4FVBA

Crystal structure of ev71 2a proteinase c110a mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SGAIYVGNFRVVNRHLATHNDWANLVWEDSSRDLLVSSTTAQGCDTIARCNCQTGVYYCNSRRKHYPVSFSKPSLIYVEASEYYPARYQSHLMLAQGHSEPGDAGGILRCQHGVVGIVSTGGNGLVGFADVRDLLWLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 2A proteinase
publication title Conformational Plasticity of 2A Proteinase from Enterovirus 71
pubmed doi rcsb
source organism Human enterovirus 71
total genus 34
structure length 138
sequence length 138
ec nomenclature ec 3.4.22.29: Picornain 2A.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvbA01
1GHZA 4JMYA 2O8TA 4X2WA 3SNBA 5K7RA 2RA0A 3TIUA 1L4ZA 1MU8B 5HMAA 1KXAA 3PLPA 1PQ8A 2FOMB 2FPZA 1C2LA 1DICA 1O33A 3BTKE 1FY4A 2AERH 3SV7A 4CBOA 5EPNA 2BD7A 1PPGE 1H9IE 1EAWA 1MAXA 4ABJA 1AFQC 2HGTH 1O3PB 3HATH 1C2MA 2ANYA 1RTFB 2H9EH 1YPLH 1NO9H 4XBBA 4K1SA 4NIVA 4KTCA 1A3BH 1A0JA 4H6SB 3SV8A 1UK3A 3BTWE 1Z8IB 4UEHH 2HPQH 1MD8A 1GI9B 4UE7H 3UUZA 3DUXH 1P9UA 3R0FA 1YCPH 1FIZA 1MTWA 2FI3E 3MFJA 3UTUH 5L30H 4AB8A 1QJ6B 1VITG 2ALPA 3OU0A 1V2NT 1CT0E 3LJJA 2CF9H 1HIAB 3M5NA 4HFPB 4MPWA 2GCHG 1DDJA 2J94A 4XE4A 1OWIA 1WTGH 2Q6FA 2Y81A 1EPTB 1CQQA 1O2NA 3V3MA 2BY7X 3RXKA 1MTNC 5IYTA 4KKDA 2EI8A 1P03A 1WUNH 1AN1E 5EXNA 2ZFPH 3TK6A 4CRGA 7LPRA 1O5FH 1GG6C 2BDCA 2FOEA 2ZTYA 3E3TA 2VIQA 3KGPA 1BBRK 1GBHA 1A0HB 1ESBA 4ZH8A 3HK6B 1SFIA 1GGDC 1V2MT 3B8JA 4WXVA 1CGIE 2QXIA 2VVVA 1K9OE 1XVMA 1GL0E 1NRPH 3A83A 2A1DB 5FAHA 5F03A 1CBWC 3ATLA 3SGAE 2JH5D 1MTUA 3PMBB 3LGYA 1QBNA 1UTNA 2ZCKP 3TGJE 4BAQB 5TCCA 1EB2A 4BXSA 3U98H 4J1YA 3SJ8A 1SFQB 2GDEH 1T32A 1PPCE 4FUGA 2B5TB 3ESTA 2HALA 4HZHA 2FI4E 2ZDLA 2QV1A 3SGQE 2VIOA 2A2XH 1XMNB 2XWAA 3D23A 1ZR0A 2FO9A 2XRCA 1SGRE 3A8AA 1LHGH 2UUKB 3RM0H 3H7OA 2HNTF 2STBE 1FN8A 4A1VA 7ESTE 3SJOA 1C5PA 1QRZA 4I8HA 4ISLA 1GJ6A 4R0IA 4A7IB 2WPHS 4DW2U 1GBAA 1A2CH 1LHFH 2A0QB 1V2JT 2ZDNA 1YPHE 1C1OA 1V2PT 2PWXA 5FPSA 2PKSC 1FNIA 1G36A 1O3MA 3NK8A 1EOJA 2RA3A 2WINI 3K6ZA 3HGNA 1GDUA 1Y5AT 1TPAE 3FZZA 1O2MA 2V0BA 5C20A 2ANKH 1E35B 2VINA 5JBTA 2A32A 1DXWA 1TGSZ 4MNVA 3UQVA 1JXPA 1BRUP 1QBOA 1YLDA 3RU4D 2F9PA 1DY8A 1DT2A 4VGCB 1GI7B 2F83A 1C1PA 3MTYA 1O2JA 5DP6A 1L1GA 2W5EA 3Q77A 4Y11E 1TNGA 2VIPA 3DD2H 1ACBE 2FIRH 1SGDE 5T6DA 1GHYH 1TNHA 2Z94A 4LXBH 5AF9H 1HAVB 3MNCA 1QGFA 2RCEA 2SGPE 4OGYA 3RC4A 2ANWA 1O5GH 1HFDA 4NZLA 2A31A 2BHGA 4ABEA 5C2ZA 1AWFH 4JCNA 1EATA 1O38A 2NWNA 4RKOB 4ABDA 2J2UA 5BPEA 4FU9A 2ODQA 4SGAE 1C5QA 4K5ZA 1O3OA 3PMHB 3T27A 1FN6A 3MNBA 4FVDA 5JBBS 1ZHPA 4BNRA 3SJIA 2FLBH 3QN7A 1D3PB 2D26C 1E34B 1C5TA 3T29A 4FUFA 4YOJA 5JYIA 2FOCA 5EW1H 1TNJA 2OCVB 1GJAB 2XBVA 4JZEH 1DSTA 2GMTC 1NESE 2NU0E 1AVXA 3MU5A 1NROH 5ETXA 2P95A 1TYNA 2WPLS 3ENSB 3UOPA 1TPPA 1SGCA 1ZPZA 3MMGA 2F9OA 2DUCA 1SQAA 4Y8XA 1D6WA 1BRCE 4K69A 4KP0A 3EDXB 2ZFQH 4A5TS 3BN9A 3P70B 1PPBH 1ELCA 4YESB 3CENA 2FZZA 1ABIH 4B2CA 1VGCB 3DT0H 1Z1JA 2SGEE 1KXEA 3TLOA 1AUTC 1JMOH 1MQ5A 1C1QA 1OPHB 1O3NA 1AZZA 2B7DH 1XKAC 1VCPA 1CE5A 4I33A 1E36B 2FS9A 1N6XA 1AHTH 5F8XA 4A92A 2ZECA 2BY8X 2UUJB 1SB1H 1O2TA 4GHQA 3U1IB 4CH2B 1HIAA 4J2YB 1CGJE 3N7OA 3O8BA 5DP7A 1VITF 1XUKA 1TA6A 1Z71A 5LPFA 1EPTA 1WSSH 3UWJH 3M3TA 2AIPA 1C5WB 3HK3B 1Z7KA 2GCHF 4U30A 1THSH 4DIIH 3HKJB 4Q7ZA 1XX9A 4WVPE 1SGIB 3PO1C 3MO6A 1XUFA 2QIQA 3FANA 1SOZA 2PV9B 1FXYA 2A4OA 1L1JA 1QA0A 4FXGH 2P3FH 1ETSH 2BDAA 2A7CA 1MD7A 3LPRA 1O3CA 1V2WT 1QQ4A 1NFXA 3Q3KA 3RC5A 1K28D 1XXDA 3RXUA 2ZWLH 3CS7A 3SU4A 1AO5A 4BAMB 5DG6A 1PJPA 1SSXA 3SNAA 1K2I1 1QFKH 2GDDA 3RMLH 2Q6DA 1WAYB 1ETRH 3SUFA 1GI6A 4RKJB 2XW9A 2BX4A 5EU8A 1L1NA 3VGCB 3BV9B 1AGJA 2GV7A 3RXMA 4BANB 5IDKA 1G32B 2JETC 5C1YA 5DJ7A 3QK1A 5I46H 4NIXA 1HAZB 1NRNH 1LKBA 3HKIB 1SGQE 1CHGA 4X8UH 5EXLA 5LPEA 3TU7H 4OS7A 1RXPA 5A8YA 2FTMA 3T62A 1ORFA 1Y3YA 4ESTE 1O5AB 1BMNH 1XUHA 1NZQH 2HRVA 2G52A 1EP5A 1RIWB 1CVWH 1TPOA 2DE9A 1AMHA 2JKHA 2XNIA 6CHAC 3SV9A 3UNSA 5CHAB 4D7GA 1S6FA 4D7FA 1T8LA 4B74A 1ZSLA 2VH6A 3F6UH 2XC4A 3PLBA 2F9VA 2ZU1A 2ZIQH 1QRWA 3AASA 4Y76A 4NIYA 1GHBG 4X6MA 1V2LT 2FDAA 3TITA 1MZAA 1K1JA 1T4UH 1TE0A 1V2RT 3STIA 1GBMA 3QDZB 1TLDA 5A09A 2SGAA 2VWMA 2JH6D 3ZZ4A 4Y8ZA 2VVUA 1F2SE 1IHSH 1JRSA 2QN5T 2GX4A 5GWZA 1TRYA 2PTCE 1AE5A 3SJ9A 2PGQB 2GTBA 3LGUA 4ZHLU 5C5OA 4DT7B 8GCHG 2ZPQA 5SGAE 2TGTA 2ZQ2A 1OYTH 1PPHE 1G3EA 1P11E 2BXUH 2XTTB 4ZKOU 1MMJN 2PUQH 3TVJB 3G01A 2SNWA 5EQSA 3S0NA 1QJ1B 1GI3A 3SNEA 1OP0A 1P57B 1B7XB 2QYIA 4LZ4B 1GHAG 2ZHWH 4Q2KA 3ZVDA 1F92A 3UREA 1HAVA 1FUJA 1SPJA 1V2KT 2GVFA 1GJ7B 1GI1A 2W7SA 2ODYB 1DOJA 4F4OC 2ZP0H 5JDUB 3I29A 2PSXA 2IJOB 1FPHH 1GVZA 1SGEE 3M7TA 1TWXB 1DY9A 1O3DA 2BOHB 1W7GH 4TWWA 1HXFH 1OWHA 4WXIA 4UFEH 2VB0A 1NFYA 3K65B 4FVBA 4X8SH 1ZJDA 2AIQA 4NFFA 1PQ5A 2BB4A 2P3UB 3STJA 4MTBA 2QF3A 3PTBA 2G00A 1WQSA 3RU4E 1O3HA 1BBRH 5E0HA 4CR9A 2XC0A 3OX7U 1EX3A 5C3NA 4CH8B 3AW0A 1GMDG 3BG4C 4IC6A 1TGBA 2Y82A 1JBUH 1C4V2 2Z9GA 3BTME 1A1RA 3A85A 1O2XA 4NG9H 1LQEA 1LPGB 1W8BH 4Y10E 1RFNA 2UUYA 1EP6A 1Z1IA 1OWEA 3BTFE 4U2WA 3W94A 1GBTA 1O2RA 4AGKA 4X2XA 1HAHH 2BLWA 1J8AA 4D9RA 2ZFTA 2Z7FE 4NSVA 5ESBA 2G5NA 2C8ZB 3AVZA 2J95A 