4FVBA

Crystal structure of ev71 2a proteinase c110a mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SGAIYVGNFRVVNRHLATHNDWANLVWEDSSRDLLVSSTTAQGCDTIARCNCQTGVYYCNSRRKHYPVSFSKPSLIYVEASEYYPARYQSHLMLAQGHSEPGDAGGILRCQHGVVGIVSTGGNGLVGFADVRDLLWLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2A proteinase
publication title Conformational Plasticity of 2A Proteinase from Enterovirus 71
pubmed doi rcsb
source organism Human enterovirus 71
molecule tags Hydrolase
total genus 34
structure length 138
sequence length 138
ec nomenclature ec 3.4.22.29: Picornain 2A.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvbA01
1UK2A 3RM2H 1BHXB 1NN6A 2FOEA 1HDTH 2XWBI 1AU8A 2V3HH 3P8GA 4U01A 4NA7A 3PMAB 1P3EA 1C9PA 2BY7X 4UFEH 5DP3A 4CR9A 1W10U 1AQ7A 1AI8H 1GVZA 1SOTA 5I25A 1W14U 1C5SA 2H1UA 4E7RG 4X1PU 2G55A 1ZPBA 5E2PA 4K1TA 2FX4A 1HJAB 1V2JT 3TJVA 2Q6FA 1E37B 3ZZ6A 3ODFA 4AFUA 1YGCH 4NZLA 2HALA 5E8EH 3BTFE 1BRCE 4AZ2B 2ODQA 1TABE 2ZEBA 5EG4A 3LGVA 3VGCC 3UNSA 1FQ3A 1IHSH 1LTOA 3T28A 1BTUA 3PLPA 1SG8B 1XUJA 3A86A 1CBWB 1SR5C 4AFQA 4IS5A 1C4U2 4Y7BA 1FY5A 1Z8IB 3LC3A 3BTTE 1SQAA 5DPAA 4OS7A 1HAVA 3SZNA 2Y82A 1BZXE 1HIAA 5EXNA 1GJ6A 2GV7A 1V2MT 2BLOA 2PGQB 3BEUA 1JIMA 1TAWA 4RN6A 1LPZB 4GCHG 3QDZB 1O2MA 2UUJB 4KTUA 1O2SA 1SOZA 3DFLA 4JK5A 4YLUA 2ZO3H 3SU2A 1FAKH 1OWHA 1EP5A 2VU8E 1EAXA 1PPHE 3B8JA 3CP7A 3PMJA 4MQAA 1GDUA 1W11U 2A45B 3GDSA 5DP4A 1O5BB 2ZHEH 4XFQA 4VGCB 1TLDA 2FTLE 1PPCE 4WY3A 2UWOA 7KMEH 3TGIE 1THPB 1QBOA 1DWBH 1CT2E 1ZSLA 1P10A 2QY0B 4GCHF 4IBLH 4YESB 1ZHRA 2ZHDA 4O9VA 2QIQA 1ID5H 1SB1H 3M5MA 1M9UA 1UMAH 1H9LB 3UR6A 4Y79A 1TMTH 4Y0ZE 2PKSB 3LU9B 1GCTC 4X1NU 3M7TA 5A0CA 1JRTA 1O35A 1KXAA 3SNCA 2D26C 2FWWA 1OSSA 2BX3A 3TH4H 1RS0A 2LPRA 2SGAA 3ENSB 1L0ZA 1SL3A 3PO1C 1GJDB 4CR5A 1GJ8B 1GG6B 1GI9B 2A7HA 2P16A 5GCHG 1O2RA 1EKBB 1TQ0B 4ZKSU 1GI5A 2RDLA 2PTNA 1THSH 1O38A 1OWDA 2AMPA 2ZQ1A 1O37A 4JYUH 2CHAC 1UTLM 1C1MA 1NO9H 3V12A 1VCPA 1HCGA 2G8TA 3UIRA 3IWMA 3M37A 1SFQB 4D9RA 2FEQH 1A2CH 3MO9A 3MNBA 1O2TA 5EXLA 1BA8B 2ULLA 1AVGH 1P01A 3SUFA 3MFJA 1S6HA 3U8TH 1C1QA 1EJNA 1KDQB 3LH1A 3T26A 1MZDA 2Y6TA 1ZSKA 5FPTA 3RDZA 3GCNA 4YM9A 2OUAA 3RXEA 4DURA 1S82A 1AUJA 5DK1A 1IQFA 3QTOH 3MOCA 4TY6A 2A4QA 3T25A 4Y11E 3ZZ9A 1SGIB 1FN6A 3ZVGA 1DVAH 4AG2A 3SJKA 1P2IA 1TNHA 3UNRA 2FODA 1IQLA 3JZ1B 1GGDB 1GMCG 9LPRA 2ZTZA 3TK9A 4U30A 1W7XH 4MNWA 5EQRA 5I46H 5F03A 2YNAA 1O2XA 1DLKB 1ESTA 2Y81A 3IG6B 3UQOA 1XM1A 3BEIB 4FXGH 4X6MA 2HOBA 3EA7A 1HUTH 1A0LA 2EEKA 5TCAA 2TIOA 1SGCA 1QFKH 2O9QA 2ODYB 1Z7KA 1KYNA 2ZFFH 2XRCA 1GMCF 3U8RH 4ZKRU 3TGKE 1Z1IA 1ELTA 2TGAA 2J95A 1FY3A 3RLWH 4DW2U 4BXSA 4XOJA 1CE5A 5F8XA 4HGCA 1UTKA 1O3NA 3Q76A 3DD2H 3GY5A 4RKOB 4A92A 1O39A 2WPMS 1GBMA 4XBDA 2A5AA 3SHCH 1ELDE 1O30A 1ZMLA 1TNKA 2ZCKP 2BZAA 5ESTE 1BOQA 1AUTC 1DWDH 2JH6D 4NFFA 3ZZBA 2KAIA 1GBEA 1LVMA 4LOYH 1C1NA 1BT7A 1UTOA 2RA3A 1DUAA 2V3OH 2OC0A 4GUXA 4D9QA 4X8UH 3SI4H 2CV3A 1GL1A 1GHWH 1NRNH 1JOUB 1G2LA 3NXPA 4I8HA 1G37A 3SORA 1K9OE 1TOMH 4Y76A 4AB8A 1PQ8A 1C1TA 2FYRA 1DY9A 1L1GA 4MTBA 3ZZ4A 3KIDU 2O8TA 1N8OB 3P8FA 1D9IA 4HTCH 1EAIA 1NFYA 1O2NA 2HPPH 3RLYH 2BDAA 1O2LA 1P8VC 1AVWA 1LO6A 3GY8A 1ELGA 4ESTE 3D62A 4XDEA 5LPEA 1EX3A 5DKMA 3KQBA 4MNXA 3UPEA 1MAXA 1GJ4H 2XBWA 1GHVH 3OYPA 2Y5GA 3L33A 2BYAX 2PKSC 1P9UA 2F3CE 1O3MA 1QJ6B 3BEFB 1FJSA 1OYQA 1EB1H 2BZ6H 2A7JA 1A1RA 3FZZA 1DSTA 1PQ5A 1Y3UA 3SQEE 1XMNB 2FYQA 2ZTYA 4WXVA 2C8ZB 3QGNB 1QY6A 1C5RA 1UTPA 1TALA 1EZXC 2ZFRH 2W3KA 3ATIA 1CA8B 4CRGA 4BXWA 8ESTE 1DANH 1BBRH 1ABIH 4JYTA 2K1QA 3LIWA 2ZFQH 1HBTH 3ZVDA 7LPRA 3ZZDA 1Z1JA 3RXBA 3SOSA 1EAWA 5FHTA 1AO5A 1V2QT 4NFEA 4ZKNU 5GPIB 3GYMA 3F1SB 1P05A 3QX5H 3TH3H 1ESBA 3SU1A 5HMAA 4DG4A 2VGCC 1O3CA 1SGFG 1TBZH 5FBIA 2GZ7A 4E7NA 4RSPA 1ELAA 3URDA 3OX7U 1IQHA 1D3DB 5FCRA 5K7RA 1ELFA 2FM2A 1HLTH 3BIVH 2C8WB 3CS0A 5FPSA 1O3AA 2BDHA 1OWKA 2ANKH 2XXLA 1WQVH 3E3TA 3RU4T 1BIOA 1ZYOA 2FP7B 4GPGA 4JZEH 5C67A 3SV6A 5HM9A 1YP9A 3SJ9A 2BD4A 1RD3B 2Z9IA 1JBUH 2O8MA 1U6QA 1KSNA 2Z7FE 1F0RA 3GDVA 2BD7A 1F5RA 1WCZA 1DE7H 2GCHG 1XXFA 2ZHQH 4K60A 2GMTB 3RXRA 2FZZA 2P3FH 2FX6A 1QRWA 1DXPA 1HYLA 2VH6A 3SJ8A 5BPEA 2VNTA 5A8YA 2PSYA 1G30B 2F91A 1BMMH 2W5EA 4K3JA 3R0FA 2SGEE 4MPUA 4X8TH 3S7KB 2VJ1A 1MKXK 1L4ZA 3OSYA 4Y7AA 1CT0E 1D6WA 2GCHF 2VIDA 1QCPA 1W0ZU 1AFQC 1TGBA 2R3UA 2VIVA 2DE9A 2XCFA 1ZR0A 1NY22 2FLBH 1TYNA 3M7QA 1MBMA 4I8LA 2GVFA 4UD9H 1P2OA 1TX6A 2HGTH 1IHTH 4NIYA 5EGMA 2QN5T 5FCKA 5LPFA 4K69A 4UDWH 1WBGB 4Y71A 1O5FH 1GI2A 4FUBA 4U2WA 1UCYE 4IN1A 3RXFA 4FUGA 2HVXA 2ZA5A 1Q3XA 2AH4X 1K1JA 1INCA 1QGFA 4A1VA 4BTIB 2QF3A 5AVDA 1GVLA 2QCYA 2GKVE 1YPKH 1PQ7A 3A7VA 2OC8A 1S6FA 2W26A 1K1OA 1GBJA 4ISOA 2ZZUH 3O8RA 1KLJH 1A46H 1V2RT 1LQDB 1AZZA 1C5ZB 1QURH 1P11E 4OS5A 5TJXA 3ZVEA 3C1KA 2BTCE 1WAYB 3VFEA 4OGXA 2J38A 3LH3A 1T8OA 1L1JA 4Y0YE 2J92A 4H6TA 1F92A 2P59A 1ZZZA 1Z6EA 3AVZA 4MPXA 2CJIA 1PQAA 3GY6A 1J8AA 1BTHH 1TOCB 4DVAU 1UJ1A 3M3SA 5EPYA 1A0HB 1J9CH 3MU1A 3VXEH 3K9XB 1BTWA 1WTGH 2BM2A 2FOMB 3B23B 1Y3XA 4THNH 2D2DA 5HM2A 3KCGH 3STIA 2NU2E 4WVPE 5C1XA 1MKWK 5K0HA 3KHVA 5IDKA 3E0PB 3RXPA 3VB4A 1ZJDA 