4FVBA

Crystal structure of ev71 2a proteinase c110a mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SGAIYVGNFRVVNRHLATHNDWANLVWEDSSRDLLVSSTTAQGCDTIARCNCQTGVYYCNSRRKHYPVSFSKPSLIYVEASEYYPARYQSHLMLAQGHSEPGDAGGILRCQHGVVGIVSTGGNGLVGFADVRDLLWLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2A proteinase
publication title Conformational Plasticity of 2A Proteinase from Enterovirus 71
pubmed doi rcsb
source organism Human enterovirus 71
molecule tags Hydrolase
total genus 34
structure length 138
sequence length 138
ec nomenclature ec 3.4.22.29: Picornain 2A.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00947 Pico_P2A Picornavirus core protein 2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fvbA01
1MZDA 4X2YA 1GBTA 1E34B 3I29A 1DUEA 2A1DB 1AE5A 5GCHF 1VCQA 3FP7E 3ODFA 1HIAB 2ZQ2A 5L2ZH 3VGCB 4BTIB 5ESTE 1BTHH 1HB0B 4CRAA 4D76A 2ZHWH 4MPXA 5F8TA 1QR3E 4GCHG 3SU5A 1GHXH 1U6QA 2FM2A 1OP8A 1GVZA 4LXBH 2PWXA 4BAHB 5HM2A 5E0HA 1O5DH 1O2SA 3UUZA 1JMOH 2LPRA 1BRAA 6ESTA 6CHAC 1GJ4H 1BB0B 5K0HA 1GJ7B 1OYTH 5DP9A 1YGCH 4R8TB 2W5EA 1GBJA 1MMJN 1C9PA 1TRNA 1H9IE 3TNTA 1LVBA 2B8OH 1KTTB 1QURH 5EGMA 1LO6A 3BG4B 1CE5A 4FU9A 3E90B 7GCHF 5LH8A 1C2KA 2P8OB 3KEEA 2OP9A 2PUQH 4YT6H 1EAUA 1MBQA 9LPRA 1C2EA 4JCNA 4YZUA 1C5PA 1EOLA 3RXFA 1XVOA 3F9HA 1G3CA 1MKXK 1UHBB 2HWLB 1ESTA 3HGNA 4KTSA 3SUGA 2BY8X 1GL0E 1DLEA 1C5LH 3LGYA 4ABDA 4Y0ZE 1O2VA 3D65E 1TAWA 4I7YH 3ITIA 3GCHC 4WH6A 4Y11E 1CHOF 1ELVA 3RMLH 1G2LA 1P2MA 4FUGA 2A32A 2V3OH 1EUFA 3MU4A 5JBTA 3FVFB 3HK3B 2HNTE 4MDSA 2J38A 1OWJA 1V2TT 1A3EH 1AVXA 4D7FA 3M35A 4DW2U 2BLQA 1K28D 1G3DA 2ILNA 1DX5M 2GCTC 1NRRH 1QA7A 4NFEA 2XRCA 2WINI 3TJUA 2P93A 4Y71A 2WPLS 3LOXA 2FOHA 2WV5A 3EA8A 1C2LA 1OWEA 1UTLM 2LNCA 1GG6C 3T2NA 4ZXXH 1EX3A 1KY9A 2FZZA 3FP8E 2ZWLH 2TGAA 3V13A 4BTUB 1ARBA 3TK6A 3RXGA 2PSYA 2TIOA 1TLDA 1S85A 1ZMLA 1XUGA 1NRSH 4MPVA 2BHGA 1GJ9B 3VB3A 1OP0A 2O8TA 4IS5A 2V3HH 3E0PB 1BOQA 3MH7A 2BDAA 3TIUA 2Z9KA 4ZKNU 2VIQA 3SBKA 1GPZA 2CV3A 1N6YA 4KELA 1WTHD 4YOIA 1KLTA 4HI3A 5ABWA 1LQEA 3A83A 4B75A 1ELDE 1HDTH 4X2VA 4XE4A 3T62A 3N7OA 2G5NA 2OINA 3SV2H 1EB1H 5L6NH 1NESE 1EPTC 3SV8A 2VIDA 1O5CB 2BXTH 2BTCE 2BXUH 1C5YB 3GICB 1QL9A 2SGPE 1SMFE 3ZVBA 5A0CA 2Y82A 2F9UA 1UCYH 2XTTB 4HTCH 1GHAF 1C5XB 1GVKB 1TRYA 4Q7YA 1SGPE 4Y6DA 3RP2A 1O2OA 1QB9A 1NFYA 3VPKA 3Q00A 4AZ2B 3LDXH 1O2KA 2BY9X 3S9AA 4A7IB 2R0KA 1AKSB 2Z9JA 2HGTH 2J34A 3P70B 3MU5A 1GBFA 4D7GA 3HPTB 4FVDA 4I32A 3ZZ6A 3LIWA 1AY6H 3MH4A 3K65B 1O3JA 2BD2A 2Y6TA 1GCDA 1NC6A 1P2NA 2CGAA 3VXEH 2A5AA 2EEKA 1SGIB 3O8CA 2RA3A 1O36A 3Q77A 5I46H 1C5MD 4MG3A 4ABBA 1S5SA 1UVPA 3F9GA 5GXPA 2CJIA 3TPIZ 2ODPA 1GBKA 2PR3A 1CSOE 1TRMA 3RXSA 1OKXA 3DT0H 1UK4A 1O5EH 1NS3A 3CP7A 3SGBE 4INKA 1BUIA 1TQ0B 4UFDH 2CMYA 1EJNA 5F03A 3A7YA 1GI6A 1QL8A 5EODA 2DE9A 1FY8E 3A8DA 3MHWU 1EAXA 1K1IA 4ABHA 3M3VA 4K1SA 2W26A 4NSYA 1A5IA 2O9QA 2ZIQH 4WMEA 2ZGCA 1LCYA 2EI7A 3SZNA 2BVRH 5LGOA 2XCNA 2CF8H 1MU6B 1V2JT 1C1OA 1OX1A 1E35B 5A8YA 2G51A 2JETC 1HJAC 1UK3A 2FEQH 3D23A 1SB1H 4QT8C 3S9CA 4OS7A 3BTFE 3W95A 5EQSA 1J17T 3SU0A 3ODDA 1HAZB 3ZZ7A 4O9VA 3SUFA 3WY8A 3QK1A 4HFPB 1O3DA 4UONA 1UTQA 1V2KT 5B6OA 2SGQE 1C1NA 2HNTF 3KQEA 3M5LA 5FBIA 1GI9B 2NU2E 2VWLA 2FO9A 1J9CH 1E38B 1YPGH 4Y7AA 3ZVAA 2KAIB 1NRNH 4ABEA 1ESBA 1X7AC 1TX7A 4ESTE 3A8CA 2Z3EA 2AMDA 1AWHB 1F7ZA 2NU3E 3PLKA 4WMFA 3GDUA 1AB9B 2P8OC 4B2AA 1T31A 1TONA 2OLGA 3FZZA 4MQAA 5GWZA 2P59A 1VITG 4AGJA 1C1RA 2GT8A 4D9RA 2BZAA 3QTVH 1TB6H 1O2JA 4Q7ZA 1LVOA 3CS0A 1O33A 3SGAE 4BANB 4U32A 4OGXA 2A5IA 4PROA 2ZU5A 1FMGA 3LGVA 2VVUA 5FPTA 1MTVA 1F0SA 3MU1A 4CH8B 1AZ8A 2CF9H 3T25A 2AGEX 1NRPH 1XUKA 2ANMH 3SJKA 3ZYDA 1W0ZU 2TRMA 4WF8A 2UUYA 1HAOH 3KGPA 1F0RA 4X8UH 3QUMP 2AGIX 4XOJA 2GV6A 1ELFA 1S81A 1GCTB 4J2YB 3TK5A 2EC9H 4DURA 1UHBA 1SQAA 3ZV8A 4UFGH 1TPAE 2VIPA 4CRGA 3UTUH 1TABE 1W8BH 1SOTA 5EQQA 1WV7H 3BTME 3LU9B 3SNDA 1Y5UT 1FY4A 1DXPA 4UEHH 2ZPRA 3E0NB 4X1PU 4RKOB 1AVGH 3CENA 2Y7ZA 1YP9A 1MCVA 2GKVE 2D8WA 1S6FA 1D4PB 4X6MA 1VITF 1SGNE 3MTYA 1EP6A 2Y81A 4F4OC 1GHBG 3GY8A 1O2GH 2PTCE 3RXAA 1PQ7A 3EAJA 4K60A 1CGJE 2BZ6H 3RC4A 2GV7A 2GTBA 2QC2A 1GDQA 3HK6B 4IN2A 2BD8A 1AHTH 1QJ1B 1P03A 1O5FH 1WQSA 1NZQH 1DT2A 2ESTE 1V2PT 3STIA 2BOHB 3MNXA 4WH8A 1BITA 2BQWB 1RIWC 2Z9IA 3GY2A 3E1XB 5GPIB 1QRWA 4AGKA 3D62A 4WVPE 4ZMAH 1UO6A 4INHA 3TH2H 2G8TA 4X6OA 2WPJS 8LPRA 2PKAA 2EA3A 3I78A 5CHAC 4TWYA 3A85A 2BY6X 3LKWA 1GI8B 2VJ1A 4AOQA 1G32B 4JZFH 3SU2A 5C3NA 2ZGXH 1EZUC 3T29A 4NCYA 6GCHF 4MLFB 2ALPA 1P57B 2FTLE 1FV9A 2PGQB 4ISHH 3Q3YA 3SQEE 1UJ1A 2FESH 1QRZA 1V2VT 1BTXA 1YYY1 2ZTZA 4BNRA 3LGTA 4BXWA 1YF4A 2F9PA 3KQDA 4BAOB 2BVSH 2QXHA 4FUIA 1K2I1 1ACBE 2XBVA 3LJOA 1PPHE 2ZU4A 1V2OT 1O35A 3QN7A 4ZAEA 3TGKE 1GBCA 2H1UA 2Z6BD 4NWLA 3TNSA 5GIBA 1EZXC 1P3CA 1Z6JH 3UNSA 3A7TA 1SGYE 1O2WA 1HFDA 2G00A 2HVXA 1S83A 1J16A 2VH6A 3SJOA 3A8BA 1VITH 9ESTA 1N8OB 3GCTF 1NPMA 2WPKS 3M3TA 3UNQA 3QZRA 4DIHH 2FLBH 4I8LA 3SORA 3OY5U 3RC6A 1QIXB 2AERH 3T27A 1GHWH 2H5DA 2GT7A 2IN2A 4CBOA 1O3MA 3A80A 2BLOA 4UD9H 1ZHRA 2JH6D 3AW1A 2A45B 3V3MA 4E06H 3BG8A 4DGJA 2ZDAH 1MKXH 1SHHB 2ZZUH 3UREA 