1Q2WA 2UWOA 4D8NA 4YT7H 1H9HE 1YCPM 4A1XA 1IQIA 2HNTC 2G4UA 1BIOA 1NRQH 2BD4A 2Y5HA 2BLQA 3NZIA 1E0FD 1H8IH 1OYQA 4JZFH 1DPOA 4MNXA 4ZXYH 2OP9A 2UWPA 3ZVCA 2PHBA 3E0PB 1C5SA 1C5OH 3EA7A 4NSYA 2BZAA 2ZDAH 3GY7A 5DP5A 3ITIA 1LPZB 3MHWU 1ARCA 5HM2A 1O2UA 1C5YB 4AN7A 1IQFA 2WYJA 1BDAA 1T8OA 8ESTE 3LC3A 1IQKA 1GJDB 1C2KA 2PR3A 1JIMA 1KTTB 1YPGH 2C8XB 3LT3A 4Y71A 1CA0B 1BITA 3PLKA 2W7UA 4FUEA 5EG4A 1THRH 1EPTC 4I8JA 2Q6GA 1GCTC 2OC1A 2Z9JA 3ZV8A 1TBQH 1NU7B 5G4BA 3GCHB 1P02A 1HAIH 5DGJA 4A1TA 1UCYK 5FXLA 1RTLA 4BAKB 1TX8A 3RXOA 5T3HA 1LHDH 2A45B 2A2QH 4CRCA 1O2VA 1HJ9A 3U69H 3RXBA 1EJNA 5EW2H 1GBFA 3M5LA 1CU1A 1DFPA 1TB6H 1GI2A 1KDQB 1O5CB 2AFQB 4JZDH 1SQOA 4MNYA 2QAAA 3TJVA 1O2ZA 3A7ZA 4BTUB 3SU3A 4AG2A 3RXSA 3UPEA 2CJIA 1ZZZA 4YLQH 1NFUA 1QCPA 3GOVB 4INHA 4XFQA 3EA8A 1C5ZB 1KLJH 1FLEE 4MG3A 3FVFB 5HGGA 3VXEH 1C5MD 1ZGVA 4I8GA 2GV6A 2G55A 3QZRA 4I7YH 1AY6H 3RDZA 1FY3A 2PSYA 2P59A 1FQ3A 3UOUA 1HBTH 1G9IE 2ZGCA 1C9PA 2BVRH 1YKTA 2OD3B 4LZ1H 4IW4E 4GAWA 3UWIA 1GHBF 4X1NU 5EGMA 1NPMA 4H4FA 3T25A 3CS0A 5DK1A 1P2NA 1O3AA 5ABWA 2Z3DA 3M7QA 3BTGE 4OS4A 5HXFA 2W3KA 3SORA 2EA3A 4GCHG 1AVWA 7GCHG 4AFQA 1OSSA 2STAE 1ELVA 1ESAA 1OWDA 4DOQA 4MPUA 1E38B 8GCHF 1HAPH 1FI8A 3AW1A 4CBNA 1SHHB 1TPSA 2F9UA 2WV5A 2VGCB 8KME2 1EXFA 5L2ZH 1ANBA 3PROA 1UVSH 1ZHRA 1ANEA 4AFZA 2OQ5A 1W0ZU 3SU2A 5DO4H 1QTFA 1O2HA 4INKA 1F5LA 5F8TA 1GHAF 3P92A 2A7JA 2AYWA 1K21H 3SV6A 3SUGA 3ZVEA 1PPZA 1UTMA 4OS5A 4U01A 3ZZ8A 3MH5A 4VGCC 3UR9A 4CR5A 1QL7A 4FUCA 3V7TA 3RXJA 3A84A 1XVOA 3H7TA 2OXSA 1MUEB 2EI6A 1GWAA 2BQ6B 4ISHH 1YF4A 2VWLA 3QWCH 1O2IA 1TRNA 2B9LA 1K1PA 2PKAB 3LKWA 4O3TA 4UDWH 4B71A 1D3DB 1O35A 4Q7XA 5L2YH 1XUGA 3AAUA 4B73A 3ZVFA 1YPEH 1GMDF 3E8LA 1VCWA 5FX5A 2Y5GA 1XUIA 1GDQA 3M7UA 5LGOA 2VIDA 3HGPA 2SGFE 2H6MA 3Q3XA 3M3SA 3PB1E 2R0LA 1BTYA 1TMUH 1NC6A 1BMMH 3Q76A 4JK6A 3F9HA 3PWBA 3MI4A 1L4DA 1FY5A 2XYAA 3M37A 1SOTA 1Y8TA 4DVAU 1H9LB 1WQVH 4IN2A 3CP7A 4NA8A 3B9FH 4WMEA 2Y6TA 3E90B 3OY6U 4K60A 4ZROA 3UFAA 1C5UA 1O3JA 1J17T 2C8YB 5LPRA 2BLOA 4IMQA 3UNQA 1PYTD 1C1WH 3EE0B 3GCOA 1SBWA 3A7WA 3M5MA 4X1PU 3E0NB 1GJ5H 3LH1A 3A88A 2BZ6H 2Z3EA 1ZTKA 3TNSA 4X6NA 3RXGA 4B75A 1UHBB 2V6NA 1HJAC 2QXGA 2RDLA 1A5IA 1VJAU 3TH2H 3LGWA 2FMJA 1KIGH 4XOJA 4ZKSU 1C2GA 1BTZA 4I32A 4MDSA 1DM4B 4I8LA 2FODA 1ZTJA 1Y3WA 1P04A 1AQ7A 2D8WA 2NU2E 1AKSB 2ZI2H 2P8OB 1QB1A 2ZTZA 2EI7A 3LGTA 4UFFH 1ZOMA 2QCYA 1SMFE 1M9UA 2ZO3H 2GT8A 2ZKSA 3SGBE 3RLYH 3UIRA 1G2MA 1ELAA 2BY6X 4WY3A 2CN0H 1V2VT 1UJ1A 4Y0ZE 1P06A 4IC5A 5DPAA 2GD4B 1AE8H 1GBBA 2XXLA 1H1BA 1IQLA 1GHWH 1BTUA 2ZFFH 2O8UA 2QGRA 1O2YA 1AB9C 2TGAA 3MH4A 2FTLE 1LVOA 1NT1A 1KDQA 1JRTA 1AUJA 1SLXB 3SU6A 1W12U 1TIOA 4X6PA 4LK4A 2XBWA 1CSOE 1Z8GA 5EQQA 4THNH 1LQDB 1MKXK 2VNTA 2FOGA 3A80A 3SQEE 3VGCC 1S5SA 1T4VH 3PV4A 3FP8E 1YPJH 1GVLA 3KHVA 5DP9A 2FLRH 1Z6JH 3C1KA 3U8RH 1P2MA 1FONA 1BHXB 4YZUA 3OSYA 4CHAB 1IQNA 5K0HA 1P3EA 1EZUC 1CT4E 1PFXC 3UQOA 1XUJA 1S81A 1C1RA 1MZDA 3RXTA 1F7ZA 1FV9A 1RIWC 2FS8A 3I78A 1H8DH 1UVOA 2OBOA 2PUXB 1GBEA 1HRTH 1P2QA 1G37A 4ZKRU 2G81E 2A5IA 1VJ9U 1GBJA 1V2UT 3D62A 5J4QA 1C2EA 2A4QA 4LOYH 1QHRB 4AYYB 1AVGH 2AMPA 1RS0A 2CV3A 3BEFB 3PYHA 3BTTE 2J92A 2ZCHP 3RM2H 3TH4H 1KLTA 4GHTA 2H1UA 1QB6A 3LONA 4GCHF 1UK2A 3PTNA 4FU8A 2VWNA 7GCHF 1BMAA 2XCFA 3RXLA 2BD9A 1QURH 4XDEA 3VB6A 1T31A 4ZUHA 3QGJA 3TGKE 1DWCH 4JYVH 2ZF0H 4X2VA 2Z3CA 1N1LA 3MNSA 4MPXA 1OX1A 1RGQA 1MBMA 1Y3VA 4Y79A 4WMDA 6LPRA 1IAUA 2ODPA 5ESTE 1DS2E 1C5LH 3QTOH 1DSUA 4WMFA 3RXPA 5F8ZA 4AFSA 1HB0B 1DLEA 4TWYA 3OTJE 3A81A 1KTSB 3GY5A 3URCA 2G4TA 2AS9A 5E8EH 2VJ1A 1GBCA 1GMCG 2Y7ZA 3KQEA 4M7GA 1GPZA 6ESTA 2HLCA 1ZGIA 3TJNA 3GDUA 2WYGA 4YO9A 3SQHE 4KTSA 3MNXA 1UCYH 1T8MA 1B0EA 2PGBB 2HNTE 4FUBA 5T6GA 1P9SA 1TBRH 1GI0A 1BHXF 1JWTA 1Y3XA 3KIDU 1O3IA 3P8FA 4K3JA 1G3DA 2B8OH 4IGDA 2BX3A 1HV7A 4B1TA 4R8TB 4GSOA 2DE8A 3A7YA 1G30B 1D9IA 1TAWA 2ZDMA 3QX5H 3HPTB 3BIVH 3GDSA 4ZXXH 1AI8H 4UFDH 1RD3B 1N8OC 3SW2B 1E37B 2FOAA 1TX7A 1UK4A 4O97A 3LDXH 4GUXA 1FY8E 2W26A 5DP8A 2THFB 1F0UA 1OP8A 1VR1H 3PM3A 3SI3H 3A7VA 1LVBA 3A82A 2V3HH 3SBKA 1D3QB 3KQCA 3ZVAA 4IN1A 1BTHH 1ZHMA 2XWBI 4BTIB 1CA8B 4ISIH 3RMMH 4X8VH 3PO1B 2QC2A 1O2KA 3ZZBA 3SUEA 1IQMA 4Y8YA 3QGNB 1YBWA 3EYDA 3SJKA 2BDYA 1VZQH 4I31A 5A0CA 1G2LA 3GDVA 5FCRA 3LGIA 5C67A 1GHXH 2C3SA 1MQ6A 1AKSA 2CHAB 1C4Y2 5LH8A 1O39A 3M36A 1IHTH 1OOKB 4Q80A 2VWOA 2ZHFH 3URDA 3UNRA 3TK9A 4X2YA 4K8YA 4A6LA 2ZFSA 2C8WB 2CGAA 4RN6A 4ZMAH 1P0SH 3K2UA 1KYNA 3GCTG 2ZGJA 4DJZB 3OYPA 4Q7YA 4K1EA 2A5AA 3U9AH 1GI5A 3VB7A 2CMYA 4ZHMU 1WTHD 1DWDH 4MQAA 4K2YA 3SU1A 4D76A 1B0FA 2BD8A 2ANMH 3GY2A 1MU6B 4NA7A 2TGDA 1P01A 3SN8A 4AG1A 4I8KA 3ELAH 2G8TA 5FX6A 3SNDA 1K1IA 4YLUA 5HM9A 1MKWK 3W95A 2BDHA 1W13U 3MWIU 1UTPA 1GI8B 4DCDA 3IITA 3TPIZ 3U8TH 5GIBA 1DWBH 5FBIA 3L3TA 1UCYE 2ZPRA 4GVUA 3NUMA 1EB1H 3NXPA 1KLIH 2O8LA 1RJXB 1HUTH 3ZZAA 1QQUA 2P16A 1LHEH 2R0KA 1ANCA 1FMGA 1FAXA 1EASA 4ISOA 4NZQA 5C1XA 1TGNA 2YNBA 4IBLH 1DUAA 3S9BA 4X0WU 1P09A 2XCNA 3LH3A 1Y59T 3RUOA 3NCLA 1TABE 1AZ8A 4E7RG 1TNKA 4ASHA 1OXGA 2FYRA 1MTVA 1BJVA 1MCTA 1BTPA 1SC8U 2FI5E 2P3TB 2C90B 3P17H 1L2EA 