4B2AA

Structure of the factor xa-like trypsin variant triple-ala (tga) in complex with eglin c
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDAGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CATIONIC TRYPSIN
publication title Thermodynamic signatures in macromolecular interactions involving conformational flexibility.
pubmed doi rcsb
source organism Bos taurus
total genus 58
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2aA02
1ZMJA 2R2WU 2J34A 3P70B 1HAHH 1O31A 2FOEA 1NROH 1V2UT 1WSSH 1W0YH 1P09A 2NU4E 1H1BA 2R0KA 3VGCC 1W3CA 4GHTA 1V2TT 2G4TA 1CQQA 4JYVH 1GWAA 4QT8C 3P8GA 2C8YB 1P05A 4XFQA 2K1QA 1BTUA 3TGIE 1V2QT 1KLIH 2FS8A 4CHAB 1GJ6A 5DP3A 6CHAB 4BAQB 2ZHEH 2VWNA 4CBOA 1UVSH 1T31A 2Y5GA 1N6YA 4NWKA 1KXBA 1QA0A 1C5RA 3ITIA 2TRMA 1H8DH 1T7CA 4RKOB 4X8TH 2HPQH 1G37A 1CHOF 2IN2A 3PLBA 3TK9A 1INCA 2Q1JA 2XRCA 1IQIA 2FM2A 2CHAB 3KQEA 3BF6H 1EASA 3AVZA 2VIDA 3RXQA 2CF8H 1QTFA 1TA6A 1EZUC 3T5FH 5BRRE 4IBLH 3D62A 3FAOA 3A8AA 1MH0A 3TGKE 1S0QA 1T4VH 2A45B 4CH8B 3BTGE 1PQ8A 4JZIA 3EA9A 4FU8A 4UFGH 4CBNA 1VZQH 1PPZA 1KTSB 1W7XH 3ZVCA 1NPMA 3QZQA 2FOGA 2ANYA 2AFQB 1O5BB 1ZMNA 3GY4A 3BTME 5EXMA 2FODA 1TX7A 4MPUA 1F5KU 1LPZB 1NFYA 4U2WA 3ZZ4A 4MPVA 1RS0A 5H4IB 2VIOA 1YBWA 1QQ4A 2QN5T 1LPKB 2I6QA 5GPIB 1EAIA 1HB0B 1Y3XA 4X2YA 3A87A 1HAGE 2FYQA 5GXPA 1SGTA 1FQ3A 1TGSZ 3AASA 1G32B 1UK3A 3ELAH 2EA3A 1LHDH 1C1WH 4IMQA 1RIWB 4U30A 5EQSA 5DO4H 1BITA 2WPKS 2Z94A 1AU8A 1MTUA 2ESTE 2ZGBH 2OP9A 4WH6A 2ZC9H 3ZYEA 3KCGH 1S85A 3E16B 1W14U 4ZAEA 2FYRA 2IPHA 1SGEE 1VJ9U 3HKJB 3MO6A 2HRVA 5LGOA 1IQHA 3VXFH 3PMBB 4WXIA 3RXBA 1LDTT 4I8LA 2A31A 1XUKA 1Z8GA 1HJAB 2G5VA 4KKDA 1TX6A 4AFUA 3Q77A 2UWPA 9ESTA 3EYDA 1C5NH 4XOJA 4ZROA 1JRTA 4YTAA 2Q6DA 1V2ST 4AYVB 5J4SA 1F0TA 1EPTC 4HGCA 5EGMA 2BOKA 3MNSA 1K28D 1P57B 3M3TA 4Y7BA 3T26A 3KN2A 1LPGB 1UTPA 1D4PB 1SG8B 4THNH 3TIUA 5A8YA 1AGJA 5A0BA 4J1YA 1TOMH 3ZYDA 4OGXA 5HXFA 1M9UA 1AUTC 4H42U 3RC4A 3TJNA 1TFXA 2B8OH 2OQ5A 1C2FA 1DXPA 1IQMA 2XWBI 1V2WT 3RXJA 1EX3A 4Y10E 2P93A 4YM9A 1V6DA 1ELAA 5F8XA 3MNCA 4DIHH 1KTTB 4JYUH 4UE7H 4UFFH 1GHAF 3MU8A 1GHXH 3SJKA 1EATA 4A6LA 1NM6A 3KL6A 4RSPA 3SV6A 1VGCB 1EB1H 2OQUA 4AFZA 2LPRA 1K1JA 1MKXH 1O5DH 1O2IA 4B76A 2KAIA 3MFJA 3A86A 1HJ9A 1DUAA 1SR5C 1YCPM 3EA8A 1AI8H 2SGAA 1E35B 1Z8JB 1ZR0A 3SUDA 4ABDA 3A88A 2VJ1A 3GCHC 1C4Y2 4GPGA 3LH3A 4K1TA 1BRUP 2R9PA 1YPJH 3DFJA 4YO9A 1PQAA 2PLXA 3A83A 1O3IA 1P2JA 1W11U 1O36A 3KQCA 2OD3B 1YLDA 3NK8A 1A7SA 4RKJB 1XVOA 4BAHB 3PTBA 1UTKA 3RXAA 4AGKA 3RLYH 1GL0E 1D3TB 2G8TA 1Z71A 1K1OA 1YPKH 1LCYA 3QZRA 1GI9B 3ODFA 3MU1A 3BSQA 1W12U 3SU4A 1ELGA 3VB6A 1CHOG 5GJ4B 1GGDB 2AEIH 4INHA 3S9CA 2D26C 5L30H 2A5IA 2FLBH 3VB7A 2A1DB 3RM2H 3O8DA 3M37A 1A5IA 2ZDAH 1V2NT 2ZI2H 2CXVA 3QDZB 4UEHH 2BVXH 1O3EA 3LH1A 2J95A 3SO3A 1HJ8A 3SU0A 1O2JA 3SNAA 2ZGCA 3ZVBA 3M35A 4FUEA 1C5PA 4CRAA 5EPYA 2JH0D 1UCYK 4ISLA 3SU5A 1O3JA 1LHCH 2QIQA 2UWLA 2BX3A 1GG6C 5CMXH 1DE7H 1C5VA 1YPGH 1IAUA 4H4FA 1RTKA 3ODDA 3LGVA 1UHBB 2HLCA 3OY5U 3GDVA 1TABE 5A8XA 2ZTXA 5DKMA 4E06H 1AKSB 5JDUB 1TA2A 3KIDU 1MTSA 1ABJH 2CJIA 4HI3A 2QF3A 3PO1B 4WJG2 1E37B 3SW2B 1TBRH 4F49A 1PPCE 2BLVA 3T25A 1BUIA 2UUFB 2FDAA 4NIXA 1GCDA 1C5TA 1H9LB 1RGQA 1O3PB 1GVKB 5DP5A 3QLPH 2VIPA 3TJOA 1O39A 1FMGA 2H5DA 3PYHA 3FANA 1HAXB 5JB9S 4ASHA 2QAAA 2Z3EA 2OXSA 1HAOH 3RP2A 2FEQH 2GV7A 2VGCC 3A7TA 3MTYA 1VCWA 2Y7ZA 4OGYA 1BMMH 1ZMLA 2AMQA 5T6GA 4AN7A 5EPNA 2SNWA 4UFDH 4LZ1H 4YLUA 1Z1IA 2ZWLH 3SI4H 5CHAC 3I29A 4TWWA 1L2EA 1UTNA 3BTDE 1HAIH 1L0ZA 2IOTA 1QR3E 2VWOA 1FV9A 2XBVA 5JYIA 1IHTH 2BQ6B 4K8YA 5FHTA 2C8WB 1GBHA 1AZ8A 1C2EA 1DWDH 1FZZA 1C5ZB 2V35A 5HM9A 1QY6A 1Z6JH 6LPRA 5G4BA 1LVMA 1AFQC 4I8GA 2XBYA 2VH0A 1XUHA 1OP2A 3O8RA 4UD9H 5E0HA 1NU9A 1D3DB 3GY5A 3TPIZ 5ESTE 2G52A 1TGTA 2BLQA 2TGTA 2VIWA 2BHGA 1QRZA 4D7FA 4Y8ZA 3UTUH 2ULLA 2AMDA 1TLDA 3SJOA 3HATH 1XUJA 2FESH 1C5SA 2VIVA 3SGBE 4ZKNU 3S9AA 2ANWA 3EDXB 3K6YA 2O9QA 2GZ8A 2Y7XA 1ZOMA 1LQEA 1SGFG 1AD8H 1JOUB 1ESAA 1PPEE 3AAVA 4Y0ZE 5FCKA 2ZTZA 1HPGA 3E91A 1S81A 2QXHA 1GHAG 4D8NA 2Y81A 1K1MA 1J8AA 1O2WA 3SUFA 1C5LH 4TYDA 1B0EA 3T29A 2WYGA 1FY1A 1EP5A 1G3BA 1BTWA 3SU3A 3LIWA 4K2YA 4ZXXH 4MNWA 4IC6A 5AVDA 1YP9A 1AE5A 1MAYA 1J16A 4LOYH 3ZVDA 1QJ6B 3A85A 3DA9B 1DWEH 3LGIA 1YYY1 2FLRH 4MTBA 7GCHF 2ZGJA 4ABJA 3RMNH 3STIA 2WPIS 3RXDA 2BZAA 1QL8A 5GDSH 3NUMA 1O2UA 3MMGA 1HXFH 1EB2A 1MKWK 2A7JA 3ENSB 3M61U 3UFAA 1MTVA 2O8LA 1A61H 