4FVBA

Crystal structure of ev71 2a proteinase c110a mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
b'SGAIYVGNFRVVNRHLATHNDWANLVWEDSSRDLLVSSTTAQGCDTIARCNCQTGVYYCNSRRKHYPVSFSKPSLIYVEASEYYPARYQSHLMLAQGHSEPGDAGGILRCQHGVVGIVSTGGNGLVGFADVRDLLWLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2A proteinase
publication title Conformational Plasticity of 2A Proteinase from Enterovirus 71
pubmed doi rcsb
source organism Human enterovirus 71
molecule tags Hydrolase
total genus 34
structure length 138
sequence length 138
ec nomenclature ec 3.4.22.29: Picornain 2A.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvbA01
3SUFA 2AEIH 5DP8A 3WY8A 1OWIA 2ZU5A 3KHVA 4Y11E 1SGFG 4IN1A 3Q3XA 1C2HA 3RM0H 1ZZZA 3KQEA 1GHYH 1MMJN 1TOCB 3M5MA 2R3YA 1TPPA 2P3TB 1SOTA 1GBHA 2PKSB 3QX5H 1ZMNA 3IITA 1C5PA 4KELA 5L2ZH 1QGFA 2THFB 3GDUA 5F8ZA 2A4QA 1P9SA 1TMBH 2ZGXH 3S9CA 2ZC9H 1O5FH 1FY1A 2BD4A 1KLJH 3MU8A 2OUAA 3SGBE 4O9VA 3K6ZA 3NK8A 4X6MA 3BIUH 5JB8S 1HDTH 3UREA 2DE8A 1QRXA 1OKXA 4Y8ZA 1CU1A 1EOLA 1F92A 4M7GA 4B76A 1YPLH 1K22H 4I31A 1O2KA 3PLPA 2FM2A 4B73A 4I7YH 1O5CB 1OWJA 1DFPA 5IDKA 4Y8YA 4I33A 3ZVBA 1W0ZU 3RXCA 1ZGVA 1XUFA 1O2WA 2C4FH 4TY6A 8KME2 1CSOE 2VIDA 4SGAE 2DE9A 1CE5A 5A2MH 2B8OH 3M36A 4Q7XA 5T6GA 3GCTF 1UO6A 1ZMLA 3QZRA 3ELAH 2FO9A 4X2VA 3DFJA 2ZHDA 3K65B 5AHGH 3STIA 4CR9A 3RM2H 3UIRA 4LXBH 1C4V2 3M7QA 3K6YA 4FUEA 2Y80A 4K69A 4U01A 1HPGA 2TGDA 4D76A 3F68H 1K1OA 5BPEA 1C2DA 2QAAA 3H7OA 1NU9A 3BIVH 3KN2A 2FDAA 5EGMA 1V2KT 3BTQE 3RXLA 1FONA 2GDDA 1TLDA 3RXKA 1V2RT 3L3TA 4HTCH 2AYWA 4X8SH 1TRYA 4FUBA 3Q76A 5C5NA 1BHXF 4CHAC 1UTJA 4ISIH 5DP5A 1OWDA 1JMOH 1PYTC 3T27A 1FI8A 2AMPA 1O3JA 2HOBA 4Y76A 1KXCA 1PQ8A 4INKA 1SHYA 1WCZA 4NA8A 4CBNA 2AH4X 1BB0B 1EZQA 9ESTA 2P8OC 4X8TH 3SNBA 1GBIA 4ZXYH 1T32A 1ZRKA 2FOAA 5FPYA 2VWOA 5J4SA 4Q7ZA 2A4GA 1GGDC 1WYKA 2CXVA 1O35A 1YYY1 4R8TB 1AFQC 5SGAE 1RTFB 2OC0A 4FUDA 4MNVA 5GJ4B 1CA0C 1F0SA 3M37A 4GCHG 1YGCH 1MZDA 1BJUA 1ZTLA 3H7TA 3BTTE 4I8GA 1C1PA 5JBAS 1O3CA 3M35A 1IQLA 5FPSA 2Z94A 4CHAB 1DSUA 2A31A 1B0FA 4MVNA 1G37A 4U30A 5I25A 1TFXA 4HZHA 3RLYH 5FBIA 4ZXXH 4ISHH 1TNLA 1VGCC 1AE5A 1NO9H 3SUEA 2ZFRH 1UMAH 3JZ2B 3MMGA 1YCPH 1NS3A 4CRAA 4AX9H 2HNTF 1MBMA 4MDSA 1O3IA 5F8TA 4A1TA 1EKBB 1AFEH 2ZTZA 2TBSA 3QN7A 2OXSA 5FBEA 2B5TB 2ZCKP 1GGDB 2PGBB 5DGJA 4WH6A 1V2OT 2J34A 3TH4H 1CA0B 4DY7B 1ACBE 3IG6B 4FVDA 3URDA 3SJ8A 3RXJA 1NU7B 1TX8A 2NWNA 2PTNA 5E2OA 3PWBA 4IS5A 4CRBA 2Y5HA 1BBRK 4OS2A 1V2WT 3SI3H 2A45B 1HAPH 3LONA 3SNCA 1O2OA 4AFSA 3EE0B 3SV8A 4AYYB 4DW2U 3LDXH 5E0HA 2ALPA 4X1SU 1VGCB 1C5TA 4GLYA 3RXPA 2A0QB 7LPRA 5FCKA 3A7VA 1O5GH 2ZGJA 4FUHA 2FPZA 2FP7B 5FXLA 2JH5D 4YLQH 3STJA 3QGNB 3ZZ6A 2OTVA 4AB8A 4FVBA 1KDQB 4MNWA 3A84A 4OS6A 3FFGA 3SQHE 5GXPA 1P06A 1GVKB 4OS4A 1OSSA 3R3GB 1BMNH 1DXWA 3F9GA 3RXUA 1C1QA 5CHAC 2QV1A 4KGAA 1QB9A 2PWXA 1QQ4A 1C1OA 2QXIA 5FAHA 4CRCA 2FOFA 1CHGA 3GCTG 1XMNB 1UTOA 2G5VA 3KQBA 2VGCB 3BEUA 1GHAF 3TLOA 2C90B 3TU7H 1SGRE 1TGTA 3E1XB 1FQ3A 2BDHA 3QO6A 1ANCA 1NY22 3NXPA 1P57B 1DANH 2V3HH 4O97A 1HJ9A 4R0IA 4DOQA 1ZOMA 2WINI 1PPEE 1ANEA 1A3BH 2BMGB 1FY5A 3AAUA 3C27B 1O3LA 1D3QB 1GBDA 5K0HA 3HGPA 3EA9A 1N8OC 1PQ7A 1T8OA 1O3MA 3OYPA 2QXHA 3C1KA 2FTMA 4NA9H 2VH0A 2H9EH 1D9IA 1GWAA 1A5IA 2IPHA 4D7FA 1AZZA 1SVPA 2R3UA 1GHBF 1HBTH 5CHAB 8LPRA 1A1RA 1GJBB 4B1TA 1VCWA 1ESBA 2V3OH 1EPTA 4I8LA 1F5LA 2HLCA 1Z6JH 1PPFE 3MFJA 2R2WU 1AVXA 2XBWA 1UCYE 1W10U 4Y0ZE 1GVLA 1RIWC 1O2UA 1FN8A 2ZGBH 3W94A 1WQVH 3MU0A 1KTTB 3F9HA 3L6PA 4O3UA 2F9PA 3CS7A 2QCYA 1EAXA 2QYIA 4K1EA 1XVOA 2CF8H 3BV9B 3RLWH 1QY6A 4THNH 2H1UA 3S7KB 1N8OB 1P2MA 1F0RA 3MH6A 1MCVA 1A46H 2Z9LA 3ZV9A 4ISNA 2O8WA 5CMXH 1GMDG 4AYVB 1SLWB 2P95A 4A7IB 3GY2A 3DA9B 2EI6A 4B75A 1ANBA 1D4PB 4OGYA 1DWBH 2I6SA 2Z3EA 1C1SA 1V2MT 1KIGH 1LQDB 1O2SA 1BRCE 4NGAH 3SN8A 3OSYA 3RU4D 2OC7A 1QFKH 4JZFH 2BX4A 2HRVA 1MQ5A 2AIPA 3D62A 3LH3A 2F9BH 4B71A 1D6WA 1ESTA 1NTPA 4NWKA 1JOUB 3RUOA 3RXVA 3LC5A 2Y7ZA 1RIWB 3HKJB 1ELAA 1FZZA 1EJAA 3P17H 4ISLA 3RC4A 5FX5A 3GDVA 1ETTH 3D65E 4Y6DA 2GV7A 2BY9X 1HAVB 3HPTB 4Y79A 1GVZA 3TNSA 2ZPRA 4TPYA 5AFZH 2FMJA 5ABWA 1XM1A 1ELCA 3SUGA 2BY8X 4X1NU 3ZZ8A 1BA8B 3B23B 2SGQE 1G2LA 1H9LB 1P3EA 4D8NA 5C2ZA 4LZ4B 1JWTA 2P93A 1LPGB 1THRH 1HAVA 1O2HA 2CJIA 1DWDH 1ZGIA 3A7TA 4FUIA 3SU6A 3F9EA 1YCPK 1K28D 2RG3A 3UNRA 1TGCA 3ZVAA 1AE8H 1IQGA 1Y3WA 4Y71A 1W0YH 2FOHA 1KY9A 1GJ9B 4BAOB 1IQKA 1VJAU 3VGCB 1G3EA 4ZKNU 1C1UH 3GYMA 5L30H 3RU4E 5LPEA 4INHA 2O8TA 3UWIA 3ATMA 1FY3A 1KXFA 2P16A 4TYDA 2F83A 1V2VT 2FX6A 2QN5T 4YOGA 3RXOA 1SFIA 2VIPA 1A0LA 1BOQA 1RTLA 3LT3A 2FESH 2ZF0H 3BEFB 2A5IA 5A0AE 2GCHF 4H6SB 2Y5GA 3PTBA 3SJOA 1DLKB 1P0SH 2F9UA 2BOHB 1AY6H 2UWLA 1P2QA 2PV9B 2WUCA 1IHTH 4GUXA 1TMUH 1GHAG 1HJ8A 2JETC 2M5TA 1E34B 1DUAA 1ELFA 1C5QA 2EA3A 2BZ6H 4TPIZ 1LVBA 1G9IE 4MG3A 4B74A 3OTJE 5EQRA 1HCGA 3QGJA 2EI8A 3E8LA 3V12A 4ZKRU 1O5DH 2FLRH 3QK1A 3SHAH 1ZR0A 4DVAU 2TPIZ 5JBCS 2WV4A 3FP7E 4MPXA 3GCNA 2WPKS 1F7ZA 1L4ZA 1O5AB 2ZFPH 1W3CA 2D1JA 1TQ0B 5EXMA 2WPLS 2ZU1A 2A2XH 3UNSA 1TNHA 4CREA 1YPEH 1QB6A 2RCEA 2GDEH 1TABE 1TGBA 4FU7A 3UPEA 1Z6EA 