4FUBA 2R2WU 5LPRA 3V7TA 1V2NT 1JBUH 3AAVA 4GHTA 5GCHG 1HUTH 4Y10E 2JKHA 2ZGJA 4Y79A 4DG4A 5F8XA 5DP5A 1V2QT 2H9EH 4NA8A 4YT7H 3H5CB 1C5RA 1D3PB 1GI1A 1DPOA 3CS7A 2VGCB 5DJ7A 1CVWH 4UFEH 1PPGE 5DPAA 5AFYH 1THPB 1EB2A 3RUOA 1F2SE 1SPJA 4LK4A 2WPIS 1O3CA 1ZJKA 1TGNA 1WQVH 1LVMA 1MH0A 1FZZA 4AYYB 5JDUB 1PPCE 1QJ6B 5EOKA 1G9IE 1G3EA 1BJVA 3KF2A 2OQUA 3PWCA 4JK5A 5FPSA 1O3NA 2PGBB 3FAOA 4ABFA 1L2EA 1M9UA 1O3FA 1DWBH 3ZYEA 1SOZA 3MO9A 1JIRA 3TJVA 2Y5GA 4H6SB 4ABGA 3P6ZB 1A7SA 4CR5A 3PYHA 1O0DH 4FUEA 4ISNA 1A0JA 2GCHF 1NFUA 3EE0B 2ANYA 3IITA 1O2LA 2H6MA 1GMDF 1TGTA 1HAPH 4XFQA 2ZFTA 7GCHG 3SNEA 3FZDA 2ZTYA 3K2UA 2VH0A 2GZ7A 2ZCHP 1TMTH 5DP3A 3V12A 3ATLA 2FTMA 3M36A 3A7ZA 2BMGB 2GDDA 1AFQB 1T8MA 2XYAA 2ZKSA 1FAKH 1WAYB 4A1XA 1TNHA 1K1LA 1ELGA 3F68H 1JOUB 1A5HA 1FPCH 1PPZA 1VZQH 5T6GA 1HCGA 1EKBB 3RM2H 1SVPA 3OY6U 4BAMB 1UVSH 1TGSZ 3IWMA 1CHOG 3RXTA 1THRH 4BAQB 3BV9B 1HYLA 4Q80A 2QCYA 3E16B 4FU7A 4K69A 4Y7BA 4A92A 3EA9A 2V35A 1MUEB 3RLWH 5JBCS 1P04A 2ZG0H 3O8BA 5FBEA 2SGEE 1OYQA 2FWWA 2J2UA 4WJG2 2BDBA 1HBTH 3DUXH 2AFQB 4E7RG 1ETTH 1GHVH 2BLWA 4K1EA 1C9TA 1BTYA 3PO1C 5T6DA 1MD8A 3UQOA 3RXKA 2DUCA 1WOFA 1QQUA 5AVDA 3SI3H 3QWCH 3RXVA 3LGWA 3LGUA 2F91A 4IMZA 1KXDA 1BMNH 3MI4A 4O03A 2BD3A 1GHYH 1O5GH 2GMTC 1D3QB 3AASA 1DLKB 2H2ZA 3NCLA 2O8WA 3RXPA 3M5OA 4GUXA 1WBGB 4K5ZA 3E6PH 3P8OA 5A0AE 4FUDA 1W0YH 1ZMNA 3RXDA 1ZSLA 1NN6A 1BTZA 1S84A 4K1TA 4Y8YA 4MNXA 4HGCA 2AMQA 1ZPZA 3RXIA 3MYWA 1Z1JA 1ANCA 1NM6A 1NRQH 3U1JB 3BTDE 1SGEE 2ZC9H 3ZVCA 1O3IA 5EXLA 3A7VA 2F9NA 1NT1A 4ABIA 1TFXA 2BYAX 3M7QA 1EXFA 1AU8A 1PYTD 4JYTA 8GCHF 4GSOA 1BBRK 4WY3A 2TBSA 2BX4A 1UVUH 1GMCG 1T32A 1ESAA 1GHAG 2PTNA 2HPPH 1GBMA 3LPRA 4F49A 1ZPBA 5IYTA 2C8YB 1SQTA 1P12E 3LJJA 1GDUA 1O2NA 5EPYA 2QGRA 1GJBB 1HLTH 3BIVH 2CHAB 1TPOA 2VVVA 2WUBA 1CT4E 4AX9H 1L1JA 4R0IA 1GBIA 4AB8A 2GDEH 3SOSA 5EW2H 1LQDB 4I8HA 3NZIA 2ZF0H 3BN9A 1OOKB 1AD8H 3ZZAA 1JXPA 2YNBA 3P92A 1K21H 1P06A 4ABAA 2PKAB 5JBBS 4YM9A 1TQ7B 3ATKA 2VNTA 2O8LA 1Z7KA 1FQ3A 1YPHE 4NSVA 4WMDA 5EW1H 1AFEH 2AGGX 3S7HB 1Q31A 1UTOA 3PMJA 2XCFA 2GX4A 4HZHA 4BOHA 1O3OA 1HRTH 4ASHA 4JMYA 2R3YA 2BB4A 2FOFA 2I6QA 1AN1E 2D1JA 1D3DB 1O2ZA 1XUIA 3UQVA 2FODA 2YNAA 1GI2A 3VXFH 2FYQA 1WTGH 1GMCF 4CHAC 1O39A 4AFZA 2A4QA 3MU8A 4MTBA 4YOGA 3ZZBA 2R0LA 4BXSA 2A7CA 1XUHA 3AVZA 2XW9A 4UFFH 4LZ1H 1AE8H 1QQ4A 1LHEH 1L0ZA 1LPZB 1C1WH 1KXAA 1C1PA 1CA8B 1HAHH 2ZFSA 2BD4A 5DG6A 1EZQA 4WXVA 1OWIA 1ZLRA 3T28A 2XBWA 1KYNA 2H5CA 2XWBI 3DFJA 1IQHA 5EPNA 1QBVH 5ESBA 3KCGH 2O8MA 2G4TA 1S0QA 2BY5X 2ZECA 4D8NA 2P3FH 4OS4A 2C8XB 1XX9A 3GY6A 1GJDB 3AW0A 1DOJA 4DIIH 1ORFA 2XBYA 1QFKH 3QX5H 1TA2A 2XC5A 1MKWK 1J14A 4KTUA 2QN5T 3GDVA 5LPEA 1H8DH 3RXRA 2O8UA 3EQ0H 3OTJE 1AVWA 3BF6H 1O2TA 1W2KH 2ALVA 1EAWA 3PM3A 3OSYA 4NGAH 1IQIA 4Z0KA 3F9FA 3S0NA 1BBRE 2YOLA 1JIMA 1VJAU 1HAIH 3KIDU 3ATIA 2C8ZB 3ATMA 1YKTA 3VGCC 2ZDVH 4DT7B 1LPKB 1FUJA 1BMMH 1P01A 2W3IA 2PW8H 1JRSA 1ARCA 1TNGA 3U8RH 3RXLA 1EAIA 2BOKA 3MNBA 4CH2B 3QTOH 3O8DA 3UOUA 2ZQ1A 1HAVA 3B23B 2TPIZ 1CA0B 3LONA 1HXEH 2A2XH 1IQKA 2BQ7B 4E05H 1P2KA 1WU1A 3RU4D 1MTSA 3A8AA 2OC1A 1T8NA 1ETSH 5FX5A 1SLUB 1DY9A 2BX3A 1YCPM 1Z6EA 5T3HA 5C1UA 1H4WA 1O5BB 4ZUHA 3URDA 1GJCB 1Z8JB 3MU0A 1A5GH 1RRKA 3BTTE 2ZHQH 3MNCA 4H6TA 4IBLH 2W7SA 1OXGA 5E2PA 2XC4A 5PTPA 4CREA 3GY7A 3BG4C 3PB1E 5JBAS 1SBWA 1DS2E 3RDZA 1C1TA 2OXSA 4YLQH 3T26A 3ZZDA 4U2WA 1GBAA 4RN6A 3VB7A 2ZDMA 4AYVB 1B7XB 2R9PA 4YOJA 2GVFA 2F3CE 1MTUA 4B76A 1ZZZA 1D6RA 4JZDH 3TITA 1O37A 4OS6A 3D49H 1PPBH 2VINA 5FCKA 3H7TA 4ZKOU 1T4UH 2JH5D 1ZMJA 2PKSB 1C5NH 1EJAA 1K9OE 1NU7B 1XVMA 3PTNA 2ZHDA 2ZDKA 4UE7H 4X6NA 3ESTA 2ODYB 1O2XA 1UTJA 1CBWB 3FANA 4NZQA 3T5FH 1RGQA 1CU1A 2OUAA 1GGDB 2F9BH 4FUFA 4NIYA 1C5SA 1QNJA 1MAXA 1SGFA 1O30A 1TX6A 1LVYA 2BVXH 1YLCA 4B71A 3RMOH 3NUMA 3ZZ4A 4K8BA 1YCPK 1AMHA 1SGQE 5T6FA 2CHAC 1IQGA 1C5UA 1O2YA 1D9IA 2FOGA 3FP6E 2K1QA 4NIVA 3U69H 2OD3B 6GCHG 4ZHLU 3DD2H 1Y3WA 5FXLA 1IQEA 1PPFE 1PPEE 1KXCA 4A5TS 5EXMA 2OC7A 4FXGH 5E2OA 2BLVA 1GJ5H 3RXBA 1CQQA 2QIQA 1ZJDA 1XUFA 3BSQA 1LMWB 4I8KA 3QGJA 1TNLA 2QYIA 3A89A 1VGCB 3ENSB 3M5NA 5TCAA 3L33A 2CXVA 1RTLA 2OC8A 4IW4E 2F9VA 1BMLA 1T4VH 1O3BA 4I31A 3UY9A 3SN8A 1AO5A 1P11E 4J1YA 1O3HA 6CHAB 1TALA 1ZHMA 2NWNA 2FOCA 4TWWA 1FDPA 7ESTE 1O3KA 3M3SA 2XBXA 4OS2A 4JZIA 1PQ5A 4K3JA 1L4DA 1TE0A 1A0LA 2SNVA 2WUCA 2ZDLA 3GCTG 3RMMH 3TH3H 1LPGB 3SJ8A 4I8GA 1TGBA 4SGAE 4NG9H 2P3UB 1JRTA 3M7TA 2Y80A 3A7XA 1NU9A 1DICA 3E3TA 4OS1A 1SG8B 2ZFPH 3ZZ9A 2Y7XA 1GI7B 3B9FH 1W10U 2OBOA 4U01A 1V2ST 1RTKA 3FFGA 4TPIZ 2C3SA 1HAXB 5DGJA 1OPHB 2SGAA 1TMBH 5FPYA 3KQBA 1MD7A 1C2DA 5A8XA 1Y3YA 4H42U 2FX4A 5AF9H 1GJ6A 4OS5A 3VB5A 1L4ZA 3HKIB 1AIXH 4ISLA 2A4OA 1F5LA 1DANH 2VIVA 3P8NA 2ZNKH 5AHGH 1HNEE 1PJPA 1QY6A 3E8LA 5EU8A 1V2MT 1LTOA 1C5QA 3PROA 2ZEBA 3SUDA 1QTFA 2ZFRH 1C2FA 1V3XA 4JZEH 3B8JA 4SGBE 5K7RA 2VWOA 3RXEA 5A09A 1UVTH 2ZFQH 2BQ6B 1GG6B 2SNWA 1UTMA 4Y8ZA 4X2XA 1C5OH 4IGDA 3SJ9A 5CMXH 3RXCA 1K1JA 1W11U 5DP8A 1KTSB 1UTKA 2IOTA 2ZO3H 2GZ8A 1W13U 2ZU2A 4XBDA 3U8OH 1O5AB 3K6ZA 4AB9A 1O3LA 2GCHG 3F1SB 3IG6B 2TGDA 1VR1H 4GVUA 1GMDG 1O3AA 1W3CA 3GCNA 4KTCA 