1IOEA 1N6XA 1XUIA 2ZPRA 1EOLA 1O3LA 1DSUA 3LJJA 1G3CA 1PQ7A 1GBCA 1DM4B 1DLEA 4LK4A 3U69H 1OX1A 1DY9A 1Z7KA 4ISOA 4WH8A 2G5NA 5F03A 3RXFA 2FO9A 1AB9C 1SLVB 4X2XA 2PKSB 4FUGA 3A7VA 2G4UA 1GJBB 5JB8S 1EAXA 4Y0YE 5AFYH 3DFLA 1THSH 3BG4C 2Z3CA 5EOKA 1DANH 1JXPA 5C67A 4Q7XA 2ZZUH 2B9LA 1ANBA 3PWBA 1A5GH 1AMHA 1TMUH 4INLA 4Q7ZA 4BNRA 3MNXA 3MU5A 2BOHB 3VGCB 3G01A 4ZHMU 3TITA 1DPOA 1O3MA 1HGTH 2BX4A 2A4GA 1ZRKA 2XC4A 1SQTA 1YPEH 2A7HA 4JZEH 2CV3A 5A8ZA 4JZDH 1A3BH 1SFQB 1XMNB 1YCPK 2A5KA 1SL3A 3ATLA 3DT0H 4KP0A 3RMLH 3TNSA 2OTVA 2FOAA 3ZZDA 1FUJA 2BD8A 1GHBG 1CGJE 1PPHE 2QYIA 3CS7A 1OWKA 2R0LA 1UVPA 2WUCA 1CA8B 1F7ZA 1TX8A 1QNJA 1ZSLA 4Q80A 2BDBA 2GZ9A 2VB0A 2R3YA 5B6OA 1C4V2 2XNIA 4Z6AH 4Y76A 2W3IA 4JMYA 2H5CA 1G9IE 1HCGA 4X8SH 2GTBA 3ZZAA 2O8UA 3LC3A 1JRSA 1U6QA 2H9HA 4X6NA 1HRTH 1V2OT 2ZG0H 3GY8A 3MOCA 1O2XA 1Q31A 1SGCA 1DUEA 3PROA 1L4DA 2O8TA 1J9CH 1NN6A 2ZA5A 2BD5A 5DG6A 1MQ5A 2ZFPH 1KXEA 4TY7A 1O2MA 1VR1H 3D65E 1QRWA 2C8XB 1WCZA 4NIVA 2FOMB 2HPPH 1ETSH 1HLTH 1ELBA 3HGPA 3O8BA 1Z1JA 2ZF0H 5EODA 5FCRA 5TJXA 4B2BA 1KDQA 2EI8A 3Q00A 1E38B 4MQAA 4BAMB 4DW2U 1OP8A 2A7CA 1W7GH 1ETTH 1EQ9A 1XX9A 1EJAA 4CRCA 1ZTJA 2ZU1A 3BV9B 1DICA 1MTNC 4MLFB 4SGAE 1UO6A 2D8WA 5LPEA 1BJUA 4NSYA 3UR9A 3OSYA 3QO6A 5ESBA 2FIRH 1G3EA 4FUDA 4KTSA 1AIXH 2WPJS 3TH3H 1BBRE 2LNCA 1L1GA 2GD4B 2TGDA 3LKWA 1BTYA 4VGCC 1HIAA 2BYAX 2PKAB 1TIOA 1PJPA 2FOCA 1L1JA 3M36A 4XE4A 2GMTC 1GPZA 4E05H 6GCHF 1MZAA 4GVUA 1HNEE 2J38A 4K69A 5GIBA 1SC8U 2FS9A 2ZGXH 1DSTA 4A7IB 1LQDB 4BOHA 1C2DA 5HYOA 2P59A 1ZHMA 2PW8H 2OC1A 1YC0A 3F9GA 2SGDE 5JPMH 1GI6A 3CS0A 4X1PU 1P2NA 3F6UH 2P8OC 3MU0A 1YLCA 1YPHC 3GYMA 4KTUA 3TK5A 1P03A 4H6TA 2J94A 1SVPA 3P6ZB 1DT2A 4M7GA 4AB8A 1FN6A 2QCYA 1SOZA 5FBIA 2JETC 1OOKB 1T8NA 4I8JA 2VH6A 3KNXA 1O37A 6ESTA 1TONA 1F0SA 4DURA 1EPTB 1THPB 1GDQA 1N8OC 2C4FH 2BY5X 4FUIA 3NWUA 1GI4A 1O2SA 7GCHG 2ZHQH 5C1XA 1GJCB 1J14A 1ELVA 3M3VA 3R3GB 2D1JA 1OWDA 1BRBE 1ABIH 1NS3A 2BY7X 4I32A 2F9BH 2ZFFH 3QWCH 1O5GH 5E2PA 3AAUA 2BY6X 1HFDA 1KXAA 1V2KT 3U9AH 4DY7B 3T62A 2HNTC 2CGAA 2XYAA 1GBJA 3F1SB 2GCHF 5DP7A 2GDDA 4ABHA 1Q3XA 4MNXA 4NA8A 1DX5M 1GCTC 2B7DH 2PTNA 2OUAA 1ZHPA 4FXGH 1TALA 5E0JA 1VITF 4B2CA 4TPIZ 1PYTD 1B7XB 1HYLA 1O3DA 1AO5A 2CN0H 2GGVB 1C5WB 1TNIA 4GLYA 1BHXF 3GCHB 4IMZA 4YZUA 1MBQA 4Y79A 1SLUB 4X8UH 3GY6A 3SGQE 1SBWA 3UQOA 4KTCA 2VVCA 3EAJA 4U32A 1T8OA 3EQ0H 3MH4A 1OWHA 2A2QH 4K5ZA 5GWZA 3H7TA 1QCPA 2DUCA 2AGGX 1WU1A 1EOJA 3RXUA 2BD7A 1NRPH 1LKBA 1F0RA 1O5CB 1O2PA 1P2MA 1WOFA 1A2CH 1TE0A 5IYTA 3UWJH 1ZTKA 1DVAH 1P02A 2ZQ1A 2ZU2A 2CHAC 1BJVA 1CT4E 2ZDVH 4ZMAH 2NU2E 3MWIU 2BVSH 1TRYA 4TWYA 1ZSJA 2Y80A 2A32A 1GJAB 2BQWB 2GT7A 4JYTA 3TLOA 5E0GA 5FPSA 1ELEE 3OYPA 1MTWA 1FPCH 5EXNA 3SZNA 4AB9A 1ZTLA 1YCPH 4Q2KA 3ZZ8A 3BIVH 1ARBA 5FPYA 1GBMA 1C5UA 1A3EH 1VITH 3UPEA 1FJSA 1K1NA 3FVFB 4Y8XA 5K0HA 1O3HA 3BEFB 1P06A 3DD2H 1GG6B 1O5FH 2ZDNA 1O5AB 3EE0B 3Q76A 1K1PA 1SMFE 1BMLA 2AMPA 4MDSA 3STJA 2G81E 1SGQE 2VU8E 4WXVA 1IQEA 9LPRA 4AOQA 1HAPH 5DP9A 7LPRA 3ATIA 3LGYA 1OXGA 2HVXA 1O3GA 3PMHB 3SJ9A 1BBRH 1ZLRA 1GJDB 2ZFSA 3P8OA 4TY6A 5L2YH 4BXWA 4ABIA 3RC5A 1BA8B 1EZSC 1NFWA 4NWLA 1GBTA 2BD3A 3A80A 3TGJE 3E8LA 2GDEH 1KIGH 1SSXA 2ZECA 1SOTA 1PYTC 4BXSA 1ESTA 1JBUH 1RIWC 2V0BA 1C1OA 4OS6A 3A82A 2VGCB 5F8TA 6GCHG 4A92A 1GMCF 2FP7B 1K9OE 3GICB 2WYJA 2ODPA 1DITH 5EW2H 3P8NA 5CHAB 5JBTA 1SHHB 2BM2A 1H4WA 3PWCA 1UMAH 1EJMA 4UONA 1ZRBA 3K65B 4HTCH 2Z6BD 1BRAA 2GX4A 2XCFA 2JH5D 3RXOA 2OC0A 2ALPA 1S6FA 2QF0A 4A1VA 2VVVA 3UY9A 1AVXA 3SU1A 1DWCH 4CR5A 3EGKH 1AFQB 3OU0A 2ILNA 4K8BA 3UNQA 1FPHH 1GBEA 1O3BA 1O2NA 2Y6TA 1ID5H 2VVUA 4AFSA 3O8CA 3RXGA 1ZYOA 3RXRA 1O3KA 3SNEA 1ELCA 1H8IH 1FY5A 3A7YA 1ORFA 3RU4D 1O32A 4MG3A 1BOQA 2OC7A 3M7UA 1O34A 2ZFTA 2ZDKA 4WY3A 4MPWA 1FI8A 1NRSH 1Y3UA 1P04A 3VXEH 2NU3E 1ARCA 5A0AE 1D9IA 2ZU5A 2SGPE 1G2MA 1GHZA 2PTCE 4NIWA 2C8ZB 1C2KA 3IWMA 3Q3KA 4PROA 2GCHG 1BHXB 2QC2A 3LONA 3F68H 5LPRA 2AS9A 2F9OA 1EAWA 1BDAA 2UWOA 3SJ8A 1OPHB 3A84A 1ACBE 8GCHF 2J4IA 3RXCA 2DE9A 3VB5A 1AQ7A 1UVOA 1HDTH 4YOJA 4X6PA 3A89A 1A46H 2OCVB 1UCYE 1L1NA 1TPOA 3SUGA 4FVBA 2VIQA 1HAVA 1QBOA 3ZVAA 5C3NA 4MNVA 2EEKA 5FX5A 3BN9A 2FOHA 3VPKA 2HGTH 3UUZA 3PLKA 1UTOA 3SBKA 2PHBA 3U8TH 1AE8H 1EXFA 2ZIQH 4MPXA 1TGCA 1SGPE 1PQ5A 1KXDA 1F5LA 1FIWA 1OYTH 1P2QA 5T6FA 1FAKH 1GJ8B 1OWJA 2G00A 4DJZB 3UR6A 5CE1A 1C9PA 1A0JA 3VB3A 1DXWA 4WMFA 1IQLA 4FUFA 1WBGB 3L3TA 1JIMA 5C5NA 