1DT2A 3MYWA 4R8TB 1C2GA 2OBOA 4X6NA 1HB0B 3E90B 2ESTE 2AIPA 1XUKA 1GI8B 3GICB 1BB0B 3PWBA 3SUEA 3SHAH 2P94A 1H1BA 3QGJA 3MU4A 1AGJA 1NTPA 4R0IA 3S7HB 3E8LA 4OS1A 4Y10E 1ORFA 2VIOA 3UREA 1ANBA 3ZV9A 3U1IB 1SGFA 3LT3A 2ZPSA 3RXKA 2PHBA 3SNEA 2W3IA 2GZ9A 4GAWA 3ESTA 1FPHH 5A0BA 3I78A 1C1OA 1IAUA 1XVMA 4NIXA 2CMYA 1C4Y2 5TCCA 4AFZA 4A1TA 4INLA 2ZGXH 4GHQA 1F7ZA 3L6PA 1XKBC 3PMBB 3JZ2B 1SC8U 2BD9A 1F0UA 3S9AA 3EGKH 1GJ7B 5T6GA 3UWIA 2GZ8A 1AB9B 2GMTC 1DSUA 3SNBA 2VWMA 1QB1A 1CSOE 1OYTH 1V2NT 4IGDA 5AF9H 1L4DA 2PSXA 3RC5A 3BTEE 4NWLA 4AYYB 2STAE 2IJOB 1P2JA 4ABDA 1MQ5A 1EQ9A 5GXPA 1OS8A 1GHZA 1TMBH 1C5PA 2J9NA 1OX1A 3KNXA 3BSQA 4X1RU 3UOPA 3U9AH 4ABBA 1O2YA 1AN1E 4B2CA 1TMUH 3ATWA 1ZPCA 3NCLA 4X2WA 2BDIA 2VVUA 5E0JA 4J1YA 1CA0C 4ZAEA 3I29A 2ZDLA 2QXIA 1GBAA 3NZIA 1UTJA 1ELCA 1GI6A 2H9TH 2B7DH 5J4QA 1AY6H 4YO9A 1NS3A 1TRYA 3P70B 2ALVA 2WYGA 4ZH8A 1FN8A 1GBDA 4JK6A 4FUJA 1O3HA 1PPBH 3AAVA 2SGDE 2W7UA 3RXAA 1C1PA 3VB5A 2SGFE 4XSKU 3EQ0H 1YPHE 1OP8A 1O2JA 1ELVA 4FUHA 3F9HA 2J2UA 4X8VH 3MO3A 3VB6A 4Q80A 2GP9B 2ZF0H 4Y8ZA 1SGNE 2ZPRA 4Y8YA 3TVJB 1H4WA 2O8UA 4DIIH 4MVNA 3A83A 3LDXH 3LGUA 2ZDVH 3SUGA 4NA8A 1C5MD 2AMDA 1TPSA 3A7ZA 4XBBA 5LH8A 3BV9B 5B6OA 2F9NA 1RIWB 2AERH 5A8ZA 3A7XA 3P92A 3TH2H 3MO6A 1QJ7B 3SU3A 4UFFH 2C4FH 5IYTA 3V13A 1DLEA 1LVYA 2BLQA 2SFAA 1ZGVA 3SNDA 3P6ZB 2G81E 1Z8GA 1S81A 3TNTA 2GDDA 3LONA 1MTNB 2BHGA 2BQWB 3A85A 2THFB 2ASUB 1A0JA 3KF2A 2TBSA 4ZMAH 1SLWB 3DUXH 4X6OA 5JBCS 3ODDA 1QBNA 1UVSH 3VB7A 2ZHFH 1DDJA 2C8YB 3Q3YA 1BMAA 3MNCA 2G51A 2ZU1A 3SU4A 4AGJA 1C5VA 3GCOA 5EQSA 2AGGX 1BJVA 2TGTA 4DGJA 2ZI2H 4DY7B 8GCHG 1ESAA 3GY4A 1BBRK 4KTSA 5HYOA 1BITA 1A61H 1V3XA 3LGTA 3M3TA 1F5LA 1FLEE 3P8OA 4H42U 2NU1E 2OBQA 3E1XB 2PUXB 2A2QH 4UFDH 1CGIE 2ZG0H 5F8TA 1QA7A 1GBLA 3BTWE 1AHTH 2VIQA 2Z3CA 1HAOH 1TBRH 2XBVA 2XBXA 8GCHF 1GJAB 1YPLH 1C5NH 2PUQH 3E16B 4ZXYH 3SNAA 5EW1H 3T5FH 1O2HA 4OS2A 2ZNKH 1BRAA 1RTKA 2VVCA 1O3BA 5DP8A 2I6SA 1ARBA 3F68H 1ZMJA 3PYHA 3UY9A 1H9HE 3B9FH 5J4SA 4B75A 1Z6JH 3NPSA 1W12U 1ABJH 3ZYEA 3AAUA 2Z6BD 1C5LH 2R2WU 1UO6A 1KIGH 5GCHF 1P03A 1QQ4A 4RKJB 4D8NA 2VINA 3UTUH 3UQVA 2FOCA 4A6LA 3FANA 3KL6A 1HRTH 1SQTA 5C5NA 1EXFA 3W95A 1Y59T 1GMDG 2A4RA 3BG4C 4WWYA 5CE1A 2HLCA 2XYAA 4KP0A 3M36A 5C1UA 2FIRH 4A5TS 1DPOA 1RTFB 1QB9A 3KGPA 2STBE 3P95A 4U32A 1CT4E 1WUNH 4FUFA 5BRRE 3GCHB 2PTCE 3RXOA 3K6ZA 1OOKB 4CRAA 4I7YH 1C2LA 2VVVA 3CS7A 1GMDF 2F9BH 1GCDA 3HKJB 1LVBA 4IN2A 3RXDA 4AFSA 1DUEA 4CHAB 2PGBB 3F9FA 1Z8JB 4DIHH 1SGQE 2BY5X 1ETTH 1GBTA 1ZOMA 1J14A 4LK4A 2GV6A 3FZDA 1BRUP 1VCWA 1BCUH 1C5TA 1HJAC 2ZU2A 1HAZB 3S69A 4DCDA 2A32A 2BD3A 1O3KA 1YYY1 4KGAA 1KDQA 2H5CA 1G9IE 1BMLA 1UCYH 1ZRKA 2ANWA 1EOLA 2FOGA 2P8OB 2QXGA 3T2NA 1CBWC 4NA9H 5DP5A 4E06H 1Y8TA 3A8CA 1D3TB 1IQEA 5AHGH 3NK8A 3F9GA 2XCNA 3SJIA 3QO6A 1H8DH 2AEIH 4F4OC 3TK5A 1SI5H 1ZJKA 1EZSC 1AFEH 1EZQA 1K22H 1K2I1 1EPTB 1O34A 3H7OA 1GHAG 2EI6A 1HJ9A 4UE7H 1PYTD 4PROA 2AS9A 1C2FA 1F2SE 2SNWA 2WUBA 3RMLH 1MTNC 5HXFA 2UWLA 2Z3DA 3EA8A 1O3GA 2ZU4A 1TRNA 1KXBA 4IC5A 1GJ5H 1PPZA 5HGGA 1NM6A 1LQEA 1HJ8A 1V2UT 2ZDAH 3PROA 2AGIX 4FUEA 1EASA 1W0YH 4Q2KA 2GDEH 2A0QB 4VGCC 1MH0A 4WH6A 2ZECA 2D8WA 2QXJA 3FP7E 1GHAF 1YKTA 5CHAB 1D3PB 5JPMH 1DWCH 2J4IA 1MZAA 1K21H 1DX5M 1C5YB 1GHBG 1OKXA 1T32A 1SGTA 5CMXH 1W13U 2YOLA 4ABIA 1PFXC 3VB3A 2GCTB 1GG6C 2UUKB 1O2OA 1VR1H 4CH2B 1T7CA 2Y5FA 2HNTE 1TNIA 3PTNA 2Z9KA 5AFYH 1Z8RA 2HNTF 4AGKA 1UVUH 1GHBF 3BTME 1FXYA 2OXSA 4IMQA 5G4BA 1TX8A 3UUZA 2O8WA 3O8CA 3ZV8A 1NU9A 3D23A 3RUOA 1T4VH 4Q7YA 5LGOA 1CVWH 3MU8A 2XTTB 1VITH 3TNSA 2PKAB 4UONA 4X8SH 1IQKA 2GX4A 1SMFE 1N6XA 4I31A 1GI3A 2ANYA 2F83A 4DJZB 3A82A 2ZC9H 1C1RA 2FMJA 2GD4B 1K1IA 1SGDE 4Q7ZA 2BXUH 2ZCLP 1ETSH 1V2OT 3ZVCA 1NFWA 3ATKA 5JBAS 3G01A 4AB9A 1C1VH 3SN8A 4CREA 4BAMB 1V6DA 3OU0A 1FIZA 4HI3A 3ZZAA 3ZVFA 1IQJA 2QGRA 3M61U 4NIWA 4YT7H 5JYIA 1GGDC 2BY9X 1SGYE 2V35A 1OP2A 2P93A 6CHAB 1GBBA 1EJMA 2FDAA 2BDBA 2P3UB 3V3MA 1KY9A 2BLWA 2WPHS 1S83A 1DITH 1NRQH 1SLUB 1O3DA 1YLDA 1G3EA 1LHEH 4WF8A 2C93B 5JB8S 4B73A 1NESE 4ISIH 4NZQA 1C2KA 3A80A 3BN9A 3Q00A 3U1JB 1BTYA 2PKAA 1K28D 1O2KA 1AVXA 2DUCA 5DJ7A 1P2KA 2C90B 3STJA 2WPKS 1MTUA 3Q3XA 1WTHD 2VB0A 2ZHWH 3BG8A 3MH6A 1O5AB 1TNJA 2ZGCA 2VIWA 2HRVA 1XUGA 1IQMA 1O2UA 1J16A 1F0SA 1ZSJA 3D49H 1ANCA 4AOQA 1B0FA 1FUJA 4YOIA 4AG1A 1RJXB 1HGTH 5FX6A 3W94A 4MNVA 6LPRA 1SVPA 3OY5U 1XVOA 1MMJN 1CQQA 3MH4A 6GCHG 4X6PA 1NRRH 3U98H 1O2VA 1YCPM 2R9PA 1H9IE 2GGVB 1N8OC 5C2ZA 3K2UA 1QTFA 2BVSH 1NFXA 1KXDA 3ZZ5A 3GOVB 2BB4A 2BVXH 2JH5D 1AIXH 4ZUHA 4TY7A 3RXQA 5F6MA 4OS4A 3SV8A 1O5GH 1N1LA 1G36A 2ZPQA 2QA9E 5DP6A 2ZKSA 3VGCB 1KXCA 1TPAE 4ASHA 1PYTC 2G4TA 3D65E 4K8BA 1OWJA 3RXSA 3QWCH 4A7IB 4ZKOU 1W7GH 1A3EH 3RXMA 1TQ7B 1P2MA 1O31A 3BTHE 3IITA 3EYDA 1NU7B 5A8XA 2A31A 5GDSH 1OWEA 2IN2A 1PPEE 5EU8A 1OWIA 1T8MA 1TWXB 3PLBA 2H9EH 4BTTB 5T6FA 3A7TA 2GCTC 1E38B 2XC0A 2XBYA 3M5OA 5F8ZA 1XX9A 3SV9A 1LDTT 1QL8A 3MTYA 1L2EA 1HNEE 2FLRH 1ZGIA 1K1LA 5EW2H 1P04A 4MDSA 3QLPH 3S9BA 2C8XB 1UTQA 1XUHA 4NG9H 2ZFTA 3FP6E 1X7AC 1EZUC 1EB2A 2A5IA 1GBKA 4MG3A 3Q77A 4NIVA 2R0KA 1J15A 1QBVH 4CRFA 