5DK1A 2V0BA 1G30B 1SLVB 3SGQE 1RJXB 3MNSA 3RXMA 2ANWA 1EZSC 1ELEE 5F6MA 3QGNB 5C2ZA 3BTKE 5G4BA 1WYKA 2P94A 1LHDH 3F9EA 1E0FD 1UK2A 2HNTC 4NFFA 4I33A 4FUHA 2WYGA 3BIUH 8KME2 4LOYH 1KDQA 4ZH8A 4WXIA 3RU4E 3ZZ8A 3SJIA 3LT3A 1W7GH 3MH5A 1MCTA 2FOEA 2FS9A 1Y59T 1XKAC 1VJ9U 3LGIA 1G2MA 1AB9C 1KIGH 1INCA 2A31A 3GYMA 1BMAA 4NIWA 1TBZH 1FY1A 1FN6A 3RXQA 1AUTC 2Q6DA 2QF0A 3SHAH 1YC0A 2AS9A 2ZU3A 1XMNB 3NPSA 5A0BA 1ETRH 1ZPCA 5A2MH 2A7HA 4TY7A 1MU8B 2PKSC 3MO6A 3DA9B 1IQJA 5HMAA 1HAVB 2ASUB 3LH1A 2AH4X 1ZGIA 1B0FA 3SU4A 1PQ8A 4A6LA 1MZAA 3C1KA 1SGDE 3F6UH 3ZVEA 1GCTC 5BRRE 2BDHA 1C5VA 2FOMB 1SGFG 2ODQA 2XXLA 2GD4B 3UWIA 4AG2A 4DJZB 1H9LB 5C67A 2GP9B 1W14U 2TGPZ 1HPGA 1C1UH 1ANDA 4TY6A 1TOMH 2ZU1A 1FN8A 2J94A 3EA7A 2RG3A 1KSNA 1O3EA 1J15A 1YPKH 2VU8E 8GCHG 1S0RA 4X1RU 5EXNA 5I25A 4CBNA 1THSH 3STJA 3TLOA 3RC5A 2C90B 3OX7U 1XXFA 3TGJE 7KMEH 2QXJA 3TU7H 1A2CH 1W7XH 4X1NU 1F0TA 1P02A 1C2IA 1TPPA 3JZ2B 2FI4E 1HAYB 3A84A 1OWHA 2G4UA 1GI5A 1AI8H 2JETB 1V2UT 2Z3DA 1HJAB 1VGCC 1C2GA 4ZXYH 4TPYA 1O2QA 4GPGA 1ZOMA 3KN2A 5C20A 2A5KA 2HRVA 1O2HA 1F0UA 4Y8XA 1P2JA 2SGDE 2NU4E 2ZTXA 1HJ9A 1ZTLA 1A3BH 2UUFB 3NK8A 2AYWA 1FAXA 3SNCA 1OWDA 2FS8A 4B1TA 1TNKA 2ZI2H 1K1MA 2C8WB 1SSXA 3BEFB 1MKWH 2I6SA 1D6WA 4XSKU 3R3GB 2B7DH 1GBBA 1IOEA 2DE8A 1MQ6A 3ELAH 1C5TA 1P05A 1W12U 1SGTA 3VEQB 3DHKH 3SUEA 1SGRE 2WYJA 1BHXB 4ZROA 1O3PB 4MPUA 3MO3A 3NWUA 2J92A 3RU4T 1BTUA 2WPHS 1BHXF 5E0GA 3RXJA 1YPMH 4JYVH 4H4FA 5H4IB 1TMUH 1QB1A 3UFAA 3OU0A 3L6PA 4TYDA 2ZP0H 3EYDA 1IHTH 1P9SA 3A87A 1LHCH 2FI3E 1EASA 2STAE 4GCHF 3PLBA 2RDLA 1V2WT 1O2RA 2QV1A 4MVNA 1ZSKA 1Y5BT 1SQOA 1SI5H 2BDGA 3SO3A 2CN0H 2P3TB 4I8JA 1V2RT 3MH6A 2PHBA 4NIXA 1AQ7A 5L2YH 2A2QH 4AFUA 1IQLA 3K9XB 1O2IA 2W3KA 2M5TA 2P95A 1E36B 2HLCA 3OYPA 2PV9B 1N8OC 1GBEA 2BM2A 1HGTH 1BRUP 3GCOA 3PMHB 1T8LA 1NTPA 1B0EA 5HXFA 5JB9S 2QXIA 6LPRA 1MBMA 2QXGA 2RCEA 3UNRA 3SV6A 1T7CA 3SU3A 1LHFH 3ZZ3A 5TJXA 2BD9A 1FIWA 1C1VH 1P2QA 3BTWE 3U98H 2A4GA 3NXPA 3UR6A 1YPJH 1HV7A 3Q3KA 1GVLA 2BDIA 2ZCKP 1ELAA 1Y3XA 1OS8A 2QF3A 1MTWA 3U1IB 4UDWH 3ATWA 2G5VA 1BIOA 5JPMH 4MNWA 2AIQA 3Q3XA 2QY0B 1P3EA 1DDJA 3QZQA 4Y76A 3VFEA 1GDNA 5EQRA 4O3UA 2VVCA 3GY5A 1A61H 3RMNH 1HXFH 2A7JA 1BRBE 2VGCC 5E0JA 1RIWB 1SC8U 3PLPA 1SL3A 4K2YA 2R2MB 1ABJH 3LH3A 1Y5AT 1FJSA 1C4Y2 4KGAA 2FXRA 2VIWA 4B74A 4WWYA 3SQHE 5ETXA 1BDAA 1PYTC 3UPEA 4X2WA 4E7NA 5CHAB 2G55A 4CR9A 1TGCA 3NKKA 3RM0H 1G37A 2C4FH 1BTPA 1WUNH 1ANEA 1MQ5A 1YCPH 3P17H 1QCPA 5E8EH 3U9AH 3QO6A 1EJMA 2FOAA 2JH0D 1DUAA 4GHQA 3TH4H 4AFSA 1BRCE 1QGFA 4AN7A 3AAUA 3BTGE 2UUJB 4AG1A 1UVOA 1EPTA 1B5GH 1JWTA 5C5NA 2VWNA 1K1PA 3SV9A 1MTNB 3A82A 4AFQA 1O38A 4U30A 2QA9E 5L30H 1Z71A 3I77A 4GAWA 1GBDA 5DKMA 1A4WH 4CRDA 2OC0A 1DITH 2Z9GA 2B0FA 4VGCB 1ZTKA 5JYIA 4K8YA 3ZVGA 2ULLA 4RSPA 4X0WU 4YO9A 3UWJH 5A8ZA 2J95A 4NWKA 2FX6A 3P8FA 1YBWA 1C1SA 1SR5C 1ELBA 2XWAA 1FLEE 3GISB 1AFQC 1GHZA 1KDQB 5J4QA 5FCRA 3ZZCA 2W7UA 1HJ8A 3GDSA 5FHTA 1VCWA 2NU0E 1ZSJA 2J4IA 2HALA 1NROH 4IMQA 5SGAE 1GI4A 1TX8A 2IJOB 1EQ9A 4DCDA 4DVAU 3HGPA 4INLA 1BCUH 2BY7X 4M7GA 1QJ7B 2R3UA 3G01A 4YLUA 1IQNA 2THFB 4YTAA 3PTBA 4KKDA 1ID5H 3PWBA 2UWOA 1PFXC 1RD3B 4JYUH 3BTQE 2D26C 3VB6A 1TIOA 3SNBA 1CHGA 2FP7B 3PV4A 1A1RA 3ZVDA 3O8RA 1C1QA 2GZ9A 2ZGBH 1DWEH 1N6XA 2TGTA 1FPHH 2FPZA 1A46H 3M37A 2XC0A 4D9QA 1BQYA 1LDTT 2FIRH 1Z8RA 4Z6AH 2BDCA 1LHGH 1O31A 1P9UA 1WCZA 1O32A 1SHYA 2GGVB 1IAUA 2A4RA 1YPEH 1C4U2 3K6YA 1HIAA 3S69A 2AEIH 3M5MA 4IC5A 1DWDH 2BD5A 3PMAB 4ISOA 4X8VH 1ELTA 1Q2WA 2F83A 1NY22 2ZPSA 4KP0A 4A1VA 1F92A 3A81A 3EDXB 4ZKSU 3ZV9A 1GI3A 1SGCA 1YLDA 3C27B 2ZDNA 4FUJA 1KLJH 4JK6A 4NA9H 1QRXA 1Z1IA 4ZKRU 4CRFA 1TNIA 1UCYK 2OBQA 2WPMS 1IQMA 1P09A 1XKBC 2Z7FE 1Q3XA 1Y3UA 5DP4A 1IHSH 5DP6A 3UR9A 3BTHE 3JZ1B 1ZR0A 1DM4B 1CGHA 1P0SH 2B5TB 2PSXA 1DY8A 1ZRBA 3UOPA 1TBRH 1A0HB 2VIOA 1BTWA 3LC3A 1P2IA 4LZ4B 4RKJB 4NA7A 2C93B 3S7KB 3BTEE 5EG4A 2IPHA 1ZRKA 2H9TH 3EGKH 1SFIA 1FXYA 3Q76A 4JZ1A 5FAHA 1QBNA 1K1OA 1UMAH 3GY4A 1H1BA 3VB4A 2ZPQA 4ISIH 3LC5A 1C2HA 2EI6A 5HGGA 1OWKA 2FMJA 2OTVA 1C4V2 1C1MA 3RXOA 1C2MA 4A1TA 2QAAA 2BD7A 1P10A 2AMPA 4B73A 5CE1A 1YM0A 1BA8B 2B9LA 1GBLA 1V6DA 1NO9H 2HOBA 1DFPA 3PO1B 2J9NA 1ZTJA 1GJAB 2NU1E 4ABJA 3RXUA 2AIPA 4X1SU 2ANKH 3ZZ5A 3HATH 1HAGE 1OSSA 1DSTA 1P8VC 2H9HA 3E91A 4BTTB 2OCVB 2GMTB 5DP7A 1OP2A 2A0QB 5IDKA 3URCA 3MFJA 1O3GA 3SU6A 1C5ZB 1V2LT 2Q1JA 1ZHPA 1E37B 1O2PA 3SW2B 2UUKB 1LKAA 2ZHFH 3MOCA 4FU8A 4IN1A 2D2DA 4X8TH 1Z8GA 2SFAA 1SLXB 1CT2E 1L1GA 5J4SA 3GCHB 2Q6FA 1RTFB 1SLWB 1SFQB 2WV4A 1RS0A 1GBHA 4Q7XA 1Z8IB 1S6HA 2BDYA 2F9OA 1H8IH 1XM1A 3QLPH 1AWFH 3W94A 1RXPA 5C1XA 2RA0A 1DSUA 1MTNC 1L1NA 1G36A 2Z3CA 1Y3VA 5F8ZA 4GLYA 1AUJA 2GCTB 1KXFA 2UWLA 4THNH 3M61U 3TVJB 1GMHG 1Y8TA 3SI4H 1D3TB 1KXBA 3M7UA 3KQCA 1ELCA 3HKJB 1GHBF 5LPFA 1FIZA 3GYLB 2ZCLP 4VGCC 1MAYA 1ZYOA 1C2JA 1UTPA 3A86A 4O3TA 4X6PA 1G3BA 1T8OA 2FI5E 3RXHA 1UCYE 2ZGHA 3BEUA 4MPWA 2FOBA 3P95A 4X1QU 4B2CA 1GJ8B 4ZHAA 2P16A 4NZLA 1EATA 3MMGA 7LPRA 1DVAH 1K1NA 1P2OA 1FI8A 4XBBA 4Q2KA 3TK9A 1AKSA 2V6NA 3SV7A 2VWMA 3ZVFA 1BT7A 4XBCA 4ZHMU 4B2BA 3L3TA 1KXEA 3GY3A 1XUJA 3RLYH 5JB8S 2Y5FA 1FY5A 