1O2RA 3T28A 2OC8A 5FXLA 5DK1A 3UREA 1TB6H 5A0CA 4JK6A 3S7KB 2WPMS 3NCLA 1XM1A 2XC5A 4BTTB 4F4OC 3RXMA 1C2MA 3RXEA 8KME2 1BCUH 1O3OA 1TPPA 1AB9B 4NGAH 4R8TB 1LHGH 1QBNA 3FZDA 2ZGHA 3E0PB 2SNVA 1BTHH 3RMOH 3SGAE 4NA7A 3SORA 3BG4B 4YOGA 1C1VH 4JZFH 5DGJA 1SB1H 2HNTF 3ZZ7A 1GHYH 2THFB 2BDIA 2FOFA 2SGEE 2BD2A 2QV1A 4OS1A 1MU6B 2F9PA 1W8BH 2TIOA 1F92A 2GT8A 2PV9B 3MO3A 1SHYA 5I46H 1ANEA 2ZDLA 2WV5A 4INKA 3S7HB 2OLGA 3GY7A 3UWIA 3V3MA 2SGQE 1PPGE 2XTTB 2C90B 1K2I1 1MBMA 1QQUA 2BDHA 3RDZA 5FBEA 1GBFA 2ASUB 2BDGA 1UTQA 5JBCS 1WV7H 2XCNA 3U1IB 1XKAC 1TNLA 1THRH 1TAWA 1DY8A 3MI4A 4X2VA 1K22H 4X8VH 1QRXA 2FWWA 3QGNB 3OX7U 3PTNA 1SGDE 1O0DH 2Z7FE 1GDNA 5EG4A 1BB0B 1G30B 2GP9B 1LHEH 3CP7A 2F3CE 1T4UH 5FAHA 4K1SA 1QL9A 4ZUHA 4X1RU 1GMCG 4GCHF 3FFGA 2AGEX 5ABWA 2KAIB 4WMDA 3NPSA 2PSYA 2UUJB 4Y6DA 4H6SB 3SV9A 3BTHE 1V3XA 4CR9A 3HGNA 2ANKH 1X7AC 1QB9A 1ZPBA 4ZH8A 1CU1A 2NWNA 3FP8E 3MH7A 1CGHA 2F91A 2GCTC 4OS5A 1P2IA 2EC9H 1WAYB 2QY0B 3BG8A 4GSOA 3BTKE 4ISNA 2V3OH 2B0FA 1CGIE 5DJ7A 5FPTA 1MTNB 1FLEE 1DS2E 3PMAB 4O3UA 3WY8A 1JMOH 1RD3B 1O2KA 1W2KH 3W95A 3URDA 5EXLA 3A7ZA 1AN1E 1CBWC 1CO7E 1QURH 3SQHE 1C1QA 2A4OA 2ZCLP 3GYLB 3SV8A 3TH4H 4DOQA 2QXGA 1GMHF 3Q3XA 2FOBA 4VGCB 3A8BA 3RXHA 4IN1A 1S0RA 2ZPSA 1ZHRA 1KYNA 2GMTB 1O3FA 5K7RA 2XBWA 2WINI 1T8LA 4D9QA 1HBTH 1N1LA 2WV4A 3SJIA 1Y3WA 3V7TA 5C1UA 1UCYH 3ZV8A 3SU6A 1G2LA 3TJUA 3ZVEA 4AG2A 1UK4A 5SGAE 1JIRA 1YPLH 8GCHG 2PGBB 2BXTH 1SGRE 2G55A 2YNBA 2ZFRH 1C2LA 4HZHA 1TRNA 4O97A 2BVRH 1BIOA 1BMNH 1EUFA 4OS7A 2UUKB 2JETB 1P10A 4XDEA 1AWFH 3GCTF 8ESTE 2D2DA 5EQQA 2AH4X 1ZJKA 4U01A 1AVGH 3TH2H 3K6ZA 3TK6A 1MKXK 3JZ2B 1ELFA 1QJ1B 1Y5BT 1LKAA 4D9RA 2BTCE 1XKBC 1ZPCA 2ALVA 2O8MA 3A81A 1BRCE 2FI5E 5AF9H 3SV2H 1CA0C 3GCOA 2AIQA 2EI7A 2Z9KA 2P16A 2RG3A 3F9HA 2G51A 1NRRH 3M7QA 1K21H 4AORA 2PUQH 2F9VA 2TGPZ 4IC5A 4AFQA 2PWXA 1EZXC 2BB4A 1NZQH 2P94A 1TNKA 4AYYB 2WUBA 5E8EH 1HAVB 1P12E 1GCTB 1L4ZA 4ABEA 4DG4A 3LJOA 1MCVA 2ANMH 1C2JA 1AVWA 1TBZH 4K60A 3ZVGA 1OS8A 1P9UA 1HAZB 7KMEH 1AZZA 4IN2A 3NZIA 4Y7AA 4FU9A 1LVOA 1NRNH 1GHVH 1ELTA 3UNRA 1BTXA 4X6MA 1AWHB 1QHRB 1F0UA 1DDJA 1RRKA 2JKHA 1C1SA 3B23B 2H9EH 4SGBE 1SLWB 3S69A 4ABBA 1FXYA 1DFPA 1Z8RA 1QL7A 2GKVE 1QA7A 3RUOA 3BIUH 3D49H 4I7YH 2H2ZA 4IW4E 1J15A 2P3TB 3P17H 2Z9LA 4YT6H 5T6DA 4B1TA 5PTPA 5FX6A 1CT0E 1A5HA 1PFXC 5ETXA 4E7RG 4NA9H 1SQAA 4X1QU 2H6MA 3P8FA 3GY2A 3MU4A 2ZU3A 4XBCA 1MU8B 1V2RT 1UHBA 1GBBA 2P3UB 1A1RA 4B71A 4A5TS 3MYWA 1AKSA 1H9HE 3K9XB 3RXTA 1Y3VA 3RMMH 4ZHLU 3SU2A 1ETRH 5HMAA 1Z8IB 3LGUA 3VB4A 2YOLA 3H5CB 3JZ1B 2Z9JA 3RU4T 2FTLE 4B73A 2ZDMA 4GCHG 2ZHFH 1XXFA 2TPIZ 3MO9A 2SFAA 4AZ2B 2FX6A 3M7TA 2ZNKH 1XXDA 3U1JB 1S83A 3C1KA 4I31A 1QB6A 2Y5FA 2BY9X 4DGJA 3KF2A 1TWXB 1IHSH 2FI3E 3LU9B 1UTLM 4A1TA 2BQ7B 1NFXA 2FTMA 3SHCH 3BTTE 1GI0A 3F9EA 2TBSA 2J2UA 1HXEH 1A0LA 1O30A 1TMTH 4X1SU 4GAWA 2UUYA 2BDAA 3I77A 2BD9A 2Z3DA 5I25A 1KLJH 1OWIA 4JCNA 1MKWH 1O2HA 1C2IA 1GVZA 3P92A 4DT7B 1O2TA 2XXLA 4CHAC 2PUXB 2QA9E 2FI4E 3KQDA 6CHAC 4XBDA 3PLPA 1UJ1A 4ZKSU 1P2KA 1OP0A 1GMHG 1SGFA 4JZ1A 5A2MH 3SI3H 3M3SA 1MQ6A 5F8ZA 1Z6EA 1O3AA 1D6RA 3SNBA 1O3CA 5DP4A 2HOBA 4O3TA 1SGNE 1E0FD 4X2WA 4B2AA 3AW1A 4GUXA 4NZQA 4UDWH 1RJXB 1YKTA 1C5YB 5DPAA 3ATKA 3E1XB 3QUMP 3RLWH 5E2OA 1P9SA 4YOIA 1O2VA 5HGGA 2ODQA 4TPYA 3ATMA 4ZHAA 1O33A 1FY3A 4J2YB 1C9TA 3ATWA 3LGWA 1A0HB 3GCTG 3PV4A 1GVLA 4O03A 1XVMA 1C5MD 1SGIB 2VNTA 3M5LA 4UFEH 2FX4A 3QTOH 1GMDF 3UOPA 2OINA 4CH2B 3QK1A 1AUJA 4NCYA 3W94A 1EJNA 3SOSA 2PGQB 3P95A 1MD8A 1QGFA 3KQBA 4BAOB 1TBQH 1VJAU 4O9VA 1TYNA 1A4WH 3TJVA 1KXCA 4MVNA 3H7OA 3ESTA 1GI1A 2C3SA 3KGPA 4NFEA 4D7GA 1LO6A 1NC6A 1V2PT 2ZHDA 3M5OA 1QB1A 2BDYA 4X6OA 2H1UA 3A8CA 3RXSA 1W13U 1Y59T 3V13A 4Q7YA 1TNJA 1EZQA 5GCHF 3URCA 2W26A 1J17T 1GI7B 3SN8A 2A0QB 3KEEA 1TQ0B 2BLWA 4ISHH 2C93B 1GBIA 1UTJA 1Y8TA 5T3HA 1YPHE 1NT1A 4DVAU 3E6PH 4FUCA 5L2ZH 3V12A 1S84A 1TOCB 3ZZCA 4FUHA 1KDQB 1ZZZA 4NG9H 3D23A 3TU7H 4I8KA 1TGBA 1C1MA 1TQ7B 1WQSA 4KELA 1FY8E 5EQRA 2A4RA 2RCEA 3QN7A 1C5XB 1HJAC 3ZV9A 3GDUA 1S82A 1VCQA 4KGAA 3RM0H 3RXIA 1C1RA 1B0FA 1RTLA 3BTQE 1ZSKA 3ZZ5A 1IQNA 4K3JA 3GY3A 3U8RH 4LXBH 2ZU4A 1GI8B 1LVBA 1WYKA 1MAXA 1T8MA 2ODYB 1HIAB 2ZQ2A 1D3PB 1C2GA 3U98H 1SLXB 1YM0A 2F9NA 3UIRA 5F6MA 1HUTH 2HNTE 2VWLA 1ZGVA 1GBAA 3QX5H 3B8JA 1KY9A 4K1EA 3SHAH 4CRGA 1B5GH 1GI5A 3BEUA 3SUEA 7ESTE 3M5NA 3ZVFA 1IQFA 2XW9A 1W0ZU 1O2GH 1SFIA 4NIYA 5JBBS 1FN8A 1FNIA 4ABGA 