2FX4A 2ZG0H 2FOFA 1YYY1 1Y3UA 1UTQA 1ELGA 2GCTB 2ZNKH 5HYOA 2BMGB 3PMAB 2GZ9A 1SHYA 1EAUA 1BA8B 1HCGA 4SGBE 3ZV9A 4NFEA 5EQRA 2GKVE 1A3EH 5JBCS 2V35A 1SI5H 2BLVA 2ZQ1A 1O3LA 1T8NA 2ZPSA 4AX9H 1LPKB 3ATKA 1O2OA 1J14A 5AFYH 4FUJA 1HPGA 2AEIH 5F6MA 3BTHE 3TH3H 5A0BA 5DP3A 5FPTA 1XXFA 1O2WA 3QLPH 1IQEA 2OBQA 1QB9A 2ZGHA 3M5OA 3SU0A 1J9CH 3DFJA 2ALVA 1C1NA 5GXPA 2C4FH 3DFLA 2Z6BD 3FZDA 1ELTA 1YPKH 3LU9B 3OY5U 3RLWH 3V0XA 2BTCE 1FAKH 1AWHB 3RU4T 3T2NA 2H5CA 2R3YA 2C93B 1WCZA 1GBDA 2A7HA 1P05A 2BD2A 6GCHG 1FIWA 4X1QU 1F0SA 2VGCC 2LPRA 1C1VH 1O3GA 1TONA 1FDPA 1ZSJA 2F9NA 4NA9H 1GJ4H 2J38A 2WPMS 1MAYA 1DUEA 1P8VC 1A61H 1BJUA 2WUCA 1SGFG 2BDBA 1DLKB 2ZU4A 1HNEE 1GMHG 2A5KA 3ZVBA 1S82A 1P2IA 1BTWA 1TX6A 1PYTC 1GMCF 3WY8A 2Z9KA 3NWUA 1K1OA 4H42U 2O8MA 1ZYOA 1EZXC 2AGGX 1IQGA 1W7XH 1YLCA 2H2ZA 3U1JB 4OGXA 3NKKA 3M35A 3S7HB 1EJAA 2BDIA 4KGAA 1S0RA 2KAIB 1ZPCA 2NU1E 3EGKH 3R3GB 4AB9A 1MKXH 5FBEA 2XC5A 2F9BH 3GISB 2UWLA 1QL9A 1C5NH 3C27B 3RXEA 2Y7XA 2IPHA 2QY0B 9LPRA 1ELDE 1O0DH 1UO6A 4X8TH 1LVYA 3A89A 4MLFB 4Z0KA 3ZZCA 2SGDE 3P8OA 3AAVA 1D6RA 5A8XA 1WYKA 3ZZ7A 1D3TB 1ID5H 1UTJA 3BTQE 4AZ2B 3Q00A 1ELFA 3VPKA 2TGPZ 2BVXH 2R2MB 4JK5A 1DWEH 1U6QA 1TOCB 1A4WH 2Z9LA 4B2BA 2WUBA 2ZU3A 1HAYB 4WJG2 1JOUB 4TY6A 1QJ7B 4HTCH 1GCTB 4WWYA 1UVPA 4MNWA 4UFGH 1BB0B 1LCYA 1QA7A 4DGJA 3E91A 3F1SB 4MVNA 1YPMH 3PMJA 1G3CA 2GGVB 2Q1JA 2WPKS 1EOLA 1S85A 2HPPH 4E05H 1QIXB 1J16A 3RXCA 4BXWA 1P2OA 5JB9S 1DANH 2NU3E 1OKXA 2TBSA 4GLYA 3A7TA 3GCTF 1S84A 1SR5C 1EZSC 1V2QT 4DY7B 2P93A 2ZHQH 1HLTH 1ABJH 1INCA 2P8OC 3KL6A 1HGTH 1RTKA 1BOQA 2AMQA 3ZZDA 4KTUA 3E16B 1PQ7A 1SL3A 1NTPA 4RSPA 3D49H 1FPCH 2BVSH 3IWMA 5C1UA 4ZAEA 1S83A 3ZZ3A 1TALA 1QNJA 2A4RA 5L6NH 2TPIZ 1AFQB 1BRAA 4Y7AA 2OUAA 1K1MA 2XBXA 1TQ0B 1FJSA 5GJ4B 3Q3YA 3KCGH 2XBYA 2NU4E 3O8CA 4YM9A 1Y5UT 1C2IA 2ZC9H 2HOBA 3ATIA 2BQ7B 5A0AE 1O32A 1GJ8B 3L6PA 1O2PA 4E06H 3FAOA 4B2AA 2SNVA 1QR3E 2ZTXA 2A4GA 1EAIA 4X6OA 4Y0YE 4JYUH 3UR6A 1N6YA 1O2QA 3GICB 1O2SA 5J4SA 3RMOH 4JZ1A 1GL1A 4QT8C 1LKAA 4HGCA 4UD9H 3GY3A 4K8BA 3A8DA 1KXDA 3SO3A 4NCYA 1HDTH 2YNAA 2J9NA 1HAOH 1O3BA 5H4IB 1UMAH 3B23B 3KF2A 2ILNA 1TA2A 3SHAH 4NWKA 5E2PA 1SLUB 1LDTT 2ZA5A 3F9GA 4CHAC 4NGAH 1MTNB 3ZZ5A 4ABHA 4GPGA 2JH0D 1ELEE 3RP2A 1VGCC 3RXHA 5BRRE 1S6HA 1TNLA 1NN6A 2AGIX 1O3FA 1O34A 3SOSA 2VVCA 1GG6B 3O8DA 2LNCA 1W14U 1MBQA 2EC9H 1BQYA 4X1RU 3SZNA 4OS2A 1SLVB 1EAXA 2QXHA 2I6QA 2B0FA 1GGDB 3S9CA 1DITH 3JZ2B 3RXRA 1CGHA 3KQDA 3RXVA 1BMLA 4AFUA 1CBWB 1V3XA 1C5XB 3GYMA 8LPRA 3L33A 1P3CA 1THPB 3RXQA 1AIXH 3A86A 1Z8RA 5I25A 3K6YA 1A7SA 2H5DA 1RRKA 1TRMA 2PLXA 2ZU2A 1CHOG 1W3CA 2ZDVH 2OTVA 1AU8A 3EA9A 2SFAA 1W11U 1GBIA 1NRSH 2AGEX 1V2TT 3FP7E 5AFZH 1KSNA 1SGYE 1Z8JB 1ZJKA 1WV7H 4JZIA 6GCHF 1J15A 5DP4A 1C5VA 1K1NA 1L0ZA 3V12A 4X1SU 3BIUH 1ESTA 3ATMA 2FESH 4DG4A 1GVKB 3ZVGA 2D2DA 1P2KA 1UTLM 3BTEE 4ABGA 2BOKA 1GJ9B 4TYDA 2D1JA 1ZPBA 1GMHF 1WOFA 3V13A 2CXVA 1G3BA 1O30A 5C5NA 5EODA 1ZLRA 4DURA 1MKWH 5AHGH 2PKSB 1OS8A 1C1TA 2AMDA 1PPEE 3KEEA 2KAIA 1O3EA 3BEUA 2IN2A 4O03A 2YOLA 5GPIB 2CF8H 1WBGB 5GCHG 2G51A 1YCPK 3ODDA 3ZYDA 3RC6A 1MCVA 3EAJA 4FU7A 1EZQA 1V6DA 4OS1A 3KNXA 1HYLA 2OQUA 1IQJA 2HVXA 2V3OH 3F9EA 3RXFA 5CHAC 1X7AC 1O3KA 3GY6A 1HJAB 2FOHA 1MTSA 5FHTA 1SLWB 3MH7A 4ZKNU 1W10U 4JYTA 2VIWA 1A5GH 3JZ1B 1SG8B 3DA9B 3I77A 2BD3A 5GDSH 1WU1A 2RG3A 2FM2A 3GY8A 3VXFH 1HXEH 1KY9A 3K9XB 3SU5A 3QZQA 4AORA 5JB8S 2GP9B 3RXAA 1C1MA 2WPJS 4XBCA 4ABIA 1Q31A 3P8NA 4HI3A 2ZHEH 1YPHC 3FP6E 2J34A 2ZHDA 1KXBA 1NRRH 3SUDA 4UONA 4YOIA 2PW8H 5JPMH 2ASUB 2G5VA 3P95A 4WH8A 4CRDA 4TPYA 1BT7A 1K22H 3T28A 1A0LA 1YGCH 3E6PH 4BTTB 3IG6B 1GDNA 1AB9B 2Y80A 3EQ0H 4YT6H 3VFEA 1C2HA 3MO3A 2VIVA 2AH4X 5T6FA 1LMWB 1O31A 2CHAC 1O36A 3O8RA 2OC0A 3PWCA 1O5EH 3GYLB 3T5FH 2GMTB 5E0GA 4IMZA 1K1LA 2PKAA 4YOGA 3LOXA 1SGTA 3S7KB 1BTXA 3MO9A 2BDGA 1ZRKA 2O9QA 3QTVH 5FPYA 1P2JA 5E2OA 1EQ9A 3TK5A 1GHVH 2UUFB 3D65E 1OWJA 3SV2H 5CMXH 5FCKA 1W2KH 1F0TA 3ZZ9A 3LJOA 1SGFA 3U8OH 2ULLA 1P10A 4ISNA 5A2MH 2QXJA 2FP7B 4NWLA 1KXFA 4OS6A 5PTPA 5CE1A 1IOEA 1DVAH 1CO7E 2IOTA 1FY1A 1SQTA 5B6OA 3MU1A 2GT7A 1EJMA 2W3IA 2FWWA 1NM6A 3SNCA 2ZDKA 1UVUH 2GZ7A 3RXIA 4FUIA 1A5HA 2R2WU 3VB4A 4ABAA 1EKBB 1C2JA 4TPIZ 1V2OT 1FZZA 5AVDA 1DX5M 9ESTA 1P12E 3NPSA 1GJCB 2PFEA 1ANDA 1VITH 7KMEH 2VU8E 1UHBA 3QUMP 2ESTE 4WH6A 3MU0A 2P94A 3MH6A 1F0RA 1ELBA 1TMBH 2M5TA 1NS3A 1O5BB 3QO6A 2OC8A 1C5RA 1D4PB 1YP9A 3A8BA 3P6ZB 3F68H 4DIHH 3M61U 2GCTC 1TBZH 3MOCA 1UTOA 1QY6A 1V2ST 1W0YH 1C4U2 1UVTH 4B76A 1BRBE 1Z6EA 1ZMJA 4CRAA 1S0QA 2EEKA 1AFEH 3A8CA 2JETB 3RMNH 3MYWA 4K1TA 1NFWA 3TJOA 5A8ZA 2H9TH 3RXDA 2BY5X 3SHCH 3TJUA 2PTNA 1EUFA 4AYVB 3ZYEA 1XM1A 1TFXA 2I6SA 4CRFA 1UTKA 1C1SA 1YM0A 3GY4A 2OLGA 4Z6AH 1CT2E 1O2GH 1GCDA 1A46H 2BYAX 5TJXA 2VH0A 1AD8H 1KXCA 1CHOF 2OINA 2BXTH 4PROA 1VCQA 3T26A 3LC5A 4IS5A 1CA0C 6CHAB 1T7CA 4YTAA 5DKMA 1BZXE 2R9PA 2ZEBA 4F49A 4U32A 1TGCA 3M3VA 1H4WA 4H6TA 2ZCLP 1F5RA 3GCHC 4FUDA 1O37A 1B5GH 1ARBA 2GZ8A 2F91A 5TCAA 3MU8A 4Y7BA 1HJ8A 4NIWA 2TRMA 3BF6H 1GI4A 3ATWA 1N8OB 2ZU5A 1NU9A 1GBKA 3BEIB 4WF8A 2WPIS 4E7NA 5JBAS 2BQWB 4XBDA 4BOHA 