3P8FA 1CVWH 4ZH8A 1L1NA 1GI3A 2CGAA 2FYRA 4JK5A 1THPB 1LQEA 1OWEA 4ZROA 5HM9A 3GY4A 1C1MA 3CS0A 2QF3A 4CR5A 3FP8E 5JPMH 1FNIA 2JETB 4ESTE 2O9QA 1V6DA 1BTUA 1UVPA 2Z9JA 4BTIB 2HPQH 1SOZA 1MUEB 2H6MA 4H4FA 1MTNB 1ZHPA 2GMTC 1JBUH 6ESTA 4UFEH 2ZHEH 3NCLA 4MQAA 1O3KA 1J16A 1MCTA 2XRCA 1IQNA 1YPJH 3QTOH 5K7RA 5GWZA 3BSQA 3QUMP 1MAXA 3ZZ4A 4AG1A 3FANA 1MQ6A 1T7CA 1G2MA 1GHXH 2VIQA 1O31A 5EPNA 2GT8A 4NG9H 3A89A 2FOMB 1O34A 1THSH 3TGKE 1DWCH 4DCDA 3ITIA 4KP0A 1FY8E 1DSTA 1TX6A 1OYTH 4IMQA 3KNXA 2P3UB 1O2JA 5DP6A 3MI4A 1PPHE 2V0BA 4CRDA 4YT7H 1HIAA 3PMBB 3M5LA 2BDGA 2ZG0H 2AMDA 2VB0A 1SGEE 1W11U 2OBQA 1VITH 4Y7BA 2TGPZ 1TNKA 4RKJB 3ZYEA 1T8NA 3S7HB 1AO5A 1ZPCA 2VVCA 1RJXB 1UK3A 2W3KA 1B0EA 1CQQA 3P92A 3TNTA 1Z1JA 1ETSH 1XUGA 3EAJA 4GSOA 4NCYA 3RC5A 1P2OA 2A4OA 4X8VH 2Y6TA 2ESTE 1WBGB 1QL8A 1SL3A 4X2XA 1EATA 1JRTA 1EX3A 1UHBB 3U1JB 1EQ9A 2UUYA 3LU9B 4AB9A 1OS8A 2AIQA 5DK1A 2STAE 3GOVB 2BD8A 3LGYA 2UUKB 3MU4A 5TJXA 2D2DA 3GCHC 4ZHMU 1IQMA 1ZJKA 1BBRE 1C1TA 1LHGH 3MO3A 5DP9A 1HAZB 3UOPA 3LH1A 1UTLM 1XUIA 2OC1A 4A6LA 2BB4A 1DICA 1SB1H 1FUJA 1LHCH 1V2JT 3O8RA 1BTPA 1TBZH 1O36A 5E2PA 5G4BA 1OXGA 2G55A 1KXEA 5LPRA 1HJAC 1BUIA 1VITF 5A0CA 3QTVH 9LPRA 1SQAA 1GHVH 1Z7KA 2QF0A 1K2I1 2ZU4A 1NESE 2G52A 1BMAA 1NT1A 1Y59T 1QCPA 1F5RA 4XSKU 1KLTA 3ZVDA 4O3TA 2NU0E 2R0LA 3PYHA 1FIZA 1O32A 1GBMA 1SGFA 1C2MA 1RGQA 3GCHB 1SFQB 2BQ6B 3A8BA 1SMFE 3T29A 4UD9H 2GVFA 1YPHE 4MNYA 2QA9E 1TRNA 2GP9B 1AN1E 3AW0A 1EZSC 1HXEH 4Q80A 3SU0A 2XBYA 1OX1A 2XYAA 1Y3UA 2FOEA 4BAMB 1Y5AT 1O39A 3PO1C 4DURA 1K1PA 1ZHMA 4CH2B 1O3OA 1GI5A 7GCHF 1HJAB 1P8VC 1WSSH 1C9TA 2AFQB 1EZXC 1DE7H 4D7GA 1O3AA 2C93B 4B2BA 3TK6A 3TPIZ 4D9QA 2BX3A 1LHEH 2W26A 1TAWA 5DJ7A 3SU1A 1M9UA 2NU1E 1P02A 3PTNA 1O5BB 3VXFH 2BHGA 4X2YA 4JYVH 4TWWA 5EU8A 2OBOA 2LPRA 2V6NA 4XBCA 2GCTC 3RC6A 3TK9A 1V2ST 1AKSB 4JZIA 1FIWA 4YO9A 1YPKH 1LVYA 1GL1A 1ZPBA 7KMEH 1P10A 1QURH 2XBVA 3S9AA 1S85A 5C20A 5TCCA 1SGTA 1NRRH 3BTDE 5DP3A 2GV6A 3UQOA 5L2YH 4ZUHA 3LGTA 1SLUB 1TOMH 3NPSA 1A7SA 2LNCA 1LPZB 4DG4A 1VCQA 3PO1B 3LC3A 3UNQA 1AKSA 2GZ8A 4AOQA 4AGJA 1HAIH 3GICB 4JYTA 3KEEA 1TALA 1O3PB 4FUCA 1N1LA 3KIDU 4JMYA 2VWNA 3VB5A 3E16B 2SFAA 1VZQH 1ZPZA 3LPRA 3BG4C 3RXGA 3FZDA 1AB9C 1DUEA 3TIUA 3OY6U 3OY5U 1WV7H 4SGBE 1GJ6A 1O2YA 2EEKA 1P03A 1QRZA 2XXLA 3VB6A 2WPHS 1ZTJA 3SU5A 5B6OA 2ZDVH 2ZFTA 1W2KH 1AI8H 1BRUP 1DXPA 1ZRBA 4JZ1A 4WMDA 2JH0D 2OD3B 1C2IA 4BAHB 2P8OB 1O3FA 4GHQA 3I78A 1TPSA 2XC4A 3MO6A 2GZ9A 1S83A 1A0JA 2A2QH 4PROA 4K5ZA 2HNTE 3BTKE 1DLEA 4JZEH 3A88A 2ZPSA 1DX5M 1DM4B 2C8WB 3U9AH 1AFQB 6GCHF 2ODYB 1MBQA 1G3BA 1QBNA 1BITA 1ANDA 1GJ5H 3L33A 3S0NA 1WAYB 1MTUA 2QIQA 1L1GA 1YP9A 3E0PB 1GBFA 1YC0A 2TIOA 3K2UA 4YM9A 1JXPA 1HAXB 1AB9B 3QWCH 2PW8H 2ZQ2A 4AZ2B 2FWWA 2G8TA 2SGEE 1S82A 1KXAA 1K1JA 2O8LA 3A7ZA 2Y82A 1BTZA 1ELTA 3P6ZB 4E7NA 4LOYH 3DUXH 2BQWB 1NRPH 2XCNA 4NIWA 5TCAA 5EQSA 2BY5X 1C4Y2 1UK4A 4WY3A 4ASHA 3RDZA 3ZV8A 4YLUA 1TNJA 1C5OH 1D6RA 1C1WH 1HLTH 4KKDA 5JB9S 3A87A 4DT7B 1AVGH 3ZZ7A 2XW9A 1BTHH 2Q1JA 4BAQB 3BTWE 3GISB 1O2GH 4WH8A 1YLCA 5I46H 4DIHH 1QIXB 1HAHH 1MD8A 4ZHAA 1EAIA 4NFFA 1W7GH 4DJZB 1C2FA 1FJSA 5LH8A 2FS8A 4ABEA 1XVMA 3KQCA 3NZIA 3VPKA 1KSNA 1GI2A 2WV5A 1GBBA 4U32A 3AASA 3SV2H 3A8AA 4BXWA 1INCA 1KXBA 2FOGA 2F9OA 3Q77A 5EXNA 4AFZA 1Z1IA 1HAYB 1KDQA 3ZZCA 6CHAC 2AERH 5GPIB 1UTPA 1QJ6B 2NU4E 3E0NB 3SI4H 3RMNH 3ZZ3A 4B2AA 4RSPA 4YOIA 1WOFA 2BD2A 4TWYA 1D3TB 1CGIE 1H8IH 1TONA 3UY9A 5BRRE 1DS2E 1EASA 1EOJA 2G4UA 4HI3A 1FPHH 2Y5FA 1TGNA 1QQUA 3BEIB 4X6OA 1G3CA 7GCHG 3RXIA 4IN2A 3PV4A 2CMYA 1A61H 2UUJB 1BRBE 1BRAA 1WU1A 4Y10E 1G30B 2CHAC 1Y8TA 2R2MB 3RXMA 3SU2A 1P05A 1C5YB 2G81E 3E90B 2ANYA 4YOJA 2P3FH 1T8LA 3EA8A 1PJPA 2ZDLA 4HFPB 4JCNA 4ZHLU 2BD5A 2BXUH 3M5NA 1P12E 1C5RA 1T4VH 5A8YA 4Q7YA 4XFQA 5JBTA 1P2JA 3PLBA 1MKWH 4UDWH 1C2JA 4NA7A 3P95A 1H4WA 1GCTC 2PFEA 1GI8B 2BVRH 4X8UH 1O2IA 1Y3XA 3HK3B 4AFUA 1SQTA 4K8YA 2ULLA 1AHTH 1LTOA 2HWLB 2ZA5A 1OWHA 1GBLA 1DOJA 2VNTA 2PLXA 1YPMH 1QJ7B 2SGPE 1SHHB 2B7DH 4RKOB 3ATLA 2FXRA 2VIWA 1K1NA 4X6NA 4X2WA 4BTTB 1KTSB 4ABGA 1G36A 1P9UA 3TVJB 1RXPA 1O3NA 3P8OA 2P94A 4BNRA 3BG8A 1XKAC 2CF9H 1TWXB 1A5HA 3GY8A 3P70B 1ELDE 1BQYA 1P2KA 3PMAB 3M7UA 3MNSA 3ODFA 1TNIA 1QA0A 4KTCA 1E38B 4FXGH 1FMGA 4WVPE 1LHFH 2XCFA 5JBBS 1XX9A 1E0FD 2G5NA 1DITH 4AORA 3R0FA 1U6QA 1AUTC 3QZQA 1DVAH 1LVMA 3OX7U 3O8CA 1GDNA 5J4QA 3U8TH 1OPHB 1V2NT 1LCYA 3A7YA 1HYLA 1QJ1B 4MTBA 3SHCH 4WF8A 4Q2KA 1J17T 2VIVA 5HM2A 3RXAA 1YM0A 1MTWA 3QLPH 5H4IB 3LGUA 1HAGE 1ELGA 1CHOF 4NWLA 8GCHF 2VWLA 1V2UT 3GCOA 1HXFH 2ZHWH 3LGWA 3MNXA 2ZHQH 1LO6A 1C5SA 2ZDNA 4WXVA 3SGAE 2ZIQH 4WWYA 4AN7A 3TGJE 1SSXA 4Y8XA 2BQ7B 4K2YA 1DT2A 4IC5A 1KLIH 4XDEA 2YNBA 1TIOA 3KCGH 5E0GA 3RXRA 1QBVH 1ZSJA 1NC6A 1AU8A 1O2LA 1P04A 2PUXB 1J14A 1O3BA 2UWPA 1GCDA 2QY0B 3UQVA 5E8EH 4NZQA 2BLWA 4H6TA 2A7CA 3ZZ5A 1MKXH 3ATKA 1J15A 3EYDA 3FAOA 1HUTH 1SGNE 5EOKA 2OQ5A 4NSYA 1GI9B 3A7WA 2GD4B 2ZDKA 3BTEE 1SQOA 2ODPA 1MD7A 3DD2H 3ATIA 1GJCB 1UVUH 2D8WA 1FXYA 1PPZA 1SGYE 1QHRB 4IW4E 1TNGA 3HGNA 5E0JA 3A81A 3GY6A 3TK5A 3A83A 1B7XB 3M3SA 1S0QA 5HMAA 2OCVB 1TYNA 4XOJA 2BD9A 