2BY6X

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by6X01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by6X02
4I8HA 3LJJA 1BTWA 2ZPQA 3GY3A 4IS5A 1M9UA 2C8WB 1JOUB 1HBTH 1UTQA 1FDPA 1BBRE 1GJAB 2WPJS 1G2LA 4H42U 4Z6AH 4O03A 1YC0A 4NIXA 3UNQA 3EA7A 2UWPA 3IITA 1OWIA 2BD5A 3TITA 2ZDVH 4M7GA 1TOMH 2F9NA 4AGKA 2BTCE 1UHBA 3ZZ8A 2A1DB 5GIBA 1SC8U 1HIAA 1SB1H 2GT8A 4JZIA 4IGDA 1S6FA 1EX3A 3TGKE 3F68H 2F83A 4ASHA 5HM9A 1GGDB 5I46H 3F9GA 2AFQB 1EUFA 1KXDA 1N8OC 1ZSKA 1PPEE 3U8OH 1TGTA 4PROA 1Z6JH 2C93B 5TCAA 2Q6GA 1O3CA 1ZTKA 1F92A 1Z1IA 3GYMA 1RJXB 1BJVA 1TGSZ 2ZGJA 2Y80A 3UNSA 2ZFRH 5C1UA 1NESE 4XBCA 2Z9IA 4CRBA 4NIVA 2AMPA 2BD3A 3BTTE 3EGKH 2HRVA 2ZTZA 1UCYH 8LPRA 1BT7A 1PYTC 3SOSA 4ABAA 1A61H 4BXSA 3SJIA 1GHBG 3P8FA 4GUXA 3TPIZ 3AW0A 1DWBH 1SBWA 3H7OA 1LVOA 1K21H 3MO3A 3P92A 2FOMB 2C4FH 1YYY1 3MU8A 3RXAA 1EZSC 2A5IA 4Z0KA 3EA8A 3VGCC 2WYGA 2ZC9H 1FV9A 1QTFA 2BD8A 2SFAA 3MU4A 1O5BB 3E6PH 5DP4A 3S9CA 1P11E 3TH3H 1VJ9U 1FZZA 2R2MB 1DWDH 4JZFH 3RXRA 1EP5A 5JBCS 2LNCA 3UR9A 5A8XA 1RS0A 1ELEE 1P2KA 2C8YB 3B9FH 1AE8H 1TMUH 5EW2H 1QJ1B 7KMEH 2ZECA 3MH6A 4LOYH 5C5NA 2ZEBA 1BRUP 3JZ1B 2ANMH 2GZ8A 5F8TA 1EOJA 2FS8A 3ATIA 3MMGA 5FPSA 1GGDC 4DIHH 3BEIB 2B8OH 1J17T 1FY4A 1P02A 5E0HA 2RA3A 3SUEA 3RMNH 1O39A 2Y81A 1YPHE 1OP8A 1OOKB 2QAAA 4A1XA 2GDDA 4NFEA 3SV2H 1GHVH 3ATMA 2XXLA 5L6NH 1FI8A 1WBGB 3QTVH 4AGJA 1GJBB 4X8VH 1PPZA 4TWYA 3TNTA 2Y5GA 1LCYA 3LC3A 1P09A 1XKBC 1GJ9B 3RP2A 3T2NA 2BQ7B 4BAHB 1ETSH 5A2MH 3SU2A 4BAMB 3LGUA 2GZ7A 1HYLA 2QC2A 3RXFA 5DKMA 3OSYA 5FXLA 5A8YA 2P3FH 3M7TA 1O2SA 3SU6A 1ELAA 2YOLA 1PQ7A 2DE8A 1RIWB 1LMWB 1V2PT 5EPNA 1ZSLA 1THSH 1CT4E 1O3LA 2IOTA 5A09A 1GMCG 3U69H 1YCPH 5F6MA 3SJ8A 5F8ZA 1TMTH 1SFIA 4AFUA 7GCHF 2KAIA 1FN6A 1C2EA 1QCPA 1ANDA 3E1XB 3SUGA 4UONA 2AEIH 2HPQH 1EATA 3O8CA 1FLEE 1MKWK 3SQEE 2VWLA 5J4QA 4D9QA 5FPTA 4I32A 4MG3A 4HFPB 2V3OH 3URCA 1XUFA 5EQQA 3ZVEA 1UVSH 4DY7B 3Q3KA 1O3PB 1GMHF 1MAXA 2ZFPH 4HTCH 2Y5FA 4X2YA 2BLQA 1AKSA 4CRDA 3RXJA 4WF8A 1QBVH 2HNTE 2YNAA 1C1VH 2G51A 3BTEE 2XC0A 1ELDE 2BDBA 1C5LH 1IQJA 1AVXA 1BJUA 4FUCA 2TRMA 3DHKH 2HNTF 1NROH 3VFEA 4B74A 3BG8A 5ESBA 1MTUA 2FOAA 1GJ6A 2BXUH 3QDZB 4BTUB 2V6NA 1DLKB 2QXJA 3UQVA 1A4WH 3BTME 2P3TB 2XW9A 1IQLA 4DOQA 1SHHB 3RXIA 1C5UA 1GBAA 4XFQA 2ODQA 1K2I1 1SGNE 3A8DA 1O2UA 3QZRA 1O2NA 1CHOG 4O3TA 5C3NA 3AASA 4A1TA 4QT8C 3QUMP 1UTPA 3RXCA 3TIUA 1RIWC 1DANH 1RTLA 1TPSA 4I7YH 1ZMNA 2Z7FE 1UJ1A 1SMFE 4FU7A 1DICA 2G52A 2HOBA 2HVXA 1LPKB 2OUAA 2C90B 4K1SA 4Y8ZA 1ESTA 2G5NA 2AGIX 2BD4A 2BDHA 1G2MA 2V3HH 1YCPK 4A92A 1O2VA 3PROA 4J2YB 3GISB 3PLBA 3W95A 1Y5UT 1GBHA 3PMBB 1OX1A 2BM2A 2J4IA 2BXTH 3QK1A 1BRAA 1G3DA 3CS7A 1A1RA 1TX7A 3IG6B 1Y3VA 2BY5X 5GWZA 2W3KA 1XUJA 3HKIB 3L3TA 2O8TA 5LPFA 3KCGH 2ZI2H 1O32A 2O8WA 1QGFA 1J14A 4NFFA 1SGQE 7LPRA 2PKSB 2BB4A 1OWHA 1TPOA 1AO5A 3ODDA 5AHGH 6CHAB 4I31A 1O5FH 1CT0E 1TRMA 4WMEA 2J2UA 1V6DA 3SU3A 1DWEH 1A5GH 2FYRA 3RMOH 2ODYB 3MWIU 2FMJA 1IQMA 1CHGA 1CE5A 1ETTH 1JRTA 3E0NB 1DSUA 4GPGA 2PSXA 4K5ZA 4X6MA 1GCTB 2GKVE 2H5CA 3SNBA 5T6FA 1C5OH 1O2LA 3BG4B 4KGAA 1C9TA 4RSPA 4A5TS 4U01A 5HXFA 5E2PA 2SGPE 2GMTB 2B9LA 4ISNA 1TBQH 4ZHMU 1C5WB 4ABEA 1EB2A 2A7JA 2VIOA 2FYQA 1T8LA 3K2UA 2XBXA 2FPZA 2HALA 2Z9KA 4TWWA 3S9AA 1NM6A 1ACBE 1LKAA 2FLBH 1QQ4A 2OLGA 2P3UB 3PB1E 3GOVB 1BDAA 2JH0D 2P8OC 3RXVA 3LONA 3AVZA 2NU2E 1QHRB 4ABGA 2FX6A 1NRNH 1W14U 1OSSA 1F0TA 1JRSA 1ZRKA 2QF3A 1FY8E 4VGCB 3ATKA 1T7CA 1AFQB 1FXYA 4MPXA 4XDEA 2P93A 1LQEA 2SGDE 3ENSB 4IC6A 5LGOA 5C20A 1QY6A 1YPEH 3SGBE 1O3EA 3BF6H 1C5RA 2R9PA 3RXLA 1KXFA 2PKSC 3KQEA 6CHAC 5HYOA 1TGBA 4CHAB 4RKJB 2STAE 5LPRA 1D3DB 1UVOA 3TH2H 1D3QB 2BX4A 3MNSA 2BD7A 1ID5H 3RXKA 3GCTF 3SU5A 1FQ3A 3U9AH 4TPYA 1UVTH 2CHAC 3UWIA 1EAXA 1K1PA 1GCTC 1OWEA 1OXGA 2OC7A 4AG1A 1BOQA 1O35A 2A4QA 1XXDA 3S7KB 3BG4C 1CU1A 2Y5HA 1XUKA 1SQAA 4AYYB 1QRXA 3LOXA 1GVZA 1C4U2 2GMTC 1HB0B 1P2MA 1SOTA 3A86A 3ZZ6A 2ZWLH 1DXPA 4AFZA 1GPZA 2ZZUH 3RDZA 1DY9A 2A45B 1Z8IB 2XTTB 1O0DH 3RU4D 1SLWB 1CSOE 1VITG 3N7OA 4FVDA 5HM2A 4BAOB 1O5AB 3AAUA 1GI2A 2ZDLA 3M7UA 3GY2A 3NUMA 1ZR0A 2OQ5A 2QF0A 2FX4A 2ANYA 5C5OA 5I25A 3PTBA 1J9CH 1QURH 2OC1A 3MI4A 1MCTA 4GSOA 1EJAA 2FESH 2SNWA 1W13U 2NU4E 2O8UA 2TPIZ 1DFPA 1PPFE 2XCFA 4VGCC 1AFQC 2ASUB 3STIA 1N1LA 3RUOA 1YGCH 1GL0E 2CGAA 2G8TA 1C5NH 3DFLA 3E3TA 1C1TA 4X1QU 1O2ZA 2IN2A 3HATH 1SGDE 1AD8H 3GYLB 1ZMJA 4DW2U 4X1NU 1DLEA 2FXRA 2XCNA 1UHBB 2FLRH 1HIAB 1VGCB 4MPWA 5JPMH 4Y7AA 4CHAC 1CQQA 4ABBA 4KP0A 4Y76A 2NWNA 3RC4A 5HGGA 2VWOA 3SN8A 9ESTA 5DO4H 3RU4E 1BTUA 3ZVCA 1S5SA 1ANBA 3SHAH 1CA0B 1XVOA 1HRTH 4YT6H 2P95A 1YBWA 1P05A 1FAXA 4NIWA 4WMDA 1HUTH 4K69A 3ZYDA 4B76A 5K0HA 1P57B 3BEFB 1MQ6A 1Z71A 5A0AE 3KL6A 4ZMAH 1L1JA 1AN1E 3SHCH 1IQIA 1EZXC 4JYTA 5IYTA 3KIDU 3F9EA 3LDXH 1V2ST 3E90B 1G3CA 1PQ8A 2VIQA 1HAPH 1YPMH 5DP5A 3ZVBA 3RXMA 2BVRH 2P59A 4LXBH 1FMGA 1LPGB 2BOHB 5SGAE 4I8KA 1HXEH 3O8DA 1PYTD 4K1TA 2ZU1A 4TPIZ 2VIWA 3RM2H 3QLPH 4LZ1H 5LPEA 1GVLA 4JZEH 4YTAA 1C2IA 1C1QA 1EB1H 1ZJKA 1DS2E 2BQ6B 2FOCA 1TRYA 2EI6A 1SQOA 2LPRA 