1GL1A 1TWXB 2FLRH 1GI0A 3UIRA 1CA0C 1VCPA 3TJOA 4OGYA 1TNJA 2G81E 2Y5HA 3KNXA 2STBE 1FONA 1IQFA 3TJNA 2EI8A 1WSSH 1DE7H 3QDZB 3A7WA 4BAKB 1EPTB 1N1LA 2Z94A 1TOCB 1CGIE 3SU1A 2PLXA 4MNYA 1K22H 3S9BA 1ABIH 2FYRA 1RFNA 1TBQH 1XXDA 5C5OA 2Q6GA 1BBRH 1DWCH 4CHAB 8ESTE 4CRCA 2UWPA 4Y0YE 3U8TH 2ZHEH 5FX6A 1GMHF 3SHCH 1O2UA 1GWAA 2XNIA 1EP5A 1NFWA 2Z9LA 1UTNA 1LKBA 4IC6A 1BJUA 1TYNA 1S82A 2ZFFH 5GDSH 3KHVA 1CT0E 2PUXB 5HYOA 3H7OA 1O34A 1TA6A 4CRBA 2FDAA 1O2MA 3SNAA 3V0XA 4XDEA 1AZZA 2VB0A 4X8SH 1QL7A 4DY7B 1FY3A 3A88A 2OQ5A 3DFLA 1ANBA 4O97A 1QA0A 3PMBB 1PQAA 3MWIU 1YPHC 3KL6A 2SGFE 2ZA5A 3BEIB 2HPQH 3P8GA 4YESB 3R0FA 1DXWA 2G52A 1F5KU 1CBWC 5C1YA 1ZGVA 5AFZH 5GJ4B 1F5RA 1C5WB 1TPSA 5TCCA 1BZXE 4DOQA 1GGDC 1QBOA 1H9HE 1FNIA 4FVBA 2PFEA 1KLIH 5HM9A 1EOJA 1J8AA 4FUCA 1AGJA 4AORA 1QHRB 5BPEA 3TGIE 4MNVA 1NFXA 2KAIA 5DO4H 1QB6A 1CO7E 3GOVB 1YPLH
chains in the Genus database with same CATH superfamily
1MZDA 4X2YA 1GBTA 1E34B 3I29A 1DUEA 2A1DB 1AE5A 5GCHF 1VCQA 2F4LA 3FP7E 3ODFA 1HIAB 2ZQ2A 3PV2A 5L2ZH 3VGCB 4BTIB 5ESTE 1BTHH 1HB0B 4CRAA 4M9FA 2ZHWH 4D76A 4MPXA 5F8TA 1QR3E 4GCHG 3SU5A 1GHXH 1U6QA 2FM2A 1OP8A 1GVZA 4LXBH 2PWXA 4BAHB 5HM2A 5E0HA 3UAIC 1O5DH 1O2SA 4AC9A 3UUZA 1JMOH 2LPRA 1BRAA 6ESTA 6CHAC 3SZEA 1GJ4H 2J98A 1BB0B 1E79D 5K0HA 1GJ7B 1OYTH 5DP9A 1YGCH 4R8TB 2W5EA 1GBJA 1WXRA 1MMJN 1C9PA 1TRNA 1H9IE 3TNTA 1LVBA 2B8OH 1KTTB 1QURH 5EGMA 1LO6A 3BG4B 1CE5A 4FU9A 3E90B 7GCHF 5LH8A 1C2KA 2P8OB 3KEEA 2OP9A 2PUQH 4YT6H 1EAUA 1MBQA 9LPRA 1C2EA 4JCNA 4YZUA 1C5PA 1EOLA 3RXFA 1XVOA 3F9HA 2LELA 1G3CA 1MKXK 1UHBB 2HWLB 1ESTA 3HGNA 4KTSA 3SUGA 2BY8X 1GL0E 1DLEA 1C5LH 2KZ4A 3LGYA 4ABDA 4Y0ZE 1O2VA 3D65E 1TAWA 4I7YH 3ITIA 3GCHC 4WH6A 4Y11E 1CHOF 1ELVA 3RMLH 1G2LA 2K8IA 1P2MA 4FUGA 2A32A 2V3OH 1EUFA 1MABB 3MU4A 5JBTA 3FVFB 3HK3B 2HNTE 4MDSA 2J38A 1OWJA 1V2TT 1A3EH 1AVXA 4D7FA 3M35A 4B6FA 2BLQA 4DW2U 1K28D 1G3DA 2ILNA 1DX5M 2GCTC 1NRRH 1QA7A 4NFEA 2XRCA 2WINI 3TJUA 2P93A 4Y71A 1COWD 2WPLS 3LOXA 2FOHA 2WV5A 2KCYA 3EA8A 1C2LA 1OWEA 1UTLM 2LNCA 1GG6C 3T2NA 4ZXXH 1EX3A 1KY9A 2FZZA 3FP8E 2ZWLH 2TGAA 3V13A 4BTUB 1ARBA 3TK6A 3RXGA 2PSYA 2TIOA 1TLDA 1S85A 1ZMLA 1XUGA 1NRSH 4MPVA 2BHGA 1GJ9B 3VB3A 1OP0A 2O8TA 4IS5A 2V3HH 3E0PB 1BOQA 3MH7A 2BDAA 3TIUA 2Z9KA 4ZKNU 2VIQA 1YLNA 3SBKA 1GPZA 2CV3A 3N7DA 1N6YA 4KELA 1WTHD 4YOIA 1KLTA 4HI3A 5ABWA 1LQEA 3A83A 4B75A 1ELDE 1HDTH 4X2VA 4XE4A 3T62A 3N7OA 2G5NA 2OINA 3SV2H 1EB1H 5L6NH 1NESE 1EPTC 3SV8A 2VIDA 1O5CB 2BXTH 2BTCE 2BXUH 1C5YB 3GICB 1QL9A 2SGPE 1SMFE 3ZVBA 5A0CA 2Y82A 2F9UA 1UCYH 2XTTB 4HTCH 5C94A 1GHAF 1C5XB 5EIYA 1GVKB 1TRYA 4Q7YA 1SGPE 4Y6DA 2QE7D 3RP2A 1O2OA 1QB9A 1NFYA 4ACBA 3VPKA 3Q00A 4AZ2B 3LDXH 1O2KA 2BY9X 3S9AA 4A7IB 2R0KA 1AKSB 2Z9JA 2HGTH 2J34A 3P70B 3MU5A 1BMFD 1GBFA 4D7GA 3HPTB 4FVDA 4I32A 3ZZ6A 3LIWA 1AY6H 3MH4A 3K65B 1O3JA 2BD2A 2Y6TA 1GCDA 1NC6A 1P2NA 2CGAA 3VXEH 2A5AA 2EEKA 3UB0A 1SGIB 3O8CA 2RA3A 1O36A 3Q77A 5I46H 1C5MD 4MG3A 4ABBA 1S5SA 1UVPA 3F9GA 5GXPA 2CJIA 3TPIZ 2ODPA 1GBKA 2PR3A 1CSOE 1TRMA 3RXSA 1OKXA 3DT0H 1UK4A 1O5EH 1NS3A 3CP7A 3SGBE 4INKA 1BUIA 1TQ0B 4UFDH 2CMYA 1EJNA 5F03A 3A7YA 1GI6A 1QL8A 5EODA 5C0TA 2DE9A 1FY8E 3A8DA 3MHWU 1EAXA 1K1IA 1E1RD 4ABHA 3M3VA 4K1SA 2W26A 4NSYA 1A5IA 2O9QA 2ZIQH 4WMEA 2ZGCA 1LCYA 2EI7A 3SZNA 2BVRH 5LGOA 2XCNA 2CF8H 1MU6B 1V2JT 1C1OA 1OX1A 1E35B 5A8YA 2G51A 2JETC 1HJAC 1UK3A 2FEQH 3D23A 1SB1H 3SYJA 4QT8C 3S9CA 4OS7A 3BTFE 3W95A 5EQSA 1J17T 3SU0A 3ODDA 1HAZB 3ZZ7A 4O9VA 3SUFA 3WY8A 3QK1A 4HFPB 1O3DA 4UONA 1UTQA 1V2KT 3AK5A 3F3BA 5B6OA 2SGQE 1C1NA 2HNTF 3KQEA 3M5LA 5FBIA 1GI9B 2NU2E 2VWLA 2FO9A 1J9CH 1E38B 1YPGH 4Y7AA 3ZVAA 2KAIB 1NRNH 4ABEA 1ESBA 1X7AC 1TX7A 4ESTE 3A8CA 2Z3EA 2AMDA 1AWHB 1F7ZA 2NU3E 3PLKA 4WMFA 3GDUA 1AB9B 2P8OC 4B2AA 4B6EA 1T31A 1TONA 2OLGA 3FZZA 4MQAA 5GWZA 2P59A 1VITG 4AGJA 1C1RA 2GT8A 2YMSD 4D9RA 2BZAA 3QTVH 1TB6H 1O2JA 4Q7ZA 1LVOA 3CS0A 4RI0A 2L74A 1O33A 3SGAE 4BANB 4U32A 3FOAA 4OGXA 2A5IA 4PROA 2ZU5A 1FMGA 3LGVA 2VVUA 5FPTA 1MTVA 1F0SA 3H09A 3MU1A 4CH8B 1AZ8A 2CF9H 3T25A 5B6LA 2F43B 2AGEX 1NRPH 1XUKA 2ANMH 3SJKA 3ZYDA 1W0ZU 2TRMA 4WF8A 2UUYA 1HAOH 3KGPA 1F0RA 4X8UH 3QUMP 2AGIX 4XOJA 2GV6A 1ELFA 1S81A 1GCTB 4J2YB 3TK5A 2EC9H 4DURA 2J98B 1UHBA 1SQAA 3ZV8A 4UFGH 1TPAE 2VIPA 4CRGA 3UTUH 1TABE 1W8BH 2WV9A 1SOTA 5EQQA 1NBMD 1WV7H 3BTME 3LU9B 3SNDA 1Y5UT 1FY4A 1DXPA 4UEHH 2ZPRA 3E0NB 4X1PU 4RKOB 1AVGH 3CENA 2Y7ZA 1YP9A 1MCVA 2WZQA 2GKVE 2D8WA 1S6FA 1D4PB 4X6MA 1VITF 1SGNE 3MTYA 1EP6A 2Y81A 4F4OC 1GHBG 5T1VA 3GY8A 5DSFA 1O2GH 2PTCE 3RXAA 4F48B 1PQ7A 3EAJA 4K60A 1CGJE 2BZ6H 3RC4A 2GV7A 2GTBA 2QC2A 1GDQA 3HK6B 4IN2A 2BD8A 1AHTH 1QJ1B 1P03A 1O5FH 1WQSA 1NZQH 1DT2A 2ESTE 2PP6A 1V2PT 3STIA 2KR7A 2BOHB 3MNXA 3PRDA 4WH8A 1BITA 2BQWB 1RIWC 2Z9IA 3GY2A 3E1XB 5GPIB 1QRWA 4AGKA 3D62A 4WVPE 4ZMAH 1UO6A 4INHA 3TH2H 2G8TA 4X6OA 2WPJS 8LPRA 2PKAA 2EA3A 3I78A 5CHAC 4TWYA 4P02A 3A85A 2BY6X 3LKWA 1GI8B 2VJ1A 4AOQA 1G32B 4JZFH 3SU2A 5C3NA 2ZGXH 1EZUC 3T29A 3N99A 4NCYA 6GCHF 4MLFB 2ALPA 1P57B 2FTLE 1FV9A 5HIZA 2PGQB 4ISHH 3Q3YA 3SQEE 1UJ1A 2FESH 1QRZA 1V2VT 2QF5A 1BTXA 1YYY1 2ZTZA 4BNRA 