1BDAA 5FHTA 1W13U 1GJ7B 2BZAA 2SGDE 1ZLRA 2ZGCA 3M3VA 1QRWA 1AWFH 1N6YA 3KQDA 1HNEE 1CBWC 3LJJA 1GHBG 3GY5A 2NU3E 2FTLE 4ABAA 3B9FH 1C1VH 2A32A 1BJVA 1C5XB 1Q2WA 2ZI2H 3E91A 3LJOA 3NKKA 3DHKH 3ZZDA 1UTQA 1S81A 1GPZA 1KXDA 4UE7H 1O2QA 2A5AA 2ZECA 2C8YB 1ZSLA 1NN6A 2ZGHA 1C1RA 2GKVE 1GMCF 4X1PU 1GDQA 7ESTE 1XXFA 1J8AA 4GVUA 2FZZA 2BLOA 2ODQA 3TGIE 3T62A 1VJ9U 1O2TA 4NIYA 1K21H 5FX6A 5C67A 2WPJS 2J9NA 1V2QT 1HAOH 1Y3YA 2F9VA 1GJ4H 1CGJE 1AIXH 2SNVA 4D9RA 4ABHA 2CV3A 3QDZB 1D3PB 4WJG2 1O2VA 1O38A 1PQAA 1ESAA 2YNAA 2Z6BD 1P01A 1S0RA 3GYLB 3V3MA 1CBWB 3S9BA 3MO9A 1A0HB 1NM6A 4FUGA 1NFYA 5C1UA 2ZU3A 1MKWK 5C1YA 1EJMA 2BD3A 3FZZA 3SU4A 3SV9A 1C2LA 2J92A 2W3IA 1N6XA 1EB1H 2C8ZB 1O37A 1V3XA 1K1IA 3A86A 5DP7A 1QL9A 3ZVEA 2ZDMA 1NFXA 5IYTA 1L2EA 2Q6FA 2GMTB 3TJUA 4ABJA 1WUNH 5T6FA 3A85A 3KF2A 2SGAA 2ZWLH 1P2NA 5EXLA 5C3NA 5F6MA 3E6PH 3I29A 3UWJH 2RDLA 3EGKH 1OP8A 3OU0A 1SGDE 1AWHB 1QR3E 3RXTA 1TMTH 3RXEA 3VB4A 1DY9A 3RMLH 1Z8IB 1TBRH 2Y7XA 5DKMA 1CHOG 8GCHG 2OINA 3ZZBA 1E37B 5GCHF 1UHBA 5GDSH 1S6HA 2ILNA 1C9PA 2KAIB 3RXBA 4LK4A 2EC9H 2RA3A 1TPAE 2BDIA 1GHWH 1JIMA 3W95A 1TGSZ 4UFFH 4A5TS 4ABIA 2PKAB 1DPOA 1HFDA 2AGEX 1QA7A 2AMQA 1GI6A 2A4RA 1SGPE 2AS9A 1LDTT 4OS5A 3P8GA 3RMMH 4UFDH 1O2PA 3SNDA 4I8KA 4GPGA 1H1BA 3NWUA 2WYJA 2XBXA 2UWOA 5EW2H 2KAIA 1RTKA 1WTGH 1DDJA 3V0XA 3VB7A 3ZVCA 3G01A 1H9HE 3SOSA 1ELBA 2TGAA 2C3SA 2GCHG 2PKAA 2PR3A 1S5SA 3BTHE 1EAWA 3UFAA 2ZTXA 2P59A 1GBAA 3HKIB 3TJOA 1W8BH 5JDUB 3UTUH 2FOBA 2ZZUH 2H5DA 4I32A 3AAVA 3DT0H 1O5EH 4ABFA 3BF6H 3TH3H 1FY4A 2Z9GA 3HATH 3SU3A 1EUFA 1F0UA 1SR5C 4XBBA 1C5NH 1ABJH 1Q3XA 2GX4A 3AVZA 1Z71A 3RU4T 3SW2B 1GBTA 3VXEH 1BZXE 2VWMA 3MU1A 3EQ0H 3SGQE 2AGIX 2R9PA 2VVVA 2OC8A 3M3TA 3MNCA 1MKXK 3T25A 2ANKH 8ESTE 2NU2E 3LGIA 1C5UA 3PMHB 1OYQA 4I8JA 4ABBA 1FV9A 2BYAX 5EODA 2BXTH 3AW1A 3ENSB 1ZMJA 5C1XA 5A09A 2XC5A 1MAYA 3E3TA 4H42U 2SGFE 3KL6A 4IC6A 3FVFB 3VB3A 1GBCA 1W7XH 2BVXH 2H9HA 2ZPQA 1RD3B 1XUHA 4OS7A 4X0WU 5A0BA 1Z8RA 2BD7A 5DPAA 3TH2H 5FCRA 1ELVA 5GIBA 1GMCG 1XXDA 4F49A 1Z8GA 4CRGA 1HGTH 2ZFQH 4ZAEA 1PPGE 4MPWA 1FN6A 3Q3YA 3M7TA 1AUJA 1YF4A 1F2SE 5EPYA 2J4IA 4YZUA 2BVSH 1O2MA 1EJNA 2PHBA 5CE1A 5HYOA 3GY3A 3ZYDA 1C2EA 2BLQA 1V2LT 2BOKA 3BTFE 1A3EH 2GCTB 2O8MA 4IBLH 2D26C 2Y81A 3Q00A 2V35A 2O8UA 1VR1H 1GMDF 1CT0E 1ZSKA 4E7RG 1O2RA 1GBJA 1J9CH 1MU8B 3UUZA 1SG8B 5T6DA 5HGGA 1NRQH 3D49H 2HGTH 1EB2A 3SJIA 1GJ8B 1IQJA 3ZVFA 1EP5A 1TRMA 5PTPA 2FI4E 2ZO3H 3GY7A 3B8JA 4ZKOU 1A4WH 3MHWU 3M5OA 2H9TH 3RXSA 4BTUB 1SI5H 1Q31A 3T2NA 1XUKA 2Z9IA 3I77A 4RN6A 4WMEA 2H2ZA 5AFYH 4XBDA 3BG4B 4A1VA 2DUCA 4B2CA 1P3CA 1SBWA 3SO3A 3T28A 1BIOA 3ESTA 4QT8C 1ARBA 1MTVA 1HB0B 3F1SB 4CRFA 1FLEE 1TBQH 2FEQH 1BTXA 2BY7X 3FP6E 2VINA 3MTYA 5F03A 1LVOA 1SGIB 3SNEA 1LKBA 2OP9A 5GCHG 2XWAA 1KYNA 3MNBA 1UTMA 3RXQA 2STBE 1L4DA 4MPVA 2VGCC 2VJ1A 3PWCA 5DP4A 3LOXA 1C2GA 3CP7A 1NPMA 1T31A 2FI3E 5A8ZA 3SORA 1O3DA 1VITG 4NFEA 2F9NA 1C5ZB 5LPFA 2Q6GA 3P8NA 2ANMH 3MH5A 2QXJA 1BMLA 1OP2A 2TGTA 4JK6A 1EPTC 3PROA 1PQ5A 1ORFA 3PB1E 1GI0A 1E36B 1P11E 2FS9A 4DIIH 4I8HA 5F8XA 2WPMS 4E05H 3ODDA 1YPHC 2ZP0H 5AVDA 1OP0A 4HGCA 4UONA 1ABIH 1C4U2 2W5EA 3PLKA 3DFLA 3F9FA 2C8XB 1RFNA 1ZHRA 3F6UH 3PM3A 2OLGA 3U98H 3LKWA 2BTCE 3MH4A 3PMJA 1GI7B 2VU8E 2ZKSA 4WMFA 4Y7AA 3ZVGA 2PUQH 1Y3VA 3TJVA 1IOEA 3TJNA 2JH6D 4F4OC 2Z3CA 2UUFB 1UCYH 4WXIA 1CGHA 1AZ8A 4K1TA 2HVXA 1IAUA 1UTNA 4OS1A 1G3DA 3A7XA 4KTSA 3A8DA 1A5GH 1K9OE 1CT4E 1P2IA 2BDAA 2RA0A 2GZ7A 1TX7A 1SGCA 3MWIU 1GJAB 1EPTB 1GI1A 1YLDA 1C5WB 2GTBA 3URCA 2IOTA 2QXGA 1VCPA 6CHAB 4DGJA 3BN9A 1ZJDA 4ABDA 3U69H 1TPOA 1T8MA 1FAXA 1AD8H 1C5LH 2FYQA 1L1JA 1SGQE 1A2CH 1O3HA 1CT2E 2B9LA 3LIWA 1T4UH 1ELEE 1BTWA 1NRSH 4ZMAH 4X6PA 3JZ1B 3RP2A 4K1SA 1Y5BT 5DG6A 5HXFA 3RXHA 1SC8U 5L6NH 2HPPH 2Z3DA 2W7UA 2ZCHP 1C5MD 2CN0H 3A80A 1PFXC 4BXSA 4BOHA 2CHAB 1IQEA 1BCUH 2W7SA 2ANWA 4NZLA 4Z6AH 1BHXB 1ZTKA 1AGJA 4KTUA 1UJ1A 3A8CA 1C1NA 4X1QU 3A82A 2ZHFH 4CBOA 3VFEA 4ISOA 1P09A 1W12U 4LZ1H 2A7HA 3BTGE 2PTCE 2XTTB 3SQEE 1SLXB 2FOCA 1GG6C 3SV7A 3TITA 1LHDH 4NSVA 1GCTB 4FU9A 2HNTC 2GT7A 5C5OA 2BY6X 2OQUA 1GMHF 1Z8JB 3ZZAA 3MYWA 1FAKH 1Y5UT 3UR6A 4GHTA 2WPIS 3LGVA 4MNXA 1GBKA 4J2YB 3ZZ9A 3IWMA 6GCHG 3D23A 3O8BA 1O0DH 4CH8B 3RMOH 1NRNH 1BTYA 1QNJA 4JYUH 5ESBA 4K8BA 1XKBC 1SPJA 1X7AC 1C5VA 1D3DB 3RXDA 3VGCC 2G4TA 2K1QA 2ASUB 4Z0KA 4JZDH 2Z7FE 4NIXA 3GDSA 1AMHA 1EZUC 4UEHH 1FPCH 1F0TA 1NFUA 3KGPA 1V2PT 1JRSA 1LPKB 1GG6B 1IQIA 4XE4A 3SNAA 1IQFA 1QB1A 3T5FH 2ALVA 2FLBH 1QBOA 5AF9H 3SV6A 1DWEH 1GDUA 3T26A 5DO4H 2ZTYA 1H9IE 4MLFB 4INLA 2F3CE 1WTHD 1LKAA 2G51A 2I6QA 4BANB 5JYIA 2ZFFH 3SBKA 2FI5E 5EW1H 1AVWA 4U2WA 5ESTE 2ZCLP 4E06H 4K3JA 1GBEA 1IQHA 1S6FA 4FUJA 1O33A 1PYTD 2J95A 1IHSH 1O3GA 2HALA 2A1DB 1UVTH 4IGDA 4VGCC 2ZEBA 1O2ZA 3EA7A 4YT6H 2J94A 4IMZA 1YCPM 1H8DH 1RS0A 1K1LA 2VVUA 2WUBA 4YESB 3H5CB 2Z9KA 1AQ7A 1PPCE 2QC2A 1EAUA 2H5CA 2GGVB 1L0ZA 1UK2A 3CENA 2Q6DA 2IJOB 1E35B 1W14U 1UVSH 2FX4A 2FIRH 2ZNKH 1ID5H 4YTAA 1GHZA 4J1YA 1DY8A 4TY7A 4GAWA 1ARCA 1O2NA 1MTNC 3EDXB 2F91A 5FPTA 3Q3KA 3K9XB 1O30A 2IN2A 2QGRA 1UTKA 1MH0A 2VIOA 3SZNA 3VEQB 1QTFA 