2VVVA 2YNBA 3QX5H 1EJNA 3E8LA 1FJSA 1ABIH 1TBZH 2TGPZ 4FUDA 4YOGA 1ABJH 3PO1B 4X2WA 5EXLA 1PPGE 2ZDNA 3BTQE 4BTIB 2TGAA 2OC8A 1WU1A 4YT7H 1ZOMA 2PSYA 1VGCC 3I29A 2PHBA 1TQ0B 3QZQA 1LVMA 3MNXA 3VB5A 1T31A 2ZP0H 4YOIA 1GBJA 1GI8B 3OTJE 1S81A 2W3IA 2C8XB 3HPTB 5B6OA 1JWTA 1P2IA 2H5DA 4MTBA 1CA0C 3E91A 3O8BA 1B0EA 6GCHG 3MH5A 4INLA 2BY6X 2PW8H 3A84A 3VB3A 1PQAA 3GDUA 1MKXH 3FP6E 4NZQA 1IQNA 3PMHB 2VH0A 1O3JA 1GHZA 3SU0A 3VB4A 3FZDA 1CO7E 1C2LA 1BMMH 1C1WH 1ANCA 1AHTH 1V2MT 1ELGA 4OS4A 5JB9S 2GDEH 4U32A 3HK3B 3OX7U 2ZHDA 1UTOA 2GCTB 1B5GH 4OS7A 1DT2A 4UFGH 2RA0A 4FXGH 4HZHA 5EQSA 5EOKA 1IAUA 2BDGA 2GX4A 2VH6A 2AMQA 3W94A 4ZH8A 1O3OA 2Q6DA 2CF8H 1V2JT 3ATWA 1BHXB 1FAKH 3A8AA 1UK3A 2HGTH 4SGAE 1TQ7B 5EQRA 4K1EA 1AGJA 1Z8JB 1LO6A 3Q3YA 5EODA 4O9VA 4E7RG 1YLDA 1D3PB 2ZKSA 3MO9A 4AZ2B 2A0QB 4Q80A 4TYDA 1GHYH 3T25A 3PO1C 2FTLE 2XWAA 3V3MA 1C1PA 1HAGE 2CN0H 2WPLS 1G30B 3HK6B 2PLXA 1GJ5H 3PWBA 2IPHA 4Q7ZA 3KF2A 1GJ4H 1HNEE 1O2TA 2F3CE 1WAYB 1GI4A 1QR3E 2C8ZB 2PWXA 3TK9A 4Y79A 5FX6A 3V0XA 4AB8A 1F0UA 1RTKA 3MFJA 1Z8GA 4UDWH 3A7WA 3A83A 1E38B 4X2XA 4OS2A 4Y10E 1NFUA 4IN2A 7ESTE 1MKXK 2OBOA 2AGGX 2IJOB 1S0QA 1F7ZA 1MKWH 1EASA 1GBMA 3S69A 4DG4A 3EQ0H 5F8XA 1C4Y2 2Z6BD 1DX5M 1WQSA 5JBAS 4BAKB 1O2WA 1KDQA 2G4TA 2Z9JA 1Y3YA 1EKBB 2GCTC 3SV6A 3ESTA 3A87A 4XBDA 3K9XB 1Q31A 5PTPA 1C2JA 8ESTE 2PGBB 4J1YA 3CP7A 1A3BH 2P94A 2VB0A 3ELAH 4Y6DA 1TIOA 1Y3UA 3KHVA 1YM0A 3M3TA 3IWMA 3SQHE 2UUJB 1TNLA 4KTSA 1EPTA 5AF9H 3RLYH 1C5XB 1SGIB 1C1RA 1LHEH 1D3TB 1HAXB 1MZDA 3OU0A 2FI4E 3M3VA 1BBRK 1V2WT 1C2GA 3OY6U 2VU8E 3ZZAA 4X2VA 3KN2A 2A32A 1S83A 3SUFA 2VIVA 5DK1A 4X1PU 2BVXH 3STJA 3ZV9A 1GMDF 1TFXA 5EXMA 3SI4H 1ZGIA 3EAJA 2OTVA 2ZU2A 1MTSA 1C1NA 9LPRA 1XUIA 2ZDMA 1A2CH 3BN9A 3LGWA 5K7RA 3FAOA 3ITIA 4FU9A 5DP3A 3K65B 1A0LA 1OYQA 1EAUA 2GD4B 4MDSA 5FBIA 4ISIH 2RDLA 2VIPA 4WJG2 1TPPA 1HDTH 1TA6A 2WYJA 3GDVA 4UE7H 3S9BA 3SV8A 4GAWA 1O30A 2WPKS 3R0FA 1UTLM 1QRZA 1A3EH 2PKAB 1ZLRA 2O8LA 3UOPA 1IHTH 1J8AA 5E0GA 1OP0A 3F6UH 2BDCA 2A2QH 1MTNB 2ZQ2A 3GDSA 3M36A 1K1IA 1E37B 2QCYA 5C1XA 1UTNA 4MVNA 1H9LB 2GTBA 1B0FA 4NGAH 3VEQB 2ULLA 1WCZA 4X1RU 4H6TA 2ALPA 4K60A 3BV9B 1GBDA 1AI8H 4NSVA 1BCUH 1BQYA 2GGVB 3HGNA 1GHAF 2A31A 1LHGH 2OBQA 3QGNB 1K28D 1W11U 3LPRA 3PMAB 1KTTB 1O2HA 2D2DA 4ISHH 1O2JA 4IC5A 4WH6A 1MU6B 2M5TA 4RKOB 1ZRBA 3MH7A 1NFYA 5T3HA 3SNCA 2VVCA 2G55A 3BIUH 3TNSA 1NU7B 2FS9A 2ZU4A 5E8EH 2THFB 1MAYA 5DP8A 1BTYA 3PLPA 1O5GH 2FODA 1TMBH 1YF4A 3LH3A 1SOZA 1BTHH 1EQ9A 4XE4A 1WTHD 1HXFH 3KQBA 1NN6A 4X6OA 2R3YA 2OINA 5FBEA 1PQ5A 1VITH 4D7GA 1JIRA 4ZXXH 4B71A 3RXQA 4MPUA 4O3UA 3TJVA 1ZSJA 4X8UH 1W3CA 1BMLA 1SGFA 1GHXH 4Q7YA 3LGTA 1C5MD 1QBNA 4MNWA 1FY3A 4ZROA 1NRQH 4FUIA 2ZHFH 4WWYA 2G81E 1RD3B 2CJIA 4KKDA 3SBKA 2Q1JA 2ANWA 1MTNC 1TX6A 2PUXB 1BTZA 1QB1A 3Q3XA 1AMHA 1H1BA 1RRKA 2H1UA 5FCRA 4AN7A 3RXTA 1KLJH 1O33A 3P6ZB 2HWLB 1O3BA 1O2OA 5GCHF 1FIZA 3PWCA 1SI5H 2H9HA 4CR9A 4CH8B 3BTWE 4LK4A 1CGJE 2XBYA 1SLVB 3JZ2B 4IMZA 2TGDA 2RCEA 1INCA 4NA7A 4UFDH 1C2DA 1OWJA 5E0JA 5BPEA 1P2OA 1T32A 2EEKA 3A81A 1F0SA 1O2QA 2GVFA 1UVPA 5L2YH 2STBE 3DA9B 2W26A 3I78A 5TJXA 2PTCE 1V2LT 3P8GA 2FTMA 4DURA 1SGPE 1HAVA 2A7HA 3SO3A 3B8JA 1DE7H 1O2YA 3S0NA 3G01A 4AOQA 4BXWA 2G00A 4XSKU 3P8OA 4B2AA 2FOFA 3A88A 1NRSH 3PYHA 1W12U 1HJ8A 3F1SB 5AFYH 2ZU5A 2QIQA 1F2SE 1GBEA 1NO9H 3UWJH 2ZGCA 3QN7A 2ZG0H 4GHTA 3D65E 3NWUA 4ABFA 1AQ7A 1GL1A 5T6DA 2V35A 1AU8A 2FI3E 1YKTA 2OC0A 4FVBA 3A8CA 4AYVB 1XM1A 4DJZB 1GMDG 3H7TA 3FP8E 3UNRA 1RXPA 5EXNA 3TH4H 2VIDA 4B2CA 2BLOA 2BDAA 3TU7H 5ABWA 3LKWA 1DVAH 1FN8A 2UWLA 4UFFH 2H2ZA 3RXUA 3NXPA 3BTHE 2QGRA 1ZTLA 3LGIA 7GCHG 1QB6A 4AX9H 1ARBA 1ZPCA 4X0WU 4X1SU 1D6WA 1SGTA 3M5NA 1O5DH 2ZHWH 3K6ZA 4FU8A 1T8MA 2VNTA 4CR5A 1L0ZA 1TBRH 1CVWH 1SLXB 1O37A 5DGJA 2JH5D 3RXPA 1FIWA 4GLYA 1GMHG 1Y5AT 1O3DA 3GICB 1SGFG 3A82A 1CA8B 3Q00A 1GHWH 1S84A 1NY22 3LH1A 1C5SA 1SGEE 5JBTA 1SGYE 4AG2A 2XBVA 4WXIA 1O2IA 4RN6A 1E36B 1C5VA 4CH2B 1G37A 2A4RA 5DPAA 1F5LA 3ZZ7A 2R0KA 3TK6A 1ANEA 1C5QA 4OS5A 3D49H 3MYWA 3FFGA 1ZTJA 1JIMA 2O9QA 2VVUA 1GHAG 3ZZ5A 3FP7E 1O3NA 4OGXA 1DM4B 3KGPA 1GI3A 4TY6A 3A8BA 1AY6H 2CXVA 1TNJA 4DT7B 1SR5C 2WINI 1ZZZA 4MNXA 3RMLH 1A0HB 2K1QA 3LGVA 2B5TB 2A2XH 4HGCA 1HAOH 1TNHA 2R2WU 4THNH 1MCVA 2BD2A 1SQTA 5EPYA 2QXGA 1FONA 2A4GA 3QWCH 3UR6A 2FOHA 2QV1A 1EP6A 4DCDA 2F9UA 5CHAB 3PLKA 1T4UH 1C5YB 1KY9A 1GI9B 3U8TH 1ELFA 1TWXB 1GBCA 2ZO3H 4BAQB 4NWLA 3EA9A 3SJ9A 2JKHA 3KNXA 1TABE 1GJDB 1S0RA 4OS1A 3E0PB 5EGMA 4ZAEA 4INHA 2A5KA 2SGQE 1XUGA 5F03A 2PTNA 5C2ZA 1P01A 4ZUHA 4K8YA 2J92A 1AUTC 3SNDA 1V2NT 1UK2A 1PPCE 2A4OA 1DOJA 4X8SH 2BY8X 1EAWA 2ZGHA 1SL3A 1L1NA 1OWKA 3PMJA 2C3SA 1HCGA 1KXBA 2VINA 1W7GH 1K1OA 2XBWA 1Z1JA 2UUFB 1KIGH 1SVPA 3MTYA 2FO9A 3NKKA 2D1JA 4I8LA 1EZUC 1NT1A 1G9IE 2BD9A 3M37A 5J4SA 2FIRH 1TRNA 1MD7A 3EDXB 1DUEA 3RXDA 1QJ6B 3LIWA 3NCLA 5AVDA 2Q6FA 1CBWB 4YESB 2SNVA 1DUAA 1O2RA 1PFXC 1MH0A 3RC5A 1ZPBA 2AH4X 4U30A 2Y7ZA 2WUBA 1VR1H 2H9EH 3RU4T 1SG8B 3BTFE 3UFAA 4K2YA 2R0LA 1O31A 3U1JB 1O34A 1KDQB 4JZ1A 1FY1A 2PGQB 