3LGTA 4BXWA 1YF4A 2F9PA 2JJ2D 3KQDA 4BAOB 2BVSH 2QXHA 4FUIA 1K2I1 1ACBE 2XBVA 3LJOA 1PPHE 2ZU4A 1V2OT 1O35A 3QN7A 4ZAEA 3TGKE 1GBCA 2H1UA 2Z6BD 4NWLA 3TNSA 5GIBA 1EZXC 1P3CA 1Z6JH 3UNSA 3A7TA 1SGYE 1O2WA 1HFDA 2G00A 2HVXA 1S83A 1J16A 1S6LA 2VH6A 3SJOA 3A8BA 1VITH 9ESTA 1N8OB 3GCTF 1NPMA 2WPKS 3M3TA 1FX0B 3UNQA 3QZRA 4DIHH 2FLBH 4I8LA 3SORA 3OY5U 1SKYE 3RC6A 1QIXB 2AERH 2RFKC 3T27A 1GHWH 2H5DA 2GT7A 2IN2A 4CBOA 1O3MA 3A80A 2BLOA 4UD9H 1ZHRA 2JH6D 3NRLA 3AW1A 2A45B 3V3MA 4ASUD 4E06H 3BG8A 4DGJA 2ZDAH 1MKXH 1SHHB 2ZZUH 3UREA 4FUBA 2R2WU 5LPRA 4YXWD 3V7TA 1V2NT 1JBUH 3AAVA 4GHTA 5GCHG 1HUTH 4Y10E 2JKHA 2ZGJA 4Y79A 4DG4A 5F8XA 5DP5A 1V2QT 2H9EH 4NA8A 4YT7H 2QF4A 3H5CB 1C5RA 1D3PB 1GI1A 1DPOA 3CS7A 2WSSD 2VGCB 5DJ7A 1CVWH 4UFEH 1PPGE 5DPAA 5AFYH 1THPB 1EB2A 3RUOA 1F2SE 1SPJA 4LK4A 2WPIS 1O3CA 1ZJKA 1TGNA 1WQVH 3U28C 1QZ8A 3WWBA 1LVMA 1MH0A 1FZZA 4AYYB 5JDUB 1PPCE 1QJ6B 5EOKA 1G9IE 1G3EA 1BJVA 3KF2A 2OQUA 3PWCA 4JK5A 5FPSA 1O3NA 2PGBB 3FAOA 5FL7D 4ABFA 1L2EA 1M9UA 1O3FA 1DWBH 3ZYEA 1SOZA 3MO9A 1JIRA 3TJVA 2Y5GA 4H6SB 4ABGA 3P6ZB 1A7SA 4CR5A 3PYHA 1O0DH 4FUEA 4ISNA 1A0JA 2GCHF 1NFUA 3EE0B 2ANYA 3FN8A 1O2LA 3IITA 2H6MA 1GMDF 1TGTA 1HAPH 4XFQA 3DCLA 2ZFTA 7GCHG 3SNEA 3FZDA 2ZTYA 3K2UA 2VH0A 2GZ7A 2ZCHP 1TMTH 5DP3A 3V12A 4Q4LA 3ATLA 2FTMA 3M36A 5HKKD 3A7ZA 2BMGB 2GDDA 1AFQB 1T8MA 2XYAA 2ZKSA 1FAKH 1WAYB 4A1XA 1TNHA 1K1LA 1ELGA 3F68H 1JOUB 1A5HA 1FPCH 1PPZA 1VZQH 5T6GA 1HCGA 1EKBB 3RM2H 1SVPA 3OY6U 4BAMB 1UVSH 1TGSZ 3IWMA 1CHOG 3RXTA 1THRH 4BAQB 3BV9B 1HYLA 4Q80A 2QCYA 3E16B 4FU7A 4K69A 4Y7BA 4A92A 3EA9A 2V35A 2XOKD 1MUEB 3RLWH 5JBCS 1P04A 2ZG0H 3O8BA 5FBEA 2SGEE 1OYQA 2FWWA 2J2UA 4WJG2 2BDBA 1HBTH 2M2AA 2AFQB 3DUXH 4E7RG 1ETTH 1GHVH 1NBME 2BLWA 1C9TA 4K1EA 1BTYA 2J97A 3PO1C 5T6DA 1MD8A 3KQ5A 3UQOA 3RXKA 2DUCA 1WOFA 1QQUA 5AVDA 3SI3H 3QWCH 3RXVA 3LGWA 3LGUA 2F91A 4IMZA 1KXDA 1BMNH 3MI4A 4O03A 2BD3A 1GHYH 1O5GH 2GMTC 1D3QB 3AASA 1DLKB 2H2ZA 3NCLA 2O8WA 3RXPA 3M5OA 4GUXA 1WBGB 4K5ZA 3E6PH 3P8OA 5A0AE 4FUDA 1W0YH 1ZMNA 3RXDA 1ZSLA 1NN6A 1BTZA 2EQNA 1S84A 4K1TA 2J5UA 4Y8YA 4MNXA 4HGCA 2AMQA 1ZPZA 3RXIA 3MYWA 1Z1JA 1ANCA 1NM6A 1NRQH 3U1JB 3BTDE 1SGEE 2ZC9H 3ZVCA 1E1QD 1O3IA 5EXLA 3A7VA 2F9NA 1NT1A 4ABIA 1TFXA 2BYAX 3M7QA 1EXFA 1AU8A 1PYTD 4JYTA 8GCHF 4GSOA 1BBRK 4WY3A 2TBSA 2BX4A 1UVUH 1GMCG 1T32A 1ESAA 1GHAG 2PTNA 2HPPH 1GBMA 3LPRA 4F49A 1ZPBA 5IYTA 2C8YB 1SQTA 1P12E 3LJJA 1GDUA 2WPDD 2K0QA 1O2NA 5EPYA 2QGRA 1GJBB 1HLTH 2W6ID 3BIVH 2CHAB 1TPOA 2VVVA 2WUBA 1CT4E 4AX9H 1L1JA 4R0IA 1GBIA 4AB8A 2GDEH 3SOSA 5EW2H 1LQDB 4I8HA 3NZIA 2ZF0H 3BN9A 1OOKB 1AD8H 3ZZAA 1JXPA 2YNBA 3P92A 1K21H 1P06A 4ABAA 2PKAB 5JBBS 4YM9A 1TQ7B 3ATKA 2VNTA 5EJZA 2O8LA 3F2HA 1Z7KA 1WDIA 1FQ3A 1YPHE 3WWFA 4NSVA 4WMDA 5EW1H 1AFEH 2AGGX 3S7HB 1Q31A 1UTOA 3PMJA 2XCFA 2GX4A 4HZHA 4BOHA 1O3OA 1HRTH 5HIYA 4ASHA 4JMYA 4ZCNA 2R3YA 2BB4A 1H8ED 2FOFA 2I6QA 1AN1E 2D1JA 1D3DB 1O2ZA 1XUIA 3UQVA 2FODA 2YNAA 1GI2A 3VXFH 2FYQA 1WTGH 1GMCF 4CHAC 1O39A 2YMSB 4AFZA 2A4QA 3MU8A 4MTBA 4FOUC 4YOGA 3ZZBA 2R0LA 4BXSA 2A7CA 1XUHA 3AVZA 2XW9A 4UFFH 4LZ1H 1AE8H 1QQ4A 1SQRA 1LHEH 1L0ZA 1LPZB 1C1WH 1KXAA 1C1PA 1CA8B 1HAHH 2ZFSA 2BD4A 5DG6A 1EZQA 4WXVA 1OWIA 1ZLRA 3T28A 2XBWA 1KYNA 2H5CA 2XWBI 3DFJA 1IQHA 2OK5A 5EPNA 1QBVH 5ESBA 3KCGH 2O8MA 2G4TA 1S0QA 2BY5X 2ZECA 4D8NA 2P3FH 2JIZD 4OS4A 2C8XB 1XX9A 5F53A 1K0HA 3GY6A 1GJDB 3AW0A 1DOJA 4DIIH 1ORFA 2XBYA 1QFKH 3QX5H 1TA2A 2XC5A 1MKWK 1J14A 4KTUA 2QN5T 3GDVA 5LPEA 1H8DH 3RXRA 3FO8D 2O8UA 3EQ0H 3OTJE 1AVWA 3BF6H 1O2TA 1W2KH 2ALVA 1EAWA 3PM3A 3OSYA 4NGAH 1IQIA 4Z0KA 3F9FA 3S0NA 1BBRE 2YOLA 1JIMA 1VJAU 1HAIH 3KIDU 3ATIA 2C8ZB 3ATMA 1YKTA 3VGCC 2JDID 2ZDVH 4DT7B 1LPKB 1FUJA 1BMMH 1P01A 2W3IA 2PW8H 1JRSA 1ARCA 1TNGA 4RT0A 3U8RH 3RXLA 1EAIA 2BOKA 3MNBA 4CH2B 3QTOH 3O8DA 3UOUA 2ZQ1A 4P00A 1HAVA 3B23B 2TPIZ 5KEDA 1CA0B 3LONA 1HXEH 2A2XH 1IQKA 2BQ7B 4E05H 1P2KA 1WU1A 3RU4D 1MTSA 3A8AA 2OC1A 1T8NA 1ETSH 5FX5A 1SLUB 1DY9A 2BX3A 1YCPM 1Z6EA 5T3HA 5C1UA 1H4WA 1O5BB 4ZUHA 3URDA 1GJCB 1Z8JB 3MU0A 1A5GH 1RRKA 3BTTE 2ZHQH 3MNCA 4H6TA 4IBLH 2W7SA 1OXGA 5E2PA 2XC4A 5PTPA 4CREA 3GY7A 3BG4C 3PB1E 5JBAS 1SBWA 1DS2E 3RDZA 1C1TA 2OXSA 2V7QD 4YLQH 3T26A 3ZZDA 4U2WA 1GBAA 4RN6A 3VB7A 2ZDMA 4AYVB 1B7XB 2R9PA 4YOJA 2GVFA 2F3CE 1MTUA 4B76A 1ZZZA 1D6RA 4JZDH 3TITA 1O37A 4OS6A 3D49H 1PPBH 2VINA 5FCKA 3H7TA 4ZKOU 1T4UH 2JH5D 1ZMJA 2PKSB 1C5NH 1EJAA 1K9OE 1NU7B 1XVMA 3PTNA 2RDEA 2ZHDA 2ZDKA 4UE7H 4X6NA 3ESTA 2ODYB 1O2XA 4OM9A 1UTJA 1CBWB 3FANA 4NZQA 4TSFD 1EFRD 3T5FH 1RGQA 1CU1A 2OUAA 1GGDB 2F9BH 4FUFA 4NIYA 1C5SA 1QNJA 1MAXA 1SGFA 1O30A 1TX6A 1LVYA 4ACAA 2BVXH 1YLCA 4B71A 3RMOH 3NUMA 3OE7D 3ZZ4A 4K8BA 1YCPK 1AMHA 1SGQE 5T6FA 2CHAC 1IQGA 1C5UA 1O2YA 1D9IA 2FOGA 3FP6E 2K1QA 4NIVA 3U69H 2OD3B 6GCHG 4ZHLU 3DD2H 1Y3WA 5FXLA 1IQEA 1PPFE 1PPEE 1KXCA 4A5TS 5EXMA 2OC7A 4FXGH 5E2OA 2BLVA 1GJ5H 3RXBA 1CQQA 2QIQA 1ZJDA 1XUFA 3BSQA 1LMWB 4I8KA 3QGJA 5CHBA 1TNLA 2QYIA 3A89A 1VGCB 3ENSB 3M5NA 5TCAA 3L33A 2CXVA 1RTLA 2OC8A 4IW4E 2F9VA 1BMLA 1T4VH 1O3BA 4I31A 3UY9A 3SN8A 1AO5A 1H8HD 1P11E 4J1YA 1O3HA 6CHAB 1TALA 1ZHMA 2NWNA 2FOCA 