1ZYOA 4VGCB 5ETXA 4O03A 1HRTH 2R0KA 2J38A 3SUDA 4AFQA 1CA8B 4A92A 2PGQB 4K60A 1WQSA 1UVOA 1OWKA 3V7TA 2XWBI 1F5KU 2FODA 6LPRA 3MOCA 1HV7A 1G32B 1PPBH 3N7OA 1YKTA 3O8DA 1BMMH 1C2KA 3RXFA 4A1XA 1RRKA 1S84A 3S69A 4UFGH 2XC0A 3U1IB 3UR9A 4FUFA 1EXFA 1TA6A 1TQ7B 2PSYA 4MPUA 1ETRH 3UOUA 2B0FA 1UCYK 5A8XA 3MU5A 3SJ9A 4BAKB 1GI4A 1GL0E 1MTSA 1MZAA 4ZKSU 3V13A 2PSXA 1B5GH 1YBWA 4OGXA 3MH7A 2BDYA 2ZDAH 2ZFSA 2WYGA 2TRMA 2YOLA 1O3EA 4AG2A 1JIRA 1NROH 1V2TT 4GCHF 1EP6A 4Y0YE 2BDBA 1MU6B 4FU8A 1QL7A 2A5KA 3M61U 3U8OH 1O2XA 1TA2A 5EQQA 3HK6B 2ZU2A 3BTME 1NFWA 3SJKA 2SNWA 1HIAB 1BT7A 2A7JA 5EG4A 2BLVA 2XNIA 5LGOA 2PKSC 1YPGH 2BDCA 1GJDB 1TE0A 2VH6A 2J2UA 1BBRH 4X1RU 1GMHG 1FDPA 1OOKB 4AGKA 1CO7E 3U8RH 1TB6H 2ZQ1A 4NIVA 1K1MA 2JKHA 5T3HA 3NUMA 2AGGX 1LMWB 2EI7A 2G00A 2BM2A 1NZQH 1XUJA 3ATWA 1SLVB
chains in the Genus database with same CATH superfamily
3SUFA 2AEIH 5DP8A 3WY8A 1OWIA 2ZU5A 3KHVA 4Y11E 1SGFG 1NBMD 3Q3XA 1C2HA 4IN1A 3RM0H 1ZZZA 3KQEA 1GHYH 1MMJN 1TOCB 3N7EA 3M5MA 2R3YA 1TPPA 2P3TB 5C0UA 1SOTA 1GBHA 2PKSB 3QX5H 3FO8D 1ZMNA 3IITA 1C5PA 4KELA 5L2ZH 1K0HA 1QGFA 2THFB 3GDUA 5F8ZA 2KM0A 2A4QA 1P9SA 1TMBH 2ZGXH 3S9CA 2ZC9H 1O5FH 1FY1A 2BD4A 1KLJH 3MU8A 2OUAA 3SGBE 4O9VA 3K6ZA 3NK8A 4X6MA 3BIUH 5JB8S 1HDTH 3UREA 2DE8A 1QRXA 1OKXA 4Y8ZA 1CU1A 1EOLA 1F92A 4M7GA 4B76A 1YPLH 1K22H 4I31A 1O2KA 3PLPA 2FM2A 4B73A 4I7YH 1O5CB 1OWJA 1DFPA 5IDKA 4Y8YA 4I33A 3ZVBA 1W0ZU 3RXCA 1ZGVA 1XUFA 1KMHB 1O2WA 2C4FH 4TY6A 8KME2 1CSOE 2VIDA 4SGAE 2DE9A 1CE5A 5A2MH 2B8OH 3M36A 4Q7XA 5T6GA 3GCTF 1UO6A 1ZMLA 2OK5A 3QZRA 3ELAH 2FO9A 4X2VA 3DSPA 3DFJA 2ZHDA 3K65B 5AHGH 3STIA 4CR9A 3RM2H 3UIRA 4LXBH 1C4V2 3M7QA 3K6YA 4FUEA 2Y80A 4K69A 4U01A 5EJLA 1HPGA 2TGDA 4D76A 3F68H 1K1OA 5BPEA 1C2DA 2QAAA 3H7OA 1NU9A 1WDIA 3BIVH 3KN2A 2FDAA 5EGMA 1V2KT 3BTQE 3RXLA 1FONA 2GDDA 1TLDA 3RXKA 1V2RT 3L3TA 4HTCH 3F2FA 2AYWA 4X8SH 1TRYA 4FUBA 3Q76A 5C5NA 1BHXF 4CHAC 1UTJA 4ISIH 5DP5A 1OWDA 1JMOH 1PYTC 3T27A 1FI8A 2AMPA 3AK5A 1O3JA 2HOBA 4Y76A 1KXCA 1PQ8A 4INKA 1SHYA 1WCZA 4NA8A 4CBNA 2AH4X 1BB0B 1EZQA 9ESTA 2P8OC 4X8TH 3SNBA 1GBIA 4ZXYH 1T32A 1ZRKA 2FOAA 5FPYA 2VWOA 5J4SA 4Q7ZA 2A4GA 3OEHD 1GGDC 1WYKA 2CXVA 1O35A 1YYY1 4R8TB 1AFQC 5SGAE 1RTFB 2OC0A 4FUDA 4MNVA 5GJ4B 1CA0C 1F0SA 3M37A 4GCHG 1YGCH 1MZDA 1BJUA 1ZTLA 3H7TA 3BTTE 4I8GA 1E1RD 5KEDA 1C1PA 5JBAS 1O3CA 3M35A 1IQLA 5FPSA 2Z94A 5C94A 4CHAB 1DSUA 2A31A 1B0FA 4MVNA 1G37A 4U30A 3OFND 5I25A 1TFXA 2KX4A 4HZHA 3RLYH 5FBIA 4ZXXH 4ISHH 1TNLA 1VGCC 1AE5A 1NO9H 3SUEA 2ZFRH 1UMAH 3JZ2B 3MMGA 1YCPH 1NS3A 4CRAA 4AX9H 2HNTF 1MBMA 4MDSA 1O3IA 5F8TA 4A1TA 1EKBB 1AFEH 2ZTZA 2TBSA 3QN7A 2OXSA 5FBEA 2B5TB 2ZCKP 1GGDB 2PGBB 5DGJA 4WH6A 1V2OT 2J34A 3TH4H 1CA0B 4DY7B 1ACBE 3IG6B 4FVDA 3URDA 3PV2A 3SJ8A 3RXJA 1NU7B 1TX8A 2NWNA 2PTNA 5E2OA 3PWBA 4IS5A 4CRBA 2Y5HA 1BBRK 4OS2A 1V2WT 1E1QD 3SI3H 2A45B 3F2HA 1HAPH 3LONA 3SNCA 1O2OA 4AFSA 1YY3A 3EE0B 3SV8A 4AYYB 4DW2U 3LDXH 5E0HA 2ALPA 4X1SU 1VGCB 1C5TA 4GLYA 3RXPA 2A0QB 7LPRA 5FCKA 3A7VA 1O5GH 2ZGJA 4FUHA 2FPZA 2FP7B 5FXLA 2JH5D 4YLQH 3STJA 3QGNB 3ZZ6A 3F0PA 2OTVA 4AB8A 4FVBA 1KDQB 4MNWA 3A84A 4OS6A 3FFGA 3SQHE 5GXPA 4ASUD 1P06A 1GVKB 1W0JD 4OS4A 1WXRA 1OSSA 3R3GB 1BMNH 1DXWA 3F9GA 3RXUA 1C1QA 5CHAC 2QV1A 4KGAA 1QB9A 2IJD1 2PWXA 1QQ4A 1C1OA 2QXIA 5FAHA 4CRCA 2FOFA 1CHGA 3GCTG 1XMNB 1UTOA 2G5VA 3KQBA 2VGCB 3BEUA 1GHAF 3TLOA 2C90B 3TU7H 1SGRE 1TGTA 3E1XB 1FQ3A 2BDHA 3QO6A 1ANCA 1NY22 3NXPA 1P57B 1DANH 2V3HH 4O97A 1HJ9A 4R0IA 4DOQA 1ZOMA 2WINI 2JJ1D 1PPEE 1ANEA 1A3BH 2BMGB 1FY5A 3AAUA 3C27B 1O3LA 1D3QB 1GBDA 5K0HA 3HGPA 3EA9A 1N8OC 1PQ7A 1SQRA 1T8OA 3FN8A 2KCAA 1O3MA 3OYPA 2QXHA 3C1KA 2FTMA 4NA9H 2VH0A 2H9EH 1D9IA 1GWAA 1A5IA 2IPHA 4D7FA 1AZZA 1SVPA 2R3UA 1BMFD 1GHBF 1HBTH 5CHAB 8LPRA 1A1RA 4OM9A 1GJBB 4B1TA 1VCWA 1ESBA 2V3OH 1EPTA 2W6JD 4I8LA 1F5LA 2HLCA 1Z6JH 1PPFE 3MFJA 2R2WU 1AVXA 2XBWA 1UCYE 1W10U 4Y0ZE 1GVLA 1RIWC 1O2UA 1FN8A 2ZGBH 3W94A 1WQVH 3MU0A 1KTTB 3F9HA 3L6PA 4O3UA 2F9PA 3CS7A 2QCYA 1EAXA 2QYIA 4K1EA 1XVOA 2CF8H 3BV9B 3RLWH 1QY6A 4THNH 2H1UA 3S7KB 1N8OB 1P2MA 1F0RA 3MH6A 1MCVA 1A46H 2Z9LA 3ZV9A 4ISNA 2O8WA 4DT4A 5CMXH 1GMDG 4AYVB 1SLWB 2P95A 4A7IB 3GY2A 4Z1MD 3DA9B 2EI6A 4B75A 1ANBA 1VKYA 1D4PB 4OGYA 1DWBH 2I6SA 2Z3EA 1C1SA 4TSFD 1V2MT 1KIGH 1LQDB 1O2SA 1BRCE 4NGAH 3SN8A 3OSYA 3RU4D 2OC7A 2JDID 1QFKH 4JZFH 2BX4A 2HRVA 1MQ5A 2AIPA 3D62A 3LH3A 2F9BH 4B71A 1D6WA 1ESTA 1NTPA 4NWKA 1JOUB 3RUOA 3RXVA 3LC5A 2Y7ZA 1RIWB 3HKJB 1ELAA 1FZZA 1EJAA 3P17H 4ISLA 3RC4A 5FX5A 3GDVA 1ETTH 3D65E 4Y6DA 2GV7A 2BY9X 1HAVB 2M2AA 3HPTB 4Y79A 1GVZA 3TNSA 2ZPRA 4TPYA 5AFZH 2FMJA 2RDEA 5ABWA 4I86A 1XM1A 1ELCA 3SUGA 2BY8X 4X1NU 3ZZ8A 1BA8B 3B23B 2SGQE 1G2LA 1H9LB 1P3EA 4D8NA 5C2ZA 4LZ4B 1JWTA 2P93A 1LPGB 1THRH 1HAVA 1O2HA 2CJIA 1DWDH 1ZGIA 3A7TA 4FUIA 3SU6A 3F9EA 1YCPK 1K28D 2RG3A 4M9FA 3UNRA 1TGCA 3ZVAA 1AE8H 1IQGA 1Y3WA 4Y71A 1W0YH 2FOHA 1KY9A 1GJ9B 3WWBA 4BAOB 1IQKA 1VJAU 3VGCB 1G3EA 4ZKNU 1C1UH 3GYMA 5L30H 3RU4E 5LPEA 4INHA 2O8TA 3UWIA 3ATMA 1FY3A 1KXFA 2P16A 4TYDA 2F83A 1V2VT 2FX6A 2QN5T 4YOGA 3RXOA 1SFIA 2VIPA 1A0LA 1BOQA 1RTLA 3LT3A 5KGOA 