYA 1XMNB 2BD7A 1RRKA 1BOQA 1ZSKA 5LPRA 2P3FH 3VB7A 1EP5A 5CMXH 3UUZA 1O37A 2HNTC 2FI5E 5DPAA 1KIGH 1AFQB 1EAWA 3CS7A 2FYQA 1YGCH 1WTGH 3GISB 1ANCA 3UQVA 1D6RA 3I77A 2BTCE 3F9FA 2XBVA 1C5TA 2FLRH 1KXAA 3QZRA 1E0FD 1TPAE 3LIWA 5AHGH 3BIUH 1GVKB 2ODYB 2VVUA 4ASHA 3UPEA 1GHWH 1SG8B 4UONA 3IG6B 3TITA 2P95A 1QL8A 1HNEE 2TIOA 4Q7YA 3A8DA 4GVUA 2OTVA 1AFEH 1LVYA 1V2NT 3SU1A 2PGQB 2VIQA 1DUAA 4ZKNU 1ELGA 3B8JA 4OGXA 1Q2WA 1G9IE 2Q6DA 4E7NA 2JH5D 2TGDA 3TJOA 3K6YA 3TH3H 3A8AA 1TB6H 1S0RA 1SGPE 1ELAA 1AB9C 1W10U 1TNGA 2XXLA 1KXFA 1FY1A 2ZA5A 5HYOA 2GZ9A 2QYIA 3RC4A 1G30B 5FCRA 1C1QA 1WV7H 4F49A 1V2UT 3EGKH 3E3TA 1DPOA 4CH2B 4THNH 4I8HA 2PKSC 4IN2A 2ZHDA 3QX5H 1S84A 1V2VT 3LGWA 1O31A 2QC2A 4ABGA 2Q6GA 1MZDA 1NRSH 1FNIA 2D2DA 1CBWC 2PR3A 4OS1A 1O2ZA 4TWWA 4Y0ZE 1KDQB 3HKIB 1P2OA 3WY8A 2XBYA 4ZROA 5GCHF 3UNSA 5A0AE 1AVGH 1RXPA 1B5GH 1GBAA 3LPRA 4YTAA 2AIQA 5FPTA 1O5GH 1C1SA 5GPIB 3F68H 1S6HA 1Y3YA 4X8SH 3PO1B 2KAIA 1ACBE 3A86A 3SU3A 2VGCB 2P3TB 2ZC9H 2YNAA 3RXJA 2I6QA 4MPXA 3LJOA 1AFQC 1UK3A 1IHTH 3UR9A 1JIMA 4DJZB 1YM0A 3MH6A 4KTCA 1OX1A 1UVSH 2V3OH 1SFIA 4X0WU 1G3CA 3UIRA 1YPGH 3GY7A 3U9AH 2QV1A 2M5TA 1PYTD 3TLOA 1WQSA 1C5MD 4INLA 3RXHA 2VNTA 2XRCA 3F9GA 3ELAH 3P70B 3ZZDA 1FN6A 1EJAA 1XUGA 4WY3A 4B74A 2Z9LA 1ABIH 1UTQA 2PGBB 2ZGCA 1DUEA 1GMHG 2HPQH 1XXDA 1T4UH 3OTJE 1F0TA 2PSYA 2RCEA 4ZH8A 2FOCA 1L2EA 4BTTB 1TMBH 3T2NA 2VIVA 1GMDF 1EOJA 2BOHB 2EA3A 1OPHB 1P3EA 3EYDA 1CA0B 1HAHH 4ZXYH 1LVBA 2DE8A 4O3UA 2SGQE 1D4PB 1E34B 3VB4A 2SGFE 3KHVA 3NZIA 3ZV9A 1TPPA 1QBVH 1MTUA 1F0UA 3AVZA 1O2NA 1GBBA 1SGRE 4H6SB 1HXFH 4IN1A 1AE8H 1QCPA 2XCNA 1QB9A 1O2XA 2ANWA 3BTQE 2Y5GA 4FUIA 4MTBA 3M7QA 2ZU3A 3RXRA 3U8OH 4JYTA 1V2ST 1MMJN 3LH1A 4J2YB 1BTWA 1V2TT 1BHXF 2FS8A 1AD8H 2BXUH 1YC0A 3BTME 3K9XB 4TPYA 1G37A 1H9HE 4K1TA 4DIIH 4LZ4B 1GG6C 3BTHE 1F7ZA 5EPNA 4CRCA 2WV5A 1G32B 2VGCC 2VJ1A 4FUDA 3T28A 1EPTB 1T32A 4X6MA 4INHA 5DP5A 4AFUA 4D9QA 1PYTC 4UFEH 4X2XA 3RXMA 4CHAB 1EZXC 2HALA 2Y7XA 1CQQA 2V3HH 1GJ6A 1Y3WA 2GCTB 1UO6A 3AW0A 3JZ1B 1YPKH 2W3IA 1GI6A 4BAQB 1ZRBA 3IITA 4NIYA 1LPGB 1MBMA 3TPIZ 2F9BH 3UFAA 1TABE 3NKKA 3EQ0H 1TLDA 2G00A 1KLIH 1P2NA 3A82A 2PHBA 2ALVA 4R8TB 1P02A 2XTTB 3FP8E 1ESTA 3ZZ7A 1MQ5A 4RKJB 1QRZA 1TONA 5T6FA 1EKBB 2OQUA 2W26A 1XX9A 1GBMA 3RXDA 3A7WA 4MPVA 4TYDA 1GMCG 1FY8E 1OS8A 1QL9A 2ESTE 1L0ZA 1V3XA 1W11U 2BLWA 2XC0A 4Y8YA 5L2ZH 2BDAA 2KAIB 4ZXXH 1P57B 2ODQA 4FUHA 1CGHA 1P3CA 2CXVA 1CU1A 3SU5A 1AZ8A 1NS3A 4J1YA 1CA0C 3P8OA 4D9RA 1C2HA 2IN2A 2SNVA 1BJUA 2A7HA 2GV6A 3A84A 5JPMH 5F03A 3SI4H 2OQ5A 1A7SA 2HPPH 2HOBA 2VWOA 2NU1E 1CGIE 2VU8E 1VZQH 1FN8A 2NU4E 2FOGA 1EAUA 2BY9X 3TGJE 2BQ7B 1TMUH 1BQYA 1DWEH 1O2MA 3TJVA 4A1TA 1GDQA 4JCNA 4YOJA 3O8BA 3GDSA 2QIQA 4AX9H 1OP2A 1LQDB 3HGPA 1P06A 3MMGA 4UFFH 1UTOA 1YKTA 3Q3KA 2G52A 3T25A 2ZTXA 3LONA 1RD3B 4D76A 3NWUA 4JZFH 4NIXA 3TNSA 4INKA 1PQ8A 1NRPH 3LGVA 1QRXA 4DY7B 4FUEA 4B1TA 4IMZA 1MTNC 4ISHH 3SV7A 4Y71A 1P2KA 1BTHH 2V35A 1ZHMA 2GV7A 1T8NA 2ZFQH 3RXOA 4CHAC 1C5WB 3O8CA 2IJOB 2W5EA 2FI3E 1JWTA 3LU9B 1W0ZU 1O2TA 5I46H 1VR1H 2GCTC 1D6WA 1H1BA 3V12A 1BIOA 4B75A 2F9OA 1NT1A 3UR6A 3M3VA 1A5HA 4E06H 1O5BB 1J9CH 4ISOA 1DWDH 1SL3A 3SQHE 1WOFA 2F9UA 5EU8A 5E8EH 2FOMB 1ZTJA 3Q77A 3A7YA 2YOLA 5ETXA 2BD2A 2FOAA 2F9PA 2EI8A 5JB8S 1SI5H 2SGPE 4YT7H 4A7IB 1BZXE 5FAHA 3D49H 3V3MA 2A4GA 1YP9A 4YOIA 4ESTE 2FTMA 2FO9A 1QGFA 1GBLA 5IYTA 4I8KA 3SUEA 3PWBA 2HLCA 5E2OA 5F8XA 3CP7A 5JBCS 2BDHA 2ZCLP 1MD8A 2ZFRH 1BRUP 1C5RA 4VGCB 1TX8A 3F9HA 2V0BA 1DY9A 2WPJS 3KNXA 4HGCA 1V2QT 3TJNA 1SVPA 4X1RU 3OU0A 4Y6DA 1ZHRA 1TNJA 2ZDMA 1OWKA 1C2JA 5B6OA 1BBRE 3U8TH 1V2JT 2ZCKP 1YYY1 2ASUB 3A8BA 4D7FA 3PMAB 1SGFG 1WBGB 3RM2H 3TH2H 1C5PA 2LPRA 3B9FH 5HGGA 1MAYA 1CHOG 3RLYH 4B73A 3NPSA 4B71A 1XVMA 1N6XA 2AFQB 4O9VA 1HYLA 1QR3E 3AAVA 1TWXB 1NM6A 2EI6A 1O3GA 1Y5UT 1MZAA 4Y8XA 1BITA 2J9NA 3P95A 5HXFA 1GHBF 3GYLB 2PSXA 1ESBA 2O8MA 3PV4A 2XW9A 1MTVA 1SGEE 3SJ9A 1OYTH 1ZPCA 4CRGA 1OKXA 3EA7A 5AVDA 1DLKB 1O5AB 3GDUA 2J95A 3SU0A 3OY5U 4CRBA 1GI9B 1UMAH 7ESTE 1FAXA 1LHGH 1LVOA 3QGJA 2XC5A 3P8FA 6LPRA 5C2ZA 1ETSH 2VB0A 1MCVA 1O3IA 4NZLA 2FOHA 1QHRB 1GJ8B 1NFWA 2QAAA 4WH8A 1OYQA 5F6MA 2IOTA 2VH0A 1FDPA 1N8OB 4TPIZ 3DFLA 3EA9A 1DWBH 1H9IE 2BQ6B 3A80A 1BTXA 3RXGA 1SFQB 2CV3A 2GD4B 5A8YA 2BY5X 3RMMH 1BA8B 3ZVAA 1L4DA 1YPEH 2GP9B 1OP8A 1UTNA 4WXIA 2BQWB 2B0FA 3SJ8A 4B76A 3SNBA 1Z7KA 1V2KT 3RU4E 3SU6A 3LDXH 4VGCC 4X2WA 3ZVGA 2GZ8A 1EB1H 1Y3XA 8LPRA 5JBAS 2AYWA 3SNEA 1O3JA 2QCYA 1DVAH 2BVRH 2ZG0H 1IQGA 4DG4A 3RC5A 3URDA 4NIVA 3PTNA 1TBQH 1INCA 3RXEA 1O5CB 1SGFA 5E0GA 5L6NH 1GL0E 3E91A 4B2BA 7GCHG 1C5YB 1PQAA 4AGKA 1GDNA 1HUTH 1ELCA 5A09A 1KTSB 3BN9A 4FUBA 2PUXB 2J94A 1A5GH 1OWDA 1UTLM 5ABWA 5C1XA 1XXFA 3HKJB 1NFYA 4HTCH 4QT8C 1NZQH 2GT7A 1TGBA 4WJG2 1P2JA 2J2UA 2FESH 1RFNA 1SGIB 3SNAA 1SBWA 1XKBC 2XYAA 2QN5T 5AF9H 4JZEH 2BVXH 2ZKSA 3BTDE 2R3YA 5C5OA 1KYNA 1WU1A 4O03A 3A85A 2A4OA 3NXPA 2FYRA 4Y7AA 1ETTH 4UDWH 1SGNE 2WYJA 1TNIA 3MI4A 3OY6U 1TRYA 1MKXK 2ZWLH 1ZTLA 