1O3AA 1YPLH 2D8WA 5E2OA 1GBFA 1GDQA 3VB7A 1AB9B 1J16A 1NFXA 5CHAC 3A7VA 1V2QT 2AGEX 3MU0A 3URDA 4AORA 3RXSA 1UCYE 4BOHA 4ZKOU 1ZHPA 2BY7X 5EG4A 4R8TB 3RM0H 2ZHEH 1SGRE 4WXVA 2Y82A 6LPRA 1LHDH 1XXFA 1JXPA 1S82A 3RXBA 3V7TA 2CF9H 2D26C 1O3HA 1GI0A 4A7IB 2P16A 1U6QA 4JK5A 1SPJA 2CMYA 1EPTB 3VXFH 4B2BA 1O36A 1C2MA 1K1JA 2J38A 2UUKB 1WUNH 3LT3A 1UMAH 3GCTG 2TGTA 1TA2A 1HV7A 2ZQ1A 2OXSA 2XWBI 4MQAA 2ZGXH 4MLFB 3FVFB 1O2PA 1AIXH 4WMFA 3UOUA 1C5PA 1T8OA 3FZZA 3D23A 3SU1A 3MOCA 1TGCA 3F9HA 1HPGA 2ZTXA 4ZXYH 2WV5A 5LH8A 1EOLA 2G5VA 2UWOA 1CGIE 1CBWC 1N6YA 5A0BA 1DDJA 1AE5A 2ANKH 1GI1A 1W0ZU 1ESBA 1CHOF 1C5ZB 2KAIB 3NPSA 4H4FA 2G4UA 3ZVFA 1GJ7B 5DP9A 3RXEA 1BBRH 3OY5U 2ZFSA 1WV7H 2J94A 1BTPA 4YO9A 3SUDA 2GV6A 2W7SA 1TPAE 4AB9A 1O3MA 1UTKA 1HGTH 3VB6A 1F0RA 2FI5E 1Y59T 2ODPA 3UIRA 1BITA 3TLOA 4CRAA 3GCOA 1AB9C 4CBOA 1W2KH 1MZAA 3ZZBA 1TLDA 4CRCA 3SORA 1KLTA 1AKSB 2JETB 3D62A 4B73A 2ILNA 2GCHF 2VGCB 2GT7A 2ALVA 1YLCA 1UTJA 3P8NA 1CT2E 1BHXF 1ESAA 2HLCA 3F9FA 1V2TT 4BANB 4KELA 4B1TA 4ISLA 4MNYA 5A0CA 1EPTC 3ZV8A 3C1KA 4OS6A 1KSNA 1V2VT 2J34A 1ZYOA 4FUEA 1QRWA 2BLWA 2ZPSA 5AFZH 3BIVH 3U8RH 2BY9X 1TALA 1AWHB 4Y0YE 2WPMS 1MD8A 2F9PA 3TK5A 1WSSH 2Z9GA 3TJNA 4JMYA 3RLWH 1K1NA 2FOEA 2FZZA 3DUXH 1Z8RA 3NZIA 2HPPH 5DG6A 1MBQA 2QXIA 1RGQA 1MQ5A 1OS8A 2XYAA 2XNIA 1PPBH 3SGQE 2GP9B 1OPHB 1LKBA 1K1LA 2WUCA 1ETRH 1L4DA 1T4VH 3O8RA 1E35B 1GVKB 1C5TA 1W0YH 4HI3A 3BSQA 1RFNA 4BNRA 1LQDB 2WPHS 1D9IA 3L6PA 5IDKA 1HFDA 1UCYK 3ZVGA 1JBUH 1AZZA 2XC5A 2FDAA 1O38A 1J15A 3GY8A 1NRRH 1A5HA 5DP7A 1ZJDA 1KXEA 3KQDA 1THRH 1Z6EA 3RXOA 1WTGH 1SLUB 1P9SA 4NCYA 1P3EA 1C1OA 1SHYA 1Z7KA 8GCHF 4R0IA 1C2FA 2OQUA 3BTDE 5CE1A 1UVUH 4INKA 1P06A 4Y8XA 1P9UA 1H4WA 4X8TH 2JETC 2QN5T 1LPZB 3T62A 4Q2KA 4WH8A 4Y0ZE 1ELTA 2VGCC 1QB9A 4Y71A 4I33A 2TBSA 2Y6TA 3M61U 1YPHC 3R3GB 4IBLH 3T28A 1DPOA 3A89A 4YLUA 4BTTB 1FPHH 1A5IA 3NK8A 1T8NA 3HKJB 1K1MA 4E05H 4GHQA 4IN1A 2I6SA 4CREA 1K22H 3M3SA 1NS3A 1L4ZA 3A7XA 1GJCB 5EW1H 3WY8A 1VCQA 2AMDA 3BEUA 1O3IA 4FUJA 3EYDA 1RTFB 3ZZCA 2JH6D 1SGCA 4A1VA 1HAHH 1UK4A 4NSYA 1BA8B 1KYNA 2OP9A 3QTOH 4YOJA 3GY4A 3P17H 4CBNA 5G4BA 2AIQA 1Y5BT 3SJKA 3H5CB 1BTXA 1KTSB 1LVBA 2DUCA 1EJMA 1NU9A 1XMNB 1CGHA 3CS0A 2FWWA 1HAVB 2ZFQH 5GXPA 1WQVH 2F91A 1GDNA 1LHCH 3AAVA 3OYPA 2NU0E 1GBIA 1XKAC 2ZF0H 3ZVDA 1ELBA 1VITF 2AIPA 4FUFA 1GG6B 2ZTYA 4YM9A 1YCPM 1OKXA 1QBOA 1O2GH 4CRGA 3A7YA 3K6YA 4B75A 1QA0A 2BMGB 3TJUA 3SGAE 4ZKRU 3TVJB 5GJ4B 3HGPA 1K9OE 1P2NA 1S6HA 1LHFH 2BDYA 3MH4A 3M5OA 4OGYA 2Z94A 1D4PB 3DFJA 3RC6A 1SSXA 1QA7A 1IQKA 2GZ9A 1UO6A 4ZKNU 1KXCA 1Q3XA 1TNIA 1F5RA 1LVYA 3C27B 2ZCLP 3I77A 4AFSA 5FCKA 1QL8A 1YPJH 1GBTA 3GY6A 3E16B 2HNTC 2A7CA 4CRFA 1G3BA 2XRCA 3DT0H 5T6GA 4ESTE 2ZNKH 2P8OB 1NZQH 1DSTA 4I8GA 1AVWA 1O5CB 3ZZDA 1AVGH 5HMAA 2ZCKP 1YP9A 2QYIA 1OWDA 4ZHAA 3BTGE 1DXWA 1ZPZA 5GDSH 2TIOA 1C2HA 1C4V2 1PPHE 3GY7A 2GCHG 4U2WA 3PTNA 3KQCA 2QA9E 1Y8TA 2AS9A 3P95A 4K3JA 3CENA 3LJOA 6ESTA 2F9BH 3ODFA 1Y3WA 4GCHF 3P70B 4NWKA 2ZHQH 2OD3B 2F9VA 2W5EA 5FAHA 1HJAB 1QNJA 2VJ1A 1TONA 2BLVA 1G3EA 4DVAU 3M5LA 2O8MA 2FM2A 1NPMA 4SGBE 3KEEA 1E34B 5L30H 2PR3A 1HAZB 1O5EH 2SGAA 3FANA 2BYAX 2CHAB 2EA3A 1GG6C 3ZZ3A 3A7ZA 2FOBA 2UUYA 1QL7A 1LTOA 1O2KA 2ZCHP 2VWMA 4ZKSU 2ZIQH 1BUIA 5ESTE 4LZ4B 4F49A 4UFEH 1HAYB 1NTPA 5DJ7A 1AFEH 3ATLA 2ZDKA 3RXHA 1ZGVA 1EXFA 2PKAA 1G36A 1MTWA 1BRCE 3V12A 3GCHB 3TGJE 4UEHH 1ORFA 2QY0B 3AW1A 3SU4A 2BDIA 3TJOA 3ZVAA 3T27A 8KME2 1TNGA 2A5AA 4XBBA 2BVSH 1TNKA 3ZZ9A 1TYNA 2DE9A 1V2RT 3M7QA 1P3CA 1P10A 1GDUA 2ZPRA 3L33A 1HLTH 5JBBS 1VCPA 4D7FA 2ZU3A 3SJOA 2EC9H 2BX3A 8GCHG 4Y11E 4Y8YA 2R3UA 2B7DH 4AFQA 6GCHF 1ZHMA 2NU3E 3SNEA 2RG3A 1MUEB 3ZZ4A 3DD2H 3TGIE 1G32B 3PM3A 3MNBA 4D9RA 1TX8A 4MPVA 2CV3A 1ZMLA 3M35A 3BTKE 1A7SA 4H6SB 1AZ8A 2ZDAH 1P03A 2H6MA 1GWAA 4MNVA 4GVUA 4O97A 1HJAC 4ABHA 1O2XA 1MTVA 2FP7B 1O2MA 2PV9B 5L2ZH 1C2KA 4KTUA 1MMJN 3QGJA 1TB6H 1AUJA 1GI6A 1YPKH 3M5MA 1XVMA 2Z3DA 4XOJA 2ESTE 3B23B 5H4IB 5GPIB 1O3FA 3QO6A 1H8IH 1BRBE 1A0JA 2Z3EA 1ELCA 2Z9LA 2H9TH 1XUHA 1TE0A 1ZHRA 1IQHA 1GI5A 3UREA 5DP6A 1ARCA 2GV7A 2B0FA 4JK6A 3LU9B 1O3GA 3UTUH 3PV4A 2BQWB 2I6QA 1GHBF 4NA9H 3GCHC 1ELVA 4JYVH 3Q76A 1P12E 1BIOA 1P0SH 3U98H 1MBMA 4JZDH 1P2QA 1E0FD 1OP2A 4ABDA 1W10U 1VCWA 2ZFTA 1C1SA 2SGFE 5BRRE 2ZA5A 4NZLA 3Q77A 1IOEA 4DIIH 3MU5A 3MNCA 1W7XH 2Y7XA 1GBBA 3VPKA 2W7UA 1DY8A 3ZYEA 1EZQA 1VZQH 3VXEH 3RMMH 1HJ9A 1QIXB 1Y3XA 1IQGA 1C9PA 1AWFH 4IMQA 1H9IE 1V3XA 2FOGA 1YPGH 1IHSH 2FEQH 3SI3H 1XX9A 1B7XB 4UD9H 4X6PA 3MU1A 1BZXE 1PJPA 1A46H 2EI8A 5FPYA 4NIYA 4Y7BA 5EU8A 4ZHLU 2AERH 1DWCH 4I8JA 4D8NA 1TOCB 5JDUB 1UTMA 1JMOH 1BB0B 1QL9A 2BHGA 1H9HE 1TAWA 3LGYA 1O3KA 3V13A 1D6RA 2ZFFH 1P8VC 1W8BH 3UQOA 1KXAA 4ABJA 1V2OT 4FUGA 1TGNA 5TCCA 1F5KU 1QJ7B 2VWNA 4JYUH 1P04A 4X6NA 1NRPH 1SFQB 4ABIA 1FUJA 1L2EA 2BZAA 1EAIA 2J9NA 3SV9A 3T26A 1GCDA 3A7TA 2BZ6H 5CMXH 1THPB 2EI7A 3T5FH 1FPCH 1FNIA 1IQFA 4FUHA 4GCHG 4NG9H 3EE0B 1BMNH 3UY9A 1NC6A 3GY5A 5GCHG 5JYIA 1L1GA 2XC4A 5C67A 2PUQH 3UPEA 1IQEA 3LC5A 4YLQH 1FY5A 4JCNA 1N8OB 1V2UT 2F9OA 2PFEA 4WVPE 4F4OC 4FUBA 1WOFA 2QXHA 1C1UH 4ISOA 3A85A 3UUZA 1MU8B 5ETXA 2Z3CA 5A8ZA 3T29A 1S85A 3GCNA 5C1YA 1GBLA 4TY7A 1DITH 2V0BA 1OYTH 1C1MA 2SGEE 5FX5A 4Q7XA 5JB8S 1LDTT 3SW2B 1P2JA 2WV4A 1HAIH 1Q2WA 3A80A 1GMCF 1VJAU 2WPIS 2BOKA 1NFWA 1BMAA 2NU1E 3MHWU 4KTCA 4NA8A 4WY3A 3S7HB 3MO6A 2ZGBH 4D76A 3SV7A 3U1IB 1QQUA 3RXGA 5FHTA 4A6LA 3SZNA 2J95A 1GJ8B 2AYWA 4IW4E 4K8BA 1QFKH 1X7AC 4E06H 1V2KT 4DGJA 4YZUA 3SNAA 1KLIH 1N6XA 4E7NA 1GBKA 1H8DH 2OCVB 3VGCB 1WYKA 1GI7B