2FESH 2ZF0H 3BEFB 2A5IA 5A0AE 2GCHF 4H6SB 3UAIC 2Y5GA 3PTBA 3SJOA 1DLKB 1P0SH 2F9UA 2BOHB 1AY6H 2UWLA 1P2QA 2PV9B 2WUCA 1IHTH 4GUXA 1TMUH 1GHAG 1HJ8A 2JETC 2M5TA 1E34B 5EIYA 1DUAA 3W1EA 1ELFA 1C5QA 2EA3A 2BZ6H 4TPIZ 1LVBA 1G9IE 4MG3A 4B74A 3OTJE 5EQRA 1HCGA 3QGJA 2EI8A 3E8LA 3V12A 4ZKRU 1O5DH 2FLRH 3QK1A 3WWFA 3SHAH 1ZR0A 4DVAU 2TPIZ 5JBCS 2WV4A 3FP7E 4MPXA 3GCNA 2WPKS 1F7ZA 1L4ZA 1O5AB 2ZFPH 1W3CA 2D1JA 1TQ0B 5EXMA 2WPLS 2ZU1A 2F43B 2A2XH 3UNSA 4XRNA 1TNHA 4CREA 1YPEH 1QB6A 2RCEA 2GDEH 1TABE 4B6FA 1TGBA 4FU7A 3UPEA 1Z6EA 3P8FA 1CVWH 4ZH8A 1L1NA 1GI3A 2CGAA 2FYRA 4JK5A 1THPB 1LQEA 1OWEA 4ZROA 5HM9A 3GY4A 3PV5A 1C1MA 3CS0A 2QF3A 4ZCNA 4ACAA 4CR5A 3FP8E 5JPMH 1FNIA 2JETB 4ESTE 2O9QA 1V6DA 1BTUA 1UVPA 2Z9JA 4BTIB 2HPQH 1SOZA 1MUEB 2H6MA 4H4FA 1MTNB 1ZHPA 2GMTC 1JBUH 6ESTA 4UFEH 2ZHEH 3NCLA 4MQAA 1O3KA 1J16A 1MCTA 2XRCA 1IQNA 1YPJH 3QTOH 5K7RA 5GWZA 3BSQA 3QUMP 1MAXA 3ZZ4A 4AG1A 3FANA 1MQ6A 1T7CA 1G2MA 1GHXH 2VIQA 1O31A 5EPNA 2GT8A 4NG9H 1FX0B 3A89A 2FOMB 1O34A 3OE7D 1THSH 3TGKE 1DWCH 4DCDA 2WSSD 3ITIA 4KP0A 1FY8E 1DSTA 1TX6A 1OYTH 4IMQA 3KNXA 2P3UB 1O2JA 5DP6A 3MI4A 1PPHE 2V0BA 4CRDA 4YT7H 1HIAA 3PMBB 3M5LA 2BDGA 2ZG0H 2AMDA 2VB0A 1SGEE 1W11U 2OBQA 1VITH 4Y7BA 2TGPZ 1TNKA 4RKJB 3ZYEA 1T8NA 3S7HB 1AO5A 1ZPCA 2VVCA 1RJXB 1UK3A 2W3KA 1B0EA 1CQQA 3P92A 3TNTA 1Z1JA 1ETSH 1XUGA 3EAJA 4GSOA 4NCYA 3RC5A 1P2OA 2A4OA 4X8VH 2Y6TA 2ESTE 1WBGB 1QL8A 1SL3A 2KFWA 1EATA 1JRTA 1EX3A 1UHBB 4X2XA 3U1JB 1EQ9A 2UUYA 3LU9B 4AB9A 1OS8A 5DSFA 2AIQA 5DK1A 2STAE 3GOVB 2PP6A 5EJZA 2BD8A 3LGYA 2UUKB 3MU4A 5TJXA 2D2DA 3GCHC 4ZHMU 1IQMA 1ZJKA 1BBRE 1C1TA 1LHGH 4RI0A 3MO3A 5DP9A 1HAZB 3UOPA 3LH1A 1UTLM 1XUIA 2OC1A 4A6LA 2BB4A 1DICA 1SB1H 1FUJA 1LHCH 1V2JT 2WPDD 3O8RA 1BTPA 1TBZH 3CNRA 2YMSD 1O36A 5E2PA 5G4BA 1OXGA 2G55A 1KXEA 5LPRA 1HJAC 1BUIA 1VITF 5A0CA 3QTVH 3WW7A 9LPRA 1SQAA 1GHVH 1Z7KA 2QF0A 1K2I1 2ZU4A 1NESE 2G52A 1BMAA 1NT1A 1Y59T 1QCPA 1F5RA 4XSKU 1KLTA 3ZVDA 1H8ED 4O3TA 2NU0E 2R0LA 3PYHA 1FIZA 1O32A 1GBMA 1SGFA 1C2MA 1RGQA 3GCHB 1SFQB 2BQ6B 3A8BA 1SMFE 1YLNA 3T29A 4UD9H 2GVFA 1YPHE 4MNYA 2QA9E 1TRNA 2GP9B 1AN1E 3AW0A 1EZSC 1HXEH 4Q80A 3SU0A 2XBYA 1OX1A 2XYAA 1Y3UA 2FOEA 4BAMB 1Y5AT 1O39A 3PO1C 4DURA 1K1PA 1ZHMA 4CH2B 1O3OA 1GI5A 7GCHF 1HJAB 1P8VC 1WSSH 1C9TA 2AFQB 1EZXC 1DE7H 4D7GA 2W6ID 1O3AA 2C93B 4B2BA 3TK6A 3TPIZ 4D9QA 2BX3A 2KZ4A 1LHEH 2W26A 1TAWA 5DJ7A 3SU1A 1M9UA 2NU1E 1P02A 3PTNA 1O5BB 3VXFH 2BHGA 4X2YA 4JYVH 4TWWA 5EU8A 5HIZA 2OBOA 2LPRA 2V6NA 4XBCA 2GCTC 3RC6A 3TK9A 1V2ST 1AKSB 4JZIA 1FIWA 4YO9A 1YPKH 1LVYA 1GL1A 1ZPBA 7KMEH 1P10A 1QURH 2XBVA 3S9AA 1S85A 5C20A 5TCCA 1SGTA 1NRRH 3BTDE 5DP3A 2GV6A 3UQOA 5L2YH 4ZUHA 3LGTA 1SLUB 1TOMH 3NPSA 1A7SA 2LNCA 1LPZB 4DG4A 1VCQA 3PO1B 3LC3A 3UNQA 1AKSA 2GZ8A 4AOQA 4AGJA 1HAIH 3GICB 4JYTA 3KEEA 1TALA 1O3PB 4FUCA 1N1LA 3KIDU 4JMYA 2V7QD 2VWNA 3VB5A 3KQ5A 3E16B 2SFAA 1VZQH 2KCYA 1ZPZA 3LPRA 3BG4C 3RXGA 3FZDA 1AB9C 1DUEA 3TIUA 3OY6U 3OY5U 1WV7H 4SGBE 1GJ6A 4RT0A 1O2YA 2EEKA 1P03A 1QRZA 2XXLA 3VB6A 2WPHS 1ZTJA 3SU5A 5B6OA 2ZDVH 2ZFTA 1E79D 1W2KH 1AI8H 1BRUP 1DXPA 1ZRBA 4JZ1A 4WMDA 2JH0D 2OD3B 1C2IA 4BAHB 2P8OB 1O3FA 4GHQA 3I78A 1TPSA 2XC4A 3MO6A 2GZ9A 1S83A 4P00A 1A0JA 2A2QH 4PROA 4K5ZA 2HNTE 3BTKE 1DLEA 4JZEH 3A88A 2ZPSA 1DX5M 1DM4B 2C8WB 3U9AH 1AFQB 6GCHF 2ODYB 1MBQA 1G3BA 1QBNA 1BITA 1ANDA 1EFRD 1GJ5H 3L33A 3S0NA 1WAYB 1MTUA 2QIQA 1L1GA 1YP9A 3E0PB 1GBFA 1YC0A 2TIOA 3K2UA 4YM9A 1JXPA 1HAXB 1AB9B 3QWCH 2PW8H 2ZQ2A 4AZ2B 2FWWA 2G8TA 2SGEE 1S82A 4XD7D 1KXAA 1K1JA 2O8LA 3A7ZA 2Y82A 1BTZA 1ELTA 3P6ZB 4E7NA 4LOYH 3DUXH 2BQWB 1NRPH 2XCNA 4NIWA 5TCAA 5EQSA 2BY5X 1C4Y2 1UK4A 4WY3A 4ASHA 3RDZA 3ZV8A 4YLUA 1TNJA 1C5OH 1D6RA 1C1WH 1HLTH 4KKDA 5JB9S 3A87A 4DT7B 1AVGH 3ZZ7A 2XW9A 1BTHH 2Q1JA 4BAQB 3BTWE 3GISB 1O2GH 4WH8A 1YLCA 5I46H 4DIHH 1QIXB 1HAHH 1MD8A 4ZHAA 1EAIA 4NFFA 1W7GH 4DJZB 1C2FA 1FJSA 5LH8A 2FS8A 4ABEA 1XVMA 3KQCA 3NZIA 3VPKA 1KSNA 1GI2A 2WV5A 1GBBA 4U32A 2AHME 3AASA 3SV2H 2XNDD 3A8AA 4BXWA 1INCA 1KXBA 2FOGA 2F9OA 3Q77A 5EXNA 4AFZA 1Z1IA 1HAYB 1KDQA 3ZZCA 6CHAC 2AERH 1S6LA 5GPIB 1UTPA 1QJ6B 2NU4E 3E0NB 3SI4H 3RMNH 3ZZ3A 4B2AA 4RSPA 4YOIA 1WOFA 2BD2A 4TWYA 1D3TB 1CGIE 1H8IH 1TONA 3UY9A 5BRRE 1DS2E 1EASA 1EOJA 2K8IA 2G4UA 4HI3A 1FPHH 2Y5FA 1TGNA 1QQUA 3BEIB 4X6OA 1G3CA 7GCHG 3RXIA 4IN2A 3PV4A 2CMYA 1A61H 2UUJB 1OHHD 1BRBE 4F48B 1BRAA 1WU1A 4Y10E 1G30B 2CHAC 1Y8TA 2R2MB 3RXMA 3SU2A 1P05A 1C5YB 2G81E 3E90B 2YMSC 2ANYA 4YOJA 2P3FH 1T8LA 3EA8A 2XOKD 1PJPA 2ZDLA 3DCLA 4HFPB 4JCNA 4RT1A 4ZHLU 2BD5A 2BXUH 3M5NA 1P12E 1C5RA 1T4VH 5A8YA 4Q7YA 4XFQA 5JBTA 3OTPA 1P2JA 3PLBA 1MKWH 4UDWH 2V3MA 1C2JA 4NA7A 3P95A 1H4WA 1GCTC 2PFEA 1GI8B 2BVRH 4X8UH 1O2IA 1Y3XA 3HK3B 4AFUA 1SQTA 4K8YA 2ULLA 1AHTH 1LTOA 2HWLB 2ZA5A 1OWHA 1GBLA 1DOJA 2VNTA 2PLXA 1YPMH 1QJ7B 2SGPE 1SHHB 2B7DH 4RKOB 3ATLA 2FXRA 2VIWA 1K1NA 4X6NA 4X2WA 4BTTB 1KTSB 2KCOA 4ABGA 1G36A 1P9UA 3TVJB 1RXPA 1O3NA 3P8OA 2P94A 4BNRA 3BG8A 1XKAC 2CF9H 2KCPA 4HG6A 1TWXB 1A5HA 3GY8A 3P70B 1ELDE 1BQYA 1P2KA 3PMAB 3M7UA 3MNSA 3ODFA 1TNIA 1QA0A 4KTCA 1E38B 4FXGH 1FMGA 4WVPE 1LHFH 2XCFA 5JBBS 