4YO9A 2PKSB 1G3EA 2SGDE 2AS9A 3RXSA 1UCYH 1C5ZB 2OLGA 1O2IA 1ID5H 5BRRE 1V2LT 3ODDA 4BOHA 3A89A 1F5LA 4NWKA 3QK1A 1YPHE 3TK9A 1FV9A 4WVPE 5TCCA 4DURA 1C5NH 3SUFA 2PKAB 2PWXA 1GI8B 1C2EA 2FI4E 1ARCA 2C90B 1HJ9A 2ODPA 3U69H 1AKSA 3A88A 1HLTH 4X1PU 3UQOA 5JYIA 2R0KA 4Y10E 2Z9KA 1OWIA 4JK5A 3T27A 1IQJA 5FPSA 1PPHE 2AEIH 3PB1E 4Q7ZA 4CRDA 2W7SA 1SGCA 2QXGA 3E8LA 1F5RA 1XUHA 1YPHC 3PTBA 1FIWA 2CMYA 2BLOA 1MUEB 1T4VH 2XC4A 3RMOH 4OS2A 4YM9A 4FXGH 2H5CA 2A5IA 2ZO3H 3FZDA 3SJOA 2TGTA 2CF9H 2R9PA 2Z3DA 2ZF0H 4FUFA 1BJVA 4NA9H 1LPKB 3RXTA 1WSSH 3PLBA 1MTWA 3ZVEA 3E90B 3S7KB 3ZZ4A 3KQDA 4BANB 2WUCA 1S85A 5DP7A 1EJNA 1CE5A 2FMJA 4AN7A 1TRNA 2ZTZA 5DP4A 2BM2A 4HZHA 3DHKH 1FY3A 2BB4A 1VGCC 5EW1H 1HRTH 4GCHF 1K1LA 1UJ1A 1FLEE 2FM2A 1AMHA 1SSXA 2ZPQA 2HWLB 1BBRK 2C93B 1O3DA 1BB0B 1Y5AT 2A5KA 5A8ZA 5HM2A 2FODA 2Z3CA 1T31A 3D62A 1QB1A 2OP9A 1XM1A 1A0JA 3I78A 3DUXH 1C1NA 4Y0YE 2R0LA 1O3CA 2BDBA 1J16A 2O8TA 1O30A 3SHAH 3B23B 1AO5A 1K1IA 4F4OC 1ZPZA 4DCDA 3RM0H 2ZHFH 2VWLA 3ZVBA 4K8BA 1ETRH 1W8BH 4I8GA 1ZPBA 4I32A 3BEFB 1HAVA 2Z94A 1DS2E 1SHHB 1BDAA 2H9EH 1KY9A 5EODA 1A2CH 3RXIA 1SLUB 1GI1A 1O38A 3RLWH 2ILNA 4TY7A 2STBE 1MBQA 2BY6X 3EA8A 1THSH 1GHZA 1FY5A 1NY22 1FPCH 1LO6A 1GG6B 1O5FH 4BXSA 4R0IA 3A7VA 1RIWB 2SGAA 2Z9IA 3U98H 1EUFA 1Y59T 1P0SH 1UHBB 3GY3A 1C4V2 2Q1JA 1GHVH 1LPZB 4YOGA 2ZU1A 3IWMA 4Y79A 1L1GA 1YCPM 1A4WH 1GCDA 2BLVA 1PPBH 1QBOA 1L1JA 2ZGXH 2F83A 4ZHLU 1M9UA 1T7CA 4U01A 5K7RA 1AVWA 2QF0A 2CHAB 4ISIH 4X8VH 3FAOA 5E2PA 3UTUH 3Q76A 1SGQE 4ZKOU 4GHQA 3GDVA 2O9QA 1OWJA 1HDTH 1O3MA 4BNRA 2HGTH 2OD3B 3MU4A 1NN6A 3AASA 4MDSA 2BXTH 2J38A 5T6GA 1F92A 1G2MA 2G5VA 2O8WA 2AGIX 1BMLA 2DUCA 3RXPA 3SUGA 3PMJA 3SV6A 3LKWA 2A2XH 2RDLA 4ABEA 6GCHG 4WMFA 5TJXA 4DGJA 1NROH 1P9SA 4IS5A 2HRVA 1GBFA 3SV2H 1VCPA 1DM4B 3M5MA 2JKHA 5TCAA 4Y76A 1UK4A 1AI8H 2TPIZ 1QQUA 2WUBA 1K1JA 1S0QA 2XNIA 1FMGA 2ZU5A 1P10A 4PROA 4MLFB 1C1TA 1D3TB 3V0XA 3T26A 1F0SA 3MNCA 1C2DA 1QJ7B 2V6NA 2BVSH 1CVWH 1TNHA 1SOTA 1MTNB 3KQEA 3Q3XA 1DOJA 2BDYA 3RXUA 4MG3A 5G4BA 1RIWC 2BD8A 1TE0A 4ZAEA 3LGIA 4MVNA 2Y81A 2ZNKH 1TQ7B 5EXLA 3ZZAA 5F8TA 1DT2A 1QBNA 3VB3A 4AB8A 1LKBA 4JYVH 4WF8A 1SGTA 1T8LA 1Q31A 3BG4B 3UWIA 9LPRA 1NFUA 3SO3A 3JZ2B 2VIOA 1SQAA 1NESE 4WMDA 5HM9A 1GJDB 4XBDA 2CHAC 4ABBA 5JDUB 1IAUA 1W13U 2P3UB 3KGPA 2BMGB 1HXEH 2R2MB 3M3TA 1UVOA 1MAXA 1FZZA 3A83A 3P8NA 1JMOH 2ANYA 4DOQA 2QXHA 8KME2 1IQIA 2Y5HA 3M37A 2WPMS 4KP0A 2GTBA 2QXJA 3KIDU 1UK2A 3STJA 1GJBB 4H4FA 1EX3A 1GHAF 5GCHG 2XCFA 3M5NA 2C8YB 1CT4E 1KLTA 1NU7B 1FIZA 4XDEA 3S69A 1MD7A 4JZIA 2ZP0H 1TA6A 1ZR0A 1C5SA 4GPGA 1MU6B 4FU9A 2WPLS 4CH8B 1V2WT 4K2YA 1V2RT 1EZUC 1O3BA 1GJ7B 4X1SU 3U1JB 2C8XB 2FDAA 4FUCA 1K21H 1MQ6A 4NZQA 2J34A 4ABDA 1JRTA 1KXBA 1MKWK 1F2SE 5JBBS 1PPGE 2XBWA 3F9EA 2UUJB 3PM3A 4OS7A 3MU1A 1DY8A 2VH6A 1YF4A 1A0HB 3VXEH 3FANA 2GDDA 3BTTE 1DFPA 5FX5A 1ELDE 2H5DA 1RGQA 2JH6D 2WPIS 3BTFE 3L6PA 4ISLA 3O8RA 2SGEE 3NK8A 1LHDH 3UY9A 3CENA 2W7UA 5C67A 1QFKH 1EXFA 2UWPA 3BG4C 4AORA 3MFJA 3QN7A 3LC5A 4X1NU 1Z8JB 3GY8A 3GY6A 1O5EH 1PFXC 5FX6A 3MH4A 3ZZ9A 1EOLA 2BYAX 1GMDG 1ZGVA 3ESTA 3HPTB 2ZPRA 2BOKA 2OINA 1WQVH 4LOYH 3ENSB 1ELFA 3T5FH 1LHCH 1D3DB 1PJPA 1YCPK 1BT7A 2ANKH 2UUKB 2WINI 4H6TA 1GI0A 3MU8A 4MPUA 1NC6A 4Q2KA 1C9PA 3GCNA 4AYVB 1GJAB 3ZZ5A 1E36B 1TNKA 3SJIA 1C9TA 4AG2A 2A4QA 3L33A 4NSVA 2Y7ZA 3G01A 3QLPH 2VWMA 1LDTT 2P94A 2LNCA 4Y7BA 4DVAU 3R0FA 3M61U 1H8IH 2H6MA 5EXMA 1IQMA 3MNBA 1TGCA 1C2KA 1GI5A 1TAWA 2PFEA 3GCTF 1UTJA 3ZVCA 3S9AA 3KQBA 5FHTA 4ABJA 3A7ZA 1GWAA 2XBXA 4ABIA 1NFXA 1DANH 3A8CA 1K1MA 1BTPA 2A7CA 1GJCB 3M36A 3BIVH 3LJJA 5DK1A 4ZMAH 1X7AC 2VIDA 4AYYB 1Y8TA 2UUFB 4AOQA 4LZ1H 1AIXH 1ZMLA 4ISNA 3SNDA 3S9CA 1EATA 3KL6A 1HFDA 3PMHB 1HIAA 1BRCE 3S9BA 1VJ9U 1XVOA 1ZYOA 2NU0E 3ATWA 2PTNA 2UWOA 4A5TS 3RU4D 5A0BA 3RUOA 1CO7E 4Q80A 3RP2A 3P6ZB 7KMEH 1MU8B 2GZ7A 2TRMA 1QL7A 1ZJKA 4NA7A 2THFB 2SFAA 1K28D 1O2PA 2P59A 1VITF 2A4RA 1IQNA 1TX7A 4SGAE 1NRNH 4XE4A 4A6LA 4K1SA 1AZZA 1CHGA 3PMBB 1YPJH 2ZQ1A 1FI8A 2G4TA 5L2YH 1PQ5A 4GLYA 4I33A 5I25A 3TVJB 4H42U 4JYUH 1TIOA 1C2MA 1WAYB 2J92A 3LGUA 2G55A 1H9LB 1C5LH 1J8AA 1GBIA 5EPYA 3R3GB 4MNWA 1C5QA 2ZI2H 3TJUA 1FPHH 1FJSA 2A31A 2ZFPH 1A61H 3E1XB 5GJ4B 4AFZA 3SHCH 3MH7A 3MO3A 2H9TH 2PLXA 1FAKH 1ZZZA 2OC7A 2QGRA 3HK6B 4K8YA 4IC5A 1HAPH 1O3NA 5C1YA 4NWLA 4OGYA 3RC6A 2P16A 1TOCB 5EGMA 2OCVB 5C20A 1SC8U 2RA3A 1OWEA 1E35B 1EJMA 1IHSH 1S83A 3BTEE 3HK3B 2A32A 5E0JA 3K6ZA 3SNCA 2OXSA 1W2KH 1YPLH 3TH4H 3RXBA 5EQSA 3FVFB 1GI2A 2AMPA 1QJ6B 5EXNA 1DE7H 2ZZUH 3K65B 2GVFA 1EAIA 4X8TH 4I7YH 4MNVA 4O3TA 1L1NA 2Z3EA 5CHAB 2FS9A 1C2GA 1O2WA 3V7TA 1HV7A 1H8DH 3BTWE 3SI3H 1VGCB 3PROA 4KGAA 3GCHC 1HB0B 3Q00A 3TNTA 5AFZH 3QO6A 3VXFH 2GKVE 2BDGA 1BMAA 1AWHB 3OX7U 3BTGE 1O2HA 4JK6A 1KDQA 8ESTE 4K69A 4ZKSU 1P01A 1QA7A 2G81E 2TGAA 2DE9A 1D9IA 1E37B 3GYMA 1P04A 3ZVDA 3LGTA 1SHYA 1UTMA 1BMNH 1MH0A 2QA9E 1C2FA 1GDUA 3GOVB 5A8XA 2ALPA 1B0EA 1HBTH 1C1WH 1O2VA 4OS4A 1QA0A 1ELTA 5EQRA 4ZHAA 2CGAA 1TBZH 1ZJDA 