chains in the Genus database with same CATH superfamily
4I8HA 3LJJA 1BTWA 2ZPQA 2V3MA 3GY3A 2LELA 1M9UA 2C8WB 4IS5A 1JOUB 1HBTH 1UTQA 1FDPA 3WW7A 1BBRE 1GJAB 2WPJS 1G2LA 4H42U 4Z6AH 4O03A 1YC0A 4NIXA 1W0KD 3UNQA 3EA7A 2UWPA 3IITA 1OWIA 2BD5A 3TITA 2ZDVH 4M7GA 1TOMH 2F9NA 4AGKA 2BTCE 1UHBA 3ZZ8A 2A1DB 5GIBA 1SC8U 1HIAA 1SB1H 2GT8A 4JZIA 4IGDA 1S6FA 1EX3A 3TGKE 3F68H 2F83A 4ASHA 5HM9A 1GGDB 5I46H 3F9GA 2AFQB 1EUFA 1KXDA 1N8OC 1ZSKA 1PPEE 3U8OH 1TGTA 4PROA 1Z6JH 2C93B 5TCAA 2Q6GA 1O3CA 1ZTKA 1F92A 1Z1IA 3DSGA 3GYMA 1RJXB 1BJVA 1TGSZ 2ZGJA 2Y80A 3UNSA 2ZFRH 5KEDA 5C1UA 1NESE 4XBCA 2Z9IA 4CRBA 4NIVA 2AMPA 2BD3A 3BTTE 3EGKH 2HRVA 2ZTZA 1UCYH 5C0TA 8LPRA 1PYTC 3PV5A 3SOSA 1BT7A 4ABAA 1A61H 4BXSA 3SJIA 1GHBG 3P8FA 4GUXA 3TPIZ 3AW0A 1DWBH 1SBWA 3H7OA 1LVOA 1K21H 3MO3A 3P92A 2FOMB 2C4FH 1YYY1 3MU8A 3RXAA 1EZSC 2A5IA 4Z0KA 3EA8A 3VGCC 2WYGA 2ZC9H 1FV9A 1QTFA 2BD8A 2SFAA 3MU4A 1O5BB 3E6PH 5HIZA 5DP4A 3S9CA 1P11E 3TH3H 1VJ9U 1FZZA 2R2MB 1DWDH 4JZFH 5FL7D 3RXRA 3N7DA 1EP5A 5JBCS 2GJGA 2LNCA 3UR9A 5A8XA 5GNDA 1RS0A 3SYJA 1ELEE 1P2KA 2C8YB 3B9FH 1AE8H 1TMUH 5EW2H 2K0QA 1QJ1B 7KMEH 2ZECA 1KMHB 3MH6A 4LOYH 5C5NA 2ZEBA 2KCPA 1BRUP 3JZ1B 2ANMH 2GZ8A 5F8TA 1EOJA 2FS8A 3ATIA 3MMGA 5FPSA 1GGDC 2IJD1 4DIHH 3BEIB 2B8OH 1J17T 1FY4A 1P02A 3SZEA 5E0HA 2RA3A 3SUEA 3DSOA 3RMNH 1O39A 2Y81A 1YPHE 1OP8A 4XRNA 1OOKB 2QAAA 4A1XA 2RFKC 2GDDA 4NFEA 3SV2H 1GHVH 3FKSD 3ATMA 2XXLA 5L6NH 1FI8A 1WBGB 3QTVH 4AGJA 1GJBB 4X8VH 1PPZA 4TWYA 3TNTA 2Y5GA 5EJ1A 1LCYA 3LC3A 1P09A 1XKBC 1GJ9B 3RP2A 3T2NA 2BQ7B 4BAHB 1ETSH 5A2MH 3SU2A 4BAMB 3LGUA 2GZ7A 1HYLA 2QC2A 3RXFA 5DKMA 3OSYA 5FXLA 5A8YA 2P3FH 3M7TA 1O2SA 3SU6A 1ELAA 2YOLA 1PQ7A 2DE8A 1RIWB 1LMWB 1V2PT 5EPNA 1ZSLA 1THSH 1CT4E 1O3LA 2IOTA 5A09A 1GMCG 3U69H 1YCPH 5F6MA 3SJ8A 5F8ZA 1TMTH 1SFIA 4AFUA 7GCHF 2KAIA 1FN6A 1C2EA 1QCPA 1ANDA 3E1XB 3SUGA 4UONA 2WSSD 2AEIH 2HPQH 1EATA 3O8CA 1FLEE 1MKWK 3SQEE 2QE7D 2VWLA 5J4QA 4D9QA 5FPTA 4I32A 4MG3A 4HFPB 2V3OH 3URCA 1XUFA 5EQQA 3ZVEA 1UVSH 4DY7B 3Q3KA 1O3PB 1GMHF 4XD7D 1MAXA 2ZFPH 4HTCH 2Y5FA 3FO8D 4X2YA 2BLQA 1AKSA 4I86A 4CRDA 3RXJA 4WF8A 1QBVH 2HNTE 2YNAA 1C1VH 2G51A 3BTEE 2XC0A 1ELDE 2BDBA 1C5LH 1IQJA 1AVXA 1BJUA 4FUCA 2TRMA 3DHKH 2HNTF 1NROH 3VFEA 4B74A 3BG8A 5ESBA 1MTUA 2FOAA 1GJ6A 2BXUH 3QDZB 4BTUB 2V6NA 1DLKB 2QXJA 3OEED 3UQVA 1A4WH 3BTME 2P3TB 2XW9A 1IQLA 4DOQA 1SHHB 3RXIA 1C5UA 1GBAA 3DSPA 4XFQA 2ODQA 1K2I1 1SGNE 3A8DA 1O2UA 3QZRA 1O2NA 1CHOG 4O3TA 5C3NA 3AASA 4A1TA 4QT8C 3QUMP 1UTPA 3RXCA 3TIUA 1RIWC 1DANH 1RTLA 1TPSA 4I7YH 1ZMNA 2Z7FE 1UJ1A 1SMFE 4FU7A 1DICA 2G52A 2HOBA 2HVXA 1LPKB 2OUAA 2YMSB 2C90B 4K1SA 4Y8ZA 1ESTA 2G5NA 1YWUA 2AGIX 2WPDD 2BD4A 2BDHA 1G2MA 2V3HH 1YCPK 4A92A 1O2VA 3PROA 4F55A 4J2YB 3GISB 3PLBA 3W95A 1Y5UT 1GBHA 3PMBB 1OX1A 1SKYE 2BM2A 2J4IA 2BXTH 3QK1A 1BRAA 1G3DA 3CS7A 1A1RA 1TX7A 3IG6B 1Y3VA 2BY5X 5GWZA 2W3KA 1XUJA 5HIYA 3HKIB 3L3TA 2O8TA 5LPFA 3KCGH 2ZI2H 1O32A 2J5UA 2O8WA 1QGFA 1J14A 4NFFA 1SGQE 7LPRA 2PKSB 2BB4A 1OWHA 1TPOA 1AO5A 3ODDA 5AHGH 6CHAB 3UAIC 4I31A 1COWD 1O5FH 1CT0E 1TRMA 4WMEA 2J2UA 1H8HD 1V6DA 3SU3A 1DWEH 1A5GH 2FYRA 3RMOH 2ODYB 3MWIU 2FMJA 1IQMA 1CHGA 1CE5A 1ETTH 1JRTA 3E0NB 1DSUA 4GPGA 2PSXA 4K5ZA 4X6MA 1GCTB 2GKVE 2H5CA 3SNBA 5T6FA 1C5OH 1O2LA 3BG4B 4KGAA 1C9TA 4RSPA 4A5TS 4U01A 5HXFA 5E2PA 2SGPE 2GMTB 2B9LA 4ISNA 1TBQH 4ZHMU 1C5WB 4ABEA 1EB2A 2A7JA 2VIOA 4B6EA 2FYQA 1T8LA 3K2UA 2XBXA 2FPZA 2HALA 2Z9KA 4TWWA 3S9AA 1NM6A 1ACBE 1LKAA 2FLBH 1QQ4A 2OLGA 2P3UB 3OFND 3PB1E 3GOVB 1BDAA 2JH0D 2P8OC 3RXVA 3LONA 2YMSC 3AVZA 2NU2E 1QHRB 4ABGA 2FX6A 1NRNH 1W14U 1OSSA 1F0TA 1JRSA 1ZRKA 2QF3A 1FY8E 4VGCB 3ATKA 1T7CA 1AFQB 1FXYA 4MPXA 4XDEA 2P93A 1LQEA 2SGDE 3ENSB 4IC6A 5LGOA 5C20A 1QY6A 1YPEH 3SGBE 1O3EA 1YLNA 3BF6H 1C5RA 2R9PA 3RXLA 1KXFA 2PKSC 3KQEA 6CHAC 5HYOA 1TGBA 4CHAB 4FOUC 2STAE 4RKJB 5LPRA 1D3DB 1UVOA 3TH2H 1D3QB 2BX4A 3MNSA 2BD7A 1ID5H 3RXKA 3GCTF 3SU5A 1FQ3A 1FX0B 3U9AH 4TPYA 1UVTH 2CHAC 4RT0A 3UWIA 1EAXA 1K1PA 1GCTC 1OWEA 1OXGA 2OC7A 4AG1A 1BOQA 1O35A 2A4QA 1XXDA 3N99A 3S7KB 3BG4C 1CU1A 2Y5HA 1XUKA 1SQAA 4AYYB 1QRXA 3LOXA 1GVZA 1C4U2 2GMTC 1HB0B 1P2MA 1SOTA 3A86A 3ZZ6A 2ZWLH 1DXPA 4AFZA 1GPZA 2ZZUH 3RDZA 1DY9A 2A45B 1Z8IB 2XTTB 1O0DH 3RU4D 1SLWB 1CSOE 1VITG 3N7OA 4FVDA 5HM2A 4BAOB 1O5AB 3AAUA 1GI2A 2ZDLA 1YY3A 3M7UA 3GY2A 3NUMA 1ZR0A 5T1VA 2OQ5A 2QF0A 2FX4A 2ANYA 5C5OA 5I25A 3PTBA 1J9CH 1QURH 2OC1A 3MI4A 1MCTA 4GSOA 1EJAA 2FESH 2SNWA 1W13U 2NU4E 2O8UA 2TPIZ 1DFPA 1PPFE 2XCFA 4VGCC 1AFQC 2ASUB 3STIA 1N1LA 3RUOA 1YGCH 1GL0E 2CGAA 2G8TA 