1XX9A 1E0FD 2G5NA 1DITH 2L6OA 2K0QA 4AORA 3R0FA 1UW7A 1U6QA 1AUTC 3QZQA 1DVAH 1LVMA 3OX7U 3O8CA 1GDNA 5J4QA 3U8TH 1OPHB 1V2NT 2WZQA 1LCYA 3A7YA 1HYLA 1QJ1B 4MTBA 2HVYB 3SHCH 4WF8A 4Q2KA 1J17T 3H09A 2VIVA 5HM2A 3RXAA 1YM0A 1MTWA 3QLPH 5H4IB 3LGUA 1HAGE 1ELGA 1CHOF 4NWLA 8GCHF 2VWLA 1V2UT 3GCOA 1HXFH 2ZHWH 3LGWA 3MNXA 2ZHQH 2J97A 1LO6A 1C5SA 2ZDNA 4WXVA 3SGAE 2ZIQH 4WWYA 4AN7A 3TGJE 1SSXA 4Y8XA 2BQ7B 4K2YA 1DT2A 4IC5A 1KLIH 4XDEA 2YNBA 1TIOA 3KCGH 5E0GA 3RXRA 1QBVH 1ZSJA 1NC6A 1AU8A 1O2LA 1P04A 2PUXB 1J14A 1O3BA 2UWPA 3F0OA 1GCDA 2QY0B 3VG8A 3UQVA 3GS9A 5E8EH 4NZQA 2BLWA 3FOAA 4H6TA 2A7CA 3ZZ5A 1MKXH 3ATKA 1J15A 3EYDA 3KYFA 3FAOA 1HUTH 1SGNE 2F4LA 5EOKA 2OQ5A 4NSYA 1GI9B 3A7WA 2GD4B 2ZDKA 3BTEE 1SQOA 2ODPA 1MD7A 3DD2H 3ATIA 3FKSD 1GJCB 1UVUH 2D8WA 1FXYA 1PPZA 1SGYE 1QHRB 4IW4E 3KYGA 1TNGA 3HGNA 5E0JA 3A81A 3GY6A 3TK5A 3A83A 1B7XB 3M3SA 1S0QA 5HMAA 2OCVB 1TYNA 4XOJA 2BD9A 1BDAA 5FHTA 2LP6A 1W13U 1GJ7B 2BZAA 2SGDE 1ZLRA 2ZGCA 3M3VA 1QRWA 1AWFH 1N6YA 3KQDA 1HNEE 1CBWC 3LJJA 1GHBG 3GY5A 2NU3E 2FTLE 4ABAA 3B9FH 1C1VH 2A32A 1BJVA 1C5XB 1Q2WA 2ZI2H 3E91A 3LJOA 3NKKA 3DHKH 3ZZDA 1UTQA 1S81A 1GPZA 5T1VA 1KXDA 4UE7H 1O2QA 2A5AA 2ZECA 2C8YB 1ZSLA 1NN6A 2ZGHA 1C1RA 2GKVE 1GMCF 4X1PU 1GDQA 7ESTE 1XXFA 1J8AA 1YWUA 4GVUA 2FZZA 2BLOA 2ODQA 3TGIE 3T62A 1VJ9U 1O2TA 4NIYA 1K21H 5FX6A 5C67A 2WPJS 2J9NA 1V2QT 1HAOH 1Y3YA 2F9VA 1GJ4H 1CGJE 1AIXH 2SNVA 4D9RA 4ABHA 2CV3A 3QDZB 1D3PB 4WJG2 1O2VA 1O38A 1PQAA 1ESAA 2YNAA 2Z6BD 1P01A 1S0RA 3GYLB 3V3MA 1CBWB 3S9BA 3MO9A 1A0HB 1NM6A 4FUGA 1NFYA 4B6EA 5C1UA 2ZU3A 1W0KD 1MKWK 5C1YA 1EJMA 2BD3A 3FZZA 3SU4A 3SV9A 1C2LA 2J92A 3N7DA 2W3IA 1N6XA 1EB1H 2C8ZB 1O37A 1V3XA 1K1IA 3A86A 5DP7A 1QL9A 3ZVEA 2ZDMA 1NFXA 2EY4C 5IYTA 1L2EA 2Q6FA 2GMTB 3TJUA 4ABJA 1WUNH 5T6FA 2GJGA 3A85A 3KF2A 2SGAA 2ZWLH 1P2NA 5EXLA 5C3NA 5F6MA 3E6PH 3I29A 2CK3D 3UWJH 2RDLA 3EGKH 1SKYE 5HKKD 1OP8A 3OU0A 1SGDE 1AWHB 1QR3E 3RXTA 1TMTH 3RXEA 3VB4A 1DY9A 3RMLH 1Z8IB 1TBRH 3F2GA 2Y7XA 5DKMA 1CHOG 8GCHG 2OINA 3ZZBA 1E37B 5GCHF 1UHBA 5GDSH 1S6HA 2ILNA 1C9PA 2KAIB 4TT3D 3RXBA 4FOUC 2EC9H 4LK4A 2RA3A 1TPAE 2BDIA 1GHWH 3NRLA 1JIMA 3W95A 1TGSZ 4UFFH 5IK2D 4A5TS 4ABIA 2PKAB 1DPOA 4FETA 1HFDA 2AGEX 1QA7A 2AMQA 1GI6A 2A4RA 1SGPE 2AS9A 1LDTT 4OS5A 3P8GA 3RMMH 4UFDH 1O2PA 3SNDA 4I8KA 4GPGA 2J5UA 1H1BA 3NWUA 2WYJA 3ZIAD 2XBXA 2UWOA 5EW2H 2KAIA 1RTKA 1WTGH 1DDJA 3V0XA 3VB7A 3ZVCA 3G01A 1H9HE 3SOSA 1ELBA 2TGAA 2C3SA 2GCHG 2PKAA 2PR3A 1S5SA 3BTHE 5EJ1A 1EAWA 3UFAA 2ZTXA 2P59A 1GBAA 3HKIB 3TJOA 1W8BH 5JDUB 3UTUH 2FOBA 4ACBA 2ZZUH 2H5DA 4I32A 2QF4A 3AAVA 3DT0H 1O5EH 4ABFA 3BF6H 4Q4LA 3TH3H 1FY4A 2Z9GA 3HATH 3SU3A 1EUFA 1F0UA 1SR5C 4XBBA 1C5NH 1ABJH 1Q3XA 1NBME 2GX4A 3AVZA 1Z71A 3RU4T 3SW2B 1GBTA 3SYJA 3VXEH 1BZXE 2VWMA 3MU1A 3EQ0H 3SGQE 1MABB 2AGIX 2R9PA 2VVVA 2OC8A 3M3TA 3MNCA 1MKXK 3T25A 2ANKH 8ESTE 2NU2E 3LGIA 1C5UA 3PMHB 1OYQA 4I8JA 4ABBA 1FV9A 2BYAX 5EODA 2BXTH 3AW1A 3ENSB 1ZMJA 5B6LA 5C1XA 5A09A 2XC5A 3PRBA 1MAYA 3E3TA 4H42U 2SGFE 3KL6A 4IC6A 3FVFB 3VB3A 1GBCA 1W7XH 2BVXH 2H9HA 2ZPQA 1RD3B 1XUHA 4OS7A 4X0WU 5A0BA 1Z8RA 2BD7A 5DPAA 3TH2H 5FCRA 1ELVA 5GIBA 1GMCG 1XXDA 4F49A 1Z8GA 2QE7D 4CRGA 1HGTH 2ZFQH 4ZAEA 1PPGE 4MPWA 1FN6A 3Q3YA 3M7TA 1AUJA 1YF4A 1F2SE 5EPYA 2J4IA 4YZUA 2BVSH 1O2MA 1EJNA 2PHBA 5CE1A 5HYOA 3GY3A 3ZYDA 1C2EA 2BLQA 1V2LT 2BOKA 3BTFE 1A3EH 2GCTB 2O8MA 4IBLH 2D26C 2Y81A 3Q00A 2V35A 2O8UA 1VR1H 1GMDF 1CT0E 1ZSKA 4E7RG 1O2RA 1GBJA 1J9CH 1MU8B 3UUZA 1SG8B 5T6DA 5HGGA 1NRQH 3D49H 2HGTH 1EB2A 3SJIA 1GJ8B 4F55A 1IQJA 3ZVFA 1EP5A 1TRMA 5PTPA 2FI4E 2ZO3H 3GY7A 3B8JA 4ZKOU 1A4WH 3MHWU 3M5OA 2H9TH 3RXSA 4BTUB 1SI5H 1Q31A 3T2NA 1XUKA 2Z9IA 3I77A 4RN6A 4WMEA 2H2ZA 5AFYH 4XBDA 3BG4B 4A1VA 2DUCA 4B2CA 1P3CA 1SBWA 3SO3A 3T28A 1BIOA 3ESTA 4QT8C 1ARBA 4AC9A 1MTVA 1HB0B 3F1SB 4CRFA 1FLEE 1TBQH 2FEQH 1BTXA 3DSGA 2BY7X 3FP6E 2VINA 3MTYA 5F03A 1LVOA 1SGIB 3SNEA 1LKBA 2OP9A 3OAAD 5GCHG 2XWAA 1KYNA 3MNBA 1UTMA 3RXQA 2STBE 1L4DA 4MPVA 2VGCC 2VJ1A 3PWCA 5DP4A 3LOXA 1C2GA 3CP7A 1NPMA 1T31A 2FI3E 5GNDA 5A8ZA 3SORA 1O3DA 1VITG 4NFEA 2F9NA 1C5ZB 5LPFA 2J98B 2Q6GA 3P8NA 2ANMH 3MH5A 2QXJA 1BMLA 1OP2A 2TGTA 4JK6A 1EPTC 3PROA 1PQ5A 1ORFA 3PB1E 1GI0A 1E36B 5C17A 1P11E 2FS9A 4DIIH 2QF5A 4I8HA 5F8XA 2WPMS 4E05H 3ODDA 1YPHC 1H8HD 2VBCA 2ZP0H 2J98A 5AVDA 1OP0A 4HGCA 4UONA 1ABIH 1C4U2 2W5EA 3PLKA 3DFLA 3F9FA 2IPQX 2C8XB 1RFNA 1ZHRA 3F6UH 3PM3A 2OLGA 3U98H 3LKWA 2BTCE 3MH4A 3PMJA 1GI7B 2VU8E 2ZKSA 4WMFA 4Y7AA 3ZVGA 2PUQH 1Y3VA 3TJVA 1IOEA 3TJNA 2JH6D 4F4OC 2Z3CA 2UUFB 1UCYH 4WXIA 1CGHA 1AZ8A 4K1TA 2HVXA 1IAUA 1UTNA 4OS1A 1G3DA 3A7XA 4KTSA 3A8DA 1A5GH 1K9OE 1CT4E 1P2IA 4Q63A 2BDAA 2RA0A 2GZ7A 1TX7A 1SGCA 3MWIU 1GJAB 1EPTB 1GI1A 1YLDA 1C5WB 2GTBA 3URCA 2IOTA 2QXGA 4P02A 1VCPA 6CHAB 4DGJA 3BN9A 1ZJDA 4ABDA 3U69H 1COWD 1TPOA 1T8MA 1FAXA 1AD8H 1C5LH 2FYQA 1L1JA 1SGQE 1A2CH 1O3HA 1CT2E 2B9LA 3LIWA 1T4UH 1ELEE 1BTWA 1NRSH 4ZMAH 2JIZD 2WHXA 4X6PA 3JZ1B 3RP2A 4K1SA 1Y5BT 5DG6A 5HXFA 3RXHA 1SC8U 5L6NH 2HPPH 2Z3DA 3U28C 2W7UA 2ZCHP 1C5MD 2CN0H 3A80A 1PFXC 4BXSA 4BOHA 5DN6D 2CHAB 1IQEA 1BCUH 2W7SA 2ANWA 4NZLA 4Z6AH 