1CA8B 2FWWA 2D1JA 1K2I1 1C5VA 5DG6A 2EI7A 1GJ5H 1O3AA 3NUMA 3RXKA 1O3EA 1TQ0B 3S0NA 4CBNA 1C5XB 1TGSZ 3H7TA 3Q3YA 2UUYA 3STIA 5DP8A 4CRFA 1IQKA 1C1UH 1HIAB 3QDZB 4K5ZA 5EG4A 3SORA 5BPEA 3MNXA 3FFGA 3UOPA 1RTKA 1V2MT 4HI3A 2AERH 4JMYA 3MHWU 3A7TA 4HFPB 2RA0A 1O39A 3A87A 1AE5A 4CRAA 4WMEA 1C5UA 1C2LA 2VIWA 1O2UA 1OSSA 1T8MA 1GBCA 1BRAA 2ZFTA 3KN2A 3C1KA 1O2QA 1VCQA 1GHBG 4RSPA 3BG8A 4X6NA 5EQQA 1JIRA 1A5IA 4XBBA 1PQ7A 1RS0A 1SR5C 1SMFE 5GWZA 1GPZA 2ZIQH 1QY6A 1VITG 5FXLA 5CHAC 1V6DA 1GBKA 1W3CA 2ZDNA 2OUAA 3DFJA 3E16B 4IBLH 4ABFA 1TYNA 1Z71A 3KQCA 2OC0A 4I8LA 1O3OA 3URCA 1HJ8A 1BHXB 2ULLA 3OYPA 9ESTA 1S5SA 1BTUA 1AGJA 1WTHD 1FXYA 3RXFA 1A3EH 2I6SA 4B2CA 4X2VA 1L4ZA 2H1UA 1J15A 1G36A 2WPHS 2W3KA 1D3PB 3QZQA 2PUQH 2Z6BD 3RMLH 3QGNB 3SGBE 1A3BH 1THPB 4X8UH 5A0CA 4NSYA 2F3CE 3BEUA 2QF3A 1Z6JH 1K9OE 1O2GH 3M7UA 3SGQE 1RJXB 2A45B 2HNTF 2FLBH 2FX6A 1LTOA 2P8OB 1EPTA 1SB1H 2OC8A 4NIWA 4NG9H 1W14U 4BTUB 1JXPA 2O8LA 3P8GA 5FCKA 4ZHMU 5SGAE 4WH6A 1OXGA 1TFXA 4U32A 1ZRKA 2YNBA 1MKXH 4FU7A 1QJ1B 3ODFA 1GMCF 1W12U 3SU2A 1OWHA 1P9UA 3U1IB 3SU4A 1JOUB 3SN8A 5C1UA 1F5KU 1SOZA 1TNLA 4K3JA 5LPEA 1UVTH 4LXBH 1TMTH 1XUFA 1O34A 1C1RA 1SPJA 2Y6TA 4BAMB 2ZDLA 2R2WU 4MNYA 1GBHA 2VWNA 3I29A 4ABAA 3EE0B 4OS5A 3W94A 3LOXA 3VEQB 1O0DH 1VITH 1Z8IB 1O3PB 4BAOB 1PPCE 5PTPA 1HCGA 1OOKB 4DIHH 4FVBA 3BV9B 1P8VC 4XSKU 4BXWA 1O2JA 2ZDVH 3E0PB 3VB5A 1J14A 3AW1A 3PWCA 2FZZA 2EC9H 2Y80A 1W7GH 1AKSB 1QB6A 3MH5A 1FONA 4IW4E 4YT6H 1P2MA 1TRMA 2GMTB 3EAJA 1NTPA 1GHXH 3UREA 1QIXB 2B8OH 3EDXB 2JETB 2BD3A 3GICB 2WYGA 1EASA 4ABHA 2WV4A 3HATH 4BAKB 1C1OA 2G4UA 1KXDA 3RXAA 1ARBA 2ZU2A 4SGBE 1Q3XA 1BCUH 1EP6A 1HGTH 1UVPA 1NRRH 3ZYDA 3H7OA 4FUGA 5ESBA 2P8OC 3M3SA 1GBTA 2AGEX 1BBRH 1C5OH 1ZGIA 4ZKRU 2CJIA 4FVDA 3D23A 1DXPA 6ESTA 1SGDE 1HAGE 4FU8A 2ZGBH 1GI7B 1LKAA 1Z8GA 3GY4A 2BY8X 2BX4A 1TPOA 5HMAA 3VB6A 4AG1A 4Z0KA 3BEIB 1B7XB 3FZZA 3TGKE 1K1OA 2BDIA 2EEKA 1TGNA 2TBSA 4KTSA 5LPFA 5GXPA 1LCYA 2OBOA 1TOMH 1A46H 3F6UH 5E0HA 3GCOA 3SBKA 1FQ3A 1VCWA 4MQAA 1HAYB 3T62A 1UCYE 1ORFA 1AQ7A 2BZAA 1LQEA 1Z6EA 4GCHG 2B9LA 1PPZA 4BAHB 2BX3A 4GHTA 3ZV8A 2FIRH 4WXVA 3PO1C 1GBJA 3TK5A 6CHAB 3VGCB 1P05A 4A1VA 1Z1JA 1O32A 4UFDH 3T29A 1OP0A 4CR5A 1HAVB 2FOFA 2BDCA 3L3TA 1EZQA 1DICA 2Y82A 3VFEA 2PW8H 2D8WA 1A1RA 1B0FA 1DSUA 1ABJH 1QRWA 1FY4A 3S7HB 1CHOF 1GVZA 3W95A 1GJ9B 2B5TB 4O97A 2GMTC 1KLJH 4GAWA 1AUTC 2ZFSA 2VVCA 3ATKA 3U8RH 1SLWB 2JETC 2C8ZB 3RU4T 1D3QB 1ESAA 1S82A 1YLCA 1ZSLA 3MNSA 2FX4A 4AFQA 3MU0A 1GVLA 5JBTA 1H4WA 1G3DA 2UWLA 3UNQA 1C4U2 2G51A 1Z8RA 4I31A 3RXLA 1P12E 3QTVH 4X2YA 5GDSH 3HGNA 4E05H 4IMQA 1CT2E 3LGYA 1P09A 1TALA 1ZHPA 4UFGH 7LPRA 1NRQH 1ELBA 3OSYA 1YBWA 3GY5A 4YESB 2F9NA 3BTKE 1WUNH 2FTLE 4D8NA 1SQOA 3LC3A 2GGVB 3LH3A 5H4IB 2BD5A 2C3SA 4MPWA 4NA8A 3TK6A 3SZNA 5FPYA 4AB9A 2BY7X 4CR9A 5GIBA 1DWCH 4DT7B 1SQTA 1GHYH 2ZEBA 1BRBE 1BTZA 3MO9A 5J4QA 1G3BA 1GBDA 2ZECA 1THRH 5F8ZA 2GDEH 3NCLA 4AZ2B 3MTYA 1ZMNA 3ATLA 5DO4H 1O35A 5DP9A 1CSOE 4KTUA 2FP7B 3QWCH 4E7RG 1KXCA 3DT0H 2H9HA 1Y3VA 4MNXA 2XWBI 1MCTA 6CHAC 3O8DA 3VGCC 1P2QA 2B7DH 5EW2H 1EPTC 2Y5FA 3QUMP 2BD4A 2Z9JA 5AFYH 3DA9B 2D26C 4X6OA 2G8TA 4K60A 1QQ4A 4FUJA 3ZZBA 1IOEA 3DD2H 1DDJA 2AGGX 3PYHA 2QY0B 2J4IA 1O3LA 1ZLRA 1SLXB 1GI3A 4K1EA 7GCHF 2WPKS 2ZQ2A 2OC1A 2R3UA 4I8JA 3PLKA 2AMDA 1O2LA 2BZ6H 1ELVA 1BUIA 1C1PA 1KTTB 1YLDA 1K1NA 2FXRA 3ZYEA 1QURH 4M7GA 1O2RA 3ZZ6A 2RG3A 1P03A 4A1XA 3SJKA 3E0NB 1PPEE 3ZZCA 2NWNA 1C2IA 1U6QA 4KKDA 1GBEA 1P2IA 4XOJA 3RDZA 3SUDA 4AFSA 2IPHA 5C3NA 1IQLA 1C1MA 3KEEA 2Z9GA 3PLPA 1UVUH 1QNJA 8GCHF 1V2OT 2QXIA 2ZGHA 1GI4A 2FEQH 5C5NA 1ELEE 1HAZB 2NU3E 1FUJA 3MOCA 1HJAB 5LGOA 4GUXA 4Q7XA 4D7GA 1HAXB 1WCZA 3FP6E 3SW2B 4WWYA 2PV9B 5FBIA 1CGJE 1DX5M 1IQFA 4XFQA 2ZDAH 2O8UA 5DP3A 2ZHWH 1O2YA 2BD9A 2A0QB 3ITIA 3RXQA 5LH8A 3LT3A 2CF8H 4UE7H 2CN0H 4X6PA 5T6DA 4U2WA 1LHEH 2C8WB 4RKOB 4B2AA 5K0HA 1AY6H 4JZ1A 1IQHA 1O3KA 4NGAH 2ZPSA 2ZGJA 4GSOA 5IDKA 2BHGA 1SLVB 1AN1E 3GCHB 1O36A 5DGJA 2GCHF 1NPMA 1JBUH 1TGTA 1J17T 3BSQA 1MKWH 1GCTB 4UEHH 1XKAC 1LHFH 3P17H 3M5LA 1MTSA 1O2OA 2C4FH 2PKAA 2ZFFH 4LK4A 2ZU4A 1YPMH 1Z1IA 2P93A 1AHTH 3D65E 5DJ7A 1GJ4H 3SOSA 3ATIA 3P92A 4CREA 3ATMA 4Z6AH 1GHAG 2ZDKA 3TIUA 4TY6A 1EZSC 4Y8ZA 3MWIU 4YLQH 1Y3UA 2H2ZA 3SV8A 1UCYK 2ZCHP 1RTLA 1TX6A 1EB2A 5DP6A 2VIPA 1LMWB 1NU9A 1ZMJA 4JZDH 5J4SA 3UNRA 3V13A 1ZOMA 4RN6A 4XBCA 1E38B 5CE1A 2VVVA 3SV9A 1DSTA 2BLQA 1O3FA 1ANDA 2OBQA 3SGAE 3N7OA 3ZZ8A 1QTFA 2FOBA 1W0YH 2G5NA 4Y11E 1KSNA 1GGDB 3MU5A 1GL1A 3GY2A 4BTIB 3CS0A 2TGPZ 1YCPH 2HVXA 3MYWA 1HPGA 1ZSJA 1HAOH 2A2QH 4NCYA 5T3HA 2F91A 3RMNH 1TBRH 1SGYE 3M7TA 1HJAC 2STAE 3H5CB 3ZZ3A 1EAXA 2NU2E 3F1SB 1XUJA 1XUIA 3K2UA 1N1LA 5EOKA 1WYKA 3TGIE 1F0RA 4U30A 2Z7FE 4IGDA 1N6YA 1S81A 3M5OA 1CT0E 3VPKA 3RXVA 5L30H 2AMQA 4IC6A 3C27B 1HAIH 1AWFH 1O3HA 3TU7H 3M35A 2GT8A 2A5AA 4YLUA 1AVXA 1DXWA 4DW2U 1G2LA 1GCTC 3KCGH 1PPFE 3ZVFA 4X1QU 2A7JA 1T8OA 1O2KA 1AUJA 1O5DH 1JRSA 1UTKA 4CBOA 1BMMH 1ANEA 1C1VH 3BF6H 4ZUHA 1P11E 1ANBA 1LVMA 1NO9H 1UTPA 1EQ9A 2A1DB 1BTYA 2F9VA 3E6PH 3MO6A 4NFEA 1RTFB 4KELA 1IQEA 1A0LA 1XUKA 1O33A 1AB9B 4OS6A 3UWJH 2VINA 5FBEA 4UD9H 1O2SA 1TPSA 1TA2A 8GCHG 5JB9S 1AU8A 2AH4X 1UHBA 2JH0D 5DKMA 2GX4A 4NFFA 1DITH 3QTOH 1K1PA 1K22H 2ZTYA