4ZHLU 2G5NA 3M3VA 4JYVH 3RXLA 3FP8E 1VITG 3TITA 2FI3E 3PV4A 1FIWA 1GI0A 5EPNA 1FDPA 1RFNA 1GCTB 1C9TA 1THRH 4B2BA 1T31A 2G4UA 1C1WH 3H5CB 3BTQE 2GTBA 2HPQH 2NWNA 5JB9S 5FBEA 3ZZCA 2TPIZ 4IMZA 2XW9A 3PO1B 4MNYA 3MNSA 3LKWA 1MD8A 1VITF 4GSOA 3SGBE 1O3EA 2QV1A 1ZHPA 1SGPE 2CHAB 2PR3A 3A81A 3LPRA 4J2YB 5T3HA 1IOEA 1TPOA 2Z9LA 2QAAA 1GJCB 2UWPA 3ELAH 3GISB 1C5UA 5C5OA 1V2TT 4XE4A 3QZQA 5DGJA 2LNCA 1NROH 4LZ4B 2A7CA 2TGPZ 3BTGE 1GDNA 1E35B 1O33A 5L30H 3GY2A 1YCPH 2B5TB 5DP9A 4BAOB 3BF6H 2FS9A 4FVBA 5A0AE 1BTZA 1P3CA 1BTPA 1NPMA 4HZHA 7GCHG 3A7YA 1QIXB 1S0QA 4Z6AH 3ZZ3A 3MNXA 1GBFA 3LGWA 1AE8H 4QT8C 1CO7E 3QUMP 1C2DA 1O2PA 1O2WA 1UTNA 3OTJE 2ZU5A 2ZGBH 4K5ZA 4NGAH 1NT1A 1C4V2 3QK1A 1HV7A 3L3TA 2BVRH 4D7FA 4CBOA 2ZQ2A 4BAQB 7GCHF 1KXEA 1TGTA 4YOGA 1SLXB 3RC6A 2PW8H 7ESTE 3HPTB 4AN7A 2ZWLH 3EE0B 2BDCA 1V2PT 1RXPA 2XC4A 3EAJA 2ZFPH 1RTLA 4WXIA 1O32A 3A89A 3A8DA 1YBWA 3PLKA 3RC4A 1VGCB 2JKHA 2H6MA 2V6NA 4YT6H 5H4IB 1NC6A 1C5QA 4Y6DA 1MKXH 4I8GA 3LGYA 3EDXB 1MD7A 1ETRH 2IOTA 1CHGA 2BXTH 1JXPA 1A3BH 1O0DH 1O2IA 2VIPA 3V7TA 3I77A 1Y5AT 2H9HA 5FPYA 4BOHA 4YLQH 4TPYA 3LOXA 1SPJA 1W8BH 4H4FA 3O8BA 1FY1A 4WMFA 2ZTXA 4FU8A 4ABJA 1PJPA 1QHRB 3T29A 1VJAU 4A1XA 1O3FA 3PB1E 2H2ZA 1WOFA 4TWWA 4Z0KA 1C2MA 2Z94A 3ZZ8A 4B1TA 2ZGHA 1TB6H 1AZ8A 3KQCA 1C1UH 1C5WB 2D1JA 1O5DH 2AYWA 2BY8X 1TBQH 1SHYA 1P09A 3RXVA 2SGPE 3BIUH 2SNVA 1O3OA 2BD5A 1QA0A 3Q3KA 1PPGE 3MU0A 4E05H 3RXJA 1BDAA 2A1DB 3LGIA 4FUCA 3SBKA 3MI4A 1OXGA 4O03A 2R3YA 2XWAA 1W2KH 2C3SA 4I33A 1O3JA 2BDGA 3HGNA 1E36B 1JIRA 1H8IH 1DOJA 1HAHH 4NWKA 8KME2 2OC7A 4D76A 2RCEA 2FTMA 1NRSH 1WSSH 2ILNA 3M5NA 1K1PA 3LC5A 3KEEA 4FU7A 2TGDA 3M7UA 3ITIA 1N6YA 1TRMA 1CGHA 5EQQA 4GLYA 2FXRA 1YPJH 3P17H 1F0TA 1YF4A 2TRMA 1Y5BT 3CENA 1JWTA 1YPMH 1MKWH 4JZIA 4NSYA 1MCTA 5GIBA 5A2MH 1Y3YA 5DO4H 4ZXXH 1G32B 1MQ6A 2OINA 4M7GA 4AX9H 1MTVA 4ABGA 1AB9C 1GI7B 2HWLB 1UVPA 1E0FD 2WPJS 2NU4E 3KN2A 2WV5A 4ABHA 2FS8A 4H6SB 6ESTA 5L2YH 2J94A 1IQIA 1A7SA 1SFIA 3A8AA 1LKAA 3HATH 1B5GH 2CF9H 1O3IA 3SU6A 1LVOA 1Q31A 2Y80A 4X2YA 1UVTH 3HK6B 4MPWA 3O8DA 4NSVA 2ZCHP 1QJ1B 2J34A 2OD3B 2VGCB 3BTKE 3SGAE 3URCA 2BD2A 3SV2H 1FZZA 3LJJA 1P02A 5FX5A 3K65B 3TGJE 2ZU3A 1ELEE 1VCQA 4ISNA 3TJNA 1UTMA 1FPCH 1DXWA 4KTCA 3LJOA 1BTXA 2Z9GA 1HXFH 1DICA 2KAIB 1G3CA 1J17T 1FNIA 2R0LA 3SO3A 1WQSA 3E0NB 3N7OA 4JZFH 2P95A 1AKSB 5AFZH 3SQHE 3SV7A 3RMNH 1PPFE 2G00A 4OGYA 5EOKA 1YM0A 1V2WT 4K2YA 2W7SA 3SI3H 3TU7H 1QL9A 1P57B 2OLGA 1V2ST 1UVOA 1C2HA 3SJOA 2FOHA 1O3PB 2Z9JA 5GWZA 1ZLRA 4FUDA 3F6UH 4YTAA 1T8NA 1VGCC 1BRBE 1HPGA 4I8KA 1E34B 1CHOG 3AASA 2JH0D 2ANMH 5GJ4B 1RIWC 1AFQB 1KLIH 1Q2WA 1EP6A 3QZRA 3H7TA 4AYVB 5SGAE 1V2LT 4B74A 4YZUA 2QF0A 8LPRA 5EXMA 1D4PB 1EJAA 1TIOA 1CHOF 1QQUA 4JCNA 3PWCA 1MU6B 4Q7XA 2OTVA 3GY3A 4IC6A 2AFQB 2BMGB 2CGAA 2FI5E 1NFUA 1VJ9U 4X2VA 4LXBH 2BX4A 1SQOA 2FOBA 1NRPH 2WYJA 1AWFH 3SU0A 1AKSA 3ZYDA 3QN7A 2R2MB 4AORA 4X1SU 4Y8XA 1MUEB 4WMEA 3MHWU 1FONA 3ATLA 1B0EA 9ESTA 1P12E 1GVKB 2BQ6B 1GBCA 4TPIZ 2AIQA 5JDUB 1BQYA 1O3LA 5L6NH 1WU1A 3UWJH 1CGJE 4ISHH 1T8LA 2I6QA 5PTPA 1GWAA 2RA0A 2CN0H 1DM4B 4IW4E 4BAHB 1QR3E 1HAPH 1RGQA 3GDUA 1CU1A 4I8JA 2BOHB 3DFJA 3TLOA 1EPTA 1VZQH 2FO9A 1HFDA 1LHFH 1W3CA 2NU0E 1YPHC 3NKKA 1GHXH 2SGQE 3SU5A 1ANEA 2PLXA 2WV4A 2ZDKA 1JRSA 1O5EH 2PFEA 1GMHG 4HFPB 3A88A 3FVFB 1TGSZ 2V0BA 4JZ1A 3V0XA 1UK4A 3GCTG 2ALPA 1ACBE 3PM3A 1KTSB 2FOFA 1C2IA 1GHYH 1S0RA 3A84A 5C3NA 3RXHA 3A8BA 1FAXA 1ZRBA 2ZGJA 4XBCA 3P8NA 1OPHB 1TNGA 2VH0A 1LHCH 2FOAA 1XUFA 1LMWB 1ELBA 1KTTB 4BTUB 1GMHF 1WV7H 2OCVB 2FESH 1S85A 2QYIA 1C1SA 4BNRA 1C2JA 2EI8A 1FV9A 1YCPK 1WYKA 3BTDE 3GCTF 3GCHC 4TWYA 1YC0A 1AWHB 2WUCA 4CRCA 1RRKA 1P9SA 2BLVA 2EA3A 4JZDH 1LKBA 3AW1A 3MH7A 1ZPZA 1XXDA 1YPGH 4CHAC 1SHHB 4OS6A 4B71A 2BOKA 1LHGH 2F9PA 3UFAA 2VWNA 2ODPA 2BQ7B 3TIUA 2WPLS 2QXHA 4B76A 2G5VA 4DOQA 3K6YA 3NUMA 4O3UA 4F49A 4K8YA 4YOJA 1IQNA 2FPZA 3C27B 4CH8B 1HAGE 3AW0A 3KQEA 2ZDNA 4O3TA 1MBQA 1FMGA 3T62A 3TJUA 1EOJA 1P2NA 1C5OH 1ARCA 5DG6A 4BAKB 2VWLA 3MU5A 4GHTA 4K1SA 4WMDA 1QL7A 1DY8A 2P8OC 1LCYA 2IPHA 1ZTLA 3ZVAA 1ZMNA 1MAYA 4INKA 3RXTA 3ZVBA 1O2QA 1TGNA 2JETB 2B0FA 2EI7A 2RG3A 5A09A 3UR9A 2XNIA 3E6PH 1TPPA 1KLTA 4ZHAA 4ABFA 4MLFB 4KKDA 1DS2E 1CA0B 1HAIH 1EPTC 4GVUA 4ZHMU 3FFGA 3E91A 2CF8H 2Y7ZA 1QNJA 3RMOH 1AMHA 1C2EA 1MCVA 1ZHMA 1O5CB 1P2QA 2AMQA 2NU3E 1TX7A 1G3BA 3FAOA 1GI1A 3R3GB 3RP2A 3EA9A 2O8LA 4UFGH 3VXFH 3U69H 1EATA 1GBHA 2G52A 5L2ZH 1UK3A 2ZIQH 1K1MA 4SGBE 2BD8A 3RU4E 2FI4E 2A5KA 1LHDH 2A4OA 3S9CA 4BANB 1SGRE 3VEQB 4SGAE 1BUIA 1FI8A 5CHAC 4LZ1H 6GCHF 3MH5A 1A4WH 1QRZA 2GT7A 2F9OA 1IQGA 1YPEH 2OP9A 1A5GH 2Q1JA 3ZZ7A 2OQ5A 1L1NA 1G3DA 1QB6A 1V2KT 1P06A 1KXFA 1V2VT 1TFXA 5E2OA 3NWUA 3TJOA 1C5XB 4JMYA 3A87A 4FU9A 2Z3EA 4FVDA 1GBIA 1K1NA 3GYLB 2YNBA 1Y3WA 1XKAC 1EAUA 3RXGA 1F5KU 3PTBA 3UOUA 2P3TB 1S84A 2B9LA 3RXUA 3RXCA 1JMOH 3RXIA 3VPKA 1SLVB 3SGQE 3DA9B 3KQDA 1TONA 5EODA 3HKIB 1TE0A 1GDQA 2ZFSA 2B8OH 2Q6DA 1BMNH 1EUFA 2ZDMA 1HAXB 1P0SH 1T4UH 1OP0A 2F9VA 1AE5A 3T27A 3QTVH 1SSXA 4TYDA 1BHXF 5LPRA 4DT7B 1O36A 4B2AA 3HK3B 2M5TA 1GI4A 1UHBB 1FY8E 2BY6X 4X2XA 5FAHA 3RMMH 