1E34B 4ABAA 1NRQH 1UTMA 3RXLA 4R0IA 5EU8A 3T27A 1O2ZA 1P8VC 2J9NA 3LC5A 3F9FA 1FDPA 1TRMA 1W10U 3MH6A 3FP7E 4B74A 4IS5A 1VGCC 1C1NA 4JK5A 1PPFE 1LVYA 1Y5UT 1EP6A 1NFUA 1SQOA 4ESTE 1QFKH 1OWEA 4BANB 3C27B 1VITG 1AFEH 1WTHD 2GV6A 1O38A 2BD4A 1GHBF 2HWLB 3OTJE 2WPHS 3VEQB 1SPJA 3BTWE 2J92A 1FY4A 3MHWU 2STBE 2TGAA 2HALA 4ZKOU 2BZ6H 3PMJA 3ZZ9A 1P3CA 4FUJA 1WUNH 1KXFA 5DP8A 3S9BA 1MZDA 2XWAA 3SV7A 1K1IA 1C5OH 2ZHWH 4ISIH 2W7UA 2BMGB 1GGDC 2W3KA 1DWBH 3TVJB 2P95A 4CRFA 5J4QA 2QXIA 1C5QA 1D3QB 1DLKB 1NU7B 3SNDA 2BLOA 2PKAA 4XSKU 1BTPA 4LZ4B 2W7SA 1LHFH 4OS2A 2AYWA 3SNCA 2OBOA 1S5SA 1TNGA 4B75A 1XUGA 3U8OH 2GCTB 2O8WA 1GL1A 3E3TA 3MNBA 2ZCHP 1EKBB 2V6NA 3GDSA 1TPAE 2FPZA 1C1UH 1NESE 2FMJA 2ZKSA 1SI5H 2QGRA 1UK2A 1ESBA 1BMAA 1QBVH 2FZZA 4DCDA 3LT3A 3QTVH 3RXVA 1RXPA 1GMDG 4Y11E 1P2OA 5AHGH 5C1YA 2BY8X 3TNTA 1SGYE 1K1LA 1F2SE 4BTIB 2BDCA 2CMYA 4A1XA 1CBWB 1F5RA 3R0FA 1JWTA 1P0SH 1KLTA 3A7WA 1BQYA 1GJ7B 3Q3YA 1ZJDA 1EPTA 3HPTB 3PO1C 3GCNA 1D6WA 1IQGA 1O2YA 3BTFE 2OBQA 1V2LT 5LH8A 2XBXA 4NZLA 4FUBA 1UVTH 1GI2A 1MCTA 1LTOA 2QXJA 1GDUA 2STAE 3V0XA 4I33A 1KSNA 3SQEE 5GCHG 4BAKB 3UOUA 1O5EH 2SGFE 5C2ZA 3IG6B 1FONA 4NSVA 1GJ5H 5L6NH 3I78A 1V2MT 1OSSA 4XBBA 2A4QA 4WF8A 2Y82A 3L6PA 1GI3A 1GHWH 2ZP0H 1NTPA 2DE8A 2XC0A 3EA7A 4Y71A 3IITA 1H9IE 4D76A 1NY22 1CVWH 2V3HH 4ABFA 2ZFQH 2ZTYA 5IDKA 2JH6D 1T32A 2RA0A 2H9TH 3KHVA 5C5OA 1GBDA 3ZZBA 3BEIB 2PFEA 1ANCA 2R3UA 2W5EA 4Z0KA 2EI6A 2Z9IA 2ZPQA 2R2MB 1IQKA 1MUEB 3UQVA 4CRDA 4IGDA 1CA0B 2NU1E 2VINA 1GJ4H 2A2XH 1WQVH 2Q6GA 8LPRA 3HK3B 3QGJA 1TPSA 3UNSA 1FIZA 3ZZ3A 1G3DA 2M5TA 1ELDE 2BXUH 2AIPA 2Z9GA 1YPMH 1E36B 2CF9H 4CREA 4YT7H 1RTFB 1P11E 5DP6A 5C20A 2PSXA 2YNAA 1TNHA 3PB1E 1XUFA 1YGCH 3LPRA 1V2JT 2RDLA 4Y8YA 4YESB 3T2NA 4WVPE 1VCPA 2FXRA 3LDXH 1O3NA 5A09A 2GVFA 1OKXA 3BTEE 2VWMA 3K2UA 1GBLA 1Q2WA 3E90B 1O35A 2ZCKP 2F83A 3OY6U 3MH5A 3RXPA 4WMEA 3DUXH 1O2LA 1G36A 2P3FH 1DOJA 4AX9H 2NU0E 2ZEBA 2I6SA 1AY6H 4MNYA 3E0NB 4AG1A 1S6HA 1AHTH 5LPFA 4HFPB 1IQJA 1GBKA 1C4U2 1Y3YA 2WPLS 1C2HA 3VFEA 1MD7A 3FP6E 4NFFA 1BTZA 2P8OB 2B5TB 1MMJN 1LMWB 2PR3A 1TMBH 2Y5HA 4ZKRU 1HV7A 1EAUA 3GISB 5JBAS 4GHQA 1UVUH 1RFNA 1V2VT 4BTUB 1C1TA 3RC6A 3N7OA 1CT2E 1O2OA 1ZPZA 5EW1H 3HK6B 5TCAA 4DIIH 3A8DA 4X0WU 3DHKH 1ZGIA 1YF4A 3PM3A 4YLQH 1BZXE 1O2QA 1Y5AT 4WWYA 1PPBH 1OYQA 3LGTA 4OS4A 1N8OB 4ZXYH 3M5MA 3CENA 3LOXA 1CHGA 1QJ7B 4E7NA 2AGIX 1BBRK 4AGJA 3ZZ6A 3FZZA 1C1PA 1NO9H 5HM2A 1P3EA 3S0NA 1HAYB 1CSOE 4RN6A 3NXPA 2A5AA 2Q6FA 4I8HA 1WTGH 2ZO3H 3L33A 4FU7A 2AERH 3HKIB 1P01A 2F9UA 3RXKA 3AW0A 1TGNA 1QIXB 4X1NU 1FAXA 2IJOB 3A7XA 1ANDA 5BPEA 1CE5A 4FVDA 1GJ9B 2PKSC 3RU4E 3B9FH 3NKKA 2RA3A 5AFZH 5TCCA 4CRBA 2GZ7A 3GOVB 1BT7A
chains in the Genus database with same CATH superfamily
1ZMJA 2R2WU 2J34A 3P70B 1HAHH 1O31A 2FOEA 1NROH 1V2UT 1WSSH 5F53A 1W0YH 2HLDD 2WPDD 1P09A 2NU4E 1H1BA 2R0KA 3VGCC 1W3CA 4GHTA 1V2TT 2G4TA 1CQQA 4JYVH 1GWAA 4QT8C 3P8GA 2C8YB 1P05A 2K8IA 4XFQA 2K1QA 1BTUA 3TGIE 1V2QT 1KLIH 2FS8A 4CHAB 1GJ6A 5DP3A 6CHAB 4BAQB 2ZHEH 2VWNA 4CBOA 1UVSH 1T31A 2Y5GA 1N6YA 4NWKA 1KXBA 1QA0A 1C5RA 3ITIA 2TRMA 1H8DH 1T7CA 3N99A 4RKOB 4X8TH 2HPQH 1G37A 2PP6A 1CHOF 4ASUD 2IN2A 3PLBA 3TK9A 1INCA 2Q1JA 2XRCA 1IQIA 2FM2A 2CHAB 3KQEA 3BF6H 1EASA 3AVZA 2VIDA 3RXQA 2CF8H 1QTFA 1TA6A 1EZUC 2JJ2D 3T5FH 5BRRE 4IBLH 2RFKC 3D62A 3FAOA 3A8AA 1MH0A 3TGKE 1S0QA 1T4VH 2A45B 4CH8B 3BTGE 1PQ8A 3UB0A 4JZIA 2M2AA 3EA9A 4FU8A 4UFGH 4CBNA 1VZQH 1PPZA 1KTSB 1W7XH 3ZVCA 1NPMA 3QZQA 2FOGA 2ANYA 2AFQB 1O5BB 1ZMNA 3GY4A 3BTME 5EXMA 2FODA 2JDID 1TX7A 4MPUA 1F5KU 1LPZB 1NFYA 4U2WA 3ZZ4A 4MPVA 1RS0A 5H4IB 2VIOA 1YBWA 1QQ4A 2QN5T 1LPKB 2I6QA 5GPIB 1EAIA 1HB0B 1Y3XA 4X2YA 3A87A 1HAGE 2FYQA 5GXPA 1SGTA 1FQ3A 1TGSZ 3AASA 1G32B 1UK3A 3ELAH 2EA3A 1LHDH 1C1WH 5C0UA 2V7QD 4IMQA 1RIWB 4U30A 5CDFE 5EQSA 5DO4H 1BITA 2WPKS 2Z94A 1AU8A 1MTUA 2ESTE 2ZGBH 3FOAA 2OP9A 4WH6A 2ZC9H 3ZYEA 3KCGH 1S85A 3E16B 1W14U 4ZAEA 3WW7A 2FYRA 2IPHA 1SGEE 1VJ9U 3HKJB 3MO6A 2HRVA 5LGOA 1IQHA 2KM0A 3VXFH 3PMBB 4WXIA 3RXBA 1LDTT 4I8LA 2A31A 1XUKA 1Z8GA 1HJAB 2G5VA 4KKDA 1TX6A 4AFUA 3Q77A 2UWPA 9ESTA 3EYDA 1C5NH 4XOJA 4ZROA 1JRTA 4YTAA 2Q6DA 1V2ST 4AYVB 5J4SA 1F0TA 1EPTC 4HGCA 5EGMA 2BOKA 3MNSA 1K28D 1P57B 3M3TA 4Y7BA 3T26A 3KN2A 1LPGB 1UTPA 1D4PB 1SG8B 4THNH 3TIUA 5A8YA 1AGJA 5A0BA 4J1YA 1TOMH 3ZYDA 4OGXA 5HXFA 1M9UA 1AUTC 4H42U 3RC4A 3TJNA 1TFXA 2B8OH 2OQ5A 1C2FA 1DXPA 1IQMA 2XWBI 