4TWWA 5C0UA 1FDPA 7ESTE 1O3KA 3M3SA 2XBXA 4OS2A 4JZIA 1PQ5A 4K3JA 1L4DA 1TE0A 1A0LA 2SNVA 2WUCA 2ZDLA 3GCTG 3RMMH 2YMSC 1LPGB 3TH3H 3SJ8A 4I8GA 1TGBA 4SGAE 4NG9H 2P3UB 1JRTA 3M7TA 2Y80A 3A7XA 1NU9A 1DICA 3E3TA 4OS1A 1SG8B 2ZFPH 3ZZ9A 2Y7XA 1GI7B 3B9FH 1W10U 2OBOA 4U01A 2LP6A 1V2ST 1RTKA 3FFGA 4TPIZ 2C3SA 1HAXB 5DGJA 1OPHB 2SGAA 1TMBH 5FPYA 3KQBA 1MD7A 1C2DA 5A8XA 1Y3YA 4H42U 2FX4A 5AF9H 1GJ6A 4OS5A 2XNDD 3VB5A 1L4ZA 3HKIB 1AIXH 4ISLA 2A4OA 1F5LA 1DANH 2VIVA 3P8NA 2ZNKH 5AHGH 1HNEE 1PJPA 1QY6A 3E8LA 5EU8A 1V2MT 1LTOA 1C5QA 3PROA 2ZEBA 3SUDA 1QTFA 2ZFRH 1C2FA 1V3XA 4JZEH 3B8JA 4SGBE 5K7RA 2VWOA 3RXEA 5A09A 1UVTH 2ZFQH 2BQ6B 1GG6B 2SNWA 1UTMA 4Y8ZA 4X2XA 1C5OH 4IGDA 3SJ9A 5CMXH 3RXCA 1K1JA 2GJGA 1W11U 5DP8A 1KTSB 1UTKA 2IOTA 2ZO3H 2GZ8A 1W13U 2ZU2A 4XBDA 3U8OH 1O5AB 3K6ZA 4AB9A 1O3LA 2GCHG 3F1SB 3F2FA 3IG6B 2TGDA 1VR1H 4GVUA 1GMDG 1O3AA 1W3CA 3GCNA 4KTCA 3F2GA 5DK1A 2V0BA 1G30B 1SLVB 3SGQE 1RJXB 3MNSA 3RXMA 2ANWA 1EZSC 1ELEE 5F6MA 3QGNB 5C2ZA 3BTKE 5G4BA 1WYKA 2P94A 1LHDH 3F9EA 1E0FD 1UK2A 2HNTC 4NFFA 4I33A 4FUHA 2WYGA 3BIUH 5IK2D 8KME2 4LOYH 1KDQA 4ZH8A 4WXIA 3RU4E 3ZZ8A 3DSPA 2IPQX 3SJIA 3LT3A 1W7GH 1YWUA 3MH5A 1MCTA 2FOEA 2FS9A 1Y59T 1XKAC 1VJ9U 3LGIA 5KGOA 1G2MA 1AB9C 1KIGH 1INCA 2A31A 3GYMA 1BMAA 4NIWA 1TBZH 1FY1A 1FN6A 3RXQA 1AUTC 2Q6DA 2QF0A 3SHAH 1YC0A 2AS9A 2ZU3A 1XMNB 3VG8A 3NPSA 5A0BA 2V3MA 1ETRH 1ZPCA 5A2MH 2A7HA 4TY7A 1MU8B 2PKSC 3MO6A 3DA9B 1IQJA 5HMAA 1HAVB 2ASUB 3LH1A 2AH4X 1ZGIA 1B0FA 3SU4A 1PQ8A 4A6LA 1MZAA 3C1KA 1SGDE 3F6UH 3ZVEA 1GCTC 5BRRE 2BDHA 1C5VA 2FOMB 4XD7D 1SGFG 2ODQA 2XXLA 2GD4B 3UWIA 4AG2A 4DJZB 1H9LB 5C67A 2GP9B 1W14U 2TGPZ 1HPGA 1C1UH 1ANDA 4XRNA 4TY6A 1TOMH 2ZU1A 1FN8A 2J94A 3EA7A 2RG3A 1KSNA 1O3EA 1J15A 1UW7A 1YPKH 4Q63A 2VU8E 5C17A 8GCHG 1S0RA 4X1RU 5EXNA 5I25A 4CBNA 3N7EA 1THSH 3STJA 3TLOA 3RC5A 2C90B 3OX7U 1XXFA 3TGJE 7KMEH 2QXJA 3TU7H 1A2CH 1W7XH 4X1NU 1F0TA 1P02A 1C2IA 1TPPA 3JZ2B 2FI4E 1HAYB 3A84A 1OWHA 2G4UA 1GI5A 1AI8H 2JETB 1V2UT 2Z3DA 1HJAB 1VGCC 1C2GA 4ZXYH 4TPYA 1O2QA 4GPGA 1ZOMA 3KN2A 5C20A 2A5KA 2HRVA 2KCPA 1O2HA 3PRBA 1F0UA 4Y8XA 1P2JA 2SGDE 2NU4E 2ZTXA 3KYGA 1HJ9A 1ZTLA 1A3BH 2UUFB 1OHHD 3NK8A 2AYWA 1FAXA 3SNCA 1OWDA 2FS8A 4B1TA 1TNKA 2ZI2H 1K1MA 2C8WB 1SSXA 3BEFB 1MKWH 2I6SA 1D6WA 4XSKU 3R3GB 2B7DH 1GBBA 1IOEA 2DE8A 1MQ6A 3ELAH 1C5TA 1P05A 1W12U 1SGTA 4HG6A 3VEQB 3DHKH 3SUEA 1SGRE 2WYJA 1BHXB 4ZROA 1O3PB 4MPUA 3MO3A 3NWUA 2J92A 3RU4T 1BTUA 2WPHS 1BHXF 5E0GA 3RXJA 1YPMH 4JYVH 4H4FA 5H4IB 1TMUH 1QB1A 3UFAA 3OU0A 3L6PA 4TYDA 4F55A 2IJD1 2ZP0H 3EYDA 1IHTH 1P9SA 3A87A 1LHCH 2FI3E 3GS9A 1EASA 2STAE 4GCHF 3PLBA 2RDLA 1YY3A 1V2WT 4I86A 1O2RA 2QV1A 4MVNA 1ZSKA 1Y5BT 1SQOA 1SI5H 3WW7A 2BDGA 3SO3A 2CN0H 2P3TB 4I8JA 1V2RT 3MH6A 2PHBA 4Z1MD 4NIXA 1AQ7A 4DT4A 5L2YH 2KCAA 2A2QH 4AFUA 1IQLA 2KM0A 3K9XB 1O2IA 2W3KA 2M5TA 2P95A 1E36B 2HLCA 3OYPA 2PV9B 1N8OC 1GBEA 2BM2A 1HGTH 1BRUP 3GCOA 3PMHB 1T8LA 1NTPA 1B0EA 5HXFA 5KECA 5JB9S 2QXIA 6LPRA 1MBMA 2QXGA 2RCEA 3UNRA 3SV6A 1T7CA 2HLDD 3SU3A 1LHFH 3ZZ3A 5TJXA 2BD9A 1FIWA 1C1VH 1P2QA 3BTWE 3U98H 2A4GA 3NXPA 3UR6A 1YPJH 1HV7A 3Q3KA 1GVLA 2BDIA 2ZCKP 1ELAA 2HVYB 1Y3XA 5DN6D 1OS8A 2QF3A 1MTWA 3U1IB 4UDWH 3ATWA 2G5VA 1BIOA 3ZIAD 4MNWA 5JPMH 2AIQA 3Q3XA 2QY0B 1P3EA 1DDJA 3QZQA 4Y76A 3VFEA 1GDNA 5GNDA 5EQRA 3FKSD 4O3UA 2VVCA 3GY5A 1A61H 3RMNH 1HXFH 2A7JA 1BRBE 2VGCC 2W6JD 5E0JA 1RIWB 1SC8U 3PLPA 1SL3A 4K2YA 2R2MB 1ABJH 3LH3A 1Y5AT 1FJSA 1C4Y2 4KGAA 2FXRA 2VIWA 4B74A 4WWYA 3SQHE 5ETXA 1BDAA 1PYTC 3UPEA 4X2WA 4E7NA 5CHAB 2G55A 4CR9A 1TGCA 3NKKA 3RM0H 1G37A 2C4FH 1BTPA 1WUNH 3OFND 1ANEA 1MQ5A 1YCPH 3P17H 1QCPA 5E8EH 3U9AH 3QO6A 1EJMA 2FOAA 2JH0D 1DUAA 3OEED 4GHQA 3TH4H 4AFSA 1BRCE 1QGFA 2L6OA 4AN7A 3AAUA 3BTGE 2UUJB 4AG1A 2EY4C 1UVOA 1EPTA 1B5GH 1JWTA 5C5NA 2VWNA 5CDFE 1K1PA 3SV9A 1MTNB 3A82A 4AFQA 1O38A 4U30A 2QA9E 5L30H 1Z71A 3I77A 4GAWA 1GBDA 5DKMA 1A4WH 4CRDA 3OEHD 2OC0A 1DITH 2Z9GA 2B0FA 4VGCB 1ZTKA 5JYIA 4K8YA 3ZVGA 2ULLA 4RSPA 4X0WU 4YO9A 3UWJH 5A8ZA 2J95A 4NWKA 2FX6A 3P8FA 1YBWA 1C1SA 1SR5C 1ELBA 2XWAA 1FLEE 3GISB 1AFQC 1GHZA 1KDQB 5J4QA 5FCRA 3ZZCA 2W7UA 1HJ8A 3GDSA 5FHTA 1VCWA 2NU0E 1ZSJA 2J4IA 2HALA 1NROH 4IMQA 5SGAE 1GI4A 1TX8A 2IJOB 1EQ9A 4DCDA 4DVAU 3HGPA 4INLA 1BCUH 2BY7X 4M7GA 1QJ7B 2R3UA 3G01A 4YLUA 1IQNA 2THFB 4YTAA 3PTBA 4KKDA 1ID5H 3PWBA 2UWOA 1PFXC 1RD3B 4JYUH 3BTQE 2D26C 3VB6A 1TIOA 3SNBA 1CHGA 2FP7B 3PV4A 1A1RA 3ZVDA 3O8RA 1C1QA 2GZ9A 2ZGBH 1DWEH 1N6XA 2TGTA 1FPHH 2FPZA 1A46H 3M37A 2XC0A 4FETA 1BQYA 4D9QA 1LDTT 2FIRH 1Z8RA 5EJLA 4Z6AH 2BDCA 1LHGH 1O31A 1P9UA 1WCZA 1O32A 1SHYA 2GGVB 3CNRA 1IAUA 2A4RA 1YPEH 2KFWA 1C4U2 3K6YA 1HIAA 3S69A 2AEIH 3M5MA 4IC5A 1DWDH 2BD5A 3PMAB 4ISOA 4X8VH 1ELTA 1Q2WA 2F83A 1NY22 2ZPSA 4KP0A 2VBCA 4A1VA 1F92A 3A81A 3EDXB 4ZKSU 3ZV9A 3OAAD 1GI3A 1SGCA 1YLDA 3C27B 2AHME 2ZDNA 4FUJA 1KLJH 4JK6A 4NA9H 1QRXA 1Z1IA 4ZKRU 1W0JD 1TNIA 1UCYK 4CRFA 2OBQA 2WPMS 1IQMA 2KX4A 1P09A 1XKBC 2Z7FE 1Q3XA 1KMHB 1W0KD 1Y3UA 5DP4A 1IHSH 5DP6A 2WHXA 3UR9A 3BTHE 3JZ1B 1ZR0A 1DM4B 1CGHA 1P0SH 2B5TB 2PSXA 1DY8A 1ZRBA 3UOPA 3OTPA 1TBRH 1A0HB 2VIOA 1BTWA 3LC3A 1P2IA 4LZ4B 