2Y7XA 1DFPA 1YLCA 4KELA 2OC1A 3RU4D 2WPIS 5ABWA 2CXVA 4ABEA 1GJ9B 1HAYB 1AD8H 1D3QB 4CRDA 5E0GA 2GT8A 2VWOA 1GL0E 3A7WA 4X1QU 1MU8B 5JBTA 2A2XH 2QC2A 2WINI 3S0NA 1O2ZA 1NZQH 3MMGA 3GY7A 1HXEH 3HGPA 3UNQA 5ESBA 1SGEE 6CHAC 1BBRE 2UUYA 4NCYA 4X0WU 5DP7A 2UUFB 1A5HA 2OQUA 3SW2B 2BDYA 1G2MA 3DT0H 2F9UA 2Y5HA 1D6RA 2EC9H 4CBNA 1MTSA 5C1YA 3U8OH 3WY8A 1B7XB 4FUIA 5JBBS 1ZTKA 5T6DA 1XUIA 1Y5UT 2Q6GA 4ZROA 1LPKB 3M35A 1QRXA 1TGCA 2H5DA 4WH8A 3M5LA 1GJBB 2XC5A 1BJUA 3TK6A 4O97A 1LPGB 3F9EA 4I32A 2AGEX 1UCYK 4K1EA 4D7GA 5C20A 3DHKH 1UHBA 3MWIU 3ATMA 3BG4B 1TA6A 2PWXA 1MTWA 3SUDA 1S5SA 1ZTJA 1DWEH 4UEHH 4MPVA 2ZP0H 3PMHB 4ABAA 1GPZA 1SBWA 1Y3VA 1O2GH 3OY6U 2DE8A 2HNTC 2PV9B 4ISLA 5E0HA 1HAVB 4WJG2 4INHA 5ETXA 1HIAB 2JETC 3TPIZ 4CRBA 1TA2A 2A4GA 1ANDA 1TNLA 3RM0H 1Z71A 1FY4A 5FXLA 1A5IA
chains in the Genus database with same CATH superfamily
1UK2A 3RM2H 1BHXB 1NN6A 2FOEA 2L74A 1HDTH 2XWBI 1AU8A 4RI0A 2V3HH 3P8GA 4U01A 4NA7A 3PMAB 1P3EA 1C9PA 2BY7X 4UFEH 5DP3A 4CR9A 1W10U 1AQ7A 1AI8H 1GVZA 1SOTA 5I25A 1W14U 1C5SA 2H1UA 4E7RG 4X1PU 2G55A 1ZPBA 5E2PA 4K1TA 2FX4A 1HJAB 1V2JT 3TJVA 2Q6FA 3F2FA 1E37B 3ZZ6A 3ODFA 4AFUA 1YGCH 4NZLA 2HALA 5E8EH 3BTFE 1BRCE 4AZ2B 2ODQA 1TABE 2ZEBA 5EG4A 3LGVA 3VGCC 2QF4A 3KQ5A 5B6LA 3UNSA 1FQ3A 1IHSH 1LTOA 3T28A 1BTUA 3PLPA 1SG8B 1XUJA 3A86A 1CBWB 1SR5C 4AFQA 4IS5A 1C4U2 4Y7BA 1EFRD 1FY5A 1Z8IB 3LC3A 3BTTE 1SQAA 5DPAA 4OS7A 1HAVA 3SZNA 2Y82A 1BZXE 1HIAA 5EXNA 1GJ6A 2GV7A 1V2MT 2BLOA 2PGQB 3BEUA 1JIMA 1TAWA 4RN6A 1LPZB 4GCHG 3QDZB 1O2MA 2UUJB 4KTUA 1O2SA 1SOZA 3DFLA 4JK5A 4YLUA 2ZO3H 3SU2A 1FAKH 1OWHA 1EP5A 4DT4A 2VU8E 1EAXA 1PPHE 3B8JA 3CP7A 3PMJA 4MQAA 1GDUA 1W11U 2A45B 3GDSA 5DP4A 1O5BB 2ZHEH 4XFQA 4VGCB 1TLDA 2FTLE 1PPCE 4WY3A 2UWOA 7KMEH 3TGIE 1THPB 1QBOA 1DWBH 1CT2E 1ZSLA 1P10A 2QY0B 4GCHF 4IBLH 4YESB 1ZHRA 2EY4C 2ZHDA 4O9VA 2QIQA 1ID5H 1SB1H 3M5MA 1M9UA 1UMAH 1H9LB 3UR6A 4Y79A 1TMTH 4Y0ZE 2PKSB 3LU9B 1GCTC 2F43B 3M7TA 4X1NU 5A0CA 1JRTA 1O35A 1KXAA 3SNCA 2D26C 2FWWA 1OSSA 2BX3A 4TSFD 3TH4H 1RS0A 2LPRA 2SGAA 5CDFE 3ENSB 1L0ZA 1SL3A 3PO1C 1GJDB 4CR5A 1GJ8B 1GG6B 1GI9B 2A7HA 2P16A 2JIZD 5GCHG 5EJ1A 1O2RA 1EKBB 1TQ0B 4ZKSU 1GI5A 2RDLA 2PTNA 1THSH 1O38A 1OWDA 2AMPA 2ZQ1A 1O37A 4JYUH 2CHAC 4ASUD 1UTLM 1C1MA 1NO9H 3V12A 1VCPA 1HCGA 2G8TA 3UIRA 3IWMA 3M37A 1SFQB 4D9RA 2FEQH 1A2CH 3MO9A 3MNBA 1O2TA 5EXLA 1BA8B 2ULLA 1AVGH 1P01A 3SUFA 3MFJA 2KM0A 1S6HA 3U8TH 1C1QA 1EJNA 1KDQB 3LH1A 3T26A 1MZDA 2Y6TA 1ZSKA 5FPTA 2WSSD 3RDZA 3GCNA 4YM9A 2OUAA 3RXEA 4Q63A 4DURA 3FN8A 1S82A 1AUJA 5DK1A 1IQFA 3QTOH 3MOCA 4TY6A 2A4QA 3T25A 5T1VA 4Y11E 3ZZ9A 1SGIB 1FN6A 3ZVGA 3ZIAD 1DVAH 4AG2A 3SJKA 1P2IA 1TNHA 3UNRA 2FODA 1IQLA 3JZ1B 1GGDB 1GMCG 9LPRA 2ZTZA 3TK9A 4U30A 1W7XH 4MNWA 5EQRA 5I46H 5F03A 2YNAA 1O2XA 1DLKB 1ESTA 2Y81A 3IG6B 3UQOA 1XM1A 3BEIB 4FXGH 4X6MA 2HOBA 3EA7A 1HUTH 1A0LA 2EEKA 5TCAA 2TIOA 1SGCA 1QFKH 2O9QA 2ODYB 1Z7KA 1KYNA 2ZFFH 2XRCA 1GMCF 3U8RH 4ZKRU 3TGKE 1Z1IA 1ELTA 2TGAA 2J95A 1FY3A 3RLWH 4DW2U 4BXSA 4XOJA 1CE5A 5F8XA 4HGCA 1UTKA 1O3NA 3Q76A 3DD2H 3GY5A 4RKOB 4A92A 1O39A 2WPMS 1GBMA 4XBDA 2A5AA 3SHCH 1ELDE 1O30A 1ZMLA 1TNKA 2ZCKP 2BZAA 5ESTE 5HKKD 1BOQA 1AUTC 1DWDH 2JH6D 4NFFA 3ZZBA 2KAIA 1GBEA 5F53A 1LVMA 4LOYH 1C1NA 1BT7A 1UTOA 2RA3A 1DUAA 2V3OH 2OC0A 4GUXA 4D9QA 4X8UH 3SI4H 2CV3A 1GL1A 1GHWH 1NRNH 1JOUB 1G2LA 3NXPA 4I8HA 2WZQA 1G37A 3SORA 1K9OE 1TOMH 4Y76A 4AB8A 1PQ8A 1C1TA 2FYRA 1DY9A 1L1GA 4MTBA 3ZZ4A 3KIDU 2O8TA 1N8OB 3P8FA 1D9IA 4HTCH 1EAIA 1NFYA 1O2NA 2HPPH 3RLYH 2BDAA 1O2LA 1P8VC 1AVWA 4XD7D 1LO6A 3GY8A 1ELGA 3DCLA 4ESTE 3D62A 4XDEA 5LPEA 1EX3A 5DKMA 3KQBA 4MNXA 3UPEA 1MAXA 1GJ4H 2XBWA 1GHVH 3OYPA 2Y5GA 3L33A 2BYAX 1P9UA 2PKSC 2F3CE 2J98B 1O3MA 1QJ6B 3BEFB 1FJSA 1OYQA 1EB1H 2BZ6H 2A7JA 1A1RA 3FZZA 1DSTA 1PQ5A 1Y3UA 3SQEE 1XMNB 2FYQA 2ZTYA 4WXVA 2C8ZB 3QGNB 1QY6A 2M2AA 1C5RA 1UTPA 1TALA 1EZXC 2ZFRH 2W3KA 2QE7D 3ATIA 1CA8B 4CRGA 4BXWA 8ESTE 1DANH 1BBRH 1ABIH 4JYTA 2K1QA 3LIWA 2ZFQH 1HBTH 3ZVDA 7LPRA 3ZZDA 1Z1JA 3RXBA 3SOSA 1EAWA 5FHTA 4B6FA 1AO5A 1V2QT 4NFEA 4ZKNU 5GPIB 3GYMA 1NBME 3F1SB 1P05A 3QX5H 3TH3H 1ESBA 3SU1A 5HMAA 4DG4A 2VGCC 1O3CA 1SGFG 1TBZH 2WPDD 5FBIA 2GZ7A 4E7NA 4RSPA 1ELAA 3URDA 3OX7U 5IK2D 1IQHA 1D3DB 5FCRA 5K7RA 1ELFA 2FM2A 1HLTH 3BIVH 2C8WB 3CS0A 5FPSA 1O3AA 2KFWA 2BDHA 1OWKA 2ANKH 2XXLA 1WQVH 3E3TA 3RU4T 1BIOA 1ZYOA 2FP7B 4GPGA 4JZEH 5C67A 3SV6A 5HM9A 1YP9A 3SJ9A 2BD4A 1RD3B 2Z9IA 1JBUH 2O8MA 1U6QA 1KSNA 2Z7FE 1F0RA 3GDVA 2BD7A 1F5RA 1WCZA 1DE7H 2GCHG 1XXFA 2ZHQH 4K60A 2GMTB 3RXRA 2FZZA 2P3FH 2FX6A 1QRWA 1DXPA 1HYLA 2VH6A 2HVYB 3SJ8A 3WWBA 5BPEA 2VNTA 5A8YA 2PSYA 1G30B 2F91A 1BMMH 2W5EA 4K3JA 3R0FA 2SGEE 4MPUA 4X8TH 3S7KB 2VJ1A 1MKXK 1L4ZA 3OSYA 4Y7AA 1CT0E 1D6WA 2GCHF 2VIDA 1QCPA 1W0ZU 1AFQC 1TGBA 2R3UA 2VIVA 2DE9A 2XCFA 1ZR0A 1NY22 2FLBH 1TYNA 3M7QA 1MBMA 4I8LA 2GVFA 4UD9H 1P2OA 1TX6A 2HGTH 1IHTH 4NIYA 5EGMA 2QN5T 5FCKA 5LPFA 4K69A 4UDWH 1WBGB 4Y71A 1O5FH 1GI2A 4FUBA 4U2WA 1UCYE 4IN1A 3RXFA 4FUGA 2HVXA 2ZA5A 1Q3XA 2AH4X 1K1JA 1INCA 1QGFA 4A1VA 4BTIB 2QF3A 5AVDA 1GVLA 2QCYA 2GKVE 5FL7D 1YPKH 1PQ7A 3A7VA 2OC8A 