chains in the Genus database with same CATH superfamily
3GCTG 2SNWA 2AIPA 4A92A 2FPZA 2XWAA 1S6FA 4FETA 1GMHF 1Y5BT 5ESTE 5A2MH 1ZTKA 3SQEE 2Q6FA 2ZHQH 3A81A 4YZUA 1GGDC 2ZHEH 3A7XA 1CBWB 2HNTE 2K1QA 3FP7E 3KF2A 2ANMH 3AAUA 1K0HA 4AGJA 1C4Y2 2FOEA 3RXCA 6GCHF 1W7XH 1N8OC 1KXEA 3OE7D 1VJAU 2PTCE 1V2PT 1DLEA 3UOUA 2GCHG 4TWYA 1XMNB 2BD7A 1RRKA 1BOQA 1ZSKA 5LPRA 2P3FH 3VB7A 5EIYA 1EP5A 5CMXH 3UUZA 1O37A 2HNTC 2FI5E 5DPAA 1KIGH 1AFQB 1EAWA 3CS7A 2FYQA 1YGCH 1WTGH 3DSPA 3GISB 1ANCA 3UQVA 1D6RA 3I77A 2BTCE 3F9FA 2XBVA 1C5TA 2FLRH 1KXAA 3QZRA 1E0FD 1TPAE 3LIWA 5AHGH 3BIUH 1GVKB 2ODYB 2VVUA 4ASHA 3UPEA 1GHWH 1SG8B 4UONA 3IG6B 3TITA 2P95A 1QL8A 1HNEE 2TIOA 4Q7YA 3A8DA 4GVUA 3W1EA 2OTVA 1AFEH 1LVYA 1V2NT 3SU1A 3N7EA 2PGQB 2VIQA 1DUAA 4ZKNU 1ELGA 3B8JA 4OGXA 1Q2WA 2JIZD 3DSGA 1G9IE 2Q6DA 4E7NA 2JH5D 2TGDA 3TJOA 3K6YA 3TH3H 3A8AA 1TB6H 1S0RA 1SGPE 1ELAA 1AB9C 1W10U 1TNGA 2XXLA 1KXFA 1FY1A 2ZA5A 4OM9A 5HYOA 2GZ9A 2QYIA 3RC4A 1G30B 5FCRA 1C1QA 1WV7H 4F49A 1V2UT 3EGKH 3E3TA 1DPOA 4CH2B 4THNH 4I8HA 2PKSC 4IN2A 2ZHDA 3QX5H 1S84A 1V2VT 3LGWA 1O31A 2QC2A 4ABGA 2Q6GA 1MZDA 1NRSH 1FNIA 2D2DA 1CBWC 2PR3A 4OS1A 1O2ZA 4TWWA 4Y0ZE 1KDQB 3HKIB 1P2OA 3WY8A 2XBYA 4ZROA 5GCHF 3UNSA 5A0AE 1AVGH 1RXPA 1B5GH 1GBAA 3LPRA 4YTAA 3WWFA 2AIQA 5FPTA 1O5GH 1C1SA 5GPIB 3F68H 1S6HA 1Y3YA 4X8SH 3PO1B 2KAIA 1ACBE 3A86A 3SU3A 2VGCB 2P3TB 2ZC9H 2YNAA 3RXJA 2I6QA 4MPXA 3LJOA 1AFQC 1UK3A 1IHTH 3UR9A 1JIMA 4DJZB 1YM0A 3MH6A 4KTCA 1OX1A 1UVSH 2V3OH 1SFIA 4X0WU 1G3CA 3UIRA 1YPGH 3GY7A 3U9AH 1YLNA 2QV1A 2M5TA 1PYTD 3TLOA 1WQSA 1C5MD 4INLA 3RXHA 2VNTA 2XRCA 3UB0A 3F9GA 3ELAH 3P70B 3ZZDA 1FN6A 1EJAA 1XUGA 4WY3A 4B74A 2Z9LA 1ABIH 1UTQA 2PGBB 2ZGCA 1DUEA 1GMHG 2HPQH 1XXDA 1T4UH 3OTJE 1F0TA 5IK2D 2PSYA 2RCEA 4ZH8A 2FOCA 1L2EA 4BTTB 1TMBH 3T2NA 2VIVA 1GMDF 1EOJA 2BOHB 2EA3A 1OPHB 1P3EA 3EYDA 1CA0B 1HAHH 4ZXYH 1LVBA 2DE8A 4O3UA 2SGQE 1D4PB 1E34B 3VB4A 2SGFE 3KHVA 3NZIA 3ZV9A 1TPPA 1QBVH 1MTUA 1F0UA 3AVZA 1O2NA 2KCYA 1GBBA 1SGRE 4H6SB 1HXFH 4IN1A 1AE8H 1QCPA 2XCNA 1QB9A 1O2XA 2ANWA 3BTQE 2KFWA 2Y5GA 4FUIA 4MTBA 3M7QA 2ZU3A 3RXRA 3U8OH 4JYTA 1V2ST 1MMJN 3LH1A 4J2YB 1BTWA 1V2TT 1BHXF 2FS8A 1AD8H 2BXUH 1YC0A 3BTME 3K9XB 4TPYA 1G37A 1H9HE 4K1TA 4DIIH 4LZ4B 2XOKD 1GG6C 3BTHE 1F7ZA 5EPNA 4CRCA 2WV5A 4XD7D 1G32B 2WV9A 2VGCC 2VJ1A 4FUDA 3T28A 1EPTB 1T32A 4X6MA 4INHA 5DP5A 4AFUA 4D9QA 1PYTC 4UFEH 4X2XA 5C0TA 3RXMA 4CHAB 1EZXC 2HALA 4F55A 2KX4A 2Y7XA 1CQQA 2V3HH 1GJ6A 1Y3WA 2GCTB 1UO6A 3AW0A 3JZ1B 1YPKH 2W3IA 1GI6A 4BAQB 1ZRBA 3IITA 2L6OA 4NIYA 1LPGB 1MBMA 3TPIZ 2F9BH 3UFAA 1TABE 3NKKA 3EQ0H 1TLDA 2G00A 1KLIH 1P2NA 3A82A 2PHBA 2ALVA 4R8TB 1P02A 2XTTB 3FP8E 1ESTA 3ZZ7A 1MQ5A 4RKJB 1QRZA 1TONA 5T6FA 1EKBB 2OQUA 2W26A 1XX9A 1GBMA 3RXDA 3A7WA 4MPVA 4TYDA 1GMCG 1FY8E 1OS8A 1QL9A 2ESTE 1L0ZA 1V3XA 1W11U 2BLWA 2XC0A 4Y8YA 5L2ZH 2BDAA 2KAIB 4ZXXH 1P57B 2ODQA 4FUHA 1CGHA 1P3CA 2CXVA 1KMHB 1CU1A 3SU5A 1AZ8A 2KZ4A 1NS3A 4J1YA 1CA0C 3P8OA 2EY4C 4D9RA 1C2HA 2IN2A 2SNVA 1BJUA 2A7HA 2GV6A 3A84A 5JPMH 5F03A 4I86A 3SI4H 2OQ5A 1A7SA 2HPPH 2HOBA 2VWOA 2NU1E 1CGIE 2VU8E 1VZQH 1FN8A 2NU4E 2FOGA 1EAUA 2BY9X 3TGJE 2BQ7B 1TMUH 1BQYA 1DWEH 1O2MA 3TJVA 4A1TA 1GDQA 4JCNA 4YOJA 3O8BA 3GDSA 2QIQA 4AX9H 1OP2A 1LQDB 3HGPA 1P06A 3MMGA 4UFFH 1UTOA 1YKTA 3Q3KA 2G52A 3T25A 2ZTXA 3LONA 1RD3B 4D76A 3NWUA 4JZFH 4NIXA 3TNSA 4INKA 1PQ8A 1NRPH 3LGVA 1QRXA 4DY7B 4FUEA 4B1TA 4IMZA 1MTNC 4ISHH 3SV7A 4Y71A 1P2KA 1BTHH 2V35A 1ZHMA 2GV7A 1T8NA 2ZFQH 3RXOA 4CHAC 1C5WB 3O8CA 2IJOB 2W5EA 2FI3E 1JWTA 3LU9B 1W0ZU 1O2TA 5I46H 1VR1H 2GCTC 1W0KD 1D6WA 1H1BA 3V12A 1BIOA 4B75A 2F9OA 1NT1A 3UR6A 3M3VA 1A5HA 4E06H 1O5BB 1J9CH 4ISOA 1DWDH 1SL3A 3SQHE 1WOFA 2F9UA 5EU8A 5E8EH 5B6LA 2FOMB 1ZTJA 3F2HA 3Q77A 3A7YA 2YOLA 5ETXA 2BD2A 2FOAA 2F9PA 2EI8A 5JB8S 1SI5H 2SGPE 4YT7H 4A7IB 1BZXE 5FAHA 3D49H 3V3MA 2A4GA 1YP9A 4YOIA 4ESTE 2FTMA 2FO9A 1QGFA 1GBLA 4P00A 5C17A 3AK5A 5IYTA 4I8KA 3SUEA 3PWBA 2HLCA 5E2OA 5F8XA 3CP7A 5JBCS 2BDHA 2ZCLP 1MD8A 2ZFRH 1BRUP 1C5RA 4VGCB 1TX8A 3F9HA 2V0BA 1DY9A 2WPJS 3KNXA 4HGCA 1V2QT 3TJNA 1SVPA 4X1RU 4F48B 3OU0A 4Y6DA 1ZHRA 1TNJA 2ZDMA 1OWKA 4B6EA 1C2JA 5B6OA 1BBRE 3U8TH 1V2JT 2ZCKP 1YYY1 2ASUB 3A8BA 4D7FA 3PMAB 1SGFG 1WBGB 3RM2H 3TH2H 1C5PA 2LPRA 3B9FH 5HGGA 1MAYA 1CHOG 3RLYH 4B73A 3NPSA 4B71A 1XVMA 1N6XA 2AFQB 4TSFD 5CDFE 4O9VA 1HYLA 1QR3E 3AAVA 1TWXB 2JJ1D 1NM6A 2EI6A 1O3GA 3FN8A 1Y5UT 1MZAA 4Y8XA 1BITA 2J9NA 2W6ID 3P95A 5HXFA 1GHBF 3GYLB 2PSXA 1ESBA 2O8MA 3PV4A 2XW9A 2WHXA 1MTVA 1SGEE 3SJ9A 1OYTH 1ZPCA 4CRGA 1OKXA 3EA7A 5AVDA 1MABB 1DLKB 1O5AB 3GDUA 2J95A 3SU0A 3OY5U 4CRBA 1GI9B 1UMAH 7ESTE 1FAXA 1LHGH 1LVOA 3QGJA 2XC5A 3P8FA 2XNDD 6LPRA 5C2ZA 1ETSH 2VB0A 1MCVA 1O3IA 4NZLA 2FOHA 1QHRB 1GJ8B 2W6JD 