3VB5A 1ZRBA 3MU4A 4BAOB 1HAGE 2BY9X 3TGIE 5GCHF 4ABBA 1XKBC 3H5CB 3KN2A 1DE7H 4O9VA 3A7XA 3LIWA 2ZGBH 3VEQB 1LTOA 3ODFA 1C9TA 2HWLB 1OWKA 3KQBA 3DHKH 1LHCH 4AGJA 1TGTA 1ZMNA 1ZTLA 4INLA 3F9FA 2Y5FA 1PQAA 1TNIA 1Y5BT 2ZGXH 1C1UH 2ZFRH 2R3UA 1Q3XA 4Y6DA 1IQHA 2J4IA 4ABFA 1F5KU 2FXRA 1SGNE 4D9QA 4MPVA 2Z9IA 3A87A 2BM2A 3LGVA 3TNTA 1LVMA 3S9AA 5EOKA 2FEQH 2H9HA 1SVPA 3BSQA 5EPYA 3BTDE 3S69A 2WV4A 1C2DA 1ZMLA 1PPFE 2FX6A 1LO6A 4KELA 4BAHB 4CREA 4TY7A 1OP2A 1O2LA 1GJBB 1BUIA 2FOBA 1JIRA 1ZSKA 3VB3A 1BCUH 3BG4B 3P8GA 2FYQA 2QF0A 1YC0A 2SGQE 1SGPE 4XSKU 1GBLA 3GCNA 4O3UA 2TIOA 3BG8A 5EXMA 1C2FA 3FFGA 1ETTH 1DXPA 2QA9E 2F3CE 4ZHAA 2ZZUH 1O5DH 2K1QA 1TQ7B 3UY9A 2BD5A 3ZZ6A 4FUHA 3E1XB 1QBVH 1NY22 4CRBA 1QL8A 1TOMH 2OC7A 1QRXA 1MH0A 2O8WA 1HAXB 3SI4H 4AOQA 1BBRE 1TMTH 5E0JA
chains in the Genus database with same CATH superfamily
1GHZA 4JMYA 2O8TA 1YWUA 4X2WA 3SNBA 5K7RA 3OAAD 2RA0A 3TIUA 1L4ZA 1MU8B 5HMAA 1KXAA 3PLPA 1PQ8A 2FOMB 2V7QD 2FPZA 1C2LA 1DICA 1O33A 3BTKE 1FY4A 2AERH 1W0JD 3SV7A 5EPNA 4CBOA 2BD7A 1PPGE 5KGOA 1H9IE 1EAWA 1MAXA 4ABJA 1AFQC 2HGTH 1O3PB 3HATH 4P00A 1C2MA 2V3MA 2ANYA 1RTFB 2H9EH 1YPLH 1NO9H 4XBBA 4K1SA 4NIVA 4KTCA 1A3BH 1A0JA 4H6SB 3SV8A 1UK3A 3BTWE 1Z8IB 4UEHH 2HPQH 1MD8A 1GI9B 4UE7H 3UUZA 3DUXH 1P9UA 3R0FA 1YCPH 1FIZA 1MTWA 2FI3E 3MFJA 3UTUH 5L30H 4AB8A 1QJ6B 1VITG 2ALPA 3OU0A 1V2NT 1CT0E 3LJJA 2CF9H 1HIAB 3M5NA 4HFPB 4MPWA 2GCHG 1DDJA 2J94A 4XE4A 1OWIA 1WTGH 2Q6FA 2Y81A 1EPTB 1CQQA 1O2NA 3V3MA 2BY7X 3RXKA 5EIYA 1MTNC 1KMHB 5IYTA 4KKDA 2EI8A 1P03A 1WUNH 1AN1E 5EXNA 2ZFPH 3TK6A 4CRGA 7LPRA 1O5FH 1GG6C 2BDCA 2FOEA 2ZTYA 3E3TA 2VIQA 3KGPA 1BBRK 1GBHA 1A0HB 1ESBA 4ZH8A 3HK6B 1SFIA 1GGDC 1V2MT 3B8JA 4WXVA 1CGIE 2QXIA 2VVVA 1K9OE 1XVMA 1GL0E 1NRPH 3A83A 2A1DB 5FAHA 5F03A 1CBWC 3ATLA 3SGAE 2JH5D 1MTUA 3PMBB 3LGYA 1QBNA 1UTNA 2ZCKP 3TGJE 4BAQB 5TCCA 1EB2A 4BXSA 3U98H 4J1YA 3SJ8A 1SFQB 2GDEH 1T32A 1PPCE 4FUGA 2B5TB 3ESTA 2HALA 4HZHA 2FI4E 2ZDLA 2QV1A 3SGQE 2VIOA 2A2XH 1XMNB 2XWAA 3D23A 1ZR0A 2FO9A 2XRCA 1SGRE 3A8AA 1LHGH 2UUKB 3RM0H 3H7OA 2HNTF 2KZ4A 3WWFA 2STBE 1FN8A 4A1VA 4Q63A 7ESTE 1WDIA 3SJOA 2WPDD 2JJ2D 1C5PA 1QRZA 4I8HA 4ISLA 1GJ6A 4R0IA 4A7IB 2WPHS 4DW2U 1GBAA 1A2CH 1LHFH 2A0QB 4AC9A 1V2JT 2ZDNA 1YPHE 1C1OA 1V2PT 2PWXA 5FPSA 2PKSC 1FNIA 1G36A 1O3MA 3NK8A 1EOJA 2RA3A 2WINI 3K6ZA 3HGNA 2J97A 1GDUA 1Y5AT 1TPAE 3FZZA 1O2MA 2V0BA 5C20A 2ANKH 1E35B 2VINA 5JBTA 2A32A 1DXWA 1TGSZ 4MNVA 2KX4A 3UQVA 1JXPA 1BRUP 1QBOA 1YLDA 3RU4D 2F9PA 1DY8A 1DT2A 4VGCB 1GI7B 2F83A 1C1PA 3MTYA 1O2JA 5DP6A 1L1GA 2W5EA 3Q77A 4Y11E 1TNGA 2VIPA 3DD2H 1ACBE 2FIRH 1SGDE 5T6DA 4I86A 1GHYH 1TNHA 2Z94A 4LXBH 5AF9H 1HAVB 3MNCA 1QGFA 2RCEA 2SGPE 4OGYA 3RC4A 2ANWA 5KECA 1O5GH 1HFDA 4NZLA 2A31A 2BHGA 4ABEA 5C2ZA 1AWFH 4JCNA 1EATA 1O38A 2NWNA 4RKOB 4ABDA 2J2UA 5BPEA 4FU9A 2ODQA 4SGAE 1C5QA 4K5ZA 2F43B 1O3OA 3PMHB 4TSFD 3T27A 1FN6A 3MNBA 4FVDA 5JBBS 4B6EA 1ZHPA 4BNRA 3SJIA 2FLBH 3QN7A 2JDID 1D3PB 2D26C 1E34B 1C5TA 3T29A 4FUFA 4YOJA 5JYIA 2FOCA 5EW1H 1TNJA 2OCVB 1GJAB 2XBVA 4JZEH 1DSTA 5IK2D 2GMTC 1NESE 2NU0E 1AVXA 3MU5A 1NROH 5ETXA 2P95A 1TYNA 2WPLS 3ENSB 3UOPA 1TPPA 1SGCA 1ZPZA 3MMGA 3DSOA 2F9OA 2DUCA 1SQAA 4Y8XA 1D6WA 3F2FA 1BRCE 4K69A 4KP0A 3EDXB 2ZFQH 4A5TS 3BN9A 3P70B 2YMSC 1PPBH 1ELCA 4YESB 3CENA 2FZZA 1ABIH 4B2CA 1VGCB 3DT0H 1Z1JA 2SGEE 1KXEA 3TLOA 1AUTC 1JMOH 3F2GA 1MQ5A 1C1QA 1OPHB 1O3NA 1AZZA 2B7DH 1XKAC 1VCPA 1CE5A 4I33A 1E36B 2FS9A 1N6XA 1AHTH 5F8XA 4A92A 2J98B 2ZECA 2BY8X 2UUJB 1SB1H 1O2TA 4GHQA 3U1IB 4CH2B 1HIAA 4J2YB 1CGJE 3N7OA 3O8BA 5DP7A 1VITF 1XUKA 1TA6A 1Z71A 5LPFA 1EPTA 1WSSH 3UWJH 1H8HD 3M3TA 2AIPA 1C5WB 3HK3B 1Z7KA 2GCHF 4U30A 1THSH 4DIIH 3HKJB 4Q7ZA 1XX9A 4WVPE 1SGIB 3PO1C 3MO6A 1XUFA 2QIQA 3FANA 1SOZA 2PV9B 1FXYA 2A4OA 1L1JA 1QA0A 4FXGH 2P3FH 1ETSH 2BDAA 2A7CA 1MD7A 3WWBA 3LPRA 1O3CA 1V2WT 1QQ4A 1NFXA 3Q3KA 3RC5A 1K28D 1XXDA 3RXUA 2ZWLH 3CS7A 3SU4A 1AO5A 4BAMB 5DG6A 2QF5A 1PJPA 1SSXA 3SNAA 1K2I1 1QFKH 2GDDA 3RMLH 2Q6DA 1WAYB 1ETRH 3SUFA 1GI6A 4RKJB 2XW9A 2BX4A 5EU8A 1L1NA 3VGCB 3BV9B 1AGJA 2GV7A 3RXMA 4BANB 5IDKA 1G32B 2JETC 5C1YA 5DJ7A 3QK1A 3F0OA 5I46H 4NIXA 1HAZB 1NRNH 1LKBA 3HKIB 1SGQE 1CHGA 4X8UH 5EXLA 5LPEA 3TU7H 4OS7A 1RXPA 5A8YA 2FTMA 3T62A 1ORFA 1Y3YA 4ESTE 1O5AB 1BMNH 1XUHA 1NZQH 2HRVA 2G52A 1EP5A 3NRLA 1RIWB 1CVWH 1TPOA 2DE9A 1AMHA 2JKHA 2XNIA 6CHAC 3SV9A 3UNSA 5CHAB 4D7GA 1S6FA 4D7FA 1T8LA 4B74A 1ZSLA 2VH6A 5EJZA 3F6UH 2XC4A 3PLBA 2F9VA 2ZU1A 2ZIQH 1QRWA 3AASA 4Y76A 5FL7D 4NIYA 1GHBG 4X6MA 1V2LT 2FDAA 3TITA 1OHHD 1MZAA 1K1JA 1T4UH 2KFWA 2LELA 1TE0A 1V2RT 4HG6A 3STIA 1GBMA 3QDZB 4ACBA 1TLDA 5B6LA 5A09A 2SGAA 2VWMA 2JH6D 3ZZ4A 4Y8ZA 2VVUA 1F2SE 1IHSH 1JRSA 2QN5T 2GX4A 5GWZA 1TRYA 2PTCE 1AE5A 3SJ9A 2PGQB 2GTBA 3LGUA 2L74A 4ZHLU 5C5OA 4DT7B 8GCHG 2ZPQA 5SGAE 2TGTA 2ZQ2A 1OYTH 1PPHE 1G3EA 1P11E 2BXUH 4OM9A 2XTTB 4ZKOU 1MMJN 2PUQH 3H09A 3TVJB 3G01A 2SNWA 5EQSA 3S0NA 1QJ1B 1GI3A 3SNEA 1OP0A 1P57B 1B7XB 2QYIA 3AK5A 4LZ4B 1GHAG 2ZHWH 4Q2KA 3ZVDA 1F92A 3UREA 1HAVA 1FUJA 1SPJA 1V2KT 2GVFA 1GJ7B 1GI1A 2W7SA 2ODYB 1DOJA 4F4OC 2ZP0H 5JDUB 3I29A 2PSXA 