1C5NH 3DFLA 3E3TA 1C1TA 4X1QU 5DN6D 1O2ZA 2IN2A 3HATH 1SGDE 4AC9A 1AD8H 3GYLB 1ZMJA 4DW2U 1BMFD 4X1NU 4OM9A 1DLEA 2FXRA 2XCNA 1UHBB 3KYFA 2FLRH 1HIAB 1VGCB 4MPWA 5JPMH 4Y7AA 4CHAC 1CQQA 4ABBA 4KP0A 4Y76A 2NWNA 3RC4A 5HGGA 2VWOA 3SN8A 9ESTA 5DO4H 3RU4E 1BTUA 3ZVCA 1S5SA 1ANBA 3SHAH 1CA0B 2WV9A 1XVOA 1HRTH 4YT6H 2P95A 1YBWA 1P05A 4ACAA 1FAXA 4NIWA 4WMDA 1HUTH 2WZQA 4K69A 3ZYDA 4B76A 5K0HA 1P57B 3BEFB 1MQ6A 1Z71A 5A0AE 3KL6A 4ZMAH 4DT4A 1L1JA 1AN1E 3SHCH 1IQIA 1EZXC 4JYTA 5IYTA 3KIDU 4RT1A 3F9EA 3LDXH 1V2ST 3E90B 1G3CA 1PQ8A 2VIQA 1HAPH 1YPMH 5DP5A 3ZVBA 3RXMA 2BVRH 2P59A 4LXBH 1FMGA 1LPGB 2BOHB 5SGAE 4I8KA 1HXEH 3O8DA 1PYTD 4K1TA 2KZ4A 2ZU1A 4TPIZ 2VIWA 3RM2H 3QLPH 4LZ1H 5LPEA 1GVLA 4JZEH 4YTAA 1C2IA 1C1QA 1EB1H 1ZJKA 1DS2E 2BQ6B 2FOCA 1TRYA 2EI6A 1SQOA 2LPRA 2VVVA 2YNBA 3QX5H 1EJNA 3E8LA 1FJSA 1ABIH 1TBZH 2TGPZ 4FUDA 4YOGA 1ABJH 3PO1B 4X2WA 5EXLA 1PPGE 2ZDNA 3BTQE 4BTIB 2TGAA 2OC8A 1WU1A 4YT7H 1ZOMA 2PSYA 1VGCC 3I29A 2PHBA 1TQ0B 3QZQA 1LVMA 3MNXA 3VB5A 1T31A 2ZP0H 2JJ2D 4YOIA 1GBJA 1GI8B 3OTJE 1S81A 2W3IA 2C8XB 3HPTB 5B6OA 1JWTA 1P2IA 2H5DA 4MTBA 1CA0C 3E91A 3O8BA 1B0EA 6GCHG 3MH5A 4INLA 2BY6X 2PW8H 3A84A 3VB3A 2V7QD 1PQAA 3GDUA 1E79D 1MKXH 3FP6E 4NZQA 1IQNA 3PMHB 2VH0A 1O3JA 1GHZA 1UW7A 3SU0A 3VB4A 3FZDA 1CO7E 1C2LA 1BMMH 1C1WH 1ANCA 1AHTH 1V2MT 1ELGA 4OS4A 5JB9S 2GDEH 4U32A 3HK3B 3OX7U 2ZHDA 1UTOA 2GCTB 1B5GH 4OS7A 4M9FA 1DT2A 4UFGH 2RA0A 4FXGH 4HZHA 5EQSA 5EOKA 1IAUA 2BDGA 2F43B 2GX4A 2VH6A 2AMQA 3W94A 4ZH8A 1O3OA 2Q6DA 2CF8H 1V2JT 3ATWA 1BHXB 1FAKH 3A8AA 1UK3A 2HGTH 4SGAE 1TQ7B 5EQRA 4K1EA 1AGJA 1Z8JB 1LO6A 3Q3YA 5EODA 4O9VA 4E7RG 1YLDA 1D3PB 2OK5A 2ZKSA 3MO9A 4AZ2B 4P02A 2A0QB 4Q80A 4TYDA 1GHYH 3T25A 3PO1C 2FTLE 2XWAA 3V3MA 1C1PA 1HAGE 2CN0H 2WPLS 1G30B 3HK6B 2PLXA 1GJ5H 3PWBA 2IPHA 4Q7ZA 3KF2A 1GJ4H 1HNEE 1O2TA 2F3CE 2HLDD 1WAYB 1GI4A 1QR3E 2C8ZB 2PWXA 3TK9A 4Y79A 5FX6A 3V0XA 4AB8A 1F0UA 1RTKA 3MFJA 4Q4LA 1Z8GA 4UDWH 3A7WA 3A83A 1E38B 4X2XA 4OS2A 4Y10E 1NFUA 4IN2A 7ESTE 1MKXK 2OBOA 2AGGX 2IJOB 1S0QA 1F7ZA 1MKWH 1EASA 1GBMA 1H8ED 2KFWA 3S69A 4DG4A 3EQ0H 5F8XA 1C4Y2 2Z6BD 3WWFA 1DX5M 1WQSA 5JBAS 4BAKB 1O2WA 1KDQA 2G4TA 2Z9JA 5CHBA 1Y3YA 1EKBB 2GCTC 3SV6A 3ESTA 3A87A 2KX4A 4XBDA 3K9XB 5HKKD 1Q31A 4HG6A 5PTPA 1C2JA 3PV2A 8ESTE 2PGBB 4J1YA 3CP7A 1A3BH 2P94A 2VB0A 3ELAH 4Y6DA 1TIOA 1Y3UA 3KHVA 1YM0A 3M3TA 3IWMA 3SQHE 2UUJB 3N7EA 1TNLA 4Z1MD 4KTSA 1EPTA 5AF9H 3RLYH 1C5XB 1SGIB 1C1RA 1LHEH 1D3TB 1HAXB 1MZDA 3OU0A 2FI4E 3M3VA 1BBRK 1V2WT 1C2GA 3OY6U 2VU8E 3ZZAA 4X2VA 3KN2A 2A32A 1S83A 3SUFA 2VIVA 5DK1A 4X1PU 2BVXH 3STJA 3ZV9A 1GMDF 1TFXA 5EXMA 3SI4H 1ZGIA 3EAJA 2OTVA 2ZU2A 1MTSA 1C1NA 9LPRA 1XUIA 2ZDMA 1A2CH 3BN9A 3LGWA 5K7RA 3FAOA 3ITIA 4FU9A 5DP3A 3K65B 1A0LA 1OYQA 1EAUA 2GD4B 4MDSA 2PP6A 5FBIA 4ISIH 2RDLA 3VG8A 2VIPA 5EIYA 5EJLA 4ZCNA 1W0JD 4WJG2 1TPPA 1HDTH 1TA6A 2F4LA 2WYJA 3GDVA 4UE7H 3S9BA 3SV8A 4GAWA 1O30A 2WPKS 3R0FA 1UTLM 3MQKC 1QRZA 1A3EH 2PKAB 1ZLRA 2O8LA 3UOPA 1IHTH 1J8AA 5E0GA 1OP0A 3F6UH 2BDCA 2A2QH 1MTNB 2ZQ2A 3GDSA 3M36A 1K1IA 1E37B 2QCYA 5C1XA 1UTNA 4MVNA 1H9LB 2GTBA 1B0FA 4NGAH 3VEQB 2ULLA 1WCZA 4X1RU 4H6TA 2ALPA 4K60A 3BV9B 1GBDA 1AI8H 4NSVA 1BCUH 1BQYA 2GGVB 3HGNA 1GHAF 2A31A 1LHGH 2OBQA 3QGNB 1K28D 1W11U 3LPRA 3PMAB 1KTTB 1O2HA 2D2DA 4ISHH 1O2JA 4IC5A 4WH6A 1MU6B 2M5TA 4RKOB 1ZRBA 3MH7A 1NFYA 5T3HA 3SNCA 2YMSD 2VVCA 2G55A 3BIUH 3TNSA 1NU7B 2FS9A 2QF5A 2ZU4A 5E8EH 2THFB 1MAYA 5DP8A 1BTYA 3PLPA 1O5GH 2FODA 1TMBH 1YF4A 3LH3A 1SOZA 1BTHH 1EQ9A 4XE4A 1WTHD 1HXFH 3KQBA 5B6LA 1VKYA 5C17A 1NN6A 4X6OA 2R3YA 2OINA 5FBEA 1PQ5A 1VITH 4D7GA 4B6FA 1JIRA 4ZXXH 4B71A 3RXQA 4MPUA 4FETA 4O3UA 3TJVA 1ZSJA 4X8UH 1W3CA 1BMLA 1SGFA 3F3BA 1GHXH 4Q7YA 3GS9A 3LGTA 1C5MD 1QBNA 4MNWA 1FY3A 4ZROA 1NRQH 4FUIA 2ZHFH 4WWYA 2G81E 1RD3B 2CJIA 4KKDA 3SBKA 2Q1JA 2ANWA 1MTNC 1TX6A 2PUXB 1BTZA 1QB1A 3Q3XA 1AMHA 1H1BA 1RRKA 2H1UA 5FCRA 4AN7A 3RXTA 1KLJH 1O33A 3P6ZB 2HWLB 1O3BA 1O2OA 5GCHF 1FIZA 3PWCA 1SI5H 2H9HA 4CR9A 4CH8B 3BTWE 4LK4A 1CGJE 2XBYA 1SLVB 4ACBA 3JZ2B 4IMZA 2TGDA 2RCEA 1INCA 4NA7A 4UFDH 1C2DA 1OWJA 5E0JA 5BPEA 1P2OA 1T32A 2EEKA 3A81A 2J98A 1F0SA 1O2QA 2GVFA 1UVPA 5L2YH 2STBE 3DA9B 2W26A 3I78A 5TJXA 1WDIA 2PTCE 1V2LT 2XOKD 3P8GA 2FTMA 4DURA 1SGPE 1HAVA 2A7HA 3SO3A 3B8JA 1DE7H 1O2YA 3S0NA 3G01A 4AOQA 4BXWA 2G00A 4XSKU 3P8OA 4B2AA 2FOFA 3A88A 1NRSH 3PYHA 1W12U 1HJ8A 3F1SB 5AFYH 2ZU5A 2QIQA 1F2SE 1GBEA 1NO9H 1NBMD 3UWJH 2ZGCA 3QN7A 2ZG0H 4GHTA 3D65E 3NWUA 4ABFA 1AQ7A 1GL1A 5T6DA 2V35A 1AU8A 2FI3E 1YKTA 2OC0A 4FVBA 3A8CA 4AYVB 1XM1A 4DJZB 1GMDG 3H7TA 3FP8E 3UNRA 1RXPA 5EXNA 3TH4H 2VIDA 4B2CA 2BLOA 2BDAA 3TU7H 5ABWA 3LKWA 1DVAH 1FN8A 2UWLA 4UFFH 2H2ZA 3RXUA 3NXPA 3BTHE 2QGRA 1ZTLA 3LGIA 7GCHG 2KCYA 1QB6A 3OTPA 4AX9H 1ARBA 1ZPCA 4X0WU 4X1SU 1D6WA 1SGTA 3M5NA 1O5DH 2ZHWH 3K6ZA 4FU8A 1T8MA 2VNTA 4CR5A 1L0ZA 3OEHD 3KQ5A 1TBRH 1CVWH 1SLXB 1O37A 5DGJA 3F2FA 2JH5D 3RXPA 1FIWA 4GLYA 1GMHG 1Y5AT 1O3DA 3GICB 1SGFG 3A82A 1CA8B 3Q00A 1GHWH 1S84A 1NY22 1NBME 3LH1A 1C5SA 1SGEE 5JBTA 3DCLA 1SGYE 4AG2A 2XBVA 