4RKJB 4NA7A 2C93B 3S7KB 3BTEE 5EG4A 2IPHA 1ZRKA 2H9TH 3EGKH 1SFIA 1FXYA 3Q76A 4JZ1A 5FAHA 1QBNA 1K1OA 1UMAH 3GY4A 1H1BA 3VB4A 2ZPQA 3PV5A 4ISIH 3LC5A 1C2HA 2EI6A 5HGGA 1OWKA 2FMJA 2JJ1D 2OTVA 1C4V2 1C1MA 3RXOA 1C2MA 4A1TA 2QAAA 2BD7A 1P10A 2AMPA 4B73A 5CE1A 1YM0A 4TT3D 1BA8B 2B9LA 1GBLA 1V6DA 1NO9H 5EJ1A 2HOBA 1DFPA 3PO1B 2J9NA 4RT1A 1ZTJA 1GJAB 2NU1E 1VKYA 4ABJA 3RXUA 2AIPA 4X1SU 2ANKH 3ZZ5A 3HATH 1HAGE 1OSSA 1DSTA 1P8VC 2H9HA 3E91A 4BTTB 2OCVB 2GMTB 5DP7A 1OP2A 2A0QB 5IDKA 3URCA 3MFJA 1O3GA 3SU6A 1C5ZB 1V2LT 2Q1JA 1ZHPA 1E37B 1O2PA 3SW2B 2UUKB 1LKAA 2ZHFH 3MOCA 4FU8A 4IN1A 2D2DA 4X8TH 2CK3D 1Z8GA 2SFAA 1SLXB 1CT2E 1L1GA 5J4SA 3GCHB 3KYFA 2Q6FA 3F0PA 1RTFB 1SLWB 1SFQB 2WV4A 1RS0A 1GBHA 4Q7XA 1Z8IB 1S6HA 2BDYA 2F9OA 1H8IH 1XM1A 3QLPH 1AWFH 3W94A 1RXPA 5C1XA 2RA0A 1DSUA 1MTNC 1L1NA 1G36A 2Z3CA 1Y3VA 5F8ZA 4GLYA 1AUJA 2GCTB 1KXFA 2UWLA 4THNH 3M61U 3TVJB 1GMHG 1Y8TA 3SI4H 1D3TB 1KXBA 3M7UA 3KQCA 1ELCA 3HKJB 1GHBF 5LPFA 1FIZA 3GYLB 2ZCLP 4VGCC 1MAYA 1ZYOA 1C2JA 1UTPA 3A86A 4O3TA 4X6PA 1G3BA 1T8OA 2FI5E 3RXHA 1UCYE 2ZGHA 3BEUA 4MPWA 2FOBA 3P95A 4X1QU 4B2CA 1GJ8B 4ZHAA 2P16A 4NZLA 1EATA 3MMGA 7LPRA 1DVAH 1K1NA 1P2OA 1FI8A 4XBBA 4Q2KA 3TK9A 1AKSA 2V6NA 3SV7A 2VWMA 3ZVFA 1BT7A 4XBCA 4ZHMU 4B2BA 3L3TA 1KXEA 3GY3A 1XUJA 3RLYH 5JB8S 2Y5FA 1FY5A 1GL1A 1TWXB 3F0OA 2FLRH 3EE7A 1GI0A 3UIRA 1CA0C 1VCPA 3MQKC 3TJOA 4OGYA 1TNJA 2G81E 2Y5HA 3KNXA 2STBE 1FONA 1IQFA 3TJNA 2EI8A 2KCOA 1WSSH 1DE7H 3QDZB 3A7WA 4BAKB 1EPTB 1N1LA 2Z94A 1TOCB 1CGIE 3SU1A 2PLXA 4MNYA 1K22H 3S9BA 1ABIH 2FYRA 1RFNA 1TBQH 1XXDA 3DSOA 5C5OA 2Q6GA 1BBRH 1DWCH 4CHAB 3W1EA 8ESTE 4CRCA 2UWPA 4Y0YE 3U8TH 2ZHEH 5FX6A 1GMHF 3SHCH 1O2UA 1GWAA 2XNIA 1EP5A 1NFWA 2Z9LA 1UTNA 1LKBA 4IC6A 1BJUA 1TYNA 1S82A 2ZFFH 5GDSH 3KHVA 1CT0E 2PUXB 5HYOA 3H7OA 1O34A 1TA6A 4CRBA 2FDAA 1O2MA 3SNAA 3V0XA 3DSGA 4XDEA 1AZZA 2VB0A 4X8SH 1QL7A 4DY7B 1FY3A 3A88A 2OQ5A 3DFLA 1ANBA 4O97A 1QA0A 3PMBB 1PQAA 3MWIU 1YPHC 3KL6A 2SGFE 2ZA5A 3BEIB 2HPQH 3P8GA 4YESB 3R0FA 1DXWA 2G52A 1F5KU 1CBWC 5C1YA 1ZGVA 5AFZH 5GJ4B 1F5RA 1C5WB 1TPSA 5TCCA 1BZXE 4DOQA 1GGDC 1QBOA 1H9HE 1FNIA 4FVBA 2PFEA 1KLIH 5HM9A 1EOJA 1J8AA 4FUCA 1AGJA 4AORA 1QHRB 5BPEA 3TGIE 4MNVA 1NFXA 2KAIA 5DO4H 1QB6A 1CO7E 3GOVB 1YPLH
chains in the Genus database with same CATH topology
1MZDA 4X2YA 1GBTA 1E34B 3I29A 1DUEA 2A1DB 1AE5A 5GCHF 1VCQA 3FP7E 3ODFA 1HIAB 2ZQ2A 5L2ZH 3VGCB 4BTIB 5ESTE 1BTHH 1HB0B 4CRAA 4D76A 2ZHWH 4MPXA 5F8TA 1QR3E 4GCHG 3SU5A 1GHXH 1U6QA 2FM2A 1OP8A 1GVZA 4LXBH 2PWXA 4BAHB 5HM2A 5E0HA 1O5DH 1O2SA 3UUZA 1JMOH 2LPRA 1BRAA 6ESTA 6CHAC 1GJ4H 1BB0B 5K0HA 1GJ7B 1OYTH 5DP9A 1YGCH 4R8TB 2W5EA 1GBJA 1MMJN 1C9PA 1TRNA 1H9IE 3TNTA 1LVBA 2B8OH 1KTTB 1QURH 5EGMA 1LO6A 3BG4B 1CE5A 4FU9A 3E90B 7GCHF 5LH8A 1C2KA 2P8OB 3KEEA 2OP9A 2PUQH 4YT6H 1EAUA 1MBQA 9LPRA 1C2EA 4JCNA 4YZUA 1C5PA 1EOLA 3RXFA 1XVOA 3F9HA 1G3CA 1MKXK 1UHBB 2HWLB 1ESTA 3HGNA 4KTSA 3SUGA 2BY8X 1GL0E 1DLEA 1C5LH 3LGYA 4ABDA 4Y0ZE 1O2VA 3D65E 1TAWA 4I7YH 3ITIA 3GCHC 4WH6A 4Y11E 1CHOF 1ELVA 3RMLH 1G2LA 1P2MA 4FUGA 2A32A 2V3OH 1EUFA 3MU4A 5JBTA 3FVFB 3HK3B 2HNTE 4MDSA 2J38A 1OWJA 1V2TT 1A3EH 1AVXA 4D7FA 3M35A 4DW2U 2BLQA 1K28D 1G3DA 2ILNA 1DX5M 2GCTC 1NRRH 1QA7A 4NFEA 2XRCA 2WINI 3TJUA 2P93A 4Y71A 2WPLS 3LOXA 2FOHA 2WV5A 3EA8A 1C2LA 1OWEA 1UTLM 2LNCA 1GG6C 3T2NA 4ZXXH 1EX3A 1KY9A 2FZZA 3FP8E 2ZWLH 2TGAA 3V13A 4BTUB 1ARBA 3TK6A 3RXGA 2PSYA 2TIOA 1TLDA 1S85A 1ZMLA 1XUGA 1NRSH 4MPVA 2BHGA 1GJ9B 3VB3A 1OP0A 2O8TA 4IS5A 2V3HH 3E0PB 1BOQA 3MH7A 2BDAA 3TIUA 2Z9KA 4ZKNU 2VIQA 3SBKA 1GPZA 2CV3A 1N6YA 4KELA 1WTHD 4YOIA 1KLTA 4HI3A 5ABWA 1LQEA 3A83A 4B75A 1ELDE 1HDTH 4X2VA 4XE4A 3T62A 3N7OA 2G5NA 2OINA 3SV2H 1EB1H 5L6NH 1NESE 1EPTC 3SV8A 2VIDA 1O5CB 2BXTH 2BTCE 2BXUH 1C5YB 3GICB 1QL9A 2SGPE 1SMFE 3ZVBA 5A0CA 2Y82A 2F9UA 1UCYH 2XTTB 4HTCH 1GHAF 1C5XB 1GVKB 1TRYA 4Q7YA 1SGPE 4Y6DA 3RP2A 1O2OA 1QB9A 1NFYA 3VPKA 3Q00A 4AZ2B 3LDXH 1O2KA 2BY9X 3S9AA 4A7IB 2R0KA 1AKSB 2Z9JA 2HGTH 2J34A 3P70B 3MU5A 1GBFA 4D7GA 3HPTB 4FVDA 4I32A 3ZZ6A 3LIWA 1AY6H 3MH4A 3K65B 1O3JA 2BD2A 2Y6TA 1GCDA 1NC6A 1P2NA 2CGAA 3VXEH 2A5AA 2EEKA 1SGIB 3O8CA 2RA3A 1O36A 3Q77A 5I46H 1C5MD 4MG3A 4ABBA 1S5SA 1UVPA 3F9GA 5GXPA 2CJIA 3TPIZ 2ODPA 1GBKA 2PR3A 1CSOE 1TRMA 3RXSA 1OKXA 3DT0H 1UK4A 1O5EH 1NS3A 3CP7A 3SGBE 4INKA 1BUIA 1TQ0B 4UFDH 2CMYA 1EJNA 5F03A 3A7YA 1GI6A 1QL8A 5EODA 2DE9A 1FY8E 3A8DA 3MHWU 1EAXA 1K1IA 4ABHA 3M3VA 4K1SA 2W26A 4NSYA 1A5IA 2O9QA 2ZIQH 4WMEA 2ZGCA 1LCYA 2EI7A 3SZNA 2BVRH 5LGOA 2XCNA 2CF8H 1MU6B 1V2JT 1C1OA 1OX1A 1E35B 5A8YA 2G51A 2JETC 1HJAC 1UK3A 2FEQH 3D23A 1SB1H 4QT8C 3S9CA 4OS7A 3BTFE 3W95A 5EQSA 1J17T 3SU0A 3ODDA 1HAZB 3ZZ7A 4O9VA 3SUFA 3WY8A 3QK1A 4HFPB 1O3DA 4UONA 1UTQA 1V2KT 5B6OA 2SGQE 1C1NA 2HNTF 3KQEA 3M5LA 5FBIA 1GI9B 2NU2E 2VWLA 2FO9A 1J9CH 1E38B 1YPGH 4Y7AA 3ZVAA 2KAIB 1NRNH 4ABEA 1ESBA 1X7AC 1TX7A 4ESTE 3A8CA 2Z3EA 2AMDA 1AWHB 1F7ZA 2NU3E 3PLKA 4WMFA 3GDUA 1AB9B 2P8OC 4B2AA 1T31A 1TONA 2OLGA 3FZZA 4MQAA 5GWZA 2P59A 1VITG 4AGJA 1C1RA 2GT8A 4D9RA 2BZAA 3QTVH 1TB6H 1O2JA 4Q7ZA 1LVOA 3CS0A 1O33A 3SGAE 4BANB 4U32A 4OGXA 2A5IA 