1V2WT 3RXJA 1EX3A 4Y10E 2P93A 4YM9A 1V6DA 1ELAA 5F8XA 3MNCA 4DIHH 1W0JD 1KTTB 4JYUH 4UE7H 4UFFH 1GHAF 3MU8A 1GHXH 3SJKA 1EATA 4A6LA 1NM6A 3KL6A 4RSPA 3SV6A 1VGCB 1EB1H 2OQUA 4AFZA 2LPRA 1K1JA 1MKXH 1O5DH 1O2IA 4B76A 2KAIA 3MFJA 3A86A 1HJ9A 1DUAA 1SR5C 1YCPM 3EA8A 1AI8H 2SGAA 1E35B 1Z8JB 1ZR0A 3SUDA 4ABDA 3A88A 2VJ1A 3GCHC 1C4Y2 4GPGA 3LH3A 4K1TA 1BRUP 2R9PA 1YPJH 3DFJA 4YO9A 1PQAA 2PLXA 3A83A 1O3IA 1P2JA 1W11U 1O36A 3KQCA 2OD3B 1YLDA 3NK8A 1A7SA 4RKJB 1XVOA 4BAHB 3PTBA 1UTKA 3RXAA 4AGKA 3RLYH 1GL0E 1D3TB 2G8TA 1Z71A 1K1OA 1YPKH 1LCYA 3QZRA 1GI9B 3ODFA 3MU1A 3BSQA 1W12U 3SU4A 1ELGA 3VB6A 1CHOG 5GJ4B 1GGDB 2AEIH 4INHA 3S9CA 2D26C 5L30H 2A5IA 2FLBH 3VB7A 2A1DB 3RM2H 3O8DA 3M37A 1A5IA 2ZDAH 1V2NT 2ZI2H 2CXVA 3QDZB 2WV9A 4UEHH 2BVXH 1O3EA 5DN6D 3LH1A 2J95A 3SO3A 1HJ8A 3SU0A 1O2JA 3SNAA 2ZGCA 3ZVBA 3M35A 4FUEA 1C5PA 4CRAA 5EPYA 2JH0D 1UCYK 4ISLA 3SU5A 1O3JA 1LHCH 2QIQA 2UWLA 5FL7D 2BX3A 1GG6C 5CMXH 1DE7H 1C5VA 2QE7D 1YPGH 1IAUA 4H4FA 1RTKA 3ODDA 3LGVA 1UHBB 1NBMD 2HLCA 3OY5U 3GDVA 1TABE 5A8XA 2ZTXA 5DKMA 4E06H 1AKSB 5JDUB 1TA2A 3KIDU 1MTSA 1ABJH 2CJIA 4HI3A 2QF3A 3PO1B 4WJG2 1E37B 3SW2B 1TBRH 4F49A 1PPCE 2BLVA 3T25A 1BUIA 2UUFB 2FDAA 4NIXA 1GCDA 1C5TA 1H9LB 1RGQA 1O3PB 1GVKB 5DP5A 3QLPH 2VIPA 3TJOA 1O39A 1FMGA 2H5DA 3PYHA 3FANA 1HAXB 5JB9S 4ASHA 2QAAA 2Z3EA 2OXSA 1HAOH 3RP2A 2FEQH 2GV7A 2VGCC 3A7TA 3MTYA 1VCWA 2Y7ZA 4OGYA 1BMMH 1ZMLA 2AMQA 5T6GA 4AN7A 5EPNA 2SNWA 4UFDH 4LZ1H 4YLUA 1Z1IA 2YMSD 2ZWLH 3SI4H 2IJD1 5CHAC 3I29A 4TWWA 1L2EA 1UTNA 5GNDA 3BTDE 1HAIH 1L0ZA 2IOTA 1WXRA 1QR3E 2VWOA 1FV9A 2XBVA 5JYIA 1IHTH 2BQ6B 4K8YA 5FHTA 2C8WB 1UW7A 1GBHA 1AZ8A 1C2EA 1DWDH 1FZZA 5KECA 1C5ZB 2V35A 5HM9A 1QY6A 1Z6JH 6LPRA 5G4BA 2KFWA 1LVMA 1WDIA 1AFQC 4I8GA 2XBYA 2VH0A 1XUHA 1OP2A 3O8RA 4UD9H 5E0HA 1NU9A 1D3DB 3GY5A 3EE7A 3TPIZ 5ESTE 2G52A 4B6FA 1TGTA 2BLQA 2TGTA 2VIWA 2L74A 2BHGA 1QRZA 4D7FA 4Y8ZA 3UTUH 2ULLA 2AMDA 1TLDA 3SJOA 3HATH 1XUJA 2FESH 1C5SA 2VIVA 3SGBE 1H8ED 4ZKNU 2RDEA 2ANWA 3S9AA 3EDXB 3K6YA 2O9QA 2GZ8A 2Y7XA 3DSGA 1ZOMA 1LQEA 1SGFG 1AD8H 1JOUB 1ESAA 1PPEE 2JJ1D 3AAVA 4Y0ZE 5FCKA 2ZTZA 1HPGA 3E91A 1S81A 2QXHA 1GHAG 4D8NA 2Y81A 1K1MA 1J8AA 4ACBA 1O2WA 3SUFA 1C5LH 4TYDA 1B0EA 3T29A 2WYGA 2J98A 1FY1A 1EP5A 1G3BA 1BTWA 3SU3A 3U28C 3LIWA 4K2YA 4ZXXH 4MNWA 4IC6A 5AVDA 1YP9A 1AE5A 1MAYA 1J16A 3F2HA 4LOYH 3ZVDA 1QJ6B 3A85A 3DA9B 1DWEH 3LGIA 1YYY1 2FLRH 4MTBA 7GCHF 2ZGJA 4ABJA 3RMNH 3STIA 2WPIS 3RXDA 2BZAA 3W1EA 1QL8A 5GDSH 2YMSC 2W6JD 3NUMA 1O2UA 3MMGA 1HXFH 1EB2A 1MKWK 2A7JA 3ENSB 3M61U 5DSFA 3UFAA 1MTVA 2O8LA 1A61H 1IOEA 1N6XA 1XUIA 2ZPRA 1EOLA 1O3LA 1DSUA 3LJJA 1G3CA 4P00A 1PQ7A 1GBCA 1DM4B 1MABB 1DLEA 4LK4A 3U69H 1OX1A 1DY9A 1Z7KA 4ISOA 4WH8A 2G5NA 5F03A 3SYJA 3RXFA 2FO9A 1AB9C 1SLVB 4X2XA 2PKSB 4FUGA 3A7VA 2G4UA 1GJBB 5JB8S 1EAXA 4Y0YE 5AFYH 3DFLA 1THSH 3BG4C 2Z3CA 5EOKA 1DANH 1JXPA 5C67A 4Q7XA 2ZZUH 2B9LA 1ANBA 3PWBA 3DCLA 1A5GH 1AMHA 1TMUH 4INLA 4Q7ZA 4BNRA 3MNXA 3FO8D 3MU5A 2LELA 2BOHB 3VGCB 3G01A 4ZHMU 3TITA 1DPOA 1O3MA 3PV2A 1HGTH 2BX4A 2A4GA 1ZRKA 2XC4A 1SQTA 1YPEH 2A7HA 4JZEH 2KCOA 2CV3A 5A8ZA 4JZDH 1A3BH 1SFQB 1XMNB 1YCPK 2A5KA 1SL3A 3ATLA 3DT0H 4KP0A 3RMLH 3TNSA 2OTVA 2FOAA 3ZZDA 1FUJA 2BD8A 1GHBG 1CGJE 1PPHE 2QYIA 3CS7A 1OWKA 2R0LA 1UVPA 2OK5A 2WUCA 1CA8B 1F7ZA 1TX8A 1QNJA 1ZSLA 4Q80A 2BDBA 2GZ9A 2VB0A 2R3YA 5B6OA 4OM9A 1C4V2 2XNIA 4Z6AH 4Y76A 2W3IA 4JMYA 2H5CA 1G9IE 1HCGA 4X8SH 2GTBA 3ZZAA 2O8UA 3LC3A 1JRSA 1U6QA 2H9HA 4X6NA 2QF5A 1HRTH 1V2OT 2ZG0H 3GY8A 3MOCA 1O2XA 1Q31A 1SGCA 1DUEA 3PROA 1L4DA 3PV5A 2O8TA 1J9CH 1NN6A 2ZA5A 2BD5A 5DG6A 1MQ5A 2ZFPH 1KXEA 4TY7A 1O2MA 1VR1H 3D65E 1QRWA 2C8XB 1WCZA 4NIVA 1OHHD 2FOMB 2HPPH 1ETSH 1HLTH 1ELBA 3HGPA 3O8BA 1Z1JA 2ZF0H 5EODA 5FCRA 5TJXA 4B2BA 1KDQA 2EI8A 3Q00A 1E38B 4MQAA 4BAMB 4DW2U 1OP8A 2A7CA 1W7GH 1ETTH 1EQ9A 1XX9A 1EJAA 4CRCA 1ZTJA 2ZU1A 3BV9B 1DICA 1MTNC 3OAAD 2WSSD 4MLFB 4SGAE 1UO6A 3F0OA 2D8WA 5LPEA 1BJUA 4NSYA 3UR9A 5C17A 3OSYA 3QO6A 5ESBA 2FIRH 1G3EA 4FUDA 4KTSA 1AIXH 2WPJS 3TH3H 1BBRE 4Q63A 2LNCA 1L1GA 2GD4B 2TGDA 3LKWA 1BTYA 4VGCC 1HIAA 2BYAX 2PKAB 1TIOA 1PJPA 2FOCA 1L1JA 3M36A 2QF4A 2GMTC 4XE4A 1GPZA 3UAIC 4E05H 6GCHF 4AC9A 1MZAA 4GVUA 1HNEE 2J38A 4K69A 5GIBA 1SC8U 2FS9A 2ZGXH 1DSTA 4A7IB 1LQDB 4BOHA 1C2DA 5HYOA 2P59A 1ZHMA 2PW8H 2OC1A 1YC0A 3F9GA 2SGDE 3WWFA 5JPMH 1GI6A 3CS0A 4X1PU 1P2NA 3F6UH 2P8OC 3MU0A 1YLCA 1YPHC 3GYMA 4KTUA 3TK5A 1P03A 4H6TA 