4WXIA 1O2IA 4RN6A 1E36B 1C5VA 4CH2B 1G37A 2A4RA 2KM0A 5DPAA 1F5LA 3H09A 3ZZ7A 2R0KA 3TK6A 1ANEA 1C5QA 4OS5A 3D49H 3MYWA 3FFGA 1ZTJA 1JIMA 2O9QA 2VVUA 1GHAG 3ZZ5A 3FP7E 1O3NA 4OGXA 1DM4B 3KGPA 1GI3A 4TY6A 3A8BA 1AY6H 2CXVA 1TNJA 4DT7B 1SR5C 2WINI 1ZZZA 1MABB 4MNXA 3RMLH 1A0HB 2K1QA 3LGVA 2B5TB 2A2XH 2JDID 4HGCA 1HAOH 1TNHA 2R2WU 4THNH 1MCVA 2BD2A 1SQTA 5EPYA 2QXGA 1FONA 2A4GA 3QWCH 3UR6A 2FOHA 2QV1A 1EP6A 4DCDA 2F9UA 5CHAB 3PLKA 1T4UH 1C5YB 1KY9A 1GI9B 3U8TH 1ELFA 1TWXB 1GBCA 2ZO3H 4BAQB 4NWLA 3EA9A 3SJ9A 2JKHA 3KNXA 1TABE 1GJDB 1S0RA 4OS1A 1EFRD 3E0PB 5EGMA 4ZAEA 4INHA 2A5KA 2SGQE 1XUGA 5F03A 2PTNA 5C2ZA 1P01A 4ZUHA 4K8YA 2J92A 1AUTC 3SNDA 1V2NT 1UK2A 1PPCE 3CNRA 2A4OA 1DOJA 2JJ1D 4X8SH 2BY8X 1EAWA 2ZGHA 1SL3A 1L1NA 1OWKA 3PMJA 2C3SA 1HCGA 1KXBA 2VINA 1W7GH 1K1OA 2XBWA 3PRDA 1Z1JA 2UUFB 1KIGH 1SVPA 3MTYA 2FO9A 3NKKA 2D1JA 4I8LA 1EZUC 2WHXA 1NT1A 1G9IE 2BD9A 3M37A 5J4SA 2FIRH 1TRNA 1MD7A 3EDXB 3F2HA 1DUEA 3RXDA 1QJ6B 3LIWA 1QZ8A 3KYGA 3NCLA 5AVDA 2Q6FA 1CBWB 4YESB 2SNVA 1DUAA 1O2RA 1PFXC 1MH0A 3RC5A 2AHME 1ZPBA 2AH4X 4U30A 2Y7ZA 5KGOA 2WUBA 2L6OA 1VR1H 2H9EH 3RU4T 1SG8B 3BTFE 3UFAA 4K2YA 2R0LA 1O31A 3U1JB 1O34A 1KDQB 4JZ1A 1FY1A 2PGQB 1O3AA 1YPLH 2L74A 2D8WA 5E2OA 1GBFA 1GDQA 3VB7A 1AB9B 1J16A 1NFXA 5CHAC 3A7VA 1V2QT 2AGEX 3MU0A 3URDA 4AORA 3RXSA 1UCYE 4BOHA 4ZKOU 1ZHPA 2BY7X 5EG4A 4R8TB 3RM0H 2ZHEH 1SGRE 4WXVA 2Y82A 6LPRA 1LHDH 1XXFA 5DSFA 1JXPA 1S82A 3RXBA 3V7TA 2CF9H 2D26C 1O3HA 1GI0A 4A7IB 2P16A 1U6QA 4JK5A 1SPJA 2CMYA 1EPTB 3VXFH 4B2BA 1O36A 1C2MA 1K1JA 2J38A 2UUKB 1WUNH 3LT3A 1UMAH 3GCTG 2TGTA 1TA2A 1HV7A 2ZQ1A 2OXSA 2XWBI 4MQAA 2ZGXH 4MLFB 3FVFB 1O2PA 1AIXH 4WMFA 3UOUA 1C5PA 1T8OA 3FZZA 3D23A 3SU1A 3EE7A 3MOCA 1TGCA 3F9HA 1HPGA 2ZTXA 2W6JD 4ZXYH 2WV5A 5LH8A 1EOLA 2G5VA 2UWOA 2KR7A 1CGIE 2M2AA 1CBWC 1N6YA 5A0BA 1DDJA 1AE5A 2ANKH 1GI1A 1W0ZU 1ESBA 1CHOF 1C5ZB 2KAIB 3NPSA 4H4FA 2G4UA 3ZVFA 1GJ7B 5DP9A 3RXEA 1BBRH 3OY5U 1WXRA 2ZFSA 1WV7H 2J94A 1BTPA 4YO9A 3SUDA 2GV6A 2W7SA 1TPAE 4AB9A 1O3MA 1UTKA 1HGTH 3VB6A 1F0RA 2FI5E 1Y59T 2J97A 2ODPA 3UIRA 1BITA 3TLOA 4CRAA 3GCOA 1AB9C 4CBOA 1W2KH 1MZAA 3ZZBA 1TLDA 4CRCA 3SORA 1KLTA 1AKSB 2JETB 3D62A 4B73A 2EQNA 2ILNA 2GCHF 2VGCB 2GT7A 2ALVA 1YLCA 1UTJA 3P8NA 1CT2E 1BHXF 1ESAA 2HLCA 3F9FA 1V2TT 4BANB 4KELA 4B1TA 4ISLA 4MNYA 5A0CA 1EPTC 3ZV8A 3C1KA 4OS6A 1KSNA 1E1RD 1V2VT 2J34A 1ZYOA 4FUEA 1QRWA 2BLWA 2ZPSA 4TSFD 5AFZH 3BIVH 3U8RH 2BY9X 1TALA 1AWHB 4Y0YE 3F2GA 2WPMS 1MD8A 2F9PA 3TK5A 1WSSH 2Z9GA 3TJNA 4JMYA 3RLWH 1K1NA 2FOEA 2FZZA 3DUXH 3ZIAD 1Z8RA 3NZIA 2HPPH 2QF4A 1MBQA 2QXIA 5DG6A 1RGQA 1MQ5A 1OS8A 2XYAA 2XNIA 1PPBH 3SGQE 2GP9B 1OPHB 1LKBA 1K1LA 2WUCA 1ETRH 1L4DA 1T4VH 3O8RA 1E35B 1GVKB 1C5TA 1W0YH 4HI3A 3BSQA 1RFNA 4BNRA 1LQDB 2WPHS 1D9IA 3L6PA 5IDKA 1HFDA 1UCYK 3ZVGA 1JBUH 2EY4C 1AZZA 2XC5A 2FDAA 1O38A 1J15A 3GY8A 1NRRH 1A5HA 5DP7A 1ZJDA 1KXEA 3KQDA 1THRH 1Z6EA 2IPQX 3RXOA 1WTGH 1SLUB 1P9SA 4NCYA 3F0PA 5KECA 1P3EA 1C1OA 1SHYA 1Z7KA 8GCHF 4R0IA 1C2FA 2OQUA 3BTDE 5CE1A 1UVUH 1SQRA 4INKA 1P06A 4Y8XA 1P9UA 1H4WA 4X8TH 2JETC 2QN5T 1LPZB 3T62A 4Q2KA 4WH8A 4Y0ZE 1ELTA 2VGCC 1QB9A 4Y71A 4I33A 2TBSA 2Y6TA 3M61U 1YPHC 3R3GB 4IBLH 3T28A 1DPOA 3A89A 3F0OA 4YLUA 2JIZD 4BTTB 1FPHH 1A5IA 3NK8A 1T8NA 3HKJB 1K1MA 3FN8A 4E05H 4GHQA 4IN1A 2I6SA 4CREA 1K22H 3M3SA 1NS3A 1L4ZA 3A7XA 1GJCB 5EW1H 3WY8A 1VCQA 2AMDA 3BEUA 1O3IA 4FUJA 3EYDA 1RTFB 3ZZCA 2JH6D 1SGCA 4A1VA 2J98B 1HAHH 1UK4A 4NSYA 1BA8B 1KYNA 2KCAA 2OP9A 3QTOH 4YOJA 3GY4A 3P17H 4CBNA 5G4BA 2AIQA 1Y5BT 3SJKA 3H5CB 1BTXA 1KTSB 1LVBA 2DUCA 1EJMA 1E1QD 1NU9A 1XMNB 1CGHA 3CS0A 4RI0A 2FWWA 1HAVB 1S6LA 2ZFQH 5GXPA 1WQVH 2F91A 1GDNA 1LHCH 3AAVA 3OYPA 2NU0E 1GBIA 1XKAC 2ZF0H 3ZVDA 1ELBA 1VITF 2AIPA 4FUFA 1GG6B 2ZTYA 4YM9A 1YCPM 1OKXA 1QBOA 1O2GH 4CRGA 3A7YA 3K6YA 3PRBA 4B75A 4TT3D 1QA0A 2BMGB 3TJUA 3SGAE 4ZKRU 3TVJB 5GJ4B 3HGPA 1K9OE 1P2NA 1S6HA 1LHFH 2BDYA 3MH4A 3M5OA 4OGYA 5EJZA 2Z94A 1D4PB 3DFJA 3RC6A 1SSXA 3UB0A 1QA7A 1IQKA 2GZ9A 1UO6A 4ZKNU 1KXCA 1Q3XA 1TNIA 1F5RA 1LVYA 3C27B 2ZCLP 3I77A 4AFSA 5FCKA 1QL8A 1OHHD 1YPJH 1GBTA 3GY6A 3E16B 2HNTC 2A7CA 4CRFA 1G3BA 2XRCA 3DT0H 5T6GA 4ESTE 2ZNKH 2P8OB 1NZQH 1DSTA 4I8GA 1AVWA 1O5CB 3ZZDA 1AVGH 5HMAA 2ZCKP 1YP9A 2QYIA 1OWDA 4ZHAA 3BTGE 1DXWA 1ZPZA 5GDSH 2TIOA 1C2HA 1C4V2 1PPHE 2HVYB 3GY7A 2GCHG 4U2WA 2K8IA 3PTNA 3KQCA 2QA9E 1Y8TA 2AS9A 3P95A 4K3JA 3CENA 5C0UA 3LJOA 6ESTA 2F9BH 3ODFA 1Y3WA 4GCHF 3P70B 4NWKA 2ZHQH 2OD3B 2F9VA 2W5EA 5FAHA 1HJAB 1QNJA 2VJ1A 1TONA 2BLVA 1G3EA 4DVAU 3M5LA 2O8MA 3OE7D 2FM2A 1NPMA 4SGBE 3KEEA 1E34B 5L30H 2PR3A 1HAZB 1O5EH 2SGAA 3FANA 2BYAX 2CHAB 2EA3A 1GG6C 3ZZ3A 3A7ZA 2FOBA 2UUYA 2VBCA 1QL7A 1LTOA 1O2KA 2ZCHP 2VWMA 4Q63A 2ZIQH 4ZKSU 1BUIA 5ESTE 4LZ4B 3FOAA 4F49A 4UFEH 1HAYB 1NTPA 5DJ7A 1AFEH 3ATLA 2ZDKA 3RXHA 1ZGVA 5F53A 1EXFA 2PKAA 1G36A 1MTWA 1BRCE 3V12A 3GCHB 3TGJE 4UEHH 1ORFA 2QY0B 3AW1A 3SU4A 2BDIA 3TJOA 3ZVAA 3T27A 8KME2 1TNGA 2A5AA 4XBBA 2BVSH 1TNKA 3ZZ9A 1TYNA 2DE9A 1V2RT 3M7QA 1P3CA 1P10A 1GDUA 2ZPRA 3L33A 1HLTH 5JBBS 1VCPA 4D7FA 