2IJOB 1FPHH 1GVZA 1SGEE 3M7TA 2KR7A 1TWXB 1DY9A 1O3DA 2BOHB 1W7GH 5EJ1A 4TWWA 1HXFH 1OWHA 4WXIA 4UFEH 2VB0A 1NFYA 3K65B 4FVBA 4X8SH 1ZJDA 2AIQA 4NFFA 1PQ5A 2BB4A 2P3UB 3STJA 4MTBA 2QF3A 3PTBA 2G00A 1WQSA 3RU4E 1O3HA 1BBRH 3OEED 5E0HA 4CR9A 2XC0A 3OX7U 1EX3A 2K0QA 5C3NA 4CH8B 3AW0A 1GMDG 3BG4C 4IC6A 1TGBA 2Y82A 1JBUH 1C4V2 2Z9GA 3BTME 1A1RA 3A85A 1O2XA 4NG9H 1LQEA 1LPGB 1W8BH 4Y10E 1RFNA 2UUYA 1EP6A 1Z1IA 1OWEA 3BTFE 4U2WA 3W94A 1GBTA 1O2RA 4AGKA 4X2XA 1HAHH 2BLWA 1J8AA 4D9RA 2ZFTA 2Z7FE 4NSVA 5ESBA 2G5NA 2C8ZB 3AVZA 2J95A 1Q2WA 2UWOA 2KM0A 4D8NA 4YT7H 1H9HE 1YCPM 4A1XA 2J98A 1IQIA 2HNTC 2G4UA 1BIOA 1NRQH 2BD4A 2Y5HA 2BLQA 3NZIA 1E0FD 1H8IH 1OYQA 1NBMD 4JZFH 1DPOA 4MNXA 4ZXYH 2OP9A 2UWPA 3ZVCA 2PHBA 3E0PB 1C5SA 1C5OH 3EA7A 4NSYA 2BZAA 2ZDAH 3GY7A 5DP5A 2KCAA 3ITIA 1LPZB 3MHWU 1ARCA 3PV2A 5HM2A 1O2UA 1C5YB 4AN7A 1IQFA 2WYJA 1BDAA 1T8OA 8ESTE 3LC3A 1IQKA 1GJDB 1C2KA 2PR3A 1JIMA 1KTTB 1YPGH 2C8XB 3LT3A 4Y71A 1CA0B 1BITA 3PLKA 2W7UA 4FUEA 5EG4A 1THRH 1EPTC 4I8JA 2Q6GA 1GCTC 2OC1A 4ZCNA 2Z9JA 3ZV8A 1E1RD 1TBQH 1NU7B 4P02A 5G4BA 3GCHB 3FN8A 1P02A 1HAIH 5DGJA 4A1TA 1UCYK 5FXLA 1RTLA 4BAKB 1TX8A 3RXOA 5T3HA 1LHDH 2A45B 2A2QH 4CRCA 1O2VA 1HJ9A 3U69H 3RXBA 1EJNA 5EW2H 1GBFA 3M5LA 1CU1A 1DFPA 1TB6H 1GI2A 1KDQB 1O5CB 2AFQB 4JZDH 1SQOA 4MNYA 2QAAA 3TJVA 1O2ZA 3A7ZA 4BTUB 2XNDD 3SU3A 4AG2A 3RXSA 3UPEA 2CJIA 1ZZZA 4YLQH 1NFUA 1QCPA 3GOVB 4INHA 4XFQA 3EA8A 1K0HA 1C5ZB 1KLJH 1FLEE 4MG3A 3FVFB 5HGGA 3VXEH 1C5MD 1ZGVA 4I8GA 2GV6A 2G55A 3QZRA 4I7YH 1AY6H 1COWD 1FY3A 3RDZA 2PSYA 2P59A 1FQ3A 3UOUA 1HBTH 1G9IE 2ZGCA 1C9PA 2BVRH 1YKTA 2OD3B 4LZ1H 4IW4E 4GAWA 3UWIA 1GHBF 4X1NU 3KQ5A 5EGMA 1NPMA 4H4FA 3T25A 3CS0A 5DK1A 1P2NA 1O3AA 5ABWA 2Z3DA 3M7QA 3BTGE 4OS4A 5HXFA 2W3KA 3SORA 2EA3A 4GCHG 1AVWA 7GCHG 4AFQA 1OSSA 2STAE 1ELVA 1ESAA 1OWDA 4DOQA 4MPUA 1E38B 8GCHF 1HAPH 1FI8A 2EY4C 3AW1A 4CBNA 1SHHB 1TPSA 2F9UA 2WV5A 2VGCB 8KME2 1EXFA 5L2ZH 1ANBA 3PROA 1UVSH 1ZHRA 1ANEA 4AFZA 2OQ5A 1W0ZU 3SU2A 5DO4H 2LP6A 1QTFA 1O2HA 4INKA 1F5LA 5F8TA 1GHAF 3P92A 2A7JA 2AYWA 1K21H 3SV6A 3SUGA 3ZVEA 1PPZA 1UTMA 1UW7A 4OS5A 4U01A 3ZZ8A 3MH5A 4VGCC 3UR9A 4CR5A 1QL7A 4FUCA 3V7TA 3RXJA 3A84A 1XVOA 3H7TA 2OXSA 1MUEB 2EI6A 1GWAA 2BQ6B 4ISHH 1YF4A 2VWLA 3QWCH 1O2IA 1TRNA 2B9LA 1K1PA 2PKAB 3LKWA 4O3TA 4UDWH 4B71A 1D3DB 1O35A 4Q7XA 5L2YH 1XUGA 3AAUA 4B73A 3ZVFA 1YPEH 2M2AA 1GMDF 3E8LA 1VCWA 5FX5A 2Y5GA 2WV9A 1XUIA 1GDQA 3M7UA 5LGOA 2VIDA 3HGPA 2SGFE 2H6MA 3Q3XA 3M3SA 3PB1E 2R0LA 1BTYA 1TMUH 1NC6A 1BMMH 3Q76A 4JK6A 3F9HA 3F3BA 3PWBA 3MI4A 1L4DA 1FY5A 2XYAA 3M37A 5C0UA 1SOTA 1Y8TA 4DVAU 1H9LB 1WQVH 4IN2A 3CP7A 4NA8A 3B9FH 4WMEA 2Y6TA 3E90B 3OY6U 4K60A 4ZROA 3UFAA 1C5UA 1O3JA 1J17T 2C8YB 5LPRA 2BLOA 4IMQA 3UNQA 1PYTD 1C1WH 3EE0B 3GCOA 1SBWA 2HLDD 3A7WA 3VG8A 3DSPA 3M5MA 4X1PU 3E0NB 1GJ5H 3LH1A 3A88A 2BZ6H 2Z3EA 1ZTKA 3TNSA 4X6NA 3RXGA 4B75A 1UHBB 2V6NA 1HJAC 2QXGA 2RDLA 1A5IA 1VJAU 3TH2H 3LGWA 2FMJA 1KIGH 4XOJA 4ZKSU 1C2GA 1BTZA 4I32A 4MDSA 4Q4LA 1DM4B 4FOUC 4I8LA 2FODA 1ZTJA 1Y3WA 1P04A 1AQ7A 2D8WA 2NU2E 3KYGA 1AKSB 2ZI2H 2P8OB 1QB1A 2ZTZA 5HIZA 2EI7A 3LGTA 4UFFH 1ZOMA 2QCYA 1SMFE 1M9UA 2ZO3H 2GT8A 2ZKSA 3SGBE 3RLYH 3UIRA 1G2MA 1ELAA 2BY6X 4WY3A 2CN0H 1V2VT 1UJ1A 4Y0ZE 1P06A 4IC5A 5DPAA 2GD4B 1AE8H 1GBBA 2XXLA 1H1BA 1IQLA 1GHWH 1BTUA 2ZFFH 2O8UA 2QGRA 1O2YA 1AB9C 2TGAA 3MH4A 2FTLE 1LVOA 1NT1A 1KDQA 1JRTA 1AUJA 1SLXB 3SU6A 1W12U 1TIOA 4X6PA 4LK4A 2XBWA 1CSOE 1Z8GA 5EQQA 4THNH 1LQDB 1MKXK 2VNTA 2FOGA 3A80A 3SQEE 3VGCC 1S5SA 1T4VH 3PV4A 3FP8E 3FOAA 1YPJH 1GVLA 3KHVA 5DP9A 2FLRH 1Z6JH 3C1KA 2WZQA 3U8RH 1P2MA 1FONA 1BHXB 4YZUA 3OSYA 4CHAB 1IQNA 5K0HA 1P3EA 1EZUC 1CT4E 4XD7D 1PFXC 3UQOA 1XUJA 1S81A 1C1RA 1MZDA 3RXTA 1F7ZA 1FV9A 1RIWC 2FS8A 3I78A 1H8DH 1UVOA 2OBOA 2PUXB 4TT3D 1GBEA 1HRTH 1P2QA 1G37A 4ZKRU 2G81E 2A5IA 1VJ9U 1GBJA 5C0TA 1V2UT 3D62A 5J4QA 1C2EA 2A4QA 4LOYH 2PP6A 1QHRB 4AYYB 1AVGH 2AMPA 1RS0A 2CV3A 3BEFB 3PYHA 3BTTE 2J92A 2ZCHP 3RM2H 3TH4H 1KLTA 4GHTA 2H1UA 1QB6A 3LONA 4GCHF 1UK2A 3PTNA 4FU8A 2VWNA 7GCHF 1BMAA 2XCFA 3RXLA 2BD9A 1QURH 4XDEA 3VB6A 1T31A 4ZUHA 3QGJA 3TGKE 1DWCH 4JYVH 2ZF0H 4X2VA 2Z3CA 1N1LA 3MNSA 4MPXA 1OX1A 1RGQA 1MBMA 1Y3VA 4Y79A 4WMDA 6LPRA 1IAUA 2ODPA 5ESTE 1DS2E 1C5LH 3QTOH 1DSUA 4WMFA 3RXPA 5F8ZA 4AFSA 3OTPA 1HB0B 1DLEA 4TWYA 1QZ8A 3OTJE 3A81A 1KTSB 3GY5A 3URCA 2G4TA 2AS9A 5E8EH 2VJ1A 1GBCA 1GMCG 2Y7ZA 3KQEA 4M7GA 1GPZA 6ESTA 2HLCA 1ZGIA 3TJNA 3GDUA 2WYGA 4YO9A 3SQHE 4KTSA 3MNXA 1UCYH 1T8MA 1B0EA 2AHME 2PGBB 2HNTE 4FUBA 5T6GA 1P9SA 1TBRH 2YMSB 1GI0A 2OK5A 1BHXF 1JWTA 1Y3XA 3KIDU 1O3IA 3UAIC 3P8FA 4K3JA 1G3DA 2B8OH 2KCPA 4IGDA 2BX3A 1HV7A 4B1TA 4R8TB 4GSOA 2DE8A 3ZIAD 3A7YA 1S6LA 1G30B 1D9IA 1TAWA 2ZDMA 4RT1A 3QX5H 3HPTB 3BIVH 3GDSA 4ZXXH 1AI8H 4UFDH 1RD3B 1N8OC 3SW2B 1E37B 2FOAA 1TX7A 1UK4A 4O97A 3LDXH 4GUXA 1FY8E 2W26A 5DP8A 2THFB 4M9FA 1F0UA 1OP8A 1VR1H 3PM3A 3SI3H 3A7VA 1LVBA 3A82A 2V3HH 1E1QD 1H8ED 3SBKA 1D3QB 3KQCA 3ZVAA 4IN1A 1BTHH 1ZHMA 2XWBI 4BTIB 1CA8B 4ISIH 3RMMH 4X8VH 3PO1B 2QC2A 1O2KA 3ZZBA 3SUEA 1IQMA 4Y8YA 2XOKD 1YBWA 3EYDA 3QGNB 3SJKA 2BDYA 1VZQH 4I31A 5A0CA 