1S6FA 4F55A 2W26A 1K1OA 1GBJA 4ISOA 2ZZUH 3O8RA 1KLJH 1A46H 1V2RT 1LQDB 1AZZA 1C5ZB 1QURH 1P11E 4OS5A 5TJXA 3ZVEA 3C1KA 2BTCE 1WAYB 3VFEA 4OGXA 2J38A 3LH3A 1T8OA 1L1JA 4Y0YE 2J92A 4H6TA 1YWUA 1F92A 2P59A 1ZZZA 1Z6EA 3AVZA 4MPXA 2CJIA 1PQAA 3GY6A 1J8AA 1BTHH 1TOCB 4DVAU 1UJ1A 3M3SA 5EPYA 1A0HB 1J9CH 3MU1A 3VXEH 3K9XB 1BTWA 1WTGH 2BM2A 2FOMB 3B23B 1Y3XA 3N99A 2D2DA 4THNH 1VKYA 3KCGH 5HM2A 3STIA 2NU2E 4WVPE 5C1XA 1MKWK 5K0HA 3KHVA 5IDKA 3E0PB 3RXPA 1W0KD 3VB4A 1H8ED 1ZJDA 1DT2A 3MYWA 1YLNA 4R8TB 1C2GA 2OBOA 4X6NA 1HB0B 3E90B 3SZEA 2ESTE 2AIPA 1XUKA 1GI8B 3GICB 1BB0B 3PWBA 3SUEA 3SHAH 2P94A 1H1BA 3QGJA 3MU4A 1AGJA 1NTPA 4R0IA 3S7HB 3E8LA 4OS1A 4Y10E 1ORFA 2VIOA 3UREA 1ANBA 3ZV9A 3U1IB 1SGFA 3LT3A 2ZPSA 3RXKA 2PHBA 2OK5A 1COWD 3SNEA 2W3IA 2GZ9A 4GAWA 3ESTA 1FPHH 4HG6A 5A0BA 3I78A 1C1OA 1IAUA 1XVMA 4NIXA 2CMYA 1C4Y2 5TCCA 4AFZA 4A1TA 4INLA 2ZGXH 4GHQA 1F7ZA 3L6PA 1XKBC 3PMBB 3JZ2B 1SC8U 2BD9A 5KECA 1F0UA 3S9AA 3EGKH 1GJ7B 5T6GA 3UWIA 2GZ8A 1AB9B 1S6LA 2GMTC 1DSUA 3SNBA 2VWMA 1QB1A 1CSOE 1OYTH 1V2NT 2JDID 4IGDA 5AF9H 1L4DA 2PSXA 3RC5A 3BTEE 3KYFA 4NWLA 4AYYB 2STAE 2IJOB 1P2JA 4ABDA 1MQ5A 1EQ9A 5GXPA 1OS8A 1WXRA 1GHZA 1TMBH 1C5PA 2J9NA 1W0JD 1OX1A 3KNXA 3BSQA 4X1RU 3UOPA 3U9AH 4ABBA 1O2YA 1AN1E 4B2CA 1TMUH 3ATWA 1ZPCA 3NCLA 4X2WA 2BDIA 2VVUA 5E0JA 4J1YA 1CA0C 1SKYE 4Q4LA 4ZAEA 3I29A 2ZDLA 2QXIA 1GBAA 3NZIA 1UTJA 1ELCA 1GI6A 2H9TH 2B7DH 5J4QA 3FO8D 1AY6H 4YO9A 1NS3A 1TRYA 3P70B 2ALVA 2WYGA 4ZH8A 1FN8A 1GBDA 4JK6A 4FUJA 1O3HA 1PPBH 3AAVA 2SGDE 2W7UA 3RXAA 1C1PA 3VB5A 2SGFE 4XSKU 3EQ0H 1YPHE 1OP8A 5EJLA 1O2JA 2JJ1D 1ELVA 4FUHA 3F9HA 3F2HA 2WHXA 2J2UA 4X8VH 3MO3A 3VB6A 4Q80A 2GP9B 2ZF0H 4Y8ZA 1SGNE 2ZPRA 4Y8YA 3TVJB 1H4WA 2O8UA 4DIIH 4MVNA 3A83A 3LDXH 3LGUA 2ZDVH 3SUGA 4NA8A 1C5MD 2AMDA 1TPSA 3A7ZA 4XBBA 5LH8A 3BV9B 5B6OA 2F9NA 1RIWB 2AERH 5A8ZA 3A7XA 2W6JD 3P92A 3TH2H 3MO6A 1QJ7B 3SU3A 4UFFH 2C4FH 5IYTA 3V13A 1DLEA 1LVYA 2BLQA 2SFAA 1ZGVA 3SNDA 3P6ZB 2G81E 1Z8GA 1S81A 3TNTA 2GDDA 3LONA 1MTNB 2BHGA 2BQWB 3A85A 2THFB 2ASUB 1A0JA 3KF2A 2TBSA 4ZMAH 1SLWB 3DUXH 3OEED 4X6OA 5JBCS 3ODDA 1QBNA 1UVSH 3MQKC 3VB7A 2ZHFH 1DDJA 2XNDD 2C8YB 3Q3YA 1BMAA 3MNCA 5GNDA 3PV2A 2G51A 2ZU1A 3SU4A 4AGJA 1C5VA 3GCOA 5EQSA 4FOUC 2AGGX 1BJVA 2TGTA 4DGJA 2ZI2H 4DY7B 5C17A 8GCHG 1ESAA 3GY4A 1BBRK 4KTSA 5HYOA 1BITA 1A61H 1V3XA 3LGTA 3M3TA 1F5LA 1FLEE 3P8OA 4H42U 2NU1E 2OBQA 4YXWD 3E1XB 3PV5A 2PUXB 2A2QH 4UFDH 1CGIE 2ZG0H 5F8TA 1QA7A 1GBLA 3BTWE 1AHTH 2VIQA 2Z3CA 1HAOH 1TBRH 2XBVA 2J97A 2XBXA 8GCHF 1GJAB 1YPLH 2IJD1 1C5NH 2PUQH 3E16B 4ZXYH 3SNAA 5EW1H 3T5FH 1O2HA 4OS2A 2ZNKH 1BRAA 1RTKA 2VVCA 1O3BA 3DSGA 5DP8A 2I6SA 1ARBA 3F68H 1ZMJA 3PYHA 3UY9A 1H9HE 3B9FH 5J4SA 4B75A 1Z6JH 3NPSA 1W12U 1ABJH 3ZYEA 3AAUA 2Z6BD 1C5LH 2R2WU 1UO6A 1KIGH 5GCHF 1P03A 1QQ4A 4RKJB 4D8NA 2VINA 3UTUH 3UQVA 2FOCA 4A6LA 3FANA 3KL6A 1HRTH 1SQTA 5C5NA 1EXFA 3W95A 1Y59T 1GMDG 2A4RA 3BG4C 4WWYA 5CE1A 2HLCA 2XYAA 4KP0A 3M36A 5C1UA 2FIRH 4A5TS 1DPOA 1RTFB 1QB9A 3KGPA 2YMSB 2STBE 3P95A 4U32A 1CT4E 1WUNH 4FUFA 5BRRE 3GCHB 2PTCE 3RXOA 3K6ZA 1OOKB 3F3BA 4CRAA 4I7YH 1C2LA 2VVVA 3CS7A 2V3MA 1GMDF 2F9BH 1GCDA 3HKJB 1LVBA 4IN2A 3NRLA 3RXDA 4AFSA 1DUEA 4CHAB 2J5UA 2PGBB 3F9FA 1Z8JB 4DIHH 1SGQE 2BY5X 1ETTH 1UW7A 1GBTA 1ZOMA 1J14A 4LK4A 2GV6A 2VBCA 3FZDA 1BRUP 1VCWA 1BCUH 1C5TA 1HJAC 2ZU2A 1HAZB 3S69A 4DCDA 2A32A 2BD3A 1O3KA 3OTPA 1YYY1 4KGAA 1KDQA 2H5CA 1G9IE 2KX4A 1BMLA 1UCYH 1ZRKA 3DSPA 3AK5A 2ANWA 1EOLA 2FOGA 2P8OB 1YY3A 2QXGA 3T2NA 1CBWC 3UB0A 4NA9H 5DP5A 4E06H 1Y8TA 3A8CA 1D3TB 1IQEA 5AHGH 3NK8A 3F9GA 2XCNA 3SJIA 3QO6A 1H8DH 2AEIH 4F4OC 3TK5A 1SI5H 1ZJKA 1E79D 1EZSC 1AFEH 1EZQA 1K22H 1K2I1 1EPTB 1O34A 3H7OA 1GHAG 2EI6A 1HJ9A 4UE7H 1PYTD 4PROA 2AS9A 1C2FA 1F2SE 2SNWA 2WUBA 3RMLH 3VG8A 1MTNC 5HXFA 2HLDD 2UWLA 2Z3DA 3EA8A 1O3GA 2ZU4A 1TRNA 1KXBA 4IC5A 1GJ5H 1PPZA 5HGGA 1NM6A 1LQEA 1HJ8A 1V2UT 2ZDAH 3PROA 2AGIX 4FUEA 1EASA 1W0YH 4Q2KA 2GDEH 2A0QB 4VGCC 1MH0A 4WH6A 2ZECA 2D8WA 2QXJA 3FP7E 1GHAF 1YKTA 5CHAB 1D3PB 5JPMH 4P00A 1DWCH 2J4IA 5KEDA 1MZAA 1K21H 1DX5M 1C5YB 1GHBG 1OKXA 1T32A 1SGTA 5CMXH 1W13U 2YOLA 4ABIA 1PFXC 3VB3A 2GCTB 1GG6C 2UUKB 1O2OA 1VR1H 4CH2B 1T7CA 2Y5FA 2HNTE 1TNIA 3PTNA 2Z9KA 5AFYH 1Z8RA 2HNTF 4AGKA 1UVUH 1GHBF 3BTME 1FXYA 2OXSA 4IMQA 5G4BA 1TX8A 3UUZA 2O8WA 3O8CA 3ZV8A 1NU9A 3D23A 3RUOA 1T4VH 4Q7YA 5LGOA 1CVWH 3MU8A 2XTTB 1VITH 3TNSA 2PKAB 4UONA 4X8SH 1IQKA 2GX4A 1SMFE 1N6XA 4I31A 1GI3A 2ANYA 2F83A 4DJZB 3A82A 2ZC9H 1C1RA 2FMJA 2GD4B 1K1IA 1SGDE 4Q7ZA 2BXUH 2ZCLP 1ETSH 1V2OT 2J98A 3ZVCA 1NFWA 3ATKA 5JBAS 3G01A 4AB9A 1C1VH 3SN8A 4CREA 4BAMB 1V6DA 3OU0A 3KYGA 1FIZA 4HI3A 3ZZAA 2LP6A 3ZVFA 1IQJA 2QGRA 3M61U 4NIWA 4YT7H 5JYIA 1GGDC 2BY9X 1SGYE 2V35A 1OP2A 2P93A 6CHAB 1GBBA 1EJMA 2FDAA 2BDBA 2P3UB 3V3MA 1KY9A 2BLWA 2WPHS 1S83A 1DITH 1NRQH 1SLUB 1O3DA 1YLDA 1G3EA 1LHEH 4WF8A 2C93B 5JB8S 4B73A 1NESE 4ISIH 4NZQA 1C2KA 3A80A 3BN9A 3Q00A 3U1JB 1BTYA 2PKAA 2K0QA 3UAIC 1K28D 1O2KA 1AVXA 2DUCA 2L6OA 5DJ7A 1P2KA 2C90B 3STJA 2WPKS 1MTUA 3Q3XA 1WTHD 2VB0A 2ZHWH 3BG8A 3MH6A 1O5AB 1NBMD 1TNJA 2ZGCA 2VIWA 2HRVA 1XUGA 1IQMA 