2ZU3A 3SJOA 2EC9H 2BX3A 8GCHG 4Y11E 4Y8YA 2R3UA 2B7DH 4ASUD 4AFQA 6GCHF 1ZHMA 2NU3E 3SNEA 2RG3A 1MUEB 3ZZ4A 3DD2H 3TGIE 1G32B 3PM3A 3MNBA 4D9RA 1TX8A 2W6ID 4MPVA 2CV3A 1ZMLA 3M35A 3BTKE 1A7SA 2XNDD 4H6SB 1AZ8A 2ZDAH 1P03A 2H6MA 1GWAA 4MNVA 4GVUA 4O97A 1HJAC 4ABHA 1O2XA 1MTVA 2FP7B 1O2MA 2PV9B 5L2ZH 1C2KA 4KTUA 1MMJN 3QGJA 5C94A 1TB6H 1AUJA 1GI6A 1YPKH 3M5MA 1XVMA 2Z3DA 4XOJA 2ESTE 3B23B 5H4IB 2CK3D 5GPIB 1O3FA 3QO6A 1H8IH 1BRBE 1A0JA 2Z3EA 1ELCA 2Z9LA 2H9TH 1XUHA 1TE0A 1ZHRA 1IQHA 1GI5A 3UREA 5DP6A 1ARCA 2GV7A 2B0FA 4JK6A 3LU9B 1O3GA 3UTUH 3PV4A 2BQWB 2I6QA 1GHBF 4NA9H 3GCHC 1ELVA 4JYVH 3Q76A 1P12E 1BIOA 1P0SH 3U98H 1MBMA 4JZDH 1P2QA 1E0FD 1OP2A 4ABDA 1W10U 1VCWA 2ZFTA 1C1SA 2SGFE 5BRRE 2ZA5A 4NZLA 3Q77A 1IOEA 4DIIH 3MU5A 3MNCA 1W7XH 2Y7XA 1GBBA 3VPKA 2W7UA 3U28C 1DY8A 3ZYEA 1EZQA 1VZQH 3VXEH 3RMMH 1HJ9A 1QIXB 1Y3XA 1IQGA 1C9PA 1AWFH 4IMQA 1H9IE 1V3XA 2FOGA 1YPGH 1IHSH 2FEQH 3SI3H 1XX9A 1B7XB 4UD9H 4X6PA 3MU1A 1BZXE 1PJPA 1A46H 2EI8A 2RDEA 2KCOA 5FPYA 4NIYA 4Y7BA 5EU8A 4ZHLU 2AERH 1DWCH 4I8JA 4D8NA 1TOCB 5JDUB 1UTMA 1JMOH 1BB0B 1QL9A 2BHGA 1H9HE 1TAWA 3LGYA 1O3KA 3V13A 1K0HA 1D6RA 5CDFE 2ZFFH 1P8VC 1W8BH 3UQOA 1KXAA 4P00A 4ABJA 1V2OT 4FUGA 1TGNA 5TCCA 1F5KU 5IK2D 1QJ7B 2VWNA 4JYUH 1P04A 4X6NA 1NRPH 1SFQB 2LP6A 4ABIA 1FUJA 1L2EA 2BZAA 1EAIA 2J9NA 3SV9A 3T26A 1GCDA 3A7TA 2BZ6H 5CMXH 1THPB 2EI7A 3T5FH 4F48B 1FPCH 1FNIA 1IQFA 4FUHA 4GCHG 4NG9H 3EE0B 1BMNH 3UY9A 1NC6A 3GY5A 5GCHG 5JYIA 1L1GA 2XC4A 5C67A 4YXWD 2PUQH 3UPEA 1IQEA 3LC5A 4YLQH 1FY5A 4JCNA 1N8OB 1V2UT 2F9OA 2PFEA 4WVPE 4F4OC 4FUBA 1WOFA 2QXHA 1C1UH 4ISOA 3A85A 3UUZA 1MU8B 5ETXA 2Z3CA 5A8ZA 3T29A 1S85A 3GCNA 5C1YA 3AK5A 1GBLA 4TY7A 1DITH 2V0BA 1OYTH 1C1MA 2SGEE 5FX5A 4Q7XA 5JB8S 1LDTT 3SW2B 1P2JA 2WV4A 1HAIH 1Q2WA 3A80A 1GMCF 1VJAU 2WPIS 2BOKA 1NFWA 1BMAA 2NU1E 3MHWU 4KTCA 4NA8A 4WY3A 3S7HB 3MO6A 2ZGBH 4D76A 3SV7A 3U1IB 1QQUA 3RXGA 3OAAD 5FHTA 4A6LA 3SZNA 2J95A 3W1EA 1GJ8B 2AYWA 4IW4E 4K8BA 1QFKH 1X7AC 4E06H 1V2KT 3NRLA 4DGJA 4YZUA 3SNAA 1KLIH 1N6XA 3WWBA 4E7NA 1GBKA 1H8DH 2OCVB 3VGCB 1WYKA 1GI7B
chains in the Genus database with same CATH topology
4I8HA 3LJJA 1BTWA 2ZPQA 3GY3A 4IS5A 1M9UA 2C8WB 1JOUB 1HBTH 1UTQA 1FDPA 1BBRE 1GJAB 2WPJS 1G2LA 4H42U 4Z6AH 4O03A 1YC0A 4NIXA 3UNQA 3EA7A 2UWPA 3IITA 1OWIA 2BD5A 3TITA 2ZDVH 4M7GA 1TOMH 2F9NA 4AGKA 2BTCE 1UHBA 3ZZ8A 2A1DB 5GIBA 1SC8U 1HIAA 1SB1H 2GT8A 4JZIA 4IGDA 1S6FA 1EX3A 3TGKE 3F68H 2F83A 4ASHA 5HM9A 1GGDB 5I46H 3F9GA 2AFQB 1EUFA 1KXDA 1N8OC 1ZSKA 1PPEE 3U8OH 1TGTA 4PROA 1Z6JH 2C93B 5TCAA 2Q6GA 1O3CA 1ZTKA 1F92A 1Z1IA 3GYMA 1RJXB 1BJVA 1TGSZ 2ZGJA 2Y80A 3UNSA 2ZFRH 5C1UA 1NESE 4XBCA 2Z9IA 4CRBA 4NIVA 2AMPA 2BD3A 3BTTE 3EGKH 2HRVA 2ZTZA 1UCYH 8LPRA 1BT7A 1PYTC 3SOSA 4ABAA 1A61H 4BXSA 3SJIA 1GHBG 3P8FA 4GUXA 3TPIZ 3AW0A 1DWBH 1SBWA 3H7OA 1LVOA 1K21H 3MO3A 3P92A 2FOMB 2C4FH 1YYY1 3MU8A 3RXAA 1EZSC 2A5IA 4Z0KA 3EA8A 3VGCC 2WYGA 2ZC9H 1FV9A 1QTFA 2BD8A 2SFAA 3MU4A 1O5BB 3E6PH 5DP4A 3S9CA 1P11E 3TH3H 1VJ9U 1FZZA 2R2MB 1DWDH 4JZFH 3RXRA 1EP5A 5JBCS 2LNCA 3UR9A 5A8XA 1RS0A 1ELEE 1P2KA 2C8YB 3B9FH 1AE8H 1TMUH 5EW2H 1QJ1B 7KMEH 2ZECA 3MH6A 4LOYH 5C5NA 2ZEBA 1BRUP 3JZ1B 2ANMH 2GZ8A 5F8TA 1EOJA 2FS8A 3ATIA 3MMGA 5FPSA 1GGDC 4DIHH 3BEIB 2B8OH 1J17T 1FY4A 1P02A 5E0HA 2RA3A 3SUEA 3RMNH 1O39A 2Y81A 1YPHE 1OP8A 1OOKB 2QAAA 4A1XA 2GDDA 4NFEA 3SV2H 1GHVH 3ATMA 2XXLA 5L6NH 1FI8A 1WBGB 3QTVH 4AGJA 1GJBB 4X8VH 1PPZA 4TWYA 3TNTA 2Y5GA 1LCYA 3LC3A 1P09A 1XKBC 1GJ9B 3RP2A 3T2NA 2BQ7B 4BAHB 1ETSH 5A2MH 3SU2A 4BAMB 3LGUA 2GZ7A 1HYLA 2QC2A 3RXFA 5DKMA 3OSYA 5FXLA 5A8YA 2P3FH 3M7TA 1O2SA 3SU6A 1ELAA 2YOLA 1PQ7A 2DE8A 1RIWB 1LMWB 1V2PT 5EPNA 1ZSLA 1THSH 1CT4E 1O3LA 2IOTA 5A09A 1GMCG 3U69H 1YCPH 5F6MA 3SJ8A 5F8ZA 1TMTH 1SFIA 4AFUA 7GCHF 2KAIA 1FN6A 1C2EA 1QCPA 1ANDA 3E1XB 3SUGA 4UONA 2AEIH 2HPQH 1EATA 3O8CA 1FLEE 1MKWK 3SQEE 2VWLA 5J4QA 4D9QA 5FPTA 4I32A 4MG3A 4HFPB 2V3OH 3URCA 1XUFA 5EQQA 3ZVEA 1UVSH 4DY7B 3Q3KA 1O3PB 1GMHF 1MAXA 2ZFPH 4HTCH 2Y5FA 4X2YA 2BLQA 1AKSA 4CRDA 3RXJA 4WF8A 1QBVH 2HNTE 2YNAA 1C1VH 2G51A 3BTEE 2XC0A 1ELDE 2BDBA 1C5LH 1IQJA 1AVXA 1BJUA 4FUCA 2TRMA 3DHKH 2HNTF 1NROH 3VFEA 4B74A 3BG8A 5ESBA 1MTUA 2FOAA 1GJ6A 2BXUH 3QDZB 4BTUB 2V6NA 1DLKB 2QXJA 3UQVA 1A4WH 3BTME 2P3TB 2XW9A 1IQLA 4DOQA 1SHHB 3RXIA 1C5UA 1GBAA 4XFQA 2ODQA 1K2I1 1SGNE 3A8DA 1O2UA 3QZRA 1O2NA 1CHOG 4O3TA 5C3NA 3AASA 4A1TA 4QT8C 3QUMP 1UTPA 3RXCA 3TIUA 1RIWC 1DANH 1RTLA 1TPSA 4I7YH 1ZMNA 2Z7FE 1UJ1A 1SMFE 4FU7A 1DICA 2G52A 2HOBA 2HVXA 1LPKB 2OUAA 2C90B 4K1SA 4Y8ZA 1ESTA 2G5NA 2AGIX 2BD4A 2BDHA 1G2MA 2V3HH 1YCPK 4A92A 1O2VA 3PROA 4J2YB 3GISB 3PLBA 3W95A 1Y5UT 1GBHA 3PMBB 1OX1A 2BM2A 2J4IA 2BXTH 3QK1A 1BRAA 1G3DA 3CS7A 1A1RA 1TX7A 3IG6B 1Y3VA 2BY5X 5GWZA 2W3KA 1XUJA 3HKIB 3L3TA 2O8TA 5LPFA 3KCGH 2ZI2H 1O32A 2O8WA 1QGFA 1J14A 4NFFA 1SGQE 7LPRA 2PKSB 2BB4A 1OWHA 1TPOA 1AO5A 3ODDA 5AHGH 6CHAB 4I31A 1O5FH 1CT0E 1TRMA 4WMEA 2J2UA 1V6DA 3SU3A 1DWEH 1A5GH 2FYRA 3RMOH 2ODYB 3MWIU 2FMJA 1IQMA 1CHGA 1CE5A 1ETTH 1JRTA 3E0NB 1DSUA 4GPGA 2PSXA 