1NFWA 2QAAA 4WH8A 1OYQA 5F6MA 2IOTA 2VH0A 1FDPA 1N8OB 4TPIZ 3DFLA 3EA9A 1DWBH 4P02A 1H9IE 2BQ6B 3A80A 4DT4A 1BTXA 3RXGA 1SFQB 2CV3A 2GD4B 5A8YA 2BY5X 3RMMH 3F2GA 1BA8B 3ZVAA 1L4DA 1YPEH 2GP9B 1OP8A 1UTNA 4WXIA 2BQWB 2B0FA 3SJ8A 4B76A 3SNBA 1Z7KA 1V2KT 3RU4E 3SU6A 3LDXH 4VGCC 4X2WA 3ZVGA 2GZ8A 1EB1H 1Y3XA 8LPRA 5JBAS 2AYWA 3SNEA 1O3JA 2QCYA 1DVAH 2BVRH 2ZG0H 1IQGA 4DG4A 3RC5A 3URDA 4NIVA 3PTNA 1TBQH 1INCA 3RXEA 1O5CB 1SGFA 5E0GA 5L6NH 1GL0E 3E91A 4B2BA 7GCHG 1C5YB 1PQAA 3DCLA 4AGKA 1GDNA 1HUTH 1ELCA 5A09A 1KTSB 3BN9A 4FUBA 2PUXB 2J94A 1A5GH 1OWDA 1UTLM 5ABWA 5C1XA 1XXFA 3HKJB 1NFYA 4HTCH 4QT8C 1NZQH 2GT7A 1TGBA 4WJG2 1P2JA 2J2UA 2FESH 1RFNA 1SGIB 3SNAA 3VG8A 1SBWA 1XKBC 2XYAA 2QN5T 5AF9H 2QF5A 4JZEH 2BVXH 2ZKSA 3BTDE 2R3YA 5C5OA 1KYNA 1WU1A 4O03A 3A85A 2A4OA 3NXPA 2FYRA 3FKSD 4Y7AA 1ETTH 4UDWH 1SGNE 2WYJA 1TNIA 3MI4A 3OY6U 1TRYA 1MKXK 2ZWLH 1ZTLA 4YO9A 2PKSB 1G3EA 5HIZA 2SGDE 2AS9A 3RXSA 1UCYH 1C5ZB 2OLGA 1O2IA 1ID5H 5EJLA 5BRRE 1V2LT 3ODDA 4BOHA 3A89A 1F5LA 4NWKA 3QK1A 1YPHE 3TK9A 1FV9A 4WVPE 5TCCA 4DURA 1C5NH 3WW7A 3SUFA 2PKAB 2PWXA 1GI8B 1C2EA 2FI4E 1ARCA 2C90B 1HJ9A 2ODPA 3U69H 1AKSA 3A88A 1HLTH 4X1PU 3UQOA 5JYIA 2R0KA 4Y10E 3ZIAD 2Z9KA 1OWIA 4JK5A 3T27A 1IQJA 5FPSA 1PPHE 2AEIH 3PB1E 4Q7ZA 4CRDA 2W7SA 1SGCA 2QXGA 3E8LA 1F5RA 1XUHA 1YPHC 3PTBA 1FIWA 2CMYA 2BLOA 1MUEB 1T4VH 2XC4A 3PV5A 3RMOH 4OS2A 4YM9A 4FXGH 2V3MA 2H5CA 2A5IA 2ZO3H 3FZDA 3SJOA 2TGTA 2CF9H 2R9PA 2Z3DA 2ZF0H 4FUFA 1BJVA 4NA9H 1LPKB 1H8ED 3RXTA 1WSSH 3PLBA 1MTWA 3ZVEA 3E90B 3S7KB 3ZZ4A 3KQDA 4BANB 2WUCA 1S85A 5DP7A 1EJNA 1CE5A 2FMJA 4AN7A 1TRNA 2ZTZA 5DP4A 2BM2A 4HZHA 3DHKH 1FY3A 2BB4A 1VGCC 5EW1H 1HRTH 4GCHF 1E1QD 1K1LA 1UJ1A 1FLEE 2FM2A 1AMHA 1SSXA 2ZPQA 2HWLB 1BBRK 1COWD 3DSOA 2C93B 1O3DA 1BB0B 1Y5AT 2A5KA 2J97A 5HM2A 5A8ZA 2FODA 2Z3CA 1T31A 3D62A 1QB1A 2OP9A 1XM1A 1A0JA 3I78A 3DUXH 1C1NA 4Y0YE 2R0LA 1O3CA 2BDBA 1J16A 2O8TA 1O30A 3SHAH 3B23B 1E1RD 1AO5A 1K1IA 4F4OC 1ZPZA 2VBCA 4DCDA 3RM0H 2ZHFH 2VWLA 3ZVBA 4K8BA 1ETRH 1W8BH 4I8GA 1ZPBA 2IJD1 3BEFB 4I32A 1HAVA 2Z94A 1DS2E 1SHHB 1BDAA 2H9EH 1KY9A 5EODA 1A2CH 3RXIA 1SLUB 1GI1A 1O38A 3RLWH 2ILNA 4TY7A 2STBE 1MBQA 2BY6X 3EA8A 1THSH 1GHZA 1FY5A 1NY22 1FPCH 1LO6A 1GG6B 1O5FH 4BXSA 4R0IA 3A7VA 1RIWB 2SGAA 1WDIA 2Z9IA 3U98H 1H8HD 1EUFA 1Y59T 1P0SH 1UHBB 3GY3A 1C4V2 2Q1JA 1GHVH 1LPZB 4YOGA 2ZU1A 3IWMA 4Y79A 1L1GA 1YCPM 1A4WH 1GCDA 2BLVA 1PPBH 1QBOA 1EFRD 1L1JA 5HIYA 2ZGXH 2F83A 4ZHLU 1M9UA 1T7CA 4U01A 5K7RA 1AVWA 2QF0A 2CHAB 4ISIH 4X8VH 3FAOA 5E2PA 3UTUH 3Q76A 1SGQE 4ZKOU 4GHQA 3GDVA 2J5UA 2O9QA 1OWJA 1HDTH 1O3MA 4BNRA 2HGTH 2OD3B 3MU4A 1NN6A 3AASA 4MDSA 2BXTH 2J38A 5T6GA 1F92A 1G2MA 2G5VA 2O8WA 2AGIX 1BMLA 2DUCA 3RXPA 3SUGA 3PMJA 3SV6A 3LKWA 2A2XH 2RDLA 4ABEA 6GCHG 2KCAA 2QE7D 4WMFA 5TJXA 4DGJA 1NROH 1P9SA 4IS5A 2HRVA 1GBFA 3SV2H 1VCPA 1DM4B 3M5MA 2JKHA 5TCAA 4Y76A 1UK4A 1AI8H 2TPIZ 1QQUA 2WUBA 4ACBA 1K1JA 1S0QA 2GJGA 5FL7D 2XNIA 1FMGA 2ZU5A 1P10A 4PROA 4MLFB 1C1TA 1D3TB 3V0XA 3T26A 1F0SA 3MNCA 1C2DA 1QJ7B 2V6NA 4RI0A 2OK5A 5DN6D 2BVSH 2KM0A 1CVWH 1TNHA 1SOTA 3OFND 1MTNB 3KQEA 3Q3XA 1DOJA 1QZ8A 2BDYA 3RXUA 4MG3A 5G4BA 1RIWC 2BD8A 1TE0A 4ZAEA 3LGIA 4ASUD 4MVNA 2Y81A 2ZNKH 1TQ7B 2J98A 5EXLA 3ZZAA 5F8TA 1DT2A 1QBNA 3VB3A 4AB8A 1LKBA 4JYVH 4WF8A 1SGTA 1T8LA 1Q31A 3BG4B 3UWIA 1YY3A 4ACAA 1NFUA 9LPRA 3SO3A 3JZ2B 2VIOA 4XRNA 1SQAA 1NESE 4WMDA 5HM9A 2HLDD 1GJDB 4XBDA 2CHAC 4ABBA 4FOUC 5JDUB 1IAUA 1W13U 2P3UB 3KGPA 2BMGB 1HXEH 2R2MB 3M3TA 1UVOA 5F53A 1MAXA 1FZZA 3A83A 3P8NA 1JMOH 2ANYA 4DOQA 2QXHA 8KME2 1IQIA 2Y5HA 3M37A 2WPMS 4KP0A 4RT1A 3UAIC 2GTBA 3MQKC 2QXJA 3KIDU 4TT3D 1UK2A 3STJA 1GJBB 4H4FA 1EX3A 1GHAF 5GCHG 2XCFA 3M5NA 2C8YB 1CT4E 3N7DA 1KLTA 1NU7B 1FIZA 4XDEA 3S69A 1MD7A 4JZIA 2ZP0H 1TA6A 1ZR0A 1E79D 1C5SA 4GPGA 1MU6B 3U28C 1UW7A 4FU9A 2WPLS 4CH8B 1V2WT 4K2YA 1V2RT 1EZUC 1O3BA 1GJ7B 4X1SU 3U1JB 2C8XB 2FDAA 4FUCA 1NBME 1K21H 1MQ6A 4NZQA 2J34A 4ABDA 4RT0A 1JRTA 1KXBA 1MKWK 1F2SE 5JBBS 4HG6A 1PPGE 2XBWA 3F9EA 2UUJB 2V7QD 3PM3A 4OS7A 3MU1A 1DY8A 2VH6A 1YF4A 1A0HB 3VXEH 3FANA 2GDDA 3BTTE 1DFPA 5FX5A 2HVYB 1ELDE 2H5DA 1RGQA 2JH6D 2WPIS 3BTFE 3L6PA 4ISLA 3O8RA 2SGEE 3NK8A 1LHDH 3UY9A 3CENA 2W7UA 5C67A 1QFKH 1EXFA 2UWPA 2KCPA 3BG4C 4AORA 3MFJA 3QN7A 3LC5A 4X1NU 1Z8JB 3GY8A 3GY6A 1O5EH 1PFXC 5FX6A 3MH4A 3ZZ9A 1EOLA 2BYAX 1GMDG 1ZGVA 3ESTA 3HPTB 2ZPRA 2BOKA 2OINA 1WQVH 4LOYH 3ENSB 1ELFA 3T5FH 1LHCH 3OAAD 1D3DB 1PJPA 1YCPK 1BT7A 2ANKH 2K8IA 2UUKB 2WINI 4H6TA 1GI0A 3MU8A 4MPUA 1NC6A 4Q2KA 1C9PA 3KYFA 3GCNA 4AYVB 1GJAB 3ZZ5A 1E36B 1TNKA 3SJIA 1C9TA 4AG2A 3F2FA 2A4QA 3L33A 4NSVA 2Y7ZA 3G01A 3QLPH 2VWMA 1LDTT 2P94A 2LNCA 4Y7BA 4DVAU 3R0FA 2YMSB 3M61U 1H8IH 2H6MA 5EXMA 4Z1MD 1IQMA 3MNBA 1TGCA 1C2KA 1GI5A 1TAWA 2PFEA 3GCTF 1UTJA 3ZVCA 3S9AA 3KQBA 5FHTA 4ABJA 3A7ZA 1GWAA 2XBXA 4ABIA 1NFXA 2LELA 1DANH 3A8CA 1K1MA 1BTPA 2A7CA 1GJCB 3M36A 3BIVH 3LJJA 2IPQX 5DK1A 4ZMAH 1X7AC 2VIDA 4AYYB 1Y8TA 2UUFB 4AOQA 2RDEA 5GNDA 4LZ1H 1AIXH 2L74A 1ZMLA 4ISNA 