1BHXB 1ZTKA 1AGJA 4KTUA 2YMSB 1UJ1A 3A8CA 1C1NA 4X1QU 3A82A 2ZHFH 4CBOA 3VFEA 4ISOA 1P09A 1W12U 4LZ1H 2A7HA 5F53A 3BTGE 2PTCE 2XTTB 3SQEE 1SLXB 2FOCA 1GG6C 3SV7A 3TITA 1LHDH 4NSVA 1GCTB 4FU9A 2HNTC 2GT7A 2RFKC 5C5OA 2BY6X 2OQUA 1GMHF 1Z8JB 3ZZAA 3MYWA 1FAKH 1Y5UT 2LELA 3UR6A 4GHTA 2WPIS 3LGVA 4MNXA 1GBKA 4J2YB 3ZZ9A 3IWMA 6GCHG 2KR7A 3D23A 3O8BA 1O0DH 4CH8B 3RMOH 1NRNH 1BTYA 1QNJA 4JYUH 5ESBA 3SZEA 4K8BA 1XKBC 1SPJA 1X7AC 1C5VA 1D3DB 3RXDA 3VGCC 2G4TA 2K1QA 2ASUB 4Z0KA 4JZDH 2Z7FE 4NIXA 3GDSA 1AMHA 3F3BA 1EZUC 4UEHH 5C0TA 1FPCH 1F0TA 1NFUA 3KGPA 1V2PT 1JRSA 1LPKB 1GG6B 3N99A 1IQIA 4XE4A 3SNAA 1IQFA 1QB1A 3T5FH 2ALVA 2FLBH 1QBOA 5AF9H 3SV6A 1DWEH 1GDUA 3T26A 5DO4H 4YXWD 2ZTYA 1H9IE 4MLFB 4INLA 2F3CE 1WTHD 1LKAA 2G51A 2I6QA 4BANB 5JYIA 2ZFFH 3SBKA 2FI5E 5EW1H 1AVWA 4U2WA 5ESTE 2ZCLP 4E06H 4K3JA 1GBEA 1IQHA 5FL7D 1S6FA 4FUJA 1O33A 1PYTD 2J95A 1IHSH 1O3GA 2HALA 2A1DB 1UVTH 4IGDA 4VGCC 2ZEBA 1O2ZA 3EA7A 4YT6H 2J94A 4IMZA 1YCPM 1H8DH 1RS0A 1K1LA 2VVUA 2WUBA 4YESB 3H5CB 2Z9KA 1AQ7A 1PPCE 2QC2A 1EAUA 2H5CA 2GGVB 1L0ZA 1UK2A 3CENA 2Q6DA 2IJOB 1E35B 1W14U 1UVSH 2FX4A 3MQKC 2FIRH 2ZNKH 1ID5H 4YTAA 1GHZA 4J1YA 3DSOA 1DY8A 4TY7A 5CDFE 4GAWA 1ARCA 1O2NA 1MTNC 3EDXB 2F91A 5FPTA 3Q3KA 3K9XB 1O30A 2IN2A 2QGRA 1UTKA 5CHBA 1MH0A 2VIOA 5HIYA 3SZNA 3VEQB 1QTFA 1ZYOA 4VGCB 5ETXA 4O03A 1HRTH 2R0KA 2J38A 3SUDA 4AFQA 1CA8B 4A92A 2PGQB 2JJ2D 4K60A 1WQSA 1UVOA 3PRDA 1OWKA 3V7TA 2XWBI 1F5KU 2FODA 6LPRA 3MOCA 1HV7A 3OEED 1G32B 1PPBH 3N7OA 1YKTA 3O8DA 1BMMH 1C2KA 3RXFA 4A1XA 1RRKA 1S84A 3S69A 4UFGH 2XC0A 3U1IB 1QZ8A 4FUFA 1EXFA 3UR9A 1TA6A 1TQ7B 2PSYA 4MPUA 1ETRH 3UOUA 2B0FA 1UCYK 5A8XA 3MU5A 2WV9A 3SJ9A 4BAKB 1GI4A 1GL0E 1MTSA 1MZAA 4ZKSU 3V13A 2PSXA 1B5GH 1YBWA 4OGXA 3MH7A 2BDYA 2L74A 2ZDAH 2ZFSA 2WYGA 2TRMA 2YOLA 1O3EA 4AG2A 1JIRA 1NROH 1V2TT 4GCHF 1EP6A 4Y0YE 2BDBA 3UB0A 1MU6B 4FU8A 1QL7A 2A5KA 3M61U 3U8OH 1O2XA 5KECA 1TA2A 5EQQA 3HK6B 2ZU2A 3BTME 1NFWA 3SJKA 2SNWA 1HIAB 3EE7A 1BT7A 2A7JA 5EG4A 2BLVA 2XNIA 5LGOA 2PKSC 2HLDD 1YPGH 2BDCA 1GJDB 1TE0A 2VH6A 2J2UA 1BBRH 4X1RU 1GMHG 1FDPA 1OOKB 4AGKA 1CO7E 3U8RH 1TB6H 2EQNA 2ZQ1A 4NIVA 1K1MA 2JKHA 5T3HA 3NUMA 2AGGX 1LMWB 2EI7A 2G00A 2BM2A 1NZQH 1XUJA 3ATWA 1SLVB
chains in the Genus database with same CATH topology
3SUFA 2AEIH 5DP8A 3WY8A 1OWIA 2ZU5A 3KHVA 4Y11E 1SGFG 4IN1A 3Q3XA 1C2HA 3RM0H 1ZZZA 3KQEA 1GHYH 1MMJN 1TOCB 3M5MA 2R3YA 1TPPA 2P3TB 1SOTA 1GBHA 2PKSB 3QX5H 1ZMNA 3IITA 1C5PA 4KELA 5L2ZH 1QGFA 2THFB 3GDUA 5F8ZA 2A4QA 1P9SA 1TMBH 2ZGXH 3S9CA 2ZC9H 1O5FH 1FY1A 2BD4A 1KLJH 3MU8A 2OUAA 3SGBE 4O9VA 3K6ZA 3NK8A 4X6MA 3BIUH 5JB8S 1HDTH 3UREA 2DE8A 1QRXA 1OKXA 4Y8ZA 1CU1A 1EOLA 1F92A 4M7GA 4B76A 1YPLH 1K22H 4I31A 1O2KA 3PLPA 2FM2A 4B73A 4I7YH 1O5CB 1OWJA 1DFPA 5IDKA 4Y8YA 4I33A 3ZVBA 1W0ZU 3RXCA 1ZGVA 1XUFA 1O2WA 2C4FH 4TY6A 8KME2 1CSOE 2VIDA 4SGAE 2DE9A 1CE5A 5A2MH 2B8OH 3M36A 4Q7XA 5T6GA 3GCTF 1UO6A 1ZMLA 3QZRA 3ELAH 2FO9A 4X2VA 3DFJA 2ZHDA 3K65B 5AHGH 3STIA 4CR9A 3RM2H 3UIRA 4LXBH 1C4V2 3M7QA 3K6YA 4FUEA 2Y80A 4K69A 4U01A 1HPGA 2TGDA 4D76A 3F68H 1K1OA 5BPEA 1C2DA 2QAAA 3H7OA 1NU9A 3BIVH 3KN2A 2FDAA 5EGMA 1V2KT 3BTQE 3RXLA 1FONA 2GDDA 1TLDA 3RXKA 1V2RT 3L3TA 4HTCH 2AYWA 4X8SH 1TRYA 4FUBA 3Q76A 5C5NA 1BHXF 4CHAC 1UTJA 4ISIH 5DP5A 1OWDA 1JMOH 1PYTC 3T27A 1FI8A 2AMPA 1O3JA 2HOBA 4Y76A 1KXCA 1PQ8A 4INKA 1SHYA 1WCZA 4NA8A 4CBNA 2AH4X 1BB0B 1EZQA 9ESTA 2P8OC 4X8TH 3SNBA 1GBIA 4ZXYH 1T32A 1ZRKA 2FOAA 5FPYA 2VWOA 5J4SA 4Q7ZA 2A4GA 1GGDC 1WYKA 2CXVA 1O35A 1YYY1 4R8TB 1AFQC 5SGAE 1RTFB 2OC0A 4FUDA 4MNVA 5GJ4B 1CA0C 1F0SA 3M37A 4GCHG 1YGCH 1MZDA 1BJUA 1ZTLA 3H7TA 3BTTE 4I8GA 1C1PA 5JBAS 1O3CA 3M35A 1IQLA 5FPSA 2Z94A 4CHAB 1DSUA 2A31A 1B0FA 4MVNA 1G37A 4U30A 5I25A 1TFXA 4HZHA 3RLYH 5FBIA 4ZXXH 4ISHH 1TNLA 1VGCC 1AE5A 1NO9H 3SUEA 2ZFRH 1UMAH 3JZ2B 3MMGA 1YCPH 1NS3A 4CRAA 4AX9H 2HNTF 1MBMA 4MDSA 1O3IA 5F8TA 4A1TA 1EKBB 1AFEH 2ZTZA 2TBSA 3QN7A 2OXSA 5FBEA 2B5TB 2ZCKP 1GGDB 2PGBB 5DGJA 4WH6A 1V2OT 2J34A 3TH4H 1CA0B 4DY7B 1ACBE 3IG6B 4FVDA 3URDA 3SJ8A 3RXJA 1NU7B 1TX8A 2NWNA 2PTNA 5E2OA 3PWBA 4IS5A 4CRBA 2Y5HA 1BBRK 4OS2A 1V2WT 3SI3H 2A45B 1HAPH 3LONA 3SNCA 1O2OA 4AFSA 3EE0B 3SV8A 4AYYB 4DW2U 3LDXH 5E0HA 2ALPA 4X1SU 1VGCB 1C5TA 4GLYA 3RXPA 2A0QB 7LPRA 5FCKA 3A7VA 1O5GH 2ZGJA 4FUHA 2FPZA 2FP7B 5FXLA 2JH5D 4YLQH 3STJA 3QGNB 3ZZ6A 2OTVA 4AB8A 4FVBA 1KDQB 4MNWA 3A84A 4OS6A 3FFGA 3SQHE 5GXPA 1P06A 1GVKB 4OS4A 1OSSA 3R3GB 1BMNH 1DXWA 3F9GA 3RXUA 1C1QA 5CHAC 2QV1A 4KGAA 1QB9A 2PWXA 1QQ4A 1C1OA 2QXIA 5FAHA 4CRCA 2FOFA 1CHGA 3GCTG 1XMNB 1UTOA 2G5VA 3KQBA 2VGCB 3BEUA 1GHAF 3TLOA 2C90B 3TU7H 1SGRE 1TGTA 3E1XB 1FQ3A 2BDHA 3QO6A 1ANCA 1NY22 3NXPA 1P57B 1DANH 2V3HH 4O97A 1HJ9A 4R0IA 4DOQA 1ZOMA 2WINI 1PPEE 1ANEA 1A3BH 2BMGB 1FY5A 3AAUA 3C27B 1O3LA 1D3QB 1GBDA 5K0HA 3HGPA 3EA9A 1N8OC 1PQ7A 1T8OA 1O3MA 3OYPA 2QXHA 3C1KA 2FTMA 4NA9H 2VH0A 2H9EH 1D9IA 1GWAA 1A5IA 2IPHA 4D7FA 1AZZA 1SVPA 2R3UA 1GHBF 1HBTH 5CHAB 8LPRA 1A1RA 1GJBB 4B1TA 1VCWA 1ESBA 2V3OH 1EPTA 4I8LA 1F5LA 2HLCA 1Z6JH 1PPFE 3MFJA 2R2WU 1AVXA 2XBWA 1UCYE 1W10U 4Y0ZE 1GVLA 1RIWC 1O2UA 1FN8A 