2J94A 1SVPA 3P6ZB 1DT2A 3CNRA 4M7GA 4AB8A 1FN6A 2QCYA 1SOZA 5FBIA 2JETC 1OOKB 2L6OA 1T8NA 4I8JA 2KCPA 2VH6A 3KNXA 1O37A 6ESTA 1TONA 1F0SA 4DURA 1YWUA 1EPTB 1THPB 1GDQA 1N8OC 2GJGA 2C4FH 2BY5X 3N7DA 4FUIA 3NWUA 1GI4A 1O2SA 7GCHG 2ZHQH 5C1XA 1GJCB 1J14A 1ELVA 3M3VA 3R3GB 2D1JA 1OWDA 1BRBE 1ABIH 1NS3A 2BY7X 4I32A 2F9BH 2ZFFH 3QWCH 1O5GH 5E2PA 3AAUA 2BY6X 1HFDA 1KXAA 1V2KT 3U9AH 4DY7B 3T62A 2HNTC 2CGAA 2XYAA 1GBJA 3F1SB 2GCHF 5DP7A 2GDDA 3KYFA 4ABHA 1Q3XA 4MNXA 4NA8A 3DSPA 1DX5M 1GCTC 2B7DH 2PTNA 2OUAA 1ZHPA 4FXGH 1TALA 5E0JA 1VITF 1H8HD 4B2CA 4TPIZ 1PYTD 1B7XB 1HYLA 1O3DA 1AO5A 2CN0H 2GGVB 1C5WB 1TNIA 4GLYA 1BHXF 3GCHB 4IMZA 4YZUA 1MBQA 4Y79A 1SLUB 4X8UH 3GY6A 3SGQE 1SBWA 3UQOA 4KTCA 2VVCA 3EAJA 4U32A 1T8OA 3EQ0H 3MH4A 2AHME 1OWHA 4P02A 2A2QH 4K5ZA 5GWZA 2J97A 3H7TA 1QCPA 1FX0B 2DUCA 2AGGX 1WU1A 1EOJA 3RXUA 2BD7A 1NRPH 1LKBA 1F0RA 1O5CB 1O2PA 1P2MA 1WOFA 1A2CH 1TE0A 5EJZA 5IYTA 3UWJH 1ZTKA 1DVAH 1P02A 2ZQ1A 2ZU2A 2KZ4A 2CHAC 1BJVA 1CT4E 2ZDVH 4ZMAH 2VBCA 2NU2E 3MWIU 2BVSH 1TRYA 4TWYA 1ZSJA 2Y80A 2A32A 1GJAB 2BQWB 2GT7A 4JYTA 3TLOA 5E0GA 5FPSA 1ELEE 3OYPA 1MTWA 1FPCH 3OTPA 5EXNA 3SZNA 4AB9A 1ZTLA 1YCPH 4Q2KA 3ZZ8A 3BIVH 1ARBA 5FPYA 1GBMA 1C5UA 1A3EH 1VITH 3UPEA 1FJSA 1K1NA 3FVFB 4Y8XA 5K0HA 1O3HA 3BEFB 1P06A 3DD2H 1GG6B 1O5FH 2ZDNA 1O5AB 3EE0B 3Q76A 1K1PA 1SMFE 1BMLA 2AMPA 4MDSA 3STJA 2G81E 1SGQE 2VU8E 4WXVA 1IQEA 9LPRA 4AOQA 1HAPH 5DP9A 1E1QD 7LPRA 3ATIA 3LGYA 1OXGA 2HVXA 1O3GA 3PMHB 3SJ9A 1BBRH 2HVYB 1ZLRA 1GJDB 2ZFSA 3P8OA 4TY6A 5L2YH 4BXWA 4ABIA 3RC5A 1BA8B 1EZSC 1NFWA 4NWLA 1GBTA 2BD3A 3A80A 3TGJE 3E8LA 2GDEH 1KIGH 1SSXA 5IK2D 2ZECA 1SOTA 1PYTC 4BXSA 1ESTA 1JBUH 1RIWC 2V0BA 1C1OA 3PRDA 4OS6A 3A82A 2VGCB 5F8TA 6GCHG 4A92A 1GMCF 5T1VA 2FP7B 1K9OE 3GICB 2WYJA 2ODPA 1DITH 5EW2H 3P8NA 5CHAB 5JBTA 1SHHB 2BM2A 1H4WA 3PWCA 1UMAH 1EJMA 4UONA 1ZRBA 3K65B 4HTCH 2Z6BD 1BRAA 2GX4A 2XCFA 3VG8A 2JH5D 3RXOA 2OC0A 2ALPA 1S6FA 2QF0A 4A1VA 2VVVA 3UY9A 1AVXA 3SU1A 1DWCH 4CR5A 3EGKH 1AFQB 3OU0A 2ILNA 4K8BA 3UNQA 1FPHH 1GBEA 1O3BA 1O2NA 2Y6TA 1ID5H 2VVUA 4AFSA 3O8CA 3RXGA 1ZYOA 3RXRA 1O3KA 3SNEA 1ELCA 1H8IH 1FY5A 3A7YA 1ORFA 3RU4D 1O32A 4MG3A 1BOQA 2OC7A 3M7UA 1O34A 2ZFTA 4M9FA 3H09A 2ZDKA 4WY3A 4MPWA 1FI8A 1NRSH 1Y3UA 1P04A 3VXEH 2NU3E 1ARCA 5A0AE 1D9IA 2ZU5A 2SGPE 1G2MA 1GHZA 2PTCE 4NIWA 2C8ZB 1C2KA 3IWMA 3Q3KA 4PROA 2GCHG 1BHXB 2QC2A 3LONA 3F68H 5LPRA 2AS9A 2F9OA 1EAWA 1BDAA 2UWOA 1E79D 3SJ8A 1OPHB 3A84A 1ACBE 8GCHF 2J4IA 1QZ8A 3RXCA 2DE9A 3VB5A 1AQ7A 1UVOA 1HDTH 4YOJA 4X6PA 3A89A 1A46H 2OCVB 1UCYE 1L1NA 1TPOA 3SUGA 4FVBA 2VIQA 3F3BA 1HAVA 1QBOA 3ZVAA 1SQRA 5C3NA 4MNVA 2EEKA 5FX5A 3BN9A 2FOHA 3VPKA 2HGTH 3UUZA 3PLKA 1UTOA 3SBKA 2PHBA 3U8TH 1AE8H 1EXFA 2ZIQH 4MPXA 1TGCA 1SGPE 1PQ5A 1KXDA 1F5LA 1FIWA 1OYTH 1P2QA 5T6FA 1FAKH 1GJ8B 1OWJA 2G00A 4DJZB 3UR6A 5CE1A 1C9PA 1A0JA 2YMSB 3VB3A 1DXWA 1SKYE 4WMFA 1IQLA 4FUFA 1WBGB 3L3TA 2JIZD 1JIMA 5C5NA 1O2RA 3T28A 2OC8A 4HG6A 5FXLA 5DK1A 3UREA 1TB6H 5A0CA 4JK6A 2LP6A 3S7KB 2WPMS 3NCLA 1XM1A 2XC5A 4BTTB 3KYGA 4F4OC 3RXMA 1C2MA 3RXEA 8KME2 1BCUH 1O3OA 1TPPA 1AB9B 2CK3D 4NGAH 4R8TB 1LHGH 1QBNA 3FZDA 2ZGHA 3E0PB 2SNVA 1BTHH 3RMOH 3SGAE 4NA7A 3SORA 3BG4B 4RI0A 4YOGA 1C1VH 4JZFH 5DGJA 1SB1H 2HNTF 3ZZ7A 1GHYH 2THFB 2BDIA 2FOFA 2SGEE 2BD2A 2QV1A 1S6LA 4OS1A 1MU6B 2F9PA 1W8BH 2TIOA 1F92A 2GT8A 2PV9B 3MO3A 1SHYA 5I46H 1ANEA 2ZDLA 2WV5A 4INKA 3S7HB 4Q4LA 2OLGA 3GY7A 3UWIA 1BMFD 3V3MA 2SGQE 1PPGE 2XTTB 2C90B 1K2I1 3F2GA 1MBMA 1QQUA 2BDHA 3RDZA 5FBEA 1GBFA 2ASUB 2BDGA 1UTQA 5JBCS 1WV7H 2XCNA 3U1IB 3F2FA 1XKAC 1TNLA 1THRH 1TAWA 1DY8A 3MI4A 4X2VA 1K22H 4X8VH 1EFRD 1QRXA 2FWWA 3QGNB 3OX7U 3PTNA 1SGDE 1O0DH 2WHXA 2Z7FE 1GDNA 5EG4A 1BB0B 1G30B 2GP9B 1LHEH 3CP7A 2F3CE 1T4UH 5FAHA 4K1SA 1QL9A 4ZUHA 4X1RU 1GMCG 4GCHF 3FFGA 3AK5A 2AGEX 5ABWA 2KAIB 4WMDA 3NPSA 1E1RD 2PSYA 2UUJB 4Y6DA 4H6SB 3SV9A 3BTHE 1V3XA 4CR9A 3HGNA 2ANKH 1X7AC 4F55A 1QB9A 1ZPBA 4ZH8A 1CU1A 2NWNA 3FP8E 3MH7A 1CGHA 2F91A 2GCTC 4OS5A 5B6LA 1P2IA 2EC9H 1WAYB 2QY0B 3BG8A 4GSOA 3BTKE 4ISNA 4TT3D 4B6EA 2V3OH 2B0FA 1CGIE 5DJ7A 5FPTA 1MTNB 1FLEE 1DS2E 3PMAB 4O3UA 3WY8A 1JMOH 1RD3B 1O2KA 1W2KH 3W95A 3URDA 5EXLA 3A7ZA 1AN1E 1CBWC 1CO7E 1QURH 3SQHE 1C1QA 2A4OA 2ZCLP 3GYLB 3SV8A 3TH4H 4DOQA 2QXGA 1GMHF 3Q3XA 2FOBA 4VGCB 3A8BA 3RXHA 4IN1A 1S0RA 2ZPSA 1ZHRA 1KYNA 2GMTB 2EQNA 1O3FA 5K7RA 2XBWA 2WINI 1T8LA 4D9QA 1HBTH 1N1LA 2WV4A 3SJIA 1Y3WA 3V7TA 5C1UA 