4K5ZA 4X6MA 1GCTB 2GKVE 2H5CA 3SNBA 5T6FA 1C5OH 1O2LA 3BG4B 4KGAA 1C9TA 4RSPA 4A5TS 4U01A 5HXFA 5E2PA 2SGPE 2GMTB 2B9LA 4ISNA 1TBQH 4ZHMU 1C5WB 4ABEA 1EB2A 2A7JA 2VIOA 2FYQA 1T8LA 3K2UA 2XBXA 2FPZA 2HALA 2Z9KA 4TWWA 3S9AA 1NM6A 1ACBE 1LKAA 2FLBH 1QQ4A 2OLGA 2P3UB 3PB1E 3GOVB 1BDAA 2JH0D 2P8OC 3RXVA 3LONA 3AVZA 2NU2E 1QHRB 4ABGA 2FX6A 1NRNH 1W14U 1OSSA 1F0TA 1JRSA 1ZRKA 2QF3A 1FY8E 4VGCB 3ATKA 1T7CA 1AFQB 1FXYA 4MPXA 4XDEA 2P93A 1LQEA 2SGDE 3ENSB 4IC6A 5LGOA 5C20A 1QY6A 1YPEH 3SGBE 1O3EA 3BF6H 1C5RA 2R9PA 3RXLA 1KXFA 2PKSC 3KQEA 6CHAC 5HYOA 1TGBA 4CHAB 4RKJB 2STAE 5LPRA 1D3DB 1UVOA 3TH2H 1D3QB 2BX4A 3MNSA 2BD7A 1ID5H 3RXKA 3GCTF 3SU5A 1FQ3A 3U9AH 4TPYA 1UVTH 2CHAC 3UWIA 1EAXA 1K1PA 1GCTC 1OWEA 1OXGA 2OC7A 4AG1A 1BOQA 1O35A 2A4QA 1XXDA 3S7KB 3BG4C 1CU1A 2Y5HA 1XUKA 1SQAA 4AYYB 1QRXA 3LOXA 1GVZA 1C4U2 2GMTC 1HB0B 1P2MA 1SOTA 3A86A 3ZZ6A 2ZWLH 1DXPA 4AFZA 1GPZA 2ZZUH 3RDZA 1DY9A 2A45B 1Z8IB 2XTTB 1O0DH 3RU4D 1SLWB 1CSOE 1VITG 3N7OA 4FVDA 5HM2A 4BAOB 1O5AB 3AAUA 1GI2A 2ZDLA 3M7UA 3GY2A 3NUMA 1ZR0A 2OQ5A 2QF0A 2FX4A 2ANYA 5C5OA 5I25A 3PTBA 1J9CH 1QURH 2OC1A 3MI4A 1MCTA 4GSOA 1EJAA 2FESH 2SNWA 1W13U 2NU4E 2O8UA 2TPIZ 1DFPA 1PPFE 2XCFA 4VGCC 1AFQC 2ASUB 3STIA 1N1LA 3RUOA 1YGCH 1GL0E 2CGAA 2G8TA 1C5NH 3DFLA 3E3TA 1C1TA 4X1QU 1O2ZA 2IN2A 3HATH 1SGDE 1AD8H 3GYLB 1ZMJA 4DW2U 4X1NU 1DLEA 2FXRA 2XCNA 1UHBB 2FLRH 1HIAB 1VGCB 4MPWA 5JPMH 4Y7AA 4CHAC 1CQQA 4ABBA 4KP0A 4Y76A 2NWNA 3RC4A 5HGGA 2VWOA 3SN8A 9ESTA 5DO4H 3RU4E 1BTUA 3ZVCA 1S5SA 1ANBA 3SHAH 1CA0B 1XVOA 1HRTH 4YT6H 2P95A 1YBWA 1P05A 1FAXA 4NIWA 4WMDA 1HUTH 4K69A 3ZYDA 4B76A 5K0HA 1P57B 3BEFB 1MQ6A 1Z71A 5A0AE 3KL6A 4ZMAH 1L1JA 1AN1E 3SHCH 1IQIA 1EZXC 4JYTA 5IYTA 3KIDU 3F9EA 3LDXH 1V2ST 3E90B 1G3CA 1PQ8A 2VIQA 1HAPH 1YPMH 5DP5A 3ZVBA 3RXMA 2BVRH 2P59A 4LXBH 1FMGA 1LPGB 2BOHB 5SGAE 4I8KA 1HXEH 3O8DA 1PYTD 4K1TA 2ZU1A 4TPIZ 2VIWA 3RM2H 3QLPH 4LZ1H 5LPEA 1GVLA 4JZEH 4YTAA 1C2IA 1C1QA 1EB1H 1ZJKA 1DS2E 2BQ6B 2FOCA 1TRYA 2EI6A 1SQOA 2LPRA 2VVVA 2YNBA 3QX5H 1EJNA 3E8LA 1FJSA 1ABIH 1TBZH 2TGPZ 4FUDA 4YOGA 1ABJH 3PO1B 4X2WA 5EXLA 1PPGE 2ZDNA 3BTQE 4BTIB 2TGAA 2OC8A 1WU1A 4YT7H 1ZOMA 2PSYA 1VGCC 3I29A 2PHBA 1TQ0B 3QZQA 1LVMA 3MNXA 3VB5A 1T31A 2ZP0H 4YOIA 1GBJA 1GI8B 3OTJE 1S81A 2W3IA 2C8XB 3HPTB 5B6OA 1JWTA 1P2IA 2H5DA 4MTBA 1CA0C 3E91A 3O8BA 1B0EA 6GCHG 3MH5A 4INLA 2BY6X 2PW8H 3A84A 3VB3A 1PQAA 3GDUA 1MKXH 3FP6E 4NZQA 1IQNA 3PMHB 2VH0A 1O3JA 1GHZA 3SU0A 3VB4A 3FZDA 1CO7E 1C2LA 1BMMH 1C1WH 1ANCA 1AHTH 1V2MT 1ELGA 4OS4A 5JB9S 2GDEH 4U32A 3HK3B 3OX7U 2ZHDA 1UTOA 2GCTB 1B5GH 4OS7A 1DT2A 4UFGH 2RA0A 4FXGH 4HZHA 5EQSA 5EOKA 1IAUA 2BDGA 2GX4A 2VH6A 2AMQA 3W94A 4ZH8A 1O3OA 2Q6DA 2CF8H 1V2JT 3ATWA 1BHXB 1FAKH 3A8AA 1UK3A 2HGTH 4SGAE 1TQ7B 5EQRA 4K1EA 1AGJA 1Z8JB 1LO6A 3Q3YA 5EODA 4O9VA 4E7RG 1YLDA 1D3PB 2ZKSA 3MO9A 4AZ2B 2A0QB 4Q80A 4TYDA 1GHYH 3T25A 3PO1C 2FTLE 2XWAA 3V3MA 1C1PA 1HAGE 2CN0H 2WPLS 1G30B 3HK6B 2PLXA 1GJ5H 3PWBA 2IPHA 4Q7ZA 3KF2A 1GJ4H 1HNEE 1O2TA 2F3CE 1WAYB 1GI4A 1QR3E 2C8ZB 2PWXA 3TK9A 4Y79A 5FX6A 3V0XA 4AB8A 1F0UA 1RTKA 3MFJA 1Z8GA 4UDWH 3A7WA 3A83A 1E38B 4X2XA 4OS2A 4Y10E 1NFUA 4IN2A 7ESTE 1MKXK 2OBOA 2AGGX 2IJOB 1S0QA 1F7ZA 1MKWH 1EASA 1GBMA 3S69A 4DG4A 3EQ0H 5F8XA 1C4Y2 2Z6BD 1DX5M 1WQSA 5JBAS 4BAKB 1O2WA 1KDQA 2G4TA 2Z9JA 1Y3YA 1EKBB 2GCTC 3SV6A 3ESTA 3A87A 4XBDA 3K9XB 1Q31A 5PTPA 1C2JA 8ESTE 2PGBB 4J1YA 3CP7A 1A3BH 2P94A 2VB0A 3ELAH 4Y6DA 1TIOA 1Y3UA 3KHVA 1YM0A 3M3TA 3IWMA 3SQHE 2UUJB 1TNLA 4KTSA 1EPTA 5AF9H 3RLYH 1C5XB 1SGIB 1C1RA 1LHEH 1D3TB 1HAXB 1MZDA 3OU0A 2FI4E 3M3VA 1BBRK 1V2WT 1C2GA 3OY6U 2VU8E 3ZZAA 4X2VA 3KN2A 2A32A 1S83A 3SUFA 2VIVA 5DK1A 4X1PU 2BVXH 3STJA 3ZV9A 1GMDF 1TFXA 5EXMA 3SI4H 1ZGIA 3EAJA 2OTVA 2ZU2A 1MTSA 1C1NA 9LPRA 1XUIA 2ZDMA 1A2CH 3BN9A 3LGWA 5K7RA 3FAOA 3ITIA 4FU9A 5DP3A 3K65B 1A0LA 1OYQA 1EAUA 2GD4B 4MDSA 5FBIA 4ISIH 2RDLA 2VIPA 4WJG2 1TPPA 1HDTH 1TA6A 2WYJA 3GDVA 4UE7H 3S9BA 3SV8A 4GAWA 1O30A 2WPKS 3R0FA 1UTLM 1QRZA 1A3EH 2PKAB 1ZLRA 2O8LA 3UOPA 1IHTH 1J8AA 5E0GA 1OP0A 3F6UH 2BDCA 2A2QH 1MTNB 2ZQ2A 3GDSA 3M36A 1K1IA 1E37B 2QCYA 5C1XA 1UTNA 4MVNA 1H9LB 2GTBA 1B0FA 4NGAH 3VEQB 2ULLA 1WCZA 4X1RU 4H6TA 2ALPA 4K60A 3BV9B 1GBDA 1AI8H 4NSVA 1BCUH 1BQYA 2GGVB 3HGNA 1GHAF 2A31A 1LHGH 2OBQA 3QGNB 1K28D 1W11U 3LPRA 3PMAB 1KTTB 1O2HA 2D2DA 4ISHH 1O2JA 4IC5A 4WH6A 1MU6B 2M5TA 4RKOB 1ZRBA 3MH7A 1NFYA 5T3HA 3SNCA 2VVCA 2G55A 3BIUH 3TNSA 1NU7B 2FS9A 2ZU4A 5E8EH 2THFB 1MAYA 5DP8A 1BTYA 3PLPA 1O5GH 2FODA 1TMBH 1YF4A 3LH3A 1SOZA 1BTHH 1EQ9A 4XE4A 1WTHD 1HXFH 3KQBA 1NN6A 4X6OA 2R3YA 2OINA 5FBEA 1PQ5A 1VITH 4D7GA 1JIRA 4ZXXH 4B71A 3RXQA 4MPUA 4O3UA 3TJVA 1ZSJA 4X8UH 1W3CA 1BMLA 1SGFA 1GHXH 4Q7YA 3LGTA 1C5MD 1QBNA 4MNWA 1FY3A 4ZROA 1NRQH 4FUIA 2ZHFH 4WWYA 2G81E 1RD3B 2CJIA 4KKDA 3SBKA 2Q1JA 2ANWA 1MTNC 1TX6A 2PUXB 1BTZA 1QB1A 3Q3XA 1AMHA 1H1BA 1RRKA 2H1UA 5FCRA 4AN7A 3RXTA 1KLJH 1O33A 3P6ZB 2HWLB 1O3BA 1O2OA 5GCHF 1FIZA 3PWCA 1SI5H 2H9HA 4CR9A 4CH8B 3BTWE 4LK4A 1CGJE 2XBYA 1SLVB 3JZ2B 4IMZA 2TGDA 2RCEA 1INCA 4NA7A 4UFDH 1C2DA