3PRBA 1O2UA 3F0PA 1J16A 1F0SA 1ZSJA 1E1QD 3PRDA 3D49H 1ANCA 4AOQA 1B0FA 1FUJA 4YOIA 4AG1A 1RJXB 1HGTH 5FX6A 3W94A 4MNVA 6LPRA 1SVPA 3OY5U 1XVOA 1MMJN 1CQQA 3MH4A 6GCHG 4X6PA 1NRRH 2K8IA 1O2VA 3U98H 2JJ2D 1YCPM 2R9PA 5EIYA 1H9IE 2GGVB 1MABB 1N8OC 3EE7A 5C2ZA 3K2UA 1QTFA 2BVSH 1NFXA 1KXDA 3ZZ5A 3GOVB 2BB4A 2BVXH 2JH5D 1AIXH 4ZUHA 4TY7A 3RXQA 5F6MA 4OS4A 3SV8A 1KMHB 2RFKC 1O5GH 1N1LA 1G36A 2ZPQA 2QA9E 5DP6A 2QF5A 2ZKSA 3VGCB 1KXCA 1TPAE 4ASHA 1PYTC 2G4TA 3D65E 4K8BA 1OWJA 3CNRA 3FKSD 3RXSA 3QWCH 4A7IB 4ZKOU 1W7GH 1A3EH 3RXMA 1TQ7B 1P2MA 1O31A 3BTHE 3IITA 3EYDA 1NU7B 5A8XA 2RDEA 2A31A 5GDSH 1OWEA 2IN2A 1PPEE 5EU8A 1OWIA 1T8MA 1TWXB 3PLBA 2H9EH 4BTTB 5T6FA 3A7TA 2GCTC 1E38B 2XC0A 2XBYA 3M5OA 5F8ZA 1XX9A 3SV9A 1LDTT 1QL8A 3MTYA 1L2EA 1HNEE 2FLRH 1ZGIA 1K1LA 5EW2H 1P04A 4MDSA 3QLPH 4ACBA 3S9BA 2C8XB 1UTQA 1XUHA 4NG9H 2ZFTA 3FP6E 1X7AC 3U28C 2AHME 1EZUC 1EB2A 2A5IA 1GBKA 4MG3A 3Q77A 4NIVA 2R0KA 1J15A 1QBVH 4CRFA 4ZHLU 2KCAA 2KCYA 2G5NA 3M3VA 4JYVH 3RXLA 3FP8E 1VITG 3TITA 2FI3E 3PV4A 1FIWA 1GI0A 5EPNA 1FDPA 1RFNA 1GCTB 1C9TA 1THRH 4FETA 4B2BA 1T31A 2G4UA 2KR7A 1C1WH 3H5CB 3BTQE 2GTBA 2HPQH 2NWNA 5JB9S 4RT1A 5FBEA 3ZZCA 2TPIZ 4IMZA 2XW9A 3PO1B 4MNYA 3MNSA 3LKWA 1MD8A 1VITF 4GSOA 3SGBE 1O3EA 2QV1A 1ZHPA 4I86A 1SGPE 2CHAB 2PR3A 3A81A 3LPRA 4J2YB 5T3HA 1IOEA 1TPOA 2Z9LA 2QAAA 1GJCB 2UWPA 3ELAH 3GISB 1C5UA 3OEHD 4M9FA 5C5OA 1V2TT 4XE4A 3QZQA 5DGJA 2LNCA 1NROH 4LZ4B 2A7CA 2TGPZ 3BTGE 1GDNA 1E35B 1O33A 5L30H 3GY2A 1YCPH 2B5TB 5DP9A 4BAOB 3BF6H 2FS9A 4FVBA 5A0AE 1BTZA 1P3CA 1BTPA 1NPMA 4HZHA 7GCHG 3A7YA 1QIXB 1S0QA 4Z6AH 3ZZ3A 3MNXA 1GBFA 3LGWA 3F2GA 1AE8H 4QT8C 1CO7E 3QUMP 1C2DA 1O2PA 5HIYA 1O2WA 1UTNA 3OTJE 2ZU5A 2ZGBH 4K5ZA 4NGAH 1NT1A 1C4V2 3QK1A 1HV7A 3L3TA 2BVRH 5HIZA 4D7FA 4CBOA 2ZQ2A 4BAQB 7GCHF 1KXEA 1TGTA 4YOGA 1SLXB 3RC6A 2PW8H 7ESTE 3HPTB 4AN7A 2ZWLH 3EE0B 2BDCA 1V2PT 1RXPA 2XC4A 3EAJA 2ZFPH 1RTLA 4WXIA 1O32A 3A89A 3A8DA 1YBWA 3PLKA 3RC4A 1VGCB 2JKHA 2H6MA 2V6NA 4YT6H 5H4IB 1NC6A 1C5QA 4Y6DA 1MKXH 2W6ID 4I8GA 3LGYA 3EDXB 1FX0B 1ETRH 1MD7A 2IOTA 1CHGA 4ACAA 2BXTH 1JXPA 1A3BH 1O0DH 1O2IA 2VIPA 3V7TA 3I77A 1Y5AT 2H9HA 5FPYA 4BOHA 4YLQH 4TPYA 3LOXA 1SPJA 1W8BH 4H4FA 3O8BA 1FY1A 4WMFA 2ZTXA 4FU8A 4ABJA 1PJPA 2XOKD 1QHRB 3T29A 1VJAU 4A1XA 1O3FA 3PB1E 2H2ZA 1WOFA 4TWWA 4Z0KA 1C2MA 2Z94A 3ZZ8A 4B1TA 2ZGHA 1TB6H 1AZ8A 3KQCA 1C1UH 1C5WB 2D1JA 1O5DH 2AYWA 2BY8X 1TBQH 1SHYA 1P09A 3RXVA 2SGPE 3BIUH 2SNVA 1O3OA 2BD5A 2KZ4A 1QA0A 3Q3KA 1PPGE 3MU0A 4E05H 3RXJA 1BDAA 2A1DB 3LGIA 4FUCA 3SBKA 3MI4A 1OXGA 4O03A 2R3YA 2XWAA 1W2KH 2C3SA 4I33A 1O3JA 2BDGA 3HGNA 1E36B 1JIRA 1H8IH 1DOJA 1HAHH 4NWKA 8KME2 2OC7A 4D76A 2RCEA 2FTMA 4ZCNA 1NRSH 1WSSH 2ILNA 3M5NA 1K1PA 4P02A 3LC5A 2KCOA 1SQRA 3KEEA 4FU7A 2TGDA 3M7UA 3ITIA 1N6YA 1TRMA 1CGHA 5EQQA 4GLYA 2FXRA 1YPJH 1K0HA 3P17H 1F0TA 1YF4A 2TRMA 1Y5BT 3CENA 1JWTA 1YPMH 2YMSD 1MKWH 4JZIA 4NSYA 1MCTA 5GIBA 5A2MH 1Y3YA 5DO4H 4ZXXH 1G32B 1MQ6A 1OHHD 2OINA 4M7GA 4AX9H 1MTVA 4ABGA 1AB9C 1GI7B 2HWLB 1UVPA 1E0FD 2WPJS 2NU4E 3KN2A 2WV5A 4ABHA 3GS9A 2FS8A 4H6SB 6ESTA 5L2YH 2LELA 2J94A 1IQIA 1A7SA 1SFIA 3A8AA 1LKAA 3HATH 1B5GH 2CF9H 1O3IA 3SU6A 1LVOA 1Q31A 2Y80A 4X2YA 1UVTH 3HK6B 4MPWA 3O8DA 4NSVA 2ZCHP 1QJ1B 3WW7A 2J34A 2OD3B 2VGCB 3BTKE 3SGAE 3URCA 1WDIA 2BD2A 3SV2H 1FZZA 3LJJA 1P02A 3N7EA 5FX5A 3K65B 3TGJE 2ZU3A 1ELEE 1VCQA 4ISNA 3TJNA 1UTMA 5KGOA 5CHBA 1FPCH 1DXWA 4KTCA 5C94A 3LJOA 1BTXA 2Z9GA 1HXFH 1DICA 2KAIB 1G3CA 1J17T 1FNIA 2R0LA 3SO3A 1WQSA 3E0NB 3N7OA 4JZFH 2P95A 1AKSB 5AFZH 3SQHE 3SV7A 3RMNH 1PPFE 2G00A 4OGYA 5EOKA 1YM0A 1V2WT 4K2YA 2W7SA 3SI3H 3TU7H 1QL9A 1P57B 2OLGA 1V2ST 1UVOA 1C2HA 3SJOA 2FOHA 1O3PB 2Z9JA 5GWZA 1ZLRA 4FUDA 3F6UH 4YTAA 1T8NA 1VGCC 1BRBE 1HPGA 4I8KA 1E34B 1CHOG 3AASA 2JH0D 2ANMH 5GJ4B 2GJGA 1RIWC 4XRNA 1AFQB 1KLIH 1Q2WA 1EP6A 3QZRA 3H7TA 4AYVB 5SGAE 1V2LT 4B74A 4YZUA 2QF0A 8LPRA 5EXMA 1D4PB 1EJAA 1TIOA 1CHOF 1QQUA 4JCNA 3PWCA 1MU6B 3OAAD 4Q7XA 4B6EA 2OTVA 3GY3A 4IC6A 2AFQB 2BMGB 4TT3D 2CGAA 2FI5E 1NFUA 1VJ9U 4X2VA 4LXBH 2BX4A 1SQOA 5EJZA 2FOBA 1NRPH 2WYJA 1AWFH 3SU0A 1AKSA 3ZYDA 3QN7A 2R2MB 2CK3D 4AORA 4X1SU 4Y8XA 1MUEB 4WMEA 3MHWU 1FONA 3ATLA 1B0EA 9ESTA 1P12E 1GVKB 2BQ6B 1GBCA 4TPIZ 2AIQA 3DSOA 1BQYA 5JDUB 1O3LA 5L6NH 1WU1A 3UWJH 1CGJE 4ISHH 1T8LA 2I6QA 5PTPA 1GWAA 2RA0A 2CN0H 1DM4B 4IW4E 4BAHB 1QR3E 1HAPH 1RGQA 3GDUA 3W1EA 1CU1A 2EQNA 4I8JA 2BOHB 3DFJA 3TLOA 1EPTA 1VZQH 2FO9A 1HFDA 1LHFH 1W3CA 2NU0E 1YPHC 3NKKA 1GHXH 2SGQE 3SU5A 1ANEA 2PLXA 2WV4A 2ZDKA 1JRSA 1O5EH 2PFEA 1GMHG 4HFPB 3A88A 3FVFB 1TGSZ 2V0BA 4JZ1A 3V0XA 1UK4A 3GCTG 2ALPA 1ACBE 3PM3A 1KTSB 2FOFA 1C2IA 1GHYH 1S0RA 3A84A 5C3NA 3RXHA 3A8BA 1FAXA 1ZRBA 2ZGJA 4XBCA 3P8NA 1OPHB 1QZ8A 1TNGA 2VH0A 1LHCH 2FOAA 1XUFA 1LMWB 1ELBA 1KTTB 4BTUB 1GMHF 1BMFD 1WV7H 2OCVB 2FESH 1S85A 2QYIA 1C1SA 4BNRA 2YMSC 1C2JA 2EI8A 1FV9A 1YCPK 1WYKA 3BTDE 3GCTF 3GCHC 4TWYA 1YC0A 1AWHB 2WUCA 4CRCA 1RRKA 3N7DA 1P9SA 2BLVA 2EA3A 4JZDH 1LKBA 3AW1A 3MH7A 1ZPZA 1XXDA 1YPGH 4CHAC 1SHHB 4OS6A 4B71A 2BOKA 1LHGH 2F9PA 3UFAA 2VWNA 2ODPA 2BQ7B 3TIUA 2WPLS 2QXHA 4B76A 2G5VA 4DOQA 3K6YA 3NUMA 