1UCYH 3ZV8A 3SU6A 1G2LA 3TJUA 3ZVEA 4AG2A 1UK4A 5SGAE 1JIRA 1YPLH 2F4LA 8GCHG 2PGBB 2BXTH 1SGRE 2G55A 2YNBA 4XRNA 2ZFRH 2KCYA 1C2LA 4HZHA 1TRNA 4O97A 2BVRH 1BIOA 1BMNH 1EUFA 4OS7A 2UUKB 2JETB 1P10A 4XDEA 1AWFH 3GCTF 8ESTE 2D2DA 5EQQA 2AH4X 1ZJKA 4U01A 1AVGH 3TH2H 3K6ZA 3TK6A 1K0HA 1MKXK 3JZ2B 1ELFA 1QJ1B 1Y5BT 1LKAA 4D9RA 3PRBA 2BTCE 1XKBC 1ZPCA 2ALVA 2O8MA 3A81A 1BRCE 2FI5E 5AF9H 3SV2H 1CA0C 3GCOA 2AIQA 2EI7A 2Z9KA 3FKSD 2P16A 2RG3A 3F9HA 2G51A 1NRRH 3M7QA 1K21H 4AORA 2PUQH 2F9VA 2TGPZ 3F0PA 4IC5A 1YLNA 4AFQA 2PWXA 1EZXC 2BB4A 1NZQH 2P94A 1TNKA 4AYYB 2WUBA 5E8EH 1HAVB 1P12E 1GCTB 1L4ZA 4ABEA 4DG4A 3LJOA 1MCVA 2ANMH 1NBME 1C2JA 1AVWA 1TBZH 4K60A 3ZVGA 1OS8A 4RT1A 1P9UA 1HAZB 7KMEH 1AZZA 4IN2A 3NZIA 4Y7AA 4FU9A 1LVOA 1NRNH 1GHVH 1ELTA 3UNRA 1BTXA 4X6MA 1AWHB 1QHRB 1F0UA 1DDJA 1RRKA 2JKHA 1C1SA 3B23B 2H9EH 4SGBE 1SLWB 3S69A 4ABBA 1FXYA 1DFPA 1Z8RA 1QL7A 2GKVE 1QA7A 3RUOA 3BIUH 3D49H 4I7YH 2H2ZA 4IW4E 1J15A 2P3TB 3P17H 2Z9LA 4YT6H 5T6DA 4B1TA 5PTPA 5FX6A 1CT0E 1A5HA 1PFXC 5ETXA 4E7RG 4NA9H 1SQAA 4X1QU 2H6MA 3P8FA 3GY2A 3MU4A 2ZU3A 4XBCA 1MU8B 1V2RT 1UHBA 1GBBA 2P3UB 1A1RA 4B71A 4A5TS 3MYWA 1AKSA 1H9HE 3K9XB 3RXTA 1Y3VA 3RMMH 4ZHLU 3SU2A 3KQ5A 1ETRH 5HMAA 1Z8IB 3LGUA 3VB4A 4F48B 2YOLA 3H5CB 3DSOA 3JZ1B 2Z9JA 3RU4T 2FTLE 4B73A 2ZDMA 4GCHG 2ZHFH 1XXFA 2TPIZ 2J98B 3MO9A 5C94A 2SFAA 4AZ2B 4DT4A 2FX6A 3M7TA 2ZNKH 1XXDA 2W6ID 3U1JB 1S83A 3C1KA 4I31A 1QB6A 2Y5FA 2BY9X 4DGJA 3KF2A 1TWXB 1IHSH 2FI3E 3MQKC 3LU9B 1UTLM 4A1TA 2BQ7B 5CHBA 1NFXA 2FTMA 3SHCH 3BTTE 1GI0A 3F9EA 2TBSA 2J2UA 1HXEH 1A0LA 3OFND 1O30A 1TMTH 4X1SU 4GAWA 4TSFD 2UUYA 2BDAA 3I77A 2BD9A 2Z3DA 5I25A 1KLJH 1OWIA 4JCNA 4RT0A 1MKWH 1O2HA 1C2IA 1GVZA 3P92A 4DT7B 5KGOA 1O2TA 2XXLA 4CHAC 2PUXB 2QA9E 2FI4E 3KQDA 6CHAC 4Z1MD 4XBDA 3PLPA 1UJ1A 4ZKSU 1P2KA 1OP0A 1GMHG 1SGFA 4JZ1A 5A2MH 3SI3H 3M3SA 1MQ6A 5F8ZA 1Z6EA 1O3AA 1D6RA 3SNBA 1O3CA 5DP4A 2HOBA 4O3TA 1SGNE 1E0FD 4X2WA 4B2AA 3AW1A 4GUXA 4NZQA 4UDWH 1RJXB 1YKTA 1C5YB 5DPAA 3ATKA 3E1XB 3QUMP 3RLWH 5HKKD 5E2OA 2XOKD 1P9SA 4YOIA 1O2VA 5HGGA 3FN8A 2ODQA 4TPYA 3ATMA 4ZHAA 1O33A 1FY3A 4J2YB 1C9TA 3ATWA 3LGWA 1A0HB 3GCTG 3PV4A 1GVLA 4O03A 1XVMA 1C5MD 1SGIB 2VNTA 3M5LA 4UFEH 2FX4A 3QTOH 1GMDF 3UOPA 2OINA 4CH2B 3QK1A 5KEDA 1AUJA 4NCYA 3WWBA 3W94A 1EJNA 3SOSA 2KX4A 2PGQB 3P95A 1MD8A 1QGFA 3KQBA 4BAOB 1TBQH 1VJAU 4O9VA 1TYNA 1A4WH 4YXWD 3TJVA 1KXCA 4MVNA 3H7OA 3ESTA 1GI1A 2C3SA 3KGPA 4NFEA 4D7GA 1LO6A 1NC6A 1V2PT 2ZHDA 5EIYA 3M5OA 1QB1A 2BDYA 4X6OA 2H1UA 3A8CA 3RXSA 1W13U 1Y59T 3V13A 4Q7YA 1TNJA 1EZQA 5GCHF 3URCA 2W26A 1J17T 1GI7B 3SN8A 2A0QB 3KEEA 1TQ0B 2BLWA 4ISHH 2C93B 1GBIA 5HIYA 1UTJA 1Y8TA 5T3HA 1YPHE 1NT1A 2IPQX 4DVAU 3E6PH 4FUCA 2K0QA 5L2ZH 3V12A 3OEED 1S84A 1TOCB 3ZZCA 4FUHA 1KDQB 1ZZZA 4NG9H 3D23A 3TU7H 4I8KA 1TGBA 1C1MA 1TQ7B 1WQSA 4KELA 1FY8E 5EQRA 2A4RA 2RCEA 3QN7A 1C5XB 1HJAC 3ZV9A 3GDUA 5EJLA 1VKYA 1S82A 1VCQA 4KGAA 3RM0H 3RXIA 1C1RA 1B0FA 1RTLA 3BTQE 1ZSKA 3ZZ5A 1IQNA 4K3JA 3GY3A 3U8RH 4LXBH 2ZU4A 1GI8B 1LVBA 1WYKA 1MAXA 2KCAA 1T8MA 2ODYB 1HIAB 2ZQ2A 1D3PB 1C2GA 3U98H 1SLXB 1YM0A 2F9NA 3UIRA 5F6MA 1HUTH 2HNTE 2VWLA 1ZGVA 1GBAA 3QX5H 3B8JA 1KY9A 4K1EA 3SHAH 4CRGA 1B5GH 1GI5A 3BEUA 3SUEA 7ESTE 3M5NA 3ZVFA 1IQFA 2XW9A 1W0ZU 1O2GH 1SFIA 1YY3A 4NIYA 4FOUC 5JBBS 1FN8A 1FNIA 4ABGA 1E34B 4ABAA 1NRQH 1UTMA 3RXLA 4R0IA 5EU8A 3T27A 1O2ZA 1P8VC 2J9NA 3LC5A 3F9FA 1FDPA 1TRMA 1W10U 3MH6A 3FP7E 4B74A 4IS5A 1VGCC 1C1NA 4JK5A 1PPFE 1LVYA 4FETA 1Y5UT 1EP6A 1NFUA 1SQOA 4ESTE 1QFKH 1OWEA 4BANB 3C27B 1VITG 1AFEH 1WTHD 2GV6A 1O38A 2BD4A 1GHBF 2HWLB 3OTJE 2WPHS 3VEQB 1SPJA 3BTWE 1COWD 2J92A 1FY4A 3MHWU 2STBE 2TGAA 2HALA 4ZKOU 2BZ6H 3PMJA 3ZZ9A 1P3CA 4FUJA 1WUNH 1KXFA 5DP8A 3S9BA 1MZDA 2XWAA 3SV7A 1K1IA 1C5OH 2ZHWH 4ISIH 2W7UA 2BMGB 1GGDC 2W3KA 1DWBH 3TVJB 5C0TA 2P95A 4CRFA 5J4QA 2QXIA 1C5QA 1D3QB 1DLKB 1NU7B 3SNDA 2BLOA 2PKAA 4XSKU 1BTPA 4LZ4B 2W7SA 1LHFH 3N7EA 4OS2A 2AYWA 2XNDD 3SNCA 2OBOA 1S5SA 1TNGA 4B75A 1XUGA 3U8OH 2GCTB 2O8WA 1GL1A 4I86A 3E3TA 3MNBA 2ZCHP 1EKBB 2V6NA 3GDSA 1TPAE 2FPZA 1C1UH 1NESE 2FMJA 2ZKSA 1SI5H 2QGRA 1UK2A 1ESBA 1BMAA 1QBVH 2FZZA 4DCDA 3LT3A 3QTVH 3RXVA 1RXPA 1GMDG 4Y11E 1P2OA 5AHGH 5C1YA 2BY8X 3TNTA 1SGYE 1K1LA 3OE7D 1F2SE 4BTIB 2BDCA 2CMYA 4A1XA 1KMHB 1CBWB 1F5RA 3R0FA 1JWTA 1P0SH 1KLTA 3A7WA 1BQYA 1GJ7B 3Q3YA 1ZJDA 1EPTA 3HPTB 3PO1C 3GCNA 1D6WA 1IQGA 1O2YA 3BTFE 2OBQA 1V2LT 5LH8A 2XBXA 4NZLA 4FUBA 