3SNDA 3S9CA 1EATA 3KL6A 1HFDA 3PMHB 1HIAA 1BRCE 3S9BA 1VJ9U 1XVOA 1ZYOA 2NU0E 3PRDA 3ATWA 2PTNA 2UWOA 4A5TS 3RU4D 5A0BA 2QF4A 3RUOA 2WSSD 1CO7E 4Q80A 3RP2A 3P6ZB 7KMEH 1MU8B 2GZ7A 2TRMA 1QL7A 1ZJKA 4NA7A 2THFB 2PP6A 1K28D 2SFAA 1O2PA 2P59A 2M2AA 1VITF 2A4RA 1IQNA 1TX7A 4SGAE 1NRNH 4XE4A 4A6LA 4K1SA 1AZZA 1CHGA 3PMBB 1YPJH 2ZQ1A 1FI8A 2G4TA 5L2YH 1PQ5A 4GLYA 4I33A 5I25A 3TVJB 4H42U 3NRLA 4JYUH 1TIOA 1C2MA 1WAYB 2J92A 3LGUA 2G55A 1H9LB 3F3BA 1C5LH 1J8AA 1GBIA 5EPYA 3R3GB 4MNWA 1C5QA 2ZI2H 3TJUA 1FPHH 1FJSA 2A31A 2ZFPH 1A61H 5EJZA 3E1XB 5GJ4B 4AFZA 3SHCH 3MH7A 3MO3A 2H9TH 2PLXA 1FAKH 1ZZZA 2OC7A 2QGRA 3HK6B 4K8YA 4IC5A 1HAPH 1O3NA 5C1YA 4NWLA 4OGYA 3RC6A 2P16A 2YMSC 1TOCB 5EGMA 2OCVB 5C20A 2F4LA 1SC8U 2RA3A 1OWEA 1E35B 1EJMA 1IHSH 1S83A 4AC9A 3BTEE 3HK3B 2A32A 5E0JA 3K6ZA 3SNCA 2OXSA 1W2KH 1YPLH 3TH4H 3RXBA 5EQSA 3FVFB 1GI2A 2AMPA 1QJ6B 5EXNA 1DE7H 2ZZUH 3K65B 2GVFA 1EAIA 4X8TH 4I7YH 4MNVA 4O3TA 1L1NA 2Z3EA 5CHAB 2FS9A 1C2GA 1O2WA 3V7TA 3KQ5A 1HV7A 1H8DH 3BTWE 3SI3H 1VGCB 3PROA 4KGAA 3GCHC 1HB0B 3Q00A 3TNTA 5AFZH 3QO6A 3VXFH 2GKVE 2BDGA 1BMAA 1AWHB 3OX7U 3BTGE 1O2HA 4JK6A 1KDQA 5C94A 8ESTE 4K69A 4ZKSU 1P01A 1QA7A 5KEDA 2G81E 2TGAA 2DE9A 1D9IA 1E37B 3GYMA 1P04A 3ZVDA 3LGTA 1SHYA 1UTMA 1BMNH 1MH0A 2QA9E 1C2FA 1GDUA 3GOVB 5A8XA 2ALPA 1B0EA 1HBTH 1C1WH 1O2VA 4OS4A 1QA0A 1ELTA 5EQRA 4ZHAA 2WPDD 2CGAA 1TBZH 1ZJDA 1CA8B 2FWWA 2D1JA 1K2I1 1C5VA 5DG6A 2EI7A 1GJ5H 1O3AA 3NUMA 3CNRA 3RXKA 1O3EA 1TQ0B 3S0NA 4CBNA 1C5XB 2KR7A 1TGSZ 3H7TA 3Q3YA 2UUYA 3STIA 5DP8A 4CRFA 1IQKA 1C1UH 1HIAB 3QDZB 4K5ZA 5EG4A 3SORA 5BPEA 3MNXA 3FFGA 3UOPA 1RTKA 1V2MT 4HI3A 2AERH 2F43B 3MHWU 3A7TA 4HFPB 2RA0A 4JMYA 1O39A 3A87A 1AE5A 4CRAA 4WMEA 1C5UA 5CHBA 1C2LA 2VIWA 1O2UA 1OSSA 5DSFA 1T8MA 1GBCA 5KECA 1BRAA 2ZFTA 3KN2A 3C1KA 1O2QA 1VCQA 1GHBG 4RSPA 3BG8A 4X6NA 5EQQA 1JIRA 1A5IA 4XBBA 1PQ7A 1RS0A 1SR5C 1SMFE 5GWZA 1GPZA 2ZIQH 1QY6A 1VITG 5FXLA 5CHAC 1V6DA 1GBKA 1W3CA 2ZDNA 2OUAA 3DFJA 3E16B 4IBLH 4ABFA 1TYNA 1Z71A 3KQCA 2OC0A 4I8LA 1O3OA 3URCA 1HJ8A 1BHXB 2ULLA 3OYPA 9ESTA 1S5SA 1BTUA 1AGJA 1WTHD 2WZQA 1FXYA 3F0OA 3RXFA 1A3EH 2I6SA 4B2CA 3EE7A 4X2VA 1L4ZA 2H1UA 1J15A 1G36A 3F0PA 1W0JD 2WPHS 2W3KA 1D3PB 3QZQA 2PUQH 2Z6BD 3RMLH 3QGNB 3SGBE 1A3BH 1THPB 4X8UH 5A0CA 4NSYA 2F3CE 3BEUA 2QF3A 3SZEA 1Z6JH 1K9OE 1O2GH 3M7UA 3SGQE 1RJXB 2A45B 2HNTF 2FLBH 2FX6A 1LTOA 2P8OB 1EPTA 1SB1H 2OC8A 4NIWA 4NG9H 1W14U 4BTUB 1JXPA 2O8LA 3P8GA 5FCKA 4ZHMU 2KCOA 3PRBA 5SGAE 2JJ2D 4WH6A 1OXGA 1TFXA 4U32A 1ZRKA 2YNBA 1MKXH 4FU7A 1QJ1B 3ODFA 1GMCF 1W12U 3SU2A 1OWHA 1P9UA 3U1IB 3SU4A 1JOUB 3SN8A 5C1UA 1F5KU 1SOZA 1TNLA 4K3JA 5LPEA 1UVTH 4LXBH 1TMTH 1XUFA 1O34A 1C1RA 1SPJA 2Y6TA 3FO8D 4BAMB 2ZDLA 2R2WU 4MNYA 1GBHA 2VWNA 3I29A 4ABAA 3EE0B 4OS5A 3W94A 3LOXA 3VEQB 1O0DH 1VITH 1Z8IB 1O3PB 4BAOB 1PPCE 5PTPA 1HCGA 1OOKB 4DIHH 3KYGA 4FVBA 3BV9B 1P8VC 4XSKU 2K0QA 1O2JA 2ZDVH 3E0PB 4BXWA 3VB5A 1J14A 3AW1A 3PWCA 2FZZA 2EC9H 2Y80A 1W7GH 1AKSB 1QB6A 3MH5A 1FONA 4IW4E 4YT6H 1P2MA 1TRMA 2GMTB 3EAJA 3OEHD 1NTPA 1GHXH 3UREA 1QIXB 2B8OH 3EDXB 2JETB 2BD3A 3GICB 2WYGA 5C0UA 1EASA 4ABHA 2WV4A 3HATH 4BAKB 1C1OA 2G4UA 1KXDA 3RXAA 1ARBA 2ZU2A 4Q63A 4SGBE 1Q3XA 1BCUH 1EP6A 3OEED 1HGTH 5T1VA 1UVPA 1NRRH 3ZYDA 3H7OA 4FUGA 5ESBA 2P8OC 3M3SA 1GBTA 2AGEX 1BBRH 1C5OH 1ZGIA 4ZKRU 2CJIA 4FVDA 3D23A 1DXPA 6ESTA 1SGDE 3GS9A 1HAGE 4FU8A 2ZGBH 1GI7B 1LKAA 1Z8GA 3GY4A 2BY8X 2BX4A 1TPOA 5HMAA 3VB6A 4AG1A 4Z0KA 3BEIB 1B7XB 3FZZA 3TGKE 1K1OA 2BDIA 2EEKA 1TGNA 2TBSA 4KTSA 5LPFA 5GXPA 1LCYA 2OBOA 1TOMH 1A46H 3F6UH 5E0HA 1OHHD 3GCOA 3SBKA 2RFKC 1FQ3A 1VCWA 4MQAA 1HAYB 3T62A 1UCYE 1ORFA 1AQ7A 2BZAA 1LQEA 1Z6EA 4GCHG 2B9LA 1PPZA 4BAHB 2BX3A 4GHTA 3ZV8A 2FIRH 4WXVA 3PO1C 1GBJA 3TK5A 6CHAB 3VGCB 1P05A 4A1VA 1Z1JA 1NBMD 1O32A 4UFDH 3T29A 1OP0A 4CR5A 1HAVB 2FOFA 2BDCA 3L3TA 1EZQA 1DICA 2Y82A 3VFEA 2PW8H 2D8WA 1A1RA 1B0FA 1DSUA 1SKYE 1ABJH 2EQNA 1QRWA 1FY4A 3S7HB 1CHOF 1GVZA 4M9FA 3W95A 1GJ9B 2B5TB 4O97A 2GMTC 1KLJH 4GAWA 1AUTC 2ZFSA 2VVCA 3ATKA 3U8RH 1SLWB 2JETC 2C8ZB 3RU4T 3WWBA 1D3QB 1ESAA 1S82A 1YLCA 1ZSLA 3MNSA 2FX4A 4AFQA 3MU0A 1GVLA 5JBTA 1H4WA 1G3DA 2UWLA 3UNQA 1C4U2 2G51A 1SQRA 1Z8RA 4I31A 3RXLA 1P12E 3QTVH 4X2YA 5GDSH 3HGNA 4E05H 4IMQA 1CT2E 3LGYA 1P09A 1TALA 1ZHPA 4UFGH 7LPRA 1NRQH 1ELBA 3OSYA 1YBWA 3GY5A 4YESB 2F9NA 3N99A 3BTKE 1WUNH 2FTLE 4D8NA 1SQOA 3LC3A 2GGVB 3LH3A 5H4IB 2BD5A 2C3SA 4MPWA 4NA8A 3TK6A 3SZNA 5FPYA 4AB9A 2BY7X 4CR9A 5GIBA 1DWCH 4DT7B 1SQTA 1GHYH 2ZEBA 1BRBE 1BTZA 3MO9A 5J4QA 1G3BA 1GBDA 2ZECA 1THRH 5F8ZA 2GDEH 3NCLA 4AZ2B 3MTYA 1ZMNA 3ATLA 2JDID 5DO4H 1O35A 5DP9A 1CSOE 4KTUA 2FP7B 3QWCH 4E7RG 1KXCA 3DT0H 2H9HA 1Y3VA 4MNXA 2XWBI 1MCTA 6CHAC 3O8DA 3VGCC 1P2QA 4Q4LA 2B7DH 5EW2H 1EPTC 2Y5FA 3QUMP 2BD4A 2Z9JA 5AFYH 3DA9B 2D26C 4X6OA 2G8TA 4K60A 1QQ4A 4FUJA 3ZZBA 1IOEA 3DD2H 1DDJA 2AGGX 3PYHA 2QY0B 2J4IA 1O3LA 1ZLRA 1SLXB 1GI3A 4K1EA 7GCHF 2WPKS 2ZQ2A 2OC1A 2R3UA 4I8JA 3PLKA 2AMDA 1O2LA 2BZ6H 1ELVA 1BUIA 1C1PA 1KTTB 1YLDA 1K1NA 2FXRA 