1G2LA 3GDVA 5FCRA 3LGIA 5C67A 1GHXH 2C3SA 1MQ6A 1AKSA 2CHAB 1C4Y2 4XRNA 5LH8A 1O39A 3M36A 2QF4A 1IHTH 1OOKB 4Q80A 2VWOA 2ZHFH 3URDA 3UNRA 3TK9A 4X2YA 4K8YA 4A6LA 2ZFSA 2C8WB 2CGAA 4RN6A 4ZMAH 1P0SH 3K2UA 1KYNA 3GCTG 2ZGJA 4DJZB 3OYPA 4Q7YA 4K1EA 2A5AA 3U9AH 1GI5A 3VB7A 2CMYA 4ZHMU 1WTHD 1DWDH 4MQAA 4K2YA 3SU1A 4D76A 1B0FA 2BD8A 2ANMH 3GY2A 2L6OA 1MU6B 4NA7A 2TGDA 1P01A 3SN8A 4AG1A 3PRBA 4I8KA 3ELAH 2G8TA 5FX6A 3SNDA 1K1IA 4YLUA 5HM9A 1MKWK 3W95A 2BDHA 1W13U 3MWIU 3SYJA 1UTPA 1GI8B 4DCDA 3IITA 3N99A 3TPIZ 3U8TH 5GIBA 1W0KD 1DWBH 5FBIA 3L3TA 1UCYE 2ZPRA 4GVUA 3NUMA 4RI0A 1EB1H 3NXPA 1KLIH 2O8LA 4FETA 1RJXB 1HUTH 3ZZAA 1QQUA 2P16A 1LHEH 2R0KA 1ANCA 1FMGA 1FAXA 1EASA 4ISOA 4NZQA 1EFRD 5C1XA 1TGNA 2YNBA 4IBLH 1DUAA 3S9BA 4X0WU 1P09A 2XCNA 3LH3A 1Y59T 3RUOA 3NCLA 1TABE 1AZ8A 4E7RG 5DN6D 1TNKA 4ASHA 3U28C 1OXGA 2FYRA 1MTVA 1BJVA 1MCTA 1BTPA 3FKSD 1SC8U 2FI5E 2P3TB 2C90B 3P17H 1L2EA 2FX4A 2ZG0H 3F0PA 2FOFA 1YYY1 1Y3UA 1UTQA 1ELGA 2GCTB 2ZNKH 5HYOA 2BMGB 3PMAB 2GZ9A 1SHYA 1EAUA 1BA8B 1HCGA 4SGBE 2GJGA 3ZV9A 2JJ1D 4NFEA 5EQRA 2GKVE 1A3EH 5JBCS 2V35A 1SI5H 2BLVA 2ZQ1A 1O3LA 1T8NA 2ZPSA 4AX9H 1LPKB 3MQKC 3ATKA 1O2OA 1J14A 5AFYH 4FUJA 1HPGA 2AEIH 5F6MA 3BTHE 3TH3H 5A0BA 5DP3A 5FPTA 1XXFA 1O2WA 3QLPH 4B6FA 3PRDA 1IQEA 2OBQA 1QB9A 2ZGHA 3M5OA 3SU0A 1J9CH 3DFJA 2ALVA 1C1NA 5GXPA 2C4FH 3KYFA 3DFLA 2Z6BD 5F53A 3FZDA 2IPQX 1ELTA 1YPKH 2KCOA 3LU9B 3OY5U 3RLWH 3V0XA 2BTCE 1FAKH 1AWHB 3RU4T 3T2NA 2H5CA 2R3YA 2C93B 1WCZA 1GBDA 2A7HA 1P05A 2BD2A 6GCHG 1FIWA 4X1QU 1F0SA 2VGCC 2LPRA 2JIZD 1C1VH 1O3GA 1TONA 1FDPA 1ZSJA 2F9NA 4NA9H 1GJ4H 2J38A 2WPMS 1MAYA 1DUEA 1P8VC 1A61H 1BJUA 2WUCA 1SGFG 2BDBA 1DLKB 2ZU4A 1HNEE 1GMHG 2A5KA 3ZVBA 3W1EA 1S82A 1P2IA 1BTWA 1TX6A 1PYTC 1GMCF 3WY8A 2Z9KA 3NWUA 1K1OA 4H42U 2O8MA 2WHXA 1ZYOA 1EZXC 2AGGX 1IQGA 1W7XH 1YLCA 2H2ZA 3U1JB 2RDEA 4OGXA 3NKKA 3M35A 3S7HB 1EJAA 2BDIA 4KGAA 1S0RA 2KAIB 1ZPCA 2NU1E 3EGKH 3R3GB 4AB9A 1MKXH 5FBEA 2XC5A 2F9BH 3GISB 2UWLA 1QL9A 1C5NH 3C27B 3RXEA 4YXWD 2Y7XA 2IPHA 2QY0B 9LPRA 1ELDE 1O0DH 1UO6A 4X8TH 1LVYA 3A89A 4MLFB 2KCYA 4Z0KA 3ZZCA 2SGDE 3P8OA 3AAVA 1D6RA 5A8XA 1WYKA 3ZZ7A 1D3TB 1ID5H 1VKYA 1YLNA 1UTJA 3BTQE 4AZ2B 1FX0B 3Q00A 1ELFA 3VPKA 2TGPZ 2BVXH 2R2MB 4JK5A 1DWEH 1U6QA 1TOCB 1A4WH 1YY3A 2Z9LA 4B2BA 2WUBA 2ZU3A 3GS9A 1HAYB 5CHBA 4WJG2 1JOUB 4TY6A 1QJ7B 4HTCH 1GCTB 4WWYA 1UVPA 4MNWA 4UFGH 1BB0B 1LCYA 5C94A 1QA7A 4DGJA 3E91A 3F1SB 4MVNA 3OEHD 2K8IA 1YPMH 3PMJA 1G3CA 2GGVB 2Q1JA 2WPKS 1EOLA 1S85A 2HPPH 4E05H 1QIXB 1J16A 3RXCA 4BXWA 1P2OA 5JB9S 1DANH 2NU3E 1OKXA 2TBSA 4GLYA 3A7TA 3GCTF 1S84A 1SR5C 1EZSC 3F2HA 1V2QT 4DY7B 2P93A 2ZHQH 1HLTH 1ABJH 3CNRA 1INCA 1E79D 2P8OC 3KL6A 1HGTH 1RTKA 1BOQA 2AMQA 3ZZDA 4KTUA 3E16B 1PQ7A 1SL3A 1NTPA 4RSPA 3D49H 1FPCH 2BVSH 3IWMA 5C1UA 4ZAEA 1S83A 3ZZ3A 1TALA 1QNJA 2A4RA 5L6NH 2TPIZ 1AFQB 1BRAA 4Y7AA 2OUAA 1K1MA 2XBXA 1TQ0B 1FJSA 5GJ4B 3Q3YA 3KCGH 2XBYA 2NU4E 3O8CA 4YM9A 1Y5UT 1C2IA 2ZC9H 2HOBA 3ATIA 2BQ7B 5A0AE 1O32A 3N7DA 1GJ8B 3L6PA 1O2PA 4E06H 3FAOA 4B2AA 2SNVA 1QR3E 2ZTXA 2A4GA 1EAIA 4X6OA 4Y0YE 4JYUH 3UR6A 1N6YA 1O2QA 3GICB 1O2SA 5J4SA 3RMOH 4JZ1A 1GL1A 4QT8C 1LKAA 4HGCA 4UD9H 3GY3A 4K8BA 3A8DA 1KXDA 3SO3A 4NCYA 4F48B 1HDTH 2YNAA 2J9NA 1HAOH 1O3BA 5H4IB 2HVYB 1UMAH 3B23B 3KF2A 2ILNA 1TA2A 3SHAH 4NWKA 5E2PA 1SLUB 1LDTT 2ZA5A 3F9GA 4CHAC 4NGAH 1MTNB 3ZZ5A 4ABHA 4GPGA 3EE7A 2JH0D 1ELEE 3RP2A 1VGCC 3RXHA 5BRRE 1S6HA 1TNLA 1NN6A 2AGIX 1O3FA 1O34A 3SOSA 2VVCA 1GG6B 3O8DA 2LNCA 1W14U 1MBQA 2EC9H 1BQYA 4X1RU 3SZNA 4OS2A 1SLVB 1EAXA 2QXHA 2I6QA 2B0FA 1GGDB 3S9CA 1DITH 3JZ2B 3RXRA 1CGHA 3FO8D 3KQDA 3RXVA 3N7EA 1BMLA 4AFUA 1CBWB 1V3XA 1C5XB 3GYMA 8LPRA 3L33A 1P3CA 1THPB 3RXQA 1AIXH 3A86A 1Z8RA 5I25A 3K6YA 1NBME 1A7SA 2H5DA 2RFKC 1RRKA 1TRMA 2PLXA 2ZU2A 1CHOG 1W3CA 2ZDVH 2OTVA 1AU8A 3EA9A 2SFAA 1W11U 1GBIA 1NRSH 2AGEX 1V2TT 3FP7E 5AFZH 1KSNA 1SGYE 1Z8JB 1ZJKA 1WV7H 4JZIA 6GCHF 1J15A 5DP4A 1C5VA 1K1NA 1L0ZA 3V12A 4X1SU 3BIUH 1ESTA 3ATMA 2FESH 4DG4A 1GVKB 3ZVGA 1BMFD 2D2DA 1WXRA 1P2KA 1UTLM 3BTEE 4ABGA 2BOKA 1GJ9B 4TYDA 2D1JA 1ZPBA 1GMHF 1WOFA 3V13A 2CXVA 1G3BA 1O30A 5C5NA 5EODA 1ZLRA 4DURA 1MKWH 5AHGH 2PKSB 1OS8A 3OE7D 1C1TA 2AMDA 1PPEE 3KEEA 2KAIA 1O3EA 3BEUA 2IN2A 4O03A 2YOLA 5GPIB 2CF8H 1WBGB 5GCHG 2G51A 1YCPK 3ODDA 3ZYDA 5GNDA 3RC6A 1MCVA 3EAJA 4FU7A 1EZQA 1V6DA 4OS1A 3KNXA 1HYLA 2OQUA 1IQJA 2HVXA 2V3OH 3F9EA 3RXFA 5CHAC 1X7AC 1O3KA 3GY6A 1HJAB 2FOHA 1MTSA 5FHTA 1SLWB 3MH7A 4ZKNU 1W10U 4JYTA 2VIWA 1A5GH 3JZ1B 1SG8B 3DA9B 3I77A 2BD3A 5GDSH 1WU1A 2RG3A 2FM2A 3GY8A 3VXFH 1HXEH 1KY9A 3K9XB 3SU5A 3QZQA 4AORA 5JB8S 2GP9B 3RXAA 1C1MA 2WPJS 4XBCA 2W6JD 4ABIA 1Q31A 3P8NA 4HI3A 2ZHEH 1YPHC 2F4LA 3FP6E 2J34A 2ZHDA 1KXBA 1NRRH 3SUDA 4UONA 4YOIA 2PW8H 5JPMH 2ASUB 2G5VA 3P95A 4WH8A 4CRDA 4TPYA 1BT7A 1K22H 2W6ID 3T28A 1A0LA 1YGCH 3E6PH 4BTTB 3IG6B 1GDNA 1AB9B 2Y80A 3EQ0H 4YT6H 3VFEA 1C2HA 3MO3A 2VIVA 2AH4X 5T6FA 1LMWB 1O31A 2CHAC 1O36A 3O8RA 2OC0A 3PWCA 1O5EH 3GYLB 3T5FH 2GMTB 5E0GA 4IMZA 1K1LA 2PKAA 4YOGA 3LOXA 1SGTA 3S7KB 1BTXA 3MO9A 2BDGA 1ZRKA 2O9QA 3QTVH 5FPYA 1P2JA 5E2OA 1EQ9A 3TK5A 