4PROA 2ZU5A 1FMGA 3LGVA 2VVUA 5FPTA 1MTVA 1F0SA 3MU1A 4CH8B 1AZ8A 2CF9H 3T25A 2AGEX 1NRPH 1XUKA 2ANMH 3SJKA 3ZYDA 1W0ZU 2TRMA 4WF8A 2UUYA 1HAOH 3KGPA 1F0RA 4X8UH 3QUMP 2AGIX 4XOJA 2GV6A 1ELFA 1S81A 1GCTB 4J2YB 3TK5A 2EC9H 4DURA 1UHBA 1SQAA 3ZV8A 4UFGH 1TPAE 2VIPA 4CRGA 3UTUH 1TABE 1W8BH 1SOTA 5EQQA 1WV7H 3BTME 3LU9B 3SNDA 1Y5UT 1FY4A 1DXPA 4UEHH 2ZPRA 3E0NB 4X1PU 4RKOB 1AVGH 3CENA 2Y7ZA 1YP9A 1MCVA 2GKVE 2D8WA 1S6FA 1D4PB 4X6MA 1VITF 1SGNE 3MTYA 1EP6A 2Y81A 4F4OC 1GHBG 3GY8A 1O2GH 2PTCE 3RXAA 1PQ7A 3EAJA 4K60A 1CGJE 2BZ6H 3RC4A 2GV7A 2GTBA 2QC2A 1GDQA 3HK6B 4IN2A 2BD8A 1AHTH 1QJ1B 1P03A 1O5FH 1WQSA 1NZQH 1DT2A 2ESTE 1V2PT 3STIA 2BOHB 3MNXA 4WH8A 1BITA 2BQWB 1RIWC 2Z9IA 3GY2A 3E1XB 5GPIB 1QRWA 4AGKA 3D62A 4WVPE 4ZMAH 1UO6A 4INHA 3TH2H 2G8TA 4X6OA 2WPJS 8LPRA 2PKAA 2EA3A 3I78A 5CHAC 4TWYA 3A85A 2BY6X 3LKWA 1GI8B 2VJ1A 4AOQA 1G32B 4JZFH 3SU2A 5C3NA 2ZGXH 1EZUC 3T29A 4NCYA 6GCHF 4MLFB 2ALPA 1P57B 2FTLE 1FV9A 2PGQB 4ISHH 3Q3YA 3SQEE 1UJ1A 2FESH 1QRZA 1V2VT 1BTXA 1YYY1 2ZTZA 4BNRA 3LGTA 4BXWA 1YF4A 2F9PA 3KQDA 4BAOB 2BVSH 2QXHA 4FUIA 1K2I1 1ACBE 2XBVA 3LJOA 1PPHE 2ZU4A 1V2OT 1O35A 3QN7A 4ZAEA 3TGKE 1GBCA 2H1UA 2Z6BD 4NWLA 3TNSA 5GIBA 1EZXC 1P3CA 1Z6JH 3UNSA 3A7TA 1SGYE 1O2WA 1HFDA 2G00A 2HVXA 1S83A 1J16A 2VH6A 3SJOA 3A8BA 1VITH 9ESTA 1N8OB 3GCTF 1NPMA 2WPKS 3M3TA 3UNQA 3QZRA 4DIHH 2FLBH 4I8LA 3SORA 3OY5U 3RC6A 1QIXB 2AERH 3T27A 1GHWH 2H5DA 2GT7A 2IN2A 4CBOA 1O3MA 3A80A 2BLOA 4UD9H 1ZHRA 2JH6D 3AW1A 2A45B 3V3MA 4E06H 3BG8A 4DGJA 2ZDAH 1MKXH 1SHHB 2ZZUH 3UREA 4FUBA 2R2WU 5LPRA 3V7TA 1V2NT 1JBUH 3AAVA 4GHTA 5GCHG 1HUTH 4Y10E 2JKHA 2ZGJA 4Y79A 4DG4A 5F8XA 5DP5A 1V2QT 2H9EH 4NA8A 4YT7H 3H5CB 1C5RA 1D3PB 1GI1A 1DPOA 3CS7A 2VGCB 5DJ7A 1CVWH 4UFEH 1PPGE 5DPAA 5AFYH 1THPB 1EB2A 3RUOA 1F2SE 1SPJA 4LK4A 2WPIS 1O3CA 1ZJKA 1TGNA 1WQVH 1LVMA 1MH0A 1FZZA 4AYYB 5JDUB 1PPCE 1QJ6B 5EOKA 1G9IE 1G3EA 1BJVA 3KF2A 2OQUA 3PWCA 4JK5A 5FPSA 1O3NA 2PGBB 3FAOA 4ABFA 1L2EA 1M9UA 1O3FA 1DWBH 3ZYEA 1SOZA 3MO9A 1JIRA 3TJVA 2Y5GA 4H6SB 4ABGA 3P6ZB 1A7SA 4CR5A 3PYHA 1O0DH 4FUEA 4ISNA 1A0JA 2GCHF 1NFUA 3EE0B 2ANYA 3IITA 1O2LA 2H6MA 1GMDF 1TGTA 1HAPH 4XFQA 2ZFTA 7GCHG 3SNEA 3FZDA 2ZTYA 3K2UA 2VH0A 2GZ7A 2ZCHP 1TMTH 5DP3A 3V12A 3ATLA 2FTMA 3M36A 3A7ZA 2BMGB 2GDDA 1AFQB 1T8MA 2XYAA 2ZKSA 1FAKH 1WAYB 4A1XA 1TNHA 1K1LA 1ELGA 3F68H 1JOUB 1A5HA 1FPCH 1PPZA 1VZQH 5T6GA 1HCGA 1EKBB 3RM2H 1SVPA 3OY6U 4BAMB 1UVSH 1TGSZ 3IWMA 1CHOG 3RXTA 1THRH 4BAQB 3BV9B 1HYLA 4Q80A 2QCYA 3E16B 4FU7A 4K69A 4Y7BA 4A92A 3EA9A 2V35A 1MUEB 3RLWH 5JBCS 1P04A 2ZG0H 3O8BA 5FBEA 2SGEE 1OYQA 2FWWA 2J2UA 4WJG2 2BDBA 1HBTH 3DUXH 2AFQB 4E7RG 1ETTH 1GHVH 2BLWA 4K1EA 1C9TA 1BTYA 3PO1C 5T6DA 1MD8A 3UQOA 3RXKA 2DUCA 1WOFA 1QQUA 5AVDA 3SI3H 3QWCH 3RXVA 3LGWA 3LGUA 2F91A 4IMZA 1KXDA 1BMNH 3MI4A 4O03A 2BD3A 1GHYH 1O5GH 2GMTC 1D3QB 3AASA 1DLKB 2H2ZA 3NCLA 2O8WA 3RXPA 3M5OA 4GUXA 1WBGB 4K5ZA 3E6PH 3P8OA 5A0AE 4FUDA 1W0YH 1ZMNA 3RXDA 1ZSLA 1NN6A 1BTZA 1S84A 4K1TA 4Y8YA 4MNXA 4HGCA 2AMQA 1ZPZA 3RXIA 3MYWA 1Z1JA 1ANCA 1NM6A 1NRQH 3U1JB 3BTDE 1SGEE 2ZC9H 3ZVCA 1O3IA 5EXLA 3A7VA 2F9NA 1NT1A 4ABIA 1TFXA 2BYAX 3M7QA 1EXFA 1AU8A 1PYTD 4JYTA 8GCHF 4GSOA 1BBRK 4WY3A 2TBSA 2BX4A 1UVUH 1GMCG 1T32A 1ESAA 1GHAG 2PTNA 2HPPH 1GBMA 3LPRA 4F49A 1ZPBA 5IYTA 2C8YB 1SQTA 1P12E 3LJJA 1GDUA 1O2NA 5EPYA 2QGRA 1GJBB 1HLTH 3BIVH 2CHAB 1TPOA 2VVVA 2WUBA 1CT4E 4AX9H 1L1JA 4R0IA 1GBIA 4AB8A 2GDEH 3SOSA 5EW2H 1LQDB 4I8HA 3NZIA 2ZF0H 3BN9A 1OOKB 1AD8H 3ZZAA 1JXPA 2YNBA 3P92A 1K21H 1P06A 4ABAA 2PKAB 5JBBS 4YM9A 1TQ7B 3ATKA 2VNTA 2O8LA 1Z7KA 1FQ3A 1YPHE 4NSVA 4WMDA 5EW1H 1AFEH 2AGGX 3S7HB 1Q31A 1UTOA 3PMJA 2XCFA 2GX4A 4HZHA 4BOHA 1O3OA 1HRTH 4ASHA 4JMYA 2R3YA 2BB4A 2FOFA 2I6QA 1AN1E 2D1JA 1D3DB 1O2ZA 1XUIA 3UQVA 2FODA 2YNAA 1GI2A 3VXFH 2FYQA 1WTGH 1GMCF 4CHAC 1O39A 4AFZA 2A4QA 3MU8A 4MTBA 4YOGA 3ZZBA 2R0LA 4BXSA 2A7CA 1XUHA 3AVZA 2XW9A 4UFFH 4LZ1H 1AE8H 1QQ4A 1LHEH 1L0ZA 1LPZB 1C1WH 1KXAA 1C1PA 1CA8B 1HAHH 2ZFSA 2BD4A 5DG6A 1EZQA 4WXVA 1OWIA 1ZLRA 3T28A 2XBWA 1KYNA 2H5CA 2XWBI 3DFJA 1IQHA 5EPNA 1QBVH 5ESBA 3KCGH 2O8MA 2G4TA 1S0QA 2BY5X 2ZECA 4D8NA 2P3FH 4OS4A 2C8XB 1XX9A 3GY6A 1GJDB 3AW0A 1DOJA 4DIIH 1ORFA 2XBYA 1QFKH 3QX5H 1TA2A 2XC5A 1MKWK 1J14A 4KTUA 2QN5T 3GDVA 5LPEA 1H8DH 3RXRA 2O8UA 3EQ0H 3OTJE 1AVWA 3BF6H 1O2TA 1W2KH 2ALVA 1EAWA 3PM3A 3OSYA 4NGAH 1IQIA 4Z0KA 3F9FA 3S0NA 1BBRE 2YOLA 1JIMA 1VJAU 1HAIH 3KIDU 3ATIA 2C8ZB 3ATMA 1YKTA 3VGCC 2ZDVH 4DT7B 1LPKB 1FUJA 1BMMH 1P01A 2W3IA 2PW8H 1JRSA 1ARCA 1TNGA 3U8RH 3RXLA 1EAIA 2BOKA 3MNBA 4CH2B 3QTOH 3O8DA 3UOUA 2ZQ1A 1HAVA 3B23B 2TPIZ 1CA0B 3LONA 1HXEH 2A2XH 1IQKA 2BQ7B 4E05H 1P2KA 1WU1A 3RU4D 1MTSA 3A8AA 2OC1A 1T8NA 1ETSH 5FX5A 1SLUB 1DY9A 2BX3A 1YCPM 1Z6EA 5T3HA 5C1UA 1H4WA 1O5BB 4ZUHA 3URDA 1GJCB 1Z8JB 3MU0A 1A5GH 1RRKA 3BTTE 2ZHQH 3MNCA 4H6TA 4IBLH 2W7SA 1OXGA 5E2PA 2XC4A 5PTPA 4CREA 3GY7A 3BG4C 3PB1E 5JBAS 1SBWA 1DS2E 3RDZA 1C1TA 2OXSA 4YLQH 3T26A 3ZZDA 4U2WA 1GBAA 4RN6A 3VB7A 2ZDMA 4AYVB 1B7XB 2R9PA 4YOJA 2GVFA 2F3CE 1MTUA 4B76A 1ZZZA 1D6RA 4JZDH 3TITA 1O37A 4OS6A 3D49H 1PPBH 2VINA 5FCKA 3H7TA 4ZKOU 1T4UH 2JH5D 1ZMJA 2PKSB