3ZYEA 1QURH 1WXRA 4M7GA 1O2RA 3ZZ6A 2J98B 2RG3A 1P03A 4A1XA 3SJKA 3E0NB 1PPEE 3ZZCA 2NWNA 1C2IA 1U6QA 4KKDA 1GBEA 1P2IA 1YWUA 4XOJA 3RDZA 3SUDA 4AFSA 2IPHA 5C3NA 1IQLA 1S6LA 1C1MA 3KEEA 2Z9GA 3PLPA 1UVUH 1QNJA 8GCHF 1V2OT 2QXIA 2ZGHA 1GI4A 2FEQH 5C5NA 1ELEE 1HAZB 2NU3E 1FUJA 3MOCA 1HJAB 5KGOA 5LGOA 4GUXA 4Q7XA 4D7GA 1HAXB 1WCZA 3FP6E 3SW2B 4WWYA 2PV9B 5FBIA 1CGJE 1DX5M 1IQFA 4XFQA 2ZDAH 2O8UA 5DP3A 2ZHWH 1O2YA 2BD9A 2A0QB 3ITIA 3RXQA 5LH8A 3LT3A 2CF8H 2YMSD 4UE7H 2CN0H 4X6PA 5T6DA 4U2WA 1LHEH 2C8WB 4RKOB 4B2AA 1BMFD 5K0HA 1AY6H 4JZ1A 1IQHA 1O3KA 4NGAH 2ZPSA 2ZGJA 4GSOA 5IDKA 2BHGA 1SLVB 1AN1E 3GCHB 1O36A 5DGJA 2GCHF 1NPMA 1JBUH 1TGTA 1J17T 3BSQA 1MKWH 1GCTB 4UEHH 1XKAC 1LHFH 3P17H 3M5LA 1MTSA 1O2OA 2C4FH 2PKAA 2ZFFH 4LK4A 2ZU4A 1YPMH 1Z1IA 2P93A 1AHTH 3D65E 5DJ7A 1GJ4H 3SOSA 3ATIA 4YXWD 3P92A 4CREA 3ATMA 4Z6AH 1GHAG 2ZDKA 3TIUA 4TY6A 1EZSC 4Y8ZA 3MWIU 4YLQH 4B6FA 5EJ1A 1Y3UA 2H2ZA 3SV8A 1UCYK 2ZCHP 1RTLA 1TX6A 1EB2A 5DP6A 2VIPA 1LMWB 1NU9A 1ZMJA 4JZDH 5J4SA 3UNRA 2AHME 3V13A 1ZOMA 4RN6A 4XBCA 1E38B 5CE1A 2VVVA 3SV9A 1DSTA 2BLQA 1O3FA 1ANDA 2OBQA 3SGAE 3N7OA 3ZZ8A 1QTFA 2FOBA 4ZCNA 1W0YH 2G5NA 4Y11E 1KSNA 1GGDB 3MU5A 1GL1A 3GY2A 4BTIB 3CS0A 2TGPZ 3H09A 1YCPH 2HVXA 3MYWA 1HPGA 3OTPA 1ZSJA 1HAOH 2A2QH 4NCYA 5T3HA 2F91A 3RMNH 3SYJA 1TBRH 1SGYE 3M7TA 1HJAC 2STAE 3H5CB 3ZZ3A 1EAXA 2NU2E 3F1SB 1XUJA 1XUIA 2LP6A 3K2UA 1N1LA 5EOKA 1WYKA 3TGIE 1F0RA 4U30A 2Z7FE 4IGDA 1N6YA 1S81A 3M5OA 1CT0E 3VPKA 3RXVA 5L30H 2AMQA 4IC6A 3C27B 1HAIH 1AWFH 1O3HA 3TU7H 3M35A 2GT8A 2A5AA 4YLUA 1AVXA 1DXWA 3FOAA 4DW2U 1G2LA 1GCTC 3KCGH 1PPFE 3ZVFA 4X1QU 2A7JA 1T8OA 1O2KA 1AUJA 5HKKD 3PV2A 1O5DH 1JRSA 1UTKA 4CBOA 1BMMH 1ANEA 1C1VH 3BF6H 4ZUHA 1P11E 1VKYA 1ANBA 1LVMA 1NO9H 1UTPA 1EQ9A 2A1DB 1FX0B 1BTYA 2F9VA 3E6PH 3MO6A 4NFEA 1RTFB 4KELA 1IQEA 1A0LA 1XUKA 1O33A 1AB9B 4OS6A 3UWJH 2VINA 5FBEA 4UD9H 1O2SA 1TPSA 1TA2A 8GCHG 5JB9S 1AU8A 2AH4X 1UHBA 2JH0D 5DKMA 2CK3D 2GX4A 4NFFA 1DITH 3QTOH 1K1PA 1K22H 2ZTYA
chains in the Genus database with same CATH topology
3GCTG 2SNWA 2AIPA 4A92A 2FPZA 2XWAA 1S6FA 1GMHF 1Y5BT 5ESTE 5A2MH 1ZTKA 3SQEE 2Q6FA 2ZHQH 3A81A 4YZUA 1GGDC 2ZHEH 3A7XA 1CBWB 2HNTE 2K1QA 3FP7E 3KF2A 2ANMH 3AAUA 4AGJA 1C4Y2 2FOEA 3RXCA 6GCHF 1W7XH 1N8OC 1KXEA 1VJAU 2PTCE 1V2PT 1DLEA 3UOUA 2GCHG 4TWYA 1XMNB 2BD7A 1RRKA 1BOQA 1ZSKA 5LPRA 2P3FH 3VB7A 1EP5A 5CMXH 3UUZA 1O37A 2HNTC 2FI5E 5DPAA 1KIGH 1AFQB 1EAWA 3CS7A 2FYQA 1YGCH 1WTGH 3GISB 1ANCA 3UQVA 1D6RA 3I77A 2BTCE 3F9FA 2XBVA 1C5TA 2FLRH 1KXAA 3QZRA 1E0FD 1TPAE 3LIWA 5AHGH 3BIUH 1GVKB 2ODYB 2VVUA 4ASHA 3UPEA 1GHWH 1SG8B 4UONA 3IG6B 3TITA 2P95A 1QL8A 1HNEE 2TIOA 4Q7YA 3A8DA 4GVUA 2OTVA 1AFEH 1LVYA 1V2NT 3SU1A 2PGQB 2VIQA 1DUAA 4ZKNU 1ELGA 3B8JA 4OGXA 1Q2WA 1G9IE 2Q6DA 4E7NA 2JH5D 2TGDA 3TJOA 3K6YA 3TH3H 3A8AA 1TB6H 1S0RA 1SGPE 1ELAA 1AB9C 1W10U 1TNGA 2XXLA 1KXFA 1FY1A 2ZA5A 5HYOA 2GZ9A 2QYIA 3RC4A 1G30B 5FCRA 1C1QA 1WV7H 4F49A 1V2UT 3EGKH 3E3TA 1DPOA 4CH2B 4THNH 4I8HA 2PKSC 4IN2A 2ZHDA 3QX5H 1S84A 1V2VT 3LGWA 1O31A 2QC2A 4ABGA 2Q6GA 1MZDA 1NRSH 1FNIA 2D2DA 1CBWC 2PR3A 4OS1A 1O2ZA 4TWWA 4Y0ZE 1KDQB 3HKIB 1P2OA 3WY8A 2XBYA 4ZROA 5GCHF 3UNSA 5A0AE 1AVGH 1RXPA 1B5GH 1GBAA 3LPRA 4YTAA 2AIQA 5FPTA 1O5GH 1C1SA 5GPIB 3F68H 1S6HA 1Y3YA 4X8SH 3PO1B 2KAIA 1ACBE 3A86A 3SU3A 2VGCB 2P3TB 2ZC9H 2YNAA 3RXJA 2I6QA 4MPXA 3LJOA 1AFQC 1UK3A 1IHTH 3UR9A 1JIMA 4DJZB 1YM0A 3MH6A 4KTCA 1OX1A 1UVSH 2V3OH 1SFIA 4X0WU 1G3CA 3UIRA 1YPGH 3GY7A 3U9AH 2QV1A 2M5TA 1PYTD 3TLOA 1WQSA 1C5MD 4INLA 3RXHA 2VNTA 2XRCA 3F9GA 3ELAH 3P70B 3ZZDA 1FN6A 1EJAA 1XUGA 4WY3A 4B74A 2Z9LA 1ABIH 1UTQA 2PGBB 2ZGCA 1DUEA 1GMHG 2HPQH 1XXDA 1T4UH 3OTJE 1F0TA 2PSYA 2RCEA 4ZH8A 2FOCA 1L2EA 4BTTB 1TMBH 3T2NA 2VIVA 1GMDF 1EOJA 2BOHB 2EA3A 1OPHB 1P3EA 3EYDA 1CA0B 1HAHH 4ZXYH 1LVBA 2DE8A 4O3UA 2SGQE 1D4PB 1E34B 3VB4A 2SGFE 3KHVA 3NZIA 3ZV9A 1TPPA 1QBVH 1MTUA 1F0UA 3AVZA 1O2NA 1GBBA 1SGRE 4H6SB 1HXFH 4IN1A 1AE8H 1QCPA 2XCNA 1QB9A 1O2XA 2ANWA 3BTQE 2Y5GA 4FUIA 4MTBA 3M7QA 2ZU3A 3RXRA 3U8OH 4JYTA 1V2ST 1MMJN 3LH1A 4J2YB 1BTWA 1V2TT 1BHXF 2FS8A 1AD8H 2BXUH 1YC0A 3BTME 3K9XB 4TPYA 1G37A 1H9HE 4K1TA 4DIIH 4LZ4B 1GG6C 3BTHE 1F7ZA 5EPNA 4CRCA 2WV5A 1G32B 2VGCC 2VJ1A 4FUDA 3T28A 1EPTB 1T32A 4X6MA 4INHA 5DP5A 4AFUA 4D9QA 1PYTC 4UFEH 4X2XA 3RXMA 4CHAB 1EZXC 2HALA 2Y7XA 1CQQA 2V3HH 1GJ6A 1Y3WA 2GCTB 1UO6A 3AW0A 3JZ1B 1YPKH 2W3IA 1GI6A 4BAQB 1ZRBA 3IITA 4NIYA 1LPGB 1MBMA 3TPIZ 2F9BH 3UFAA 1TABE 3NKKA 3EQ0H 1TLDA 2G00A 1KLIH 1P2NA 3A82A 2PHBA 2ALVA 4R8TB 1P02A 2XTTB 3FP8E 1ESTA 3ZZ7A 1MQ5A 4RKJB 1QRZA 1TONA 5T6FA 1EKBB 2OQUA 2W26A 1XX9A 1GBMA 3RXDA 3A7WA 4MPVA 4TYDA 1GMCG 1FY8E 1OS8A 1QL9A 2ESTE 1L0ZA 1V3XA 1W11U 2BLWA 2XC0A 4Y8YA 5L2ZH 2BDAA 2KAIB 4ZXXH 1P57B 2ODQA 4FUHA 1CGHA 1P3CA 2CXVA 1CU1A 3SU5A 1AZ8A 1NS3A 4J1YA 1CA0C 3P8OA 4D9RA 1C2HA 2IN2A 2SNVA 1BJUA 2A7HA 2GV6A 3A84A 5JPMH 5F03A 3SI4H 2OQ5A 1A7SA 2HPPH 2HOBA 2VWOA 2NU1E 1CGIE 2VU8E 1VZQH 1FN8A 2NU4E 2FOGA 1EAUA 2BY9X 3TGJE 2BQ7B 