2ZGBH 3W94A 1WQVH 3MU0A 1KTTB 3F9HA 3L6PA 4O3UA 2F9PA 3CS7A 2QCYA 1EAXA 2QYIA 4K1EA 1XVOA 2CF8H 3BV9B 3RLWH 1QY6A 4THNH 2H1UA 3S7KB 1N8OB 1P2MA 1F0RA 3MH6A 1MCVA 1A46H 2Z9LA 3ZV9A 4ISNA 2O8WA 5CMXH 1GMDG 4AYVB 1SLWB 2P95A 4A7IB 3GY2A 3DA9B 2EI6A 4B75A 1ANBA 1D4PB 4OGYA 1DWBH 2I6SA 2Z3EA 1C1SA 1V2MT 1KIGH 1LQDB 1O2SA 1BRCE 4NGAH 3SN8A 3OSYA 3RU4D 2OC7A 1QFKH 4JZFH 2BX4A 2HRVA 1MQ5A 2AIPA 3D62A 3LH3A 2F9BH 4B71A 1D6WA 1ESTA 1NTPA 4NWKA 1JOUB 3RUOA 3RXVA 3LC5A 2Y7ZA 1RIWB 3HKJB 1ELAA 1FZZA 1EJAA 3P17H 4ISLA 3RC4A 5FX5A 3GDVA 1ETTH 3D65E 4Y6DA 2GV7A 2BY9X 1HAVB 3HPTB 4Y79A 1GVZA 3TNSA 2ZPRA 4TPYA 5AFZH 2FMJA 5ABWA 1XM1A 1ELCA 3SUGA 2BY8X 4X1NU 3ZZ8A 1BA8B 3B23B 2SGQE 1G2LA 1H9LB 1P3EA 4D8NA 5C2ZA 4LZ4B 1JWTA 2P93A 1LPGB 1THRH 1HAVA 1O2HA 2CJIA 1DWDH 1ZGIA 3A7TA 4FUIA 3SU6A 3F9EA 1YCPK 1K28D 2RG3A 3UNRA 1TGCA 3ZVAA 1AE8H 1IQGA 1Y3WA 4Y71A 1W0YH 2FOHA 1KY9A 1GJ9B 4BAOB 1IQKA 1VJAU 3VGCB 1G3EA 4ZKNU 1C1UH 3GYMA 5L30H 3RU4E 5LPEA 4INHA 2O8TA 3UWIA 3ATMA 1FY3A 1KXFA 2P16A 4TYDA 2F83A 1V2VT 2FX6A 2QN5T 4YOGA 3RXOA 1SFIA 2VIPA 1A0LA 1BOQA 1RTLA 3LT3A 2FESH 2ZF0H 3BEFB 2A5IA 5A0AE 2GCHF 4H6SB 2Y5GA 3PTBA 3SJOA 1DLKB 1P0SH 2F9UA 2BOHB 1AY6H 2UWLA 1P2QA 2PV9B 2WUCA 1IHTH 4GUXA 1TMUH 1GHAG 1HJ8A 2JETC 2M5TA 1E34B 1DUAA 1ELFA 1C5QA 2EA3A 2BZ6H 4TPIZ 1LVBA 1G9IE 4MG3A 4B74A 3OTJE 5EQRA 1HCGA 3QGJA 2EI8A 3E8LA 3V12A 4ZKRU 1O5DH 2FLRH 3QK1A 3SHAH 1ZR0A 4DVAU 2TPIZ 5JBCS 2WV4A 3FP7E 4MPXA 3GCNA 2WPKS 1F7ZA 1L4ZA 1O5AB 2ZFPH 1W3CA 2D1JA 1TQ0B 5EXMA 2WPLS 2ZU1A 2A2XH 3UNSA 1TNHA 4CREA 1YPEH 1QB6A 2RCEA 2GDEH 1TABE 1TGBA 4FU7A 3UPEA 1Z6EA 3P8FA 1CVWH 4ZH8A 1L1NA 1GI3A 2CGAA 2FYRA 4JK5A 1THPB 1LQEA 1OWEA 4ZROA 5HM9A 3GY4A 1C1MA 3CS0A 2QF3A 4CR5A 3FP8E 5JPMH 1FNIA 2JETB 4ESTE 2O9QA 1V6DA 1BTUA 1UVPA 2Z9JA 4BTIB 2HPQH 1SOZA 1MUEB 2H6MA 4H4FA 1MTNB 1ZHPA 2GMTC 1JBUH 6ESTA 4UFEH 2ZHEH 3NCLA 4MQAA 1O3KA 1J16A 1MCTA 2XRCA 1IQNA 1YPJH 3QTOH 5K7RA 5GWZA 3BSQA 3QUMP 1MAXA 3ZZ4A 4AG1A 3FANA 1MQ6A 1T7CA 1G2MA 1GHXH 2VIQA 1O31A 5EPNA 2GT8A 4NG9H 3A89A 2FOMB 1O34A 1THSH 3TGKE 1DWCH 4DCDA 3ITIA 4KP0A 1FY8E 1DSTA 1TX6A 1OYTH 4IMQA 3KNXA 2P3UB 1O2JA 5DP6A 3MI4A 1PPHE 2V0BA 4CRDA 4YT7H 1HIAA 3PMBB 3M5LA 2BDGA 2ZG0H 2AMDA 2VB0A 1SGEE 1W11U 2OBQA 1VITH 4Y7BA 2TGPZ 1TNKA 4RKJB 3ZYEA 1T8NA 3S7HB 1AO5A 1ZPCA 2VVCA 1RJXB 1UK3A 2W3KA 1B0EA 1CQQA 3P92A 3TNTA 1Z1JA 1ETSH 1XUGA 3EAJA 4GSOA 4NCYA 3RC5A 1P2OA 2A4OA 4X8VH 2Y6TA 2ESTE 1WBGB 1QL8A 1SL3A 4X2XA 1EATA 1JRTA 1EX3A 1UHBB 3U1JB 1EQ9A 2UUYA 3LU9B 4AB9A 1OS8A 2AIQA 5DK1A 2STAE 3GOVB 2BD8A 3LGYA 2UUKB 3MU4A 5TJXA 2D2DA 3GCHC 4ZHMU 1IQMA 1ZJKA 1BBRE 1C1TA 1LHGH 3MO3A 5DP9A 1HAZB 3UOPA 3LH1A 1UTLM 1XUIA 2OC1A 4A6LA 2BB4A 1DICA 1SB1H 1FUJA 1LHCH 1V2JT 3O8RA 1BTPA 1TBZH 1O36A 5E2PA 5G4BA 1OXGA 2G55A 1KXEA 5LPRA 1HJAC 1BUIA 1VITF 5A0CA 3QTVH 9LPRA 1SQAA 1GHVH 1Z7KA 2QF0A 1K2I1 2ZU4A 1NESE 2G52A 1BMAA 1NT1A 1Y59T 1QCPA 1F5RA 4XSKU 1KLTA 3ZVDA 4O3TA 2NU0E 2R0LA 3PYHA 1FIZA 1O32A 1GBMA 1SGFA 1C2MA 1RGQA 3GCHB 1SFQB 2BQ6B 3A8BA 1SMFE 3T29A 4UD9H 2GVFA 1YPHE 4MNYA 2QA9E 1TRNA 2GP9B 1AN1E 3AW0A 1EZSC 1HXEH 4Q80A 3SU0A 2XBYA 1OX1A 2XYAA 1Y3UA 2FOEA 4BAMB 1Y5AT 1O39A 3PO1C 4DURA 1K1PA 1ZHMA 4CH2B 1O3OA 1GI5A 7GCHF 1HJAB 1P8VC 1WSSH 1C9TA 2AFQB 1EZXC 1DE7H 4D7GA 1O3AA 2C93B 4B2BA 3TK6A 3TPIZ 4D9QA 2BX3A 1LHEH 2W26A 1TAWA 5DJ7A 3SU1A 1M9UA 2NU1E 1P02A 3PTNA 1O5BB 3VXFH 2BHGA 4X2YA 4JYVH 4TWWA 5EU8A 2OBOA 2LPRA 2V6NA 4XBCA 2GCTC 3RC6A 3TK9A 1V2ST 1AKSB 4JZIA 1FIWA 4YO9A 1YPKH 1LVYA 1GL1A 1ZPBA 7KMEH 1P10A 1QURH 2XBVA 3S9AA 1S85A 5C20A 5TCCA 1SGTA 1NRRH 3BTDE 5DP3A 2GV6A 3UQOA 5L2YH 4ZUHA 3LGTA 1SLUB 1TOMH 3NPSA 1A7SA 2LNCA 1LPZB 4DG4A 1VCQA 3PO1B 3LC3A 3UNQA 1AKSA 2GZ8A 4AOQA 4AGJA 1HAIH 3GICB 4JYTA 3KEEA 1TALA 1O3PB 4FUCA 1N1LA 3KIDU 4JMYA 2VWNA 3VB5A 3E16B 2SFAA 1VZQH 1ZPZA 3LPRA 3BG4C 3RXGA 3FZDA 1AB9C 1DUEA 3TIUA 3OY6U 3OY5U 1WV7H 4SGBE 1GJ6A 1O2YA 2EEKA 1P03A 1QRZA 2XXLA 3VB6A 2WPHS 1ZTJA 3SU5A 5B6OA 2ZDVH 2ZFTA 1W2KH 1AI8H 1BRUP 1DXPA 1ZRBA 4JZ1A 4WMDA 2JH0D 2OD3B 1C2IA 4BAHB 2P8OB 1O3FA 4GHQA 3I78A 1TPSA 2XC4A 3MO6A 2GZ9A 1S83A 1A0JA 2A2QH 4PROA 4K5ZA 2HNTE 3BTKE 1DLEA 4JZEH 3A88A 2ZPSA 1DX5M 1DM4B 2C8WB 3U9AH 1AFQB 6GCHF 2ODYB 1MBQA 1G3BA 1QBNA 1BITA 1ANDA 1GJ5H 3L33A 3S0NA 1WAYB 1MTUA 2QIQA 1L1GA 1YP9A 3E0PB 1GBFA 1YC0A 2TIOA 3K2UA 4YM9A 1JXPA 1HAXB 1AB9B 3QWCH 2PW8H 2ZQ2A 4AZ2B 2FWWA 2G8TA 2SGEE 1S82A 1KXAA 1K1JA 2O8LA 3A7ZA 2Y82A 1BTZA 1ELTA 3P6ZB 4E7NA 4LOYH 3DUXH 2BQWB 1NRPH 2XCNA 4NIWA 5TCAA 5EQSA 2BY5X 1C4Y2 1UK4A 4WY3A 4ASHA 3RDZA 3ZV8A 4YLUA 1TNJA 1C5OH 1D6RA 1C1WH 1HLTH 4KKDA 5JB9S 3A87A 4DT7B 1AVGH 3ZZ7A 2XW9A 1BTHH 2Q1JA 4BAQB 3BTWE 3GISB 1O2GH 4WH8A 1YLCA 5I46H 4DIHH 1QIXB 1HAHH 1MD8A 4ZHAA 1EAIA 4NFFA 1W7GH 4DJZB 1C2FA 1FJSA 5LH8A 2FS8A 4ABEA 1XVMA 3KQCA 3NZIA 3VPKA 1KSNA 1GI2A 2WV5A 1GBBA 4U32A 3AASA 3SV2H 3A8AA 4BXWA 1INCA 1KXBA 2FOGA 2F9OA 3Q77A 5EXNA 4AFZA 1Z1IA 1HAYB 1KDQA 3ZZCA 6CHAC 2AERH 5GPIB 1UTPA 1QJ6B 2NU4E 3E0NB 3SI4H 3RMNH 3ZZ3A 4B2AA 4RSPA 4YOIA 1WOFA 2BD2A 4TWYA 1D3TB 1CGIE 1H8IH 1TONA 3UY9A 5BRRE 1DS2E 1EASA 1EOJA 2G4UA