1GHVH 2EQNA 2UUFB 1OWJA 3D65E 3SV2H 5CMXH 1W2KH 1F0TA 3ZZ9A 5FCKA 3LJOA 1SGFA 3U8OH 2ULLA 5HKKD 1P10A 4ISNA 5A2MH 2QXJA 2FP7B 4NWLA 1KXFA 4OS6A 5PTPA 5CE1A 1IOEA 1DVAH 1CO7E 2IOTA 1FY1A 1SQTA 5B6OA 3MU1A 2GT7A 1EJMA 2W3IA 2FWWA 1NM6A 3SNCA 2ZDKA 1UVUH 2GZ7A 3RXIA 4FUIA 1A5HA 2R2WU 3VB4A 4ABAA 1EKBB 1C2JA 4TPIZ 1V2OT 1FZZA 5AVDA 1DX5M 1SKYE 9ESTA 1P12E 1SQRA 3NPSA 1GJCB 2PFEA 1ANDA 1VITH 7KMEH 2VU8E 1UHBA 3QUMP 2ESTE 4WH6A 3MU0A 2P94A 3MH6A 1F0RA 1ELBA 1TMBH 2M5TA 3WW7A 1NS3A 1O5BB 3QO6A 2OC8A 1C5RA 1D4PB 1YP9A 3A8BA 3P6ZB 3F68H 4DIHH 3M61U 2GCTC 1TBZH 3MOCA 1UTOA 1QY6A 1V2ST 2J5UA 2YMSD 1W0YH 1C4U2 1UVTH 4B76A 1BRBE 1Z6EA 1ZMJA 4CRAA 1S0QA 2EEKA 1AFEH 3A8CA 2JETB 3OFND 3RMNH 3MYWA 3UB0A 4K1TA 1NFWA 3TJOA 5A8ZA 2H9TH 3RXDA 2BY5X 3SHCH 3TJUA 2PTNA 1EUFA 4AYVB 3ZYEA 1XM1A 1TFXA 2I6SA 4CRFA 1UTKA 1C1SA 1YM0A 3GY4A 2OLGA 4F55A 4Z6AH 3SZEA 1CT2E 1O2GH 1GCDA 1A46H 2BYAX 5TJXA 2VH0A 1AD8H 1KXCA 1CHOF 2OINA 2BXTH 4PROA 1VCQA 3T26A 3LC5A 4IS5A 4Z1MD 5T1VA 1CA0C 5HIYA 6CHAB 1T7CA 4YTAA 5DKMA 1BZXE 2R9PA 2ZEBA 4F49A 4U32A 1TGCA 3M3VA 1H4WA 4H6TA 2ZCLP 1F5RA 3GCHC 4FUDA 1O37A 3DCLA 1B5GH 1ARBA 2GZ8A 2F91A 5TCAA 3MU8A 4Y7BA 4ASUD 1HJ8A 4NIWA 2TRMA 3BF6H 1GI4A 3ATWA 1N8OB 2ZU5A 1NU9A 1GBKA 5KEDA 3BEIB 4WF8A 2WPIS 4E7NA 5JBAS 2BQWB 4XBDA 4BOHA 3VB5A 1ZRBA 3MU4A 4BAOB 1HAGE 2BY9X 5C17A 3TGIE 5GCHF 4ABBA 1XKBC 3H5CB 3KN2A 1DE7H 4O9VA 3A7XA 3LIWA 2ZGBH 3VEQB 1LTOA 3ODFA 1C9TA 2HWLB 1OWKA 3KQBA 5DSFA 3DHKH 1LHCH 5EJLA 4AGJA 1TGTA 1ZMNA 1ZTLA 4INLA 3F9FA 2Y5FA 1PQAA 1TNIA 1Y5BT 2ZGXH 1C1UH 2ZFRH 2R3UA 1Q3XA 1MABB 4Y6DA 2WSSD 1IQHA 2J4IA 2VBCA 4ABFA 1F5KU 2FXRA 1SGNE 4D9QA 4MPVA 2Z9IA 3PV5A 3A87A 2BM2A 3LGVA 3TNTA 1LVMA 3S9AA 5EOKA 2FEQH 2H9HA 1SVPA 2IJD1 3BSQA 5EPYA 3BTDE 3S69A 2WV4A 1C2DA 1ZMLA 1PPFE 2FX6A 1LO6A 4KELA 4BAHB 4CREA 4TY7A 4ACAA 1OP2A 4RT0A 1O2LA 1GJBB 1BUIA 2FOBA 1JIRA 1ZSKA 3VB3A 1BCUH 3BG4B 3P8GA 2FYQA 2QF0A 1YC0A 2SGQE 1SGPE 4XSKU 1GBLA 3GCNA 4O3UA 2TIOA 3BG8A 5EXMA 1C2FA 3FFGA 1ETTH 1DXPA 2QA9E 2F3CE 4ZHAA 2ZZUH 4DT4A 1O5DH 2CK3D 2K1QA 1TQ7B 3UY9A 2BD5A 3ZZ6A 4FUHA 3E1XB 1QBVH 2QE7D 1NY22 4CRBA 1QL8A 1TOMH 2OC7A 1QRXA 1MH0A 2O8WA 1HAXB 3DSGA 3SI4H 4AOQA 5CDFE 1BBRE 1TMTH 5E0JA
chains in the Genus database with same CATH topology
1GHZA 4JMYA 2O8TA 4X2WA 3SNBA 5K7RA 2RA0A 3TIUA 1L4ZA 1MU8B 5HMAA 1KXAA 3PLPA 1PQ8A 2FOMB 2FPZA 1C2LA 1DICA 1O33A 3BTKE 1FY4A 2AERH 3SV7A 4CBOA 5EPNA 2BD7A 1PPGE 1H9IE 1EAWA 1MAXA 4ABJA 1AFQC 2HGTH 1O3PB 3HATH 1C2MA 2ANYA 1RTFB 2H9EH 1YPLH 1NO9H 4XBBA 4K1SA 4NIVA 4KTCA 1A3BH 1A0JA 4H6SB 3SV8A 1UK3A 3BTWE 1Z8IB 4UEHH 2HPQH 1MD8A 1GI9B 4UE7H 3UUZA 3DUXH 1P9UA 3R0FA 1YCPH 1FIZA 1MTWA 2FI3E 3MFJA 3UTUH 5L30H 4AB8A 1QJ6B 1VITG 2ALPA 3OU0A 1V2NT 1CT0E 3LJJA 2CF9H 1HIAB 3M5NA 4HFPB 4MPWA 2GCHG 1DDJA 2J94A 4XE4A 1OWIA 1WTGH 2Q6FA 2Y81A 1EPTB 1CQQA 1O2NA 3V3MA 2BY7X 3RXKA 1MTNC 5IYTA 4KKDA 2EI8A 1P03A 1WUNH 1AN1E 5EXNA 2ZFPH 3TK6A 4CRGA 7LPRA 1O5FH 1GG6C 2BDCA 2FOEA 2ZTYA 3E3TA 2VIQA 3KGPA 1BBRK 1GBHA 1A0HB 1ESBA 4ZH8A 3HK6B 1SFIA 1GGDC 1V2MT 3B8JA 4WXVA 1CGIE 2QXIA 2VVVA 1K9OE 1XVMA 1GL0E 1NRPH 3A83A 2A1DB 5FAHA 5F03A 1CBWC 3ATLA 3SGAE 2JH5D 1MTUA 3PMBB 3LGYA 1QBNA 1UTNA 2ZCKP 3TGJE 4BAQB 5TCCA 1EB2A 4BXSA 3U98H 4J1YA 3SJ8A 1SFQB 2GDEH 1T32A 1PPCE 4FUGA 2B5TB 3ESTA 2HALA 4HZHA 2FI4E 2ZDLA 2QV1A 3SGQE 2VIOA 2A2XH 1XMNB 2XWAA 3D23A 1ZR0A 2FO9A 2XRCA 1SGRE 3A8AA 1LHGH 2UUKB 3RM0H 3H7OA 2HNTF 2STBE 1FN8A 4A1VA 7ESTE 3SJOA 1C5PA 1QRZA 4I8HA 4ISLA 1GJ6A 4R0IA 4A7IB 2WPHS 4DW2U 1GBAA 1A2CH 1LHFH 2A0QB 1V2JT 2ZDNA 1YPHE 1C1OA 1V2PT 2PWXA 5FPSA 2PKSC 1FNIA 1G36A 1O3MA 3NK8A 1EOJA 2RA3A 2WINI 3K6ZA 3HGNA 1GDUA 1Y5AT 1TPAE 3FZZA 1O2MA 2V0BA 5C20A 2ANKH 1E35B 2VINA 5JBTA 2A32A 1DXWA 1TGSZ 4MNVA 3UQVA 1JXPA 1BRUP 1QBOA 1YLDA 3RU4D 2F9PA 1DY8A 1DT2A 4VGCB 1GI7B 2F83A 1C1PA 3MTYA 1O2JA 5DP6A 1L1GA 2W5EA 3Q77A 4Y11E 1TNGA 2VIPA 3DD2H 1ACBE 2FIRH 1SGDE 5T6DA 1GHYH 1TNHA 2Z94A 4LXBH 5AF9H 1HAVB 3MNCA 1QGFA 2RCEA 2SGPE 4OGYA 3RC4A 2ANWA 1O5GH 1HFDA 4NZLA 2A31A 2BHGA 4ABEA 5C2ZA 1AWFH 4JCNA 1EATA 1O38A 2NWNA 4RKOB 4ABDA 2J2UA 5BPEA 4FU9A 2ODQA 4SGAE 1C5QA 4K5ZA 1O3OA 3PMHB 3T27A 1FN6A 3MNBA 4FVDA 5JBBS 1ZHPA 4BNRA 3SJIA 2FLBH 3QN7A 1D3PB 2D26C 1E34B 1C5TA 3T29A 4FUFA 4YOJA 5JYIA 2FOCA 5EW1H 1TNJA 2OCVB 1GJAB 2XBVA 4JZEH 1DSTA 2GMTC 1NESE 2NU0E 1AVXA 3MU5A 1NROH 5ETXA 2P95A 1TYNA 2WPLS 3ENSB 3UOPA 1TPPA 1SGCA 1ZPZA 3MMGA 2F9OA 2DUCA 1SQAA 4Y8XA 1D6WA 1BRCE 4K69A 4KP0A 3EDXB 2ZFQH 4A5TS 3BN9A 3P70B 1PPBH 1ELCA 4YESB 3CENA 2FZZA 1ABIH 4B2CA 1VGCB 3DT0H 1Z1JA 2SGEE 1KXEA 3TLOA 1AUTC 1JMOH 1MQ5A 1C1QA 1OPHB 1O3NA 1AZZA 2B7DH 1XKAC 1VCPA 1CE5A 4I33A 1E36B 2FS9A 1N6XA 1AHTH 5F8XA 4A92A 2ZECA 2BY8X 2UUJB 1SB1H 1O2TA 4GHQA 3U1IB 4CH2B 1HIAA 4J2YB 1CGJE 3N7OA 3O8BA 5DP7A 1VITF 1XUKA 1TA6A 1Z71A 5LPFA 1EPTA 1WSSH 3UWJH 3M3TA 2AIPA 1C5WB 3HK3B 1Z7KA 2GCHF 4U30A 1THSH 4DIIH 3HKJB 4Q7ZA 1XX9A 4WVPE 1SGIB 3PO1C 3MO6A 1XUFA 2QIQA 3FANA 1SOZA 2PV9B 1FXYA 2A4OA 1L1JA 1QA0A 4FXGH 2P3FH 1ETSH 2BDAA 2A7CA 1MD7A 3LPRA 1O3CA 1V2WT 1QQ4A 1NFXA 3Q3KA 3RC5A 1K28D 1XXDA 