1TMUH 1BQYA 1DWEH 1O2MA 3TJVA 4A1TA 1GDQA 4JCNA 4YOJA 3O8BA 3GDSA 2QIQA 4AX9H 1OP2A 1LQDB 3HGPA 1P06A 3MMGA 4UFFH 1UTOA 1YKTA 3Q3KA 2G52A 3T25A 2ZTXA 3LONA 1RD3B 4D76A 3NWUA 4JZFH 4NIXA 3TNSA 4INKA 1PQ8A 1NRPH 3LGVA 1QRXA 4DY7B 4FUEA 4B1TA 4IMZA 1MTNC 4ISHH 3SV7A 4Y71A 1P2KA 1BTHH 2V35A 1ZHMA 2GV7A 1T8NA 2ZFQH 3RXOA 4CHAC 1C5WB 3O8CA 2IJOB 2W5EA 2FI3E 1JWTA 3LU9B 1W0ZU 1O2TA 5I46H 1VR1H 2GCTC 1D6WA 1H1BA 3V12A 1BIOA 4B75A 2F9OA 1NT1A 3UR6A 3M3VA 1A5HA 4E06H 1O5BB 1J9CH 4ISOA 1DWDH 1SL3A 3SQHE 1WOFA 2F9UA 5EU8A 5E8EH 2FOMB 1ZTJA 3Q77A 3A7YA 2YOLA 5ETXA 2BD2A 2FOAA 2F9PA 2EI8A 5JB8S 1SI5H 2SGPE 4YT7H 4A7IB 1BZXE 5FAHA 3D49H 3V3MA 2A4GA 1YP9A 4YOIA 4ESTE 2FTMA 2FO9A 1QGFA 1GBLA 5IYTA 4I8KA 3SUEA 3PWBA 2HLCA 5E2OA 5F8XA 3CP7A 5JBCS 2BDHA 2ZCLP 1MD8A 2ZFRH 1BRUP 1C5RA 4VGCB 1TX8A 3F9HA 2V0BA 1DY9A 2WPJS 3KNXA 4HGCA 1V2QT 3TJNA 1SVPA 4X1RU 3OU0A 4Y6DA 1ZHRA 1TNJA 2ZDMA 1OWKA 1C2JA 5B6OA 1BBRE 3U8TH 1V2JT 2ZCKP 1YYY1 2ASUB 3A8BA 4D7FA 3PMAB 1SGFG 1WBGB 3RM2H 3TH2H 1C5PA 2LPRA 3B9FH 5HGGA 1MAYA 1CHOG 3RLYH 4B73A 3NPSA 4B71A 1XVMA 1N6XA 2AFQB 4O9VA 1HYLA 1QR3E 3AAVA 1TWXB 1NM6A 2EI6A 1O3GA 1Y5UT 1MZAA 4Y8XA 1BITA 2J9NA 3P95A 5HXFA 1GHBF 3GYLB 2PSXA 1ESBA 2O8MA 3PV4A 2XW9A 1MTVA 1SGEE 3SJ9A 1OYTH 1ZPCA 4CRGA 1OKXA 3EA7A 5AVDA 1DLKB 1O5AB 3GDUA 2J95A 3SU0A 3OY5U 4CRBA 1GI9B 1UMAH 7ESTE 1FAXA 1LHGH 1LVOA 3QGJA 2XC5A 3P8FA 6LPRA 5C2ZA 1ETSH 2VB0A 1MCVA 1O3IA 4NZLA 2FOHA 1QHRB 1GJ8B 1NFWA 2QAAA 4WH8A 1OYQA 5F6MA 2IOTA 2VH0A 1FDPA 1N8OB 4TPIZ 3DFLA 3EA9A 1DWBH 1H9IE 2BQ6B 3A80A 1BTXA 3RXGA 1SFQB 2CV3A 2GD4B 5A8YA 2BY5X 3RMMH 1BA8B 3ZVAA 1L4DA 1YPEH 2GP9B 1OP8A 1UTNA 4WXIA 2BQWB 2B0FA 3SJ8A 4B76A 3SNBA 1Z7KA 1V2KT 3RU4E 3SU6A 3LDXH 4VGCC 4X2WA 3ZVGA 2GZ8A 1EB1H 1Y3XA 8LPRA 5JBAS 2AYWA 3SNEA 1O3JA 2QCYA 1DVAH 2BVRH 2ZG0H 1IQGA 4DG4A 3RC5A 3URDA 4NIVA 3PTNA 1TBQH 1INCA 3RXEA 1O5CB 1SGFA 5E0GA 5L6NH 1GL0E 3E91A 4B2BA 7GCHG 1C5YB 1PQAA 4AGKA 1GDNA 1HUTH 1ELCA 5A09A 1KTSB 3BN9A 4FUBA 2PUXB 2J94A 1A5GH 1OWDA 1UTLM 5ABWA 5C1XA 1XXFA 3HKJB 1NFYA 4HTCH 4QT8C 1NZQH 2GT7A 1TGBA 4WJG2 1P2JA 2J2UA 2FESH 1RFNA 1SGIB 3SNAA 1SBWA 1XKBC 2XYAA 2QN5T 5AF9H 4JZEH 2BVXH 2ZKSA 3BTDE 2R3YA 5C5OA 1KYNA 1WU1A 4O03A 3A85A 2A4OA 3NXPA 2FYRA 4Y7AA 1ETTH 4UDWH 1SGNE 2WYJA 1TNIA 3MI4A 3OY6U 1TRYA 1MKXK 2ZWLH 1ZTLA 4YO9A 2PKSB 1G3EA 2SGDE 2AS9A 3RXSA 1UCYH 1C5ZB 2OLGA 1O2IA 1ID5H 5BRRE 1V2LT 3ODDA 4BOHA 3A89A 1F5LA 4NWKA 3QK1A 1YPHE 3TK9A 1FV9A 4WVPE 5TCCA 4DURA 1C5NH 3SUFA 2PKAB 2PWXA 1GI8B 1C2EA 2FI4E 1ARCA 2C90B 1HJ9A 2ODPA 3U69H 1AKSA 3A88A 1HLTH 4X1PU 3UQOA 5JYIA 2R0KA 4Y10E 2Z9KA 1OWIA 4JK5A 3T27A 1IQJA 5FPSA 1PPHE 2AEIH 3PB1E 4Q7ZA 4CRDA 2W7SA 1SGCA 2QXGA 3E8LA 1F5RA 1XUHA 1YPHC 3PTBA 1FIWA 2CMYA 2BLOA 1MUEB 1T4VH 2XC4A 3RMOH 4OS2A 4YM9A 4FXGH 2H5CA 2A5IA 2ZO3H 3FZDA 3SJOA 2TGTA 2CF9H 2R9PA 2Z3DA 2ZF0H 4FUFA 1BJVA 4NA9H 1LPKB 3RXTA 1WSSH 3PLBA 1MTWA 3ZVEA 3E90B 3S7KB 3ZZ4A 3KQDA 4BANB 2WUCA 1S85A 5DP7A 1EJNA 1CE5A 2FMJA 4AN7A 1TRNA 2ZTZA 5DP4A 2BM2A 4HZHA 3DHKH 1FY3A 2BB4A 1VGCC 5EW1H 1HRTH 4GCHF 1K1LA 1UJ1A 1FLEE 2FM2A 1AMHA 1SSXA 2ZPQA 2HWLB 1BBRK 2C93B 1O3DA 1BB0B 1Y5AT 2A5KA 5A8ZA 5HM2A 2FODA 2Z3CA 1T31A 3D62A 1QB1A 2OP9A 1XM1A 1A0JA 3I78A 3DUXH 1C1NA 4Y0YE 2R0LA 1O3CA 2BDBA 1J16A 2O8TA 1O30A 3SHAH 3B23B 1AO5A 1K1IA 4F4OC 1ZPZA 4DCDA 3RM0H 2ZHFH 2VWLA 3ZVBA 4K8BA 1ETRH 1W8BH 4I8GA 1ZPBA 4I32A 3BEFB 1HAVA 2Z94A 1DS2E 1SHHB 1BDAA 2H9EH 1KY9A 5EODA 1A2CH 3RXIA 1SLUB 1GI1A 1O38A 3RLWH 2ILNA 4TY7A 2STBE 1MBQA 2BY6X 3EA8A 1THSH 1GHZA 1FY5A 1NY22 1FPCH 1LO6A 1GG6B 1O5FH 4BXSA 4R0IA 3A7VA 1RIWB 2SGAA 2Z9IA 3U98H 1EUFA 1Y59T 1P0SH 1UHBB 3GY3A 1C4V2 2Q1JA 1GHVH 1LPZB 4YOGA 2ZU1A 3IWMA 4Y79A 1L1GA 1YCPM 1A4WH 1GCDA 2BLVA 1PPBH 1QBOA 1L1JA 2ZGXH 2F83A 4ZHLU 1M9UA 1T7CA 4U01A 5K7RA 1AVWA 2QF0A 2CHAB 4ISIH 4X8VH 3FAOA 5E2PA 3UTUH 3Q76A 1SGQE 4ZKOU 4GHQA 3GDVA 2O9QA 1OWJA 1HDTH 1O3MA 4BNRA 2HGTH 2OD3B 3MU4A 1NN6A 3AASA 4MDSA 2BXTH 2J38A 5T6GA 1F92A 1G2MA 2G5VA 2O8WA 2AGIX 1BMLA 2DUCA 3RXPA 3SUGA 3PMJA 3SV6A 3LKWA 2A2XH 2RDLA 4ABEA 6GCHG 4WMFA 5TJXA 4DGJA 1NROH 1P9SA 4IS5A 2HRVA 1GBFA 3SV2H 1VCPA 1DM4B 3M5MA 2JKHA 5TCAA 4Y76A 1UK4A 1AI8H 2TPIZ 1QQUA 2WUBA 1K1JA 1S0QA 2XNIA 1FMGA 2ZU5A 1P10A 4PROA 4MLFB 1C1TA 1D3TB 3V0XA 3T26A 1F0SA 3MNCA 1C2DA 1QJ7B 2V6NA 2BVSH 1CVWH 1TNHA 1SOTA 1MTNB 3KQEA 3Q3XA 1DOJA 2BDYA 3RXUA 4MG3A 5G4BA 1RIWC 2BD8A 1TE0A 4ZAEA 3LGIA 4MVNA 2Y81A 2ZNKH 1TQ7B 5EXLA 3ZZAA 5F8TA 1DT2A 1QBNA 3VB3A 4AB8A 1LKBA 4JYVH 4WF8A 1SGTA 1T8LA 1Q31A 3BG4B 3UWIA 9LPRA 1NFUA 3SO3A 3JZ2B 2VIOA 1SQAA 1NESE 4WMDA 5HM9A 1GJDB 4XBDA 2CHAC 4ABBA 5JDUB 1IAUA 1W13U 2P3UB 3KGPA 2BMGB 1HXEH 2R2MB 3M3TA 1UVOA 1MAXA 1FZZA 3A83A 3P8NA 1JMOH 2ANYA 4DOQA 2QXHA 8KME2 1IQIA 2Y5HA 3M37A 2WPMS 4KP0A 2GTBA 2QXJA 3KIDU 1UK2A 3STJA 1GJBB 4H4FA 1EX3A 1GHAF 5GCHG 2XCFA 3M5NA 2C8YB 1CT4E 1KLTA 1NU7B 1FIZA 4XDEA 3S69A 1MD7A 4JZIA 2ZP0H 1TA6A 1ZR0A 1C5SA 4GPGA 1MU6B 4FU9A 2WPLS 4CH8B 1V2WT 4K2YA 1V2RT 1EZUC