3FOAA 4O3UA 4F49A 4K8YA 1E1RD 4YOJA 1IQNA 2FPZA 3C27B 4CH8B 1HAGE 3AW0A 3KQEA 2ZDNA 4O3TA 1MBQA 1FMGA 3T62A 3TJUA 1EOJA 1P2NA 1C5OH 1ARCA 5DG6A 4BAKB 2VWLA 3MU5A 4GHTA 4K1SA 4WMDA 1QL7A 1DY8A 2P8OC 1LCYA 2IPHA 1ZTLA 3ZVAA 1ZMNA 1MAYA 4INKA 3RXTA 3ZVBA 1O2QA 3OFND 1TGNA 2JETB 2B0FA 2EI7A 2RG3A 5A09A 3UR9A 2XNIA 3E6PH 1TPPA 1KLTA 4F48B 4ZHAA 4ABFA 4MLFB 4KKDA 1DS2E 1CA0B 1HAIH 1EPTC 4GVUA 4ZHMU 3FFGA 3E91A 2CF8H 2Y7ZA 1QNJA 3RMOH 1AMHA 1C2EA 1MCVA 1ZHMA 1O5CB 1P2QA 2AMQA 2NU3E 1TX7A 1G3BA 3FAOA 1GI1A 3R3GB 3RP2A 3EA9A 2O8LA 4UFGH 3VXFH 3U69H 1EATA 1GBHA 2G52A 5L2ZH 1UK3A 2ZIQH 1K1MA 4SGBE 2BD8A 3RU4E 2FI4E 2A5KA 3WWFA 1LHDH 2A4OA 3S9CA 4BANB 1SGRE 3VEQB 4SGAE 1BUIA 3H09A 1FI8A 5CHAC 4LZ1H 6GCHF 3MH5A 1A4WH 2F4LA 1QRZA 2GT7A 2F9OA 1IQGA 1YPEH 2OP9A 1A5GH 2Q1JA 3ZZ7A 4RT0A 2OQ5A 1L1NA 1G3DA 1QB6A 1V2KT 3F0OA 1P06A 5C0UA 1KXFA 1V2VT 1TFXA 5E2OA 3NWUA 3TJOA 1C5XB 4JMYA 3A87A 4FU9A 2Z3EA 4FVDA 1GBIA 1K1NA 3GYLB 2YNBA 1Y3WA 1XKAC 1EAUA 3RXGA 1F5KU 3PTBA 3UOUA 2P3TB 1S84A 2B9LA 3RXUA 2KCPA 3RXCA 1JMOH 3RXIA 3VPKA 1SLVB 3SGQE 5C0TA 3DA9B 3KQDA 1TONA 5EODA 3HKIB 1TE0A 1GDQA 2ZFSA 2B8OH 2Q6DA 1BMNH 1EUFA 2ZDMA 1HAXB 1P0SH 4OM9A 1T4UH 1OP0A 2F9VA 1AE5A 3T27A 3QTVH 1SSXA 4TYDA 1BHXF 5LPRA 4DT7B 5DSFA 1O36A 4B2AA 3HK3B 2M5TA 1GI4A 1UHBB 1FY8E 2BY6X 4X2XA 5FAHA 3RMMH 2Y7XA 1DFPA 2WV9A 1YLCA 4KELA 2OC1A 3RU4D 2WPIS 5ABWA 2CXVA 4ABEA 1GJ9B 1HAYB 1AD8H 1D3QB 2V7QD 4CRDA 5E0GA 2GT8A 2VWOA 1GL0E 3A7WA 4X1QU 1MU8B 5JBTA 2A2XH 2QC2A 2WINI 3S0NA 1O2ZA 1NZQH 3MMGA 3GY7A 1HXEH 3HGPA 3UNQA 5ESBA 1SGEE 6CHAC 1BBRE 2UUYA 4NCYA 4X0WU 5DN6D 5DP7A 2UUFB 1A5HA 2OQUA 3SW2B 2BDYA 1G2MA 3DT0H 2F9UA 2Y5HA 1D6RA 2EC9H 4CBNA 1MTSA 5C1YA 3U8OH 3WY8A 1B7XB 2IPQX 4FUIA 5JBBS 1ZTKA 5T6DA 1XUIA 1Y5UT 2Q6GA 4ZROA 1LPKB 3M35A 1QRXA 1TGCA 2H5DA 4WH8A 3M5LA 1GJBB 2XC5A 1BJUA 3TK6A 4O97A 1LPGB 3F9EA 4I32A 2AGEX 1H8HD 1UCYK 4K1EA 4D7GA 2PP6A 3DHKH 1UHBA 3MWIU 5C20A 3ATMA 4Z1MD 3BG4B 1TA6A 2PWXA 1MTWA 3SUDA 1S5SA 1ZTJA 1DWEH 4UEHH 4MPVA 2ZP0H 3PMHB 4ABAA 3OE7D 1GPZA 1SBWA 1Y3VA 1O2GH 3OY6U 2DE8A 2HNTC 2PV9B 4ISLA 5E0HA 1HAVB 4WJG2 4INHA 5ETXA 4AC9A 1HIAB 2JETC 3TPIZ 4CRBA 3SYJA 1TA2A 2A4GA 1ANDA 1TNLA 3RM0H 1Z71A 1FY4A 5FXLA 1A5IA
chains in the Genus database with same CATH topology
1UK2A 3RM2H 1BHXB 1NN6A 2FOEA 1HDTH 2XWBI 1AU8A 2V3HH 3P8GA 4U01A 4NA7A 3PMAB 1P3EA 1C9PA 2BY7X 4UFEH 5DP3A 4CR9A 1W10U 1AQ7A 1AI8H 1GVZA 1SOTA 5I25A 1W14U 1C5SA 2H1UA 4E7RG 4X1PU 2G55A 1ZPBA 5E2PA 4K1TA 2FX4A 1HJAB 1V2JT 3TJVA 2Q6FA 1E37B 3ZZ6A 3ODFA 4AFUA 1YGCH 4NZLA 2HALA 5E8EH 3BTFE 1BRCE 4AZ2B 2ODQA 1TABE 2ZEBA 5EG4A 3LGVA 3VGCC 3UNSA 1FQ3A 1IHSH 1LTOA 3T28A 1BTUA 3PLPA 1SG8B 1XUJA 3A86A 1CBWB 1SR5C 4AFQA 4IS5A 1C4U2 4Y7BA 1FY5A 1Z8IB 3LC3A 3BTTE 1SQAA 5DPAA 4OS7A 1HAVA 3SZNA 2Y82A 1BZXE 1HIAA 5EXNA 1GJ6A 2GV7A 1V2MT 2BLOA 2PGQB 3BEUA 1JIMA 1TAWA 4RN6A 1LPZB 4GCHG 3QDZB 1O2MA 2UUJB 4KTUA 1O2SA 1SOZA 3DFLA 4JK5A 4YLUA 2ZO3H 3SU2A 1FAKH 1OWHA 1EP5A 2VU8E 1EAXA 1PPHE 3B8JA 3CP7A 3PMJA 4MQAA 1GDUA 1W11U 2A45B 3GDSA 5DP4A 1O5BB 2ZHEH 4XFQA 4VGCB 1TLDA 2FTLE 1PPCE 4WY3A 2UWOA 7KMEH 3TGIE 1THPB 1QBOA 1DWBH 1CT2E 1ZSLA 1P10A 2QY0B 4GCHF 4IBLH 4YESB 1ZHRA 2ZHDA 4O9VA 2QIQA 1ID5H 1SB1H 3M5MA 1M9UA 1UMAH 1H9LB 3UR6A 4Y79A 1TMTH 4Y0ZE 2PKSB 3LU9B 1GCTC 4X1NU 3M7TA 5A0CA 1JRTA 1O35A 1KXAA 3SNCA 2D26C 2FWWA 1OSSA 2BX3A 3TH4H 1RS0A 2LPRA 2SGAA 3ENSB 1L0ZA 1SL3A 3PO1C 1GJDB 4CR5A 1GJ8B 1GG6B 1GI9B 2A7HA 2P16A 5GCHG 1O2RA 1EKBB 1TQ0B 4ZKSU 1GI5A 2RDLA 2PTNA 1THSH 1O38A 1OWDA 2AMPA 2ZQ1A 1O37A 4JYUH 2CHAC 1UTLM 1C1MA 1NO9H 3V12A 1VCPA 1HCGA 2G8TA 3UIRA 3IWMA 3M37A 1SFQB 4D9RA 2FEQH 1A2CH 3MO9A 3MNBA 1O2TA 5EXLA 1BA8B 2ULLA 1AVGH 1P01A 3SUFA 3MFJA 1S6HA 3U8TH 1C1QA 1EJNA 1KDQB 3LH1A 3T26A 1MZDA 2Y6TA 1ZSKA 5FPTA 3RDZA 3GCNA 4YM9A 2OUAA 3RXEA 4DURA 1S82A 1AUJA 5DK1A 1IQFA 3QTOH 3MOCA 4TY6A 2A4QA 3T25A 4Y11E 3ZZ9A 1SGIB 1FN6A 3ZVGA 1DVAH 4AG2A 3SJKA 1P2IA 1TNHA 3UNRA 2FODA 1IQLA 3JZ1B 1GGDB 1GMCG 9LPRA 2ZTZA 3TK9A 4U30A 1W7XH 4MNWA 5EQRA 5I46H 5F03A 2YNAA 1O2XA 1DLKB 1ESTA 2Y81A 3IG6B 3UQOA 1XM1A 3BEIB 4FXGH 4X6MA 2HOBA 3EA7A 1HUTH 1A0LA 2EEKA 5TCAA 2TIOA 1SGCA 1QFKH 2O9QA 2ODYB 1Z7KA 1KYNA 2ZFFH 2XRCA 1GMCF 3U8RH 4ZKRU 3TGKE 1Z1IA 1ELTA 2TGAA 2J95A 1FY3A 3RLWH 4DW2U 4BXSA 4XOJA 1CE5A 5F8XA 4HGCA 1UTKA 1O3NA 3Q76A 3DD2H 3GY5A 4RKOB 4A92A 1O39A 2WPMS 1GBMA 4XBDA 2A5AA 3SHCH 1ELDE 1O30A 1ZMLA 1TNKA 2ZCKP 2BZAA 5ESTE 1BOQA 1AUTC 1DWDH 2JH6D 4NFFA 3ZZBA 2KAIA 1GBEA 1LVMA 4LOYH 1C1NA 1BT7A 1UTOA 2RA3A 1DUAA 2V3OH 2OC0A 4GUXA 4D9QA 4X8UH 3SI4H 2CV3A 1GL1A 1GHWH 1NRNH 1JOUB 1G2LA 3NXPA 4I8HA 1G37A 3SORA 1K9OE 1TOMH 4Y76A 4AB8A 1PQ8A 1C1TA 2FYRA 1DY9A 1L1GA 4MTBA 3ZZ4A 3KIDU 2O8TA 1N8OB 3P8FA 1D9IA 4HTCH 1EAIA 1NFYA 1O2NA 2HPPH 3RLYH 2BDAA 1O2LA 1P8VC 1AVWA 1LO6A 3GY8A 1ELGA 4ESTE 3D62A 4XDEA 5LPEA 1EX3A 5DKMA 3KQBA 4MNXA 3UPEA 1MAXA 1GJ4H 2XBWA 1GHVH 3OYPA 2Y5GA 3L33A 2BYAX 2PKSC 1P9UA 2F3CE 1O3MA 1QJ6B 3BEFB 1FJSA 1OYQA 1EB1H 2BZ6H 2A7JA 1A1RA 3FZZA 1DSTA 1PQ5A 1Y3UA 3SQEE 1XMNB 2FYQA 2ZTYA 4WXVA 2C8ZB 3QGNB 1QY6A 1C5RA 1UTPA 1TALA 