3RXUA 2ZWLH 3CS7A 3SU4A 1AO5A 4BAMB 5DG6A 1PJPA 1SSXA 3SNAA 1K2I1 1QFKH 2GDDA 3RMLH 2Q6DA 1WAYB 1ETRH 3SUFA 1GI6A 4RKJB 2XW9A 2BX4A 5EU8A 1L1NA 3VGCB 3BV9B 1AGJA 2GV7A 3RXMA 4BANB 5IDKA 1G32B 2JETC 5C1YA 5DJ7A 3QK1A 5I46H 4NIXA 1HAZB 1NRNH 1LKBA 3HKIB 1SGQE 1CHGA 4X8UH 5EXLA 5LPEA 3TU7H 4OS7A 1RXPA 5A8YA 2FTMA 3T62A 1ORFA 1Y3YA 4ESTE 1O5AB 1BMNH 1XUHA 1NZQH 2HRVA 2G52A 1EP5A 1RIWB 1CVWH 1TPOA 2DE9A 1AMHA 2JKHA 2XNIA 6CHAC 3SV9A 3UNSA 5CHAB 4D7GA 1S6FA 4D7FA 1T8LA 4B74A 1ZSLA 2VH6A 3F6UH 2XC4A 3PLBA 2F9VA 2ZU1A 2ZIQH 1QRWA 3AASA 4Y76A 4NIYA 1GHBG 4X6MA 1V2LT 2FDAA 3TITA 1MZAA 1K1JA 1T4UH 1TE0A 1V2RT 3STIA 1GBMA 3QDZB 1TLDA 5A09A 2SGAA 2VWMA 2JH6D 3ZZ4A 4Y8ZA 2VVUA 1F2SE 1IHSH 1JRSA 2QN5T 2GX4A 5GWZA 1TRYA 2PTCE 1AE5A 3SJ9A 2PGQB 2GTBA 3LGUA 4ZHLU 5C5OA 4DT7B 8GCHG 2ZPQA 5SGAE 2TGTA 2ZQ2A 1OYTH 1PPHE 1G3EA 1P11E 2BXUH 2XTTB 4ZKOU 1MMJN 2PUQH 3TVJB 3G01A 2SNWA 5EQSA 3S0NA 1QJ1B 1GI3A 3SNEA 1OP0A 1P57B 1B7XB 2QYIA 4LZ4B 1GHAG 2ZHWH 4Q2KA 3ZVDA 1F92A 3UREA 1HAVA 1FUJA 1SPJA 1V2KT 2GVFA 1GJ7B 1GI1A 2W7SA 2ODYB 1DOJA 4F4OC 2ZP0H 5JDUB 3I29A 2PSXA 2IJOB 1FPHH 1GVZA 1SGEE 3M7TA 1TWXB 1DY9A 1O3DA 2BOHB 1W7GH 4TWWA 1HXFH 1OWHA 4WXIA 4UFEH 2VB0A 1NFYA 3K65B 4FVBA 4X8SH 1ZJDA 2AIQA 4NFFA 1PQ5A 2BB4A 2P3UB 3STJA 4MTBA 2QF3A 3PTBA 2G00A 1WQSA 3RU4E 1O3HA 1BBRH 5E0HA 4CR9A 2XC0A 3OX7U 1EX3A 5C3NA 4CH8B 3AW0A 1GMDG 3BG4C 4IC6A 1TGBA 2Y82A 1JBUH 1C4V2 2Z9GA 3BTME 1A1RA 3A85A 1O2XA 4NG9H 1LQEA 1LPGB 1W8BH 4Y10E 1RFNA 2UUYA 1EP6A 1Z1IA 1OWEA 3BTFE 4U2WA 3W94A 1GBTA 1O2RA 4AGKA 4X2XA 1HAHH 2BLWA 1J8AA 4D9RA 2ZFTA 2Z7FE 4NSVA 5ESBA 2G5NA 2C8ZB 3AVZA 2J95A 1Q2WA 2UWOA 4D8NA 4YT7H 1H9HE 1YCPM 4A1XA 1IQIA 2HNTC 2G4UA 1BIOA 1NRQH 2BD4A 2Y5HA 2BLQA 3NZIA 1E0FD 1H8IH 1OYQA 4JZFH 1DPOA 4MNXA 4ZXYH 2OP9A 2UWPA 3ZVCA 2PHBA 3E0PB 1C5SA 1C5OH 3EA7A 4NSYA 2BZAA 2ZDAH 3GY7A 5DP5A 3ITIA 1LPZB 3MHWU 1ARCA 5HM2A 1O2UA 1C5YB 4AN7A 1IQFA 2WYJA 1BDAA 1T8OA 8ESTE 3LC3A 1IQKA 1GJDB 1C2KA 2PR3A 1JIMA 1KTTB 1YPGH 2C8XB 3LT3A 4Y71A 1CA0B 1BITA 3PLKA 2W7UA 4FUEA 5EG4A 1THRH 1EPTC 4I8JA 2Q6GA 1GCTC 2OC1A 2Z9JA 3ZV8A 1TBQH 1NU7B 5G4BA 3GCHB 1P02A 1HAIH 5DGJA 4A1TA 1UCYK 5FXLA 1RTLA 4BAKB 1TX8A 3RXOA 5T3HA 1LHDH 2A45B 2A2QH 4CRCA 1O2VA 1HJ9A 3U69H 3RXBA 1EJNA 5EW2H 1GBFA 3M5LA 1CU1A 1DFPA 1TB6H 1GI2A 1KDQB 1O5CB 2AFQB 4JZDH 1SQOA 4MNYA 2QAAA 3TJVA 1O2ZA 3A7ZA 4BTUB 3SU3A 4AG2A 3RXSA 3UPEA 2CJIA 1ZZZA 4YLQH 1NFUA 1QCPA 3GOVB 4INHA 4XFQA 3EA8A 1C5ZB 1KLJH 1FLEE 4MG3A 3FVFB 5HGGA 3VXEH 1C5MD 1ZGVA 4I8GA 2GV6A 2G55A 3QZRA 4I7YH 1AY6H 3RDZA 1FY3A 2PSYA 2P59A 1FQ3A 3UOUA 1HBTH 1G9IE 2ZGCA 1C9PA 2BVRH 1YKTA 2OD3B 4LZ1H 4IW4E 4GAWA 3UWIA 1GHBF 4X1NU 5EGMA 1NPMA 4H4FA 3T25A 3CS0A 5DK1A 1P2NA 1O3AA 5ABWA 2Z3DA 3M7QA 3BTGE 4OS4A 5HXFA 2W3KA 3SORA 2EA3A 4GCHG 1AVWA 7GCHG 4AFQA 1OSSA 2STAE 1ELVA 1ESAA 1OWDA 4DOQA 4MPUA 1E38B 8GCHF 1HAPH 1FI8A 3AW1A 4CBNA 1SHHB 1TPSA 2F9UA 2WV5A 2VGCB 8KME2 1EXFA 5L2ZH 1ANBA 3PROA 1UVSH 1ZHRA 1ANEA 4AFZA 2OQ5A 1W0ZU 3SU2A 5DO4H 1QTFA 1O2HA 4INKA 1F5LA 5F8TA 1GHAF 3P92A 2A7JA 2AYWA 1K21H 3SV6A 3SUGA 3ZVEA 1PPZA 1UTMA 4OS5A 4U01A 3ZZ8A 3MH5A 4VGCC 3UR9A 4CR5A 1QL7A 4FUCA 3V7TA 3RXJA 3A84A 1XVOA 3H7TA 2OXSA 1MUEB 2EI6A 1GWAA 2BQ6B 4ISHH 1YF4A 2VWLA 3QWCH 1O2IA 1TRNA 2B9LA 1K1PA 2PKAB 3LKWA 4O3TA 4UDWH 4B71A 1D3DB 1O35A 4Q7XA 5L2YH 1XUGA 3AAUA 4B73A 3ZVFA 1YPEH 1GMDF 3E8LA 1VCWA 5FX5A 2Y5GA 1XUIA 1GDQA 3M7UA 5LGOA 2VIDA 3HGPA 2SGFE 2H6MA 3Q3XA 3M3SA 3PB1E 2R0LA 1BTYA 1TMUH 1NC6A 1BMMH 3Q76A 4JK6A 3F9HA 3PWBA 3MI4A 1L4DA 1FY5A 2XYAA 3M37A 1SOTA 1Y8TA 4DVAU 1H9LB 1WQVH 4IN2A 3CP7A 4NA8A 3B9FH 4WMEA 2Y6TA 3E90B 3OY6U 4K60A 4ZROA 3UFAA 1C5UA 1O3JA 1J17T 2C8YB 5LPRA 2BLOA 4IMQA 3UNQA 1PYTD 1C1WH 3EE0B 3GCOA 1SBWA 3A7WA 3M5MA 4X1PU 3E0NB 1GJ5H 3LH1A 3A88A 2BZ6H 2Z3EA 1ZTKA 3TNSA 4X6NA 3RXGA 4B75A 1UHBB 2V6NA 1HJAC 2QXGA 2RDLA 1A5IA 1VJAU 3TH2H 3LGWA 2FMJA 1KIGH 4XOJA 4ZKSU 1C2GA 1BTZA 4I32A 4MDSA 1DM4B 4I8LA 2FODA 1ZTJA 1Y3WA 1P04A 1AQ7A 2D8WA 2NU2E 1AKSB 2ZI2H 2P8OB 1QB1A 2ZTZA 2EI7A 3LGTA 4UFFH 1ZOMA 2QCYA 1SMFE 1M9UA 2ZO3H 2GT8A 2ZKSA 3SGBE 3RLYH 3UIRA 1G2MA 1ELAA 2BY6X 4WY3A 2CN0H 1V2VT 1UJ1A 4Y0ZE 1P06A 4IC5A 5DPAA 2GD4B 1AE8H 1GBBA 2XXLA 1H1BA 1IQLA 1GHWH 1BTUA 2ZFFH 2O8UA 2QGRA 1O2YA 1AB9C 2TGAA 3MH4A 2FTLE 1LVOA 1NT1A 1KDQA 1JRTA 1AUJA 1SLXB 3SU6A 1W12U 1TIOA 4X6PA 4LK4A 2XBWA 1CSOE 1Z8GA 5EQQA 4THNH 1LQDB 1MKXK 2VNTA 2FOGA 3A80A 3SQEE 3VGCC 1S5SA 1T4VH 3PV4A 3FP8E 1YPJH 1GVLA 3KHVA 5DP9A 2FLRH 1Z6JH 3C1KA 3U8RH 1P2MA 1FONA 1BHXB 4YZUA 3OSYA 4CHAB 1IQNA 5K0HA 1P3EA 1EZUC 1CT4E 1PFXC 3UQOA 1XUJA 1S81A 1C1RA 1MZDA 3RXTA 1F7ZA 1FV9A 1RIWC 2FS8A 3I78A 1H8DH 1UVOA 2OBOA 2PUXB 1GBEA 1HRTH 1P2QA 1G37A 4ZKRU 2G81E 2A5IA 1VJ9U 1GBJA 1V2UT 3D62A 5J4QA 1C2EA 2A4QA 4LOYH 1QHRB 4AYYB 1AVGH 2AMPA 1RS0A 2CV3A 3BEFB 3PYHA 3BTTE 2J92A 2ZCHP 3RM2H 3TH4H 1KLTA 4GHTA 2H1UA 1QB6A 3LONA 4GCHF 1UK2A 3PTNA 4FU8A 2VWNA 7GCHF 1BMAA 2XCFA 3RXLA 2BD9A 1QURH 4XDEA 3VB6A 1T31A 4ZUHA 3QGJA 3TGKE 1DWCH 4JYVH 2ZF0H 4X2VA 2Z3CA 1N1LA 3MNSA 4MPXA 1OX1A 1RGQA 1MBMA 1Y3VA 4Y79A 4WMDA 6LPRA 1IAUA 2ODPA 5ESTE