1EZXC 2ZFRH 2W3KA 3ATIA 1CA8B 4CRGA 4BXWA 8ESTE 1DANH 1BBRH 1ABIH 4JYTA 2K1QA 3LIWA 2ZFQH 1HBTH 3ZVDA 7LPRA 3ZZDA 1Z1JA 3RXBA 3SOSA 1EAWA 5FHTA 1AO5A 1V2QT 4NFEA 4ZKNU 5GPIB 3GYMA 3F1SB 1P05A 3QX5H 3TH3H 1ESBA 3SU1A 5HMAA 4DG4A 2VGCC 1O3CA 1SGFG 1TBZH 5FBIA 2GZ7A 4E7NA 4RSPA 1ELAA 3URDA 3OX7U 1IQHA 1D3DB 5FCRA 5K7RA 1ELFA 2FM2A 1HLTH 3BIVH 2C8WB 3CS0A 5FPSA 1O3AA 2BDHA 1OWKA 2ANKH 2XXLA 1WQVH 3E3TA 3RU4T 1BIOA 1ZYOA 2FP7B 4GPGA 4JZEH 5C67A 3SV6A 5HM9A 1YP9A 3SJ9A 2BD4A 1RD3B 2Z9IA 1JBUH 2O8MA 1U6QA 1KSNA 2Z7FE 1F0RA 3GDVA 2BD7A 1F5RA 1WCZA 1DE7H 2GCHG 1XXFA 2ZHQH 4K60A 2GMTB 3RXRA 2FZZA 2P3FH 2FX6A 1QRWA 1DXPA 1HYLA 2VH6A 3SJ8A 5BPEA 2VNTA 5A8YA 2PSYA 1G30B 2F91A 1BMMH 2W5EA 4K3JA 3R0FA 2SGEE 4MPUA 4X8TH 3S7KB 2VJ1A 1MKXK 1L4ZA 3OSYA 4Y7AA 1CT0E 1D6WA 2GCHF 2VIDA 1QCPA 1W0ZU 1AFQC 1TGBA 2R3UA 2VIVA 2DE9A 2XCFA 1ZR0A 1NY22 2FLBH 1TYNA 3M7QA 1MBMA 4I8LA 2GVFA 4UD9H 1P2OA 1TX6A 2HGTH 1IHTH 4NIYA 5EGMA 2QN5T 5FCKA 5LPFA 4K69A 4UDWH 1WBGB 4Y71A 1O5FH 1GI2A 4FUBA 4U2WA 1UCYE 4IN1A 3RXFA 4FUGA 2HVXA 2ZA5A 1Q3XA 2AH4X 1K1JA 1INCA 1QGFA 4A1VA 4BTIB 2QF3A 5AVDA 1GVLA 2QCYA 2GKVE 1YPKH 1PQ7A 3A7VA 2OC8A 1S6FA 2W26A 1K1OA 1GBJA 4ISOA 2ZZUH 3O8RA 1KLJH 1A46H 1V2RT 1LQDB 1AZZA 1C5ZB 1QURH 1P11E 4OS5A 5TJXA 3ZVEA 3C1KA 2BTCE 1WAYB 3VFEA 4OGXA 2J38A 3LH3A 1T8OA 1L1JA 4Y0YE 2J92A 4H6TA 1F92A 2P59A 1ZZZA 1Z6EA 3AVZA 4MPXA 2CJIA 1PQAA 3GY6A 1J8AA 1BTHH 1TOCB 4DVAU 1UJ1A 3M3SA 5EPYA 1A0HB 1J9CH 3MU1A 3VXEH 3K9XB 1BTWA 1WTGH 2BM2A 2FOMB 3B23B 1Y3XA 4THNH 2D2DA 5HM2A 3KCGH 3STIA 2NU2E 4WVPE 5C1XA 1MKWK 5K0HA 3KHVA 5IDKA 3E0PB 3RXPA 3VB4A 1ZJDA 1DT2A 3MYWA 4R8TB 1C2GA 2OBOA 4X6NA 1HB0B 3E90B 2ESTE 2AIPA 1XUKA 1GI8B 3GICB 1BB0B 3PWBA 3SUEA 3SHAH 2P94A 1H1BA 3QGJA 3MU4A 1AGJA 1NTPA 4R0IA 3S7HB 3E8LA 4OS1A 4Y10E 1ORFA 2VIOA 3UREA 1ANBA 3ZV9A 3U1IB 1SGFA 3LT3A 2ZPSA 3RXKA 2PHBA 3SNEA 2W3IA 2GZ9A 4GAWA 3ESTA 1FPHH 5A0BA 3I78A 1C1OA 1IAUA 1XVMA 4NIXA 2CMYA 1C4Y2 5TCCA 4AFZA 4A1TA 4INLA 2ZGXH 4GHQA 1F7ZA 3L6PA 1XKBC 3PMBB 3JZ2B 1SC8U 2BD9A 1F0UA 3S9AA 3EGKH 1GJ7B 5T6GA 3UWIA 2GZ8A 1AB9B 2GMTC 1DSUA 3SNBA 2VWMA 1QB1A 1CSOE 1OYTH 1V2NT 4IGDA 5AF9H 1L4DA 2PSXA 3RC5A 3BTEE 4NWLA 4AYYB 2STAE 2IJOB 1P2JA 4ABDA 1MQ5A 1EQ9A 5GXPA 1OS8A 1GHZA 1TMBH 1C5PA 2J9NA 1OX1A 3KNXA 3BSQA 4X1RU 3UOPA 3U9AH 4ABBA 1O2YA 1AN1E 4B2CA 1TMUH 3ATWA 1ZPCA 3NCLA 4X2WA 2BDIA 2VVUA 5E0JA 4J1YA 1CA0C 4ZAEA 3I29A 2ZDLA 2QXIA 1GBAA 3NZIA 1UTJA 1ELCA 1GI6A 2H9TH 2B7DH 5J4QA 1AY6H 4YO9A 1NS3A 1TRYA 3P70B 2ALVA 2WYGA 4ZH8A 1FN8A 1GBDA 4JK6A 4FUJA 1O3HA 1PPBH 3AAVA 2SGDE 2W7UA 3RXAA 1C1PA 3VB5A 2SGFE 4XSKU 3EQ0H 1YPHE 1OP8A 1O2JA 1ELVA 4FUHA 3F9HA 2J2UA 4X8VH 3MO3A 3VB6A 4Q80A 2GP9B 2ZF0H 4Y8ZA 1SGNE 2ZPRA 4Y8YA 3TVJB 1H4WA 2O8UA 4DIIH 4MVNA 3A83A 3LDXH 3LGUA 2ZDVH 3SUGA 4NA8A 1C5MD 2AMDA 1TPSA 3A7ZA 4XBBA 5LH8A 3BV9B 5B6OA 2F9NA 1RIWB 2AERH 5A8ZA 3A7XA 3P92A 3TH2H 3MO6A 1QJ7B 3SU3A 4UFFH 2C4FH 5IYTA 3V13A 1DLEA 1LVYA 2BLQA 2SFAA 1ZGVA 3SNDA 3P6ZB 2G81E 1Z8GA 1S81A 3TNTA 2GDDA 3LONA 1MTNB 2BHGA 2BQWB 3A85A 2THFB 2ASUB 1A0JA 3KF2A 2TBSA 4ZMAH 1SLWB 3DUXH 4X6OA 5JBCS 3ODDA 1QBNA 1UVSH 3VB7A 2ZHFH 1DDJA 2C8YB 3Q3YA 1BMAA 3MNCA 2G51A 2ZU1A 3SU4A 4AGJA 1C5VA 3GCOA 5EQSA 2AGGX 1BJVA 2TGTA 4DGJA 2ZI2H 4DY7B 8GCHG 1ESAA 3GY4A 1BBRK 4KTSA 5HYOA 1BITA 1A61H 1V3XA 3LGTA 3M3TA 1F5LA 1FLEE 3P8OA 4H42U 2NU1E 2OBQA 3E1XB 2PUXB 2A2QH 4UFDH 1CGIE 2ZG0H 5F8TA 1QA7A 1GBLA 3BTWE 1AHTH 2VIQA 2Z3CA 1HAOH 1TBRH 2XBVA 2XBXA 8GCHF 1GJAB 1YPLH 1C5NH 2PUQH 3E16B 4ZXYH 3SNAA 5EW1H 3T5FH 1O2HA 4OS2A 2ZNKH 1BRAA 1RTKA 2VVCA 1O3BA 5DP8A 2I6SA 1ARBA 3F68H 1ZMJA 3PYHA 3UY9A 1H9HE 3B9FH 5J4SA 4B75A 1Z6JH 3NPSA 1W12U 1ABJH 3ZYEA 3AAUA 2Z6BD 1C5LH 2R2WU 1UO6A 1KIGH 5GCHF 1P03A 1QQ4A 4RKJB 4D8NA 2VINA 3UTUH 3UQVA 2FOCA 4A6LA 3FANA 3KL6A 1HRTH 1SQTA 5C5NA 1EXFA 3W95A 1Y59T 1GMDG 2A4RA 3BG4C 4WWYA 5CE1A 2HLCA 2XYAA 4KP0A 3M36A 5C1UA 2FIRH 4A5TS 1DPOA 1RTFB 1QB9A 3KGPA 2STBE 3P95A 4U32A 1CT4E 1WUNH 4FUFA 5BRRE 3GCHB 2PTCE 3RXOA 3K6ZA 1OOKB 4CRAA 4I7YH 1C2LA 2VVVA 3CS7A 1GMDF 2F9BH 1GCDA 3HKJB 1LVBA 4IN2A 3RXDA 4AFSA 1DUEA 4CHAB 2PGBB 3F9FA 1Z8JB 4DIHH 1SGQE 2BY5X 1ETTH 1GBTA 1ZOMA 1J14A 4LK4A 2GV6A 3FZDA 1BRUP 1VCWA 1BCUH 1C5TA 1HJAC 2ZU2A 1HAZB 3S69A 4DCDA 2A32A 2BD3A 1O3KA 1YYY1 4KGAA 1KDQA 2H5CA 1G9IE 1BMLA 1UCYH 1ZRKA 2ANWA 1EOLA 2FOGA 2P8OB 2QXGA 3T2NA 1CBWC 4NA9H 5DP5A 4E06H 1Y8TA 3A8CA 1D3TB 1IQEA 5AHGH 3NK8A 3F9GA 2XCNA 3SJIA 3QO6A 1H8DH 2AEIH 4F4OC 3TK5A 1SI5H 1ZJKA 1EZSC 1AFEH 1EZQA 1K22H 1K2I1 1EPTB 1O34A 3H7OA 1GHAG 2EI6A 1HJ9A 4UE7H 1PYTD 4PROA 2AS9A 1C2FA 1F2SE 2SNWA 2WUBA 3RMLH 1MTNC 5HXFA 2UWLA 2Z3DA 3EA8A 1O3GA 2ZU4A 1TRNA 1KXBA 4IC5A 1GJ5H 1PPZA 5HGGA 1NM6A 1LQEA 1HJ8A 1V2UT 2ZDAH 3PROA 2AGIX 4FUEA 1EASA 1W0YH 4Q2KA 2GDEH 2A0QB 4VGCC 1MH0A 4WH6A 2ZECA 2D8WA 2QXJA 3FP7E 1GHAF 1YKTA 5CHAB 1D3PB 5JPMH 1DWCH 2J4IA 1MZAA 1K21H 1DX5M 1C5YB 1GHBG 1OKXA 1T32A 1SGTA 5CMXH 1W13U 2YOLA 4ABIA 1PFXC 3VB3A 2GCTB 1GG6C 2UUKB 1O2OA 1VR1H 4CH2B 1T7CA 2Y5FA 2HNTE 1TNIA 3PTNA 2Z9KA 5AFYH 1Z8RA 2HNTF 4AGKA 1UVUH 1GHBF 3BTME 1FXYA 2OXSA 4IMQA 5G4BA 1TX8A