1UVTH 1GI2A 1MCTA 1LTOA 2QXJA 1GDUA 2STAE 3V0XA 4I33A 1KSNA 2F43B 3SQEE 5GCHG 4BAKB 3UOUA 1O5EH 2SGFE 5C2ZA 3SZEA 3IG6B 1FONA 4NSVA 1GJ5H 5L6NH 3I78A 1V2MT 1OSSA 4XBBA 2A4QA 4WF8A 2Y82A 3L6PA 1GI3A 1GHWH 2ZP0H 1NTPA 2DE8A 2XC0A 2KR7A 3EA7A 4Y71A 3IITA 4XD7D 1H9IE 4D76A 2EY4C 1NY22 1CVWH 2V3HH 4ABFA 2ZFQH 2ZTYA 5IDKA 2JH6D 1T32A 2WZQA 2RA0A 2H9TH 3KHVA 5C5OA 1GBDA 3ZZBA 3BEIB 2PFEA 1ANCA 2R3UA 2W5EA 4Z0KA 2EI6A 2Z9IA 2ZPQA 2R2MB 1IQKA 1MUEB 3UQVA 2V3MA 4CRDA 4IGDA 1CA0B 2NU1E 2VINA 4ACAA 1GJ4H 2A2XH 1WQVH 2Q6GA 8LPRA 3HK3B 3QGJA 1TPSA 3UNSA 1FIZA 3ZZ3A 1G3DA 2M5TA 1ELDE 2BXUH 2AIPA 2Z9GA 1YPMH 1E36B 2CF9H 4CREA 4YT7H 1RTFB 1P11E 5DP6A 5C20A 2PSXA 2YNAA 1TNHA 3PB1E 1XUFA 1YGCH 3LPRA 1V2JT 2RDLA 4Y8YA 4YESB 3T2NA 4WVPE 1VCPA 2FXRA 3LDXH 1O3NA 5A09A 2GVFA 1OKXA 3BTEE 2VWMA 3K2UA 1GBLA 1Q2WA 3E90B 1O35A 2ZCKP 2F83A 3OY6U 3OEHD 3MH5A 3RXPA 4WMEA 3DUXH 1O2LA 1G36A 2P3FH 1DOJA 4AX9H 2NU0E 2ZEBA 2I6SA 1AY6H 4ZCNA 4MNYA 3E0NB 4AG1A 1S6HA 1AHTH 5LPFA 5HIZA 4HFPB 1IQJA 1GBKA 1C4U2 1Y3YA 2WPLS 1C2HA 3VFEA 1MD7A 3FP6E 4NFFA 1BTZA 2P8OB 2B5TB 1MMJN 1LMWB 2PR3A 1TMBH 2Y5HA 4ZKRU 1HV7A 1EAUA 3GISB 5JBAS 4GHQA 1UVUH 1RFNA 1V2VT 4BTUB 1C1TA 3RC6A 3N7OA 1CT2E 1O2OA 1ZPZA 5EW1H 3HK6B 1W0KD 5TCAA 4DIIH 3A8DA 4X0WU 3DHKH 1ZGIA 1YF4A 3PM3A 4YLQH 1BZXE 1O2QA 1Y5AT 4WWYA 1PPBH 1OYQA 3LGTA 4OS4A 1N8OB 4ZXYH 3M5MA 3CENA 3LOXA 1CHGA 1QJ7B 4E7NA 2AGIX 1BBRK 4AGJA 3ZZ6A 3FZZA 1C1PA 1NO9H 5EJ1A 5HM2A 1P3EA 3S0NA 1HAYB 1CSOE 4RN6A 3NXPA 2A5AA 2Q6FA 4I8HA 1WTGH 2ZO3H 3L33A 4FU7A 2AERH 3HKIB 1P01A 2F9UA 3RXKA 2J5UA 1TGNA 3AW0A 1QIXB 4X1NU 1FAXA 2IJOB 3A7XA 1ANDA 5BPEA 1CE5A 4FVDA 3GS9A 3NRLA 1GJ9B 2PKSC 3RU4E 3B9FH 3NKKA 2RA3A 5AFZH 5TCCA 4CRBA 3ZIAD 2GZ7A 3GOVB 1BT7A
chains in the Genus database with same CATH topology
1ZMJA 2R2WU 2J34A 3P70B 1HAHH 1O31A 2FOEA 1NROH 1V2UT 1WSSH 1W0YH 1P09A 2NU4E 1H1BA 2R0KA 3VGCC 1W3CA 4GHTA 1V2TT 2G4TA 1CQQA 4JYVH 1GWAA 4QT8C 3P8GA 2C8YB 1P05A 4XFQA 2K1QA 1BTUA 3TGIE 1V2QT 1KLIH 2FS8A 4CHAB 1GJ6A 5DP3A 6CHAB 4BAQB 2ZHEH 2VWNA 4CBOA 1UVSH 1T31A 2Y5GA 1N6YA 4NWKA 1KXBA 1QA0A 1C5RA 3ITIA 2TRMA 1H8DH 1T7CA 4RKOB 4X8TH 2HPQH 1G37A 1CHOF 2IN2A 3PLBA 3TK9A 1INCA 2Q1JA 2XRCA 1IQIA 2FM2A 2CHAB 3KQEA 3BF6H 1EASA 3AVZA 2VIDA 3RXQA 2CF8H 1QTFA 1TA6A 1EZUC 3T5FH 5BRRE 4IBLH 3D62A 3FAOA 3A8AA 1MH0A 3TGKE 1S0QA 1T4VH 2A45B 4CH8B 3BTGE 1PQ8A 4JZIA 3EA9A 4FU8A 4UFGH 4CBNA 1VZQH 1PPZA 1KTSB 1W7XH 3ZVCA 1NPMA 3QZQA 2FOGA 2ANYA 2AFQB 1O5BB 1ZMNA 3GY4A 3BTME 5EXMA 2FODA 1TX7A 4MPUA 1F5KU 1LPZB 1NFYA 4U2WA 3ZZ4A 4MPVA 1RS0A 5H4IB 2VIOA 1YBWA 1QQ4A 2QN5T 1LPKB 2I6QA 5GPIB 1EAIA 1HB0B 1Y3XA 4X2YA 3A87A 1HAGE 2FYQA 5GXPA 1SGTA 1FQ3A 1TGSZ 3AASA 1G32B 1UK3A 3ELAH 2EA3A 1LHDH 1C1WH 4IMQA 1RIWB 4U30A 5EQSA 5DO4H 1BITA 2WPKS 2Z94A 1AU8A 1MTUA 2ESTE 2ZGBH 2OP9A 4WH6A 2ZC9H 3ZYEA 3KCGH 1S85A 3E16B 1W14U 4ZAEA 2FYRA 2IPHA 1SGEE 1VJ9U 3HKJB 3MO6A 2HRVA 5LGOA 1IQHA 3VXFH 3PMBB 4WXIA 3RXBA 1LDTT 4I8LA 2A31A 1XUKA 1Z8GA 1HJAB 2G5VA 4KKDA 1TX6A 4AFUA 3Q77A 2UWPA 9ESTA 3EYDA 1C5NH 4XOJA 4ZROA 1JRTA 4YTAA 2Q6DA 1V2ST 4AYVB 5J4SA 1F0TA 1EPTC 4HGCA 5EGMA 2BOKA 3MNSA 1K28D 1P57B 3M3TA 4Y7BA 3T26A 3KN2A 1LPGB 1UTPA 1D4PB 1SG8B 4THNH 3TIUA 5A8YA 1AGJA 5A0BA 4J1YA 1TOMH 3ZYDA 4OGXA 5HXFA 1M9UA 1AUTC 4H42U 3RC4A 3TJNA 1TFXA 2B8OH 2OQ5A 1C2FA 1DXPA 1IQMA 2XWBI 1V2WT 3RXJA 1EX3A 4Y10E 2P93A 4YM9A 1V6DA 1ELAA 5F8XA 3MNCA 4DIHH 1KTTB 4JYUH 4UE7H 4UFFH 1GHAF 3MU8A 1GHXH 3SJKA 1EATA 4A6LA 1NM6A 3KL6A 4RSPA 3SV6A 1VGCB 1EB1H 2OQUA 4AFZA 2LPRA 1K1JA 1MKXH 1O5DH 1O2IA 4B76A 2KAIA 3MFJA 3A86A 1HJ9A 1DUAA 1SR5C 1YCPM 3EA8A 1AI8H 2SGAA 1E35B 1Z8JB 1ZR0A 3SUDA 4ABDA 3A88A 2VJ1A 3GCHC 1C4Y2 4GPGA 3LH3A 4K1TA 1BRUP 2R9PA 1YPJH 3DFJA 4YO9A 1PQAA 2PLXA 3A83A 1O3IA 1P2JA 1W11U 1O36A 3KQCA 2OD3B 1YLDA 3NK8A 1A7SA 4RKJB 1XVOA 4BAHB 3PTBA 1UTKA 3RXAA 4AGKA 3RLYH 1GL0E 1D3TB 2G8TA 1Z71A 1K1OA 1YPKH 1LCYA 3QZRA 1GI9B 3ODFA 3MU1A 3BSQA 1W12U 3SU4A 1ELGA 3VB6A 1CHOG 5GJ4B 1GGDB 2AEIH 4INHA 3S9CA 2D26C 5L30H 2A5IA 2FLBH 3VB7A 2A1DB 3RM2H 3O8DA 3M37A 1A5IA 2ZDAH 1V2NT 2ZI2H 2CXVA 3QDZB 4UEHH 2BVXH 1O3EA 3LH1A 2J95A 3SO3A 1HJ8A 3SU0A 1O2JA 3SNAA 2ZGCA 3ZVBA 3M35A 4FUEA 1C5PA 4CRAA 5EPYA 2JH0D 1UCYK 4ISLA 3SU5A 1O3JA 1LHCH 2QIQA 2UWLA 2BX3A 1GG6C 5CMXH 1DE7H 1C5VA 1YPGH 1IAUA 4H4FA 1RTKA 3ODDA 3LGVA 1UHBB 2HLCA 3OY5U 3GDVA 1TABE 5A8XA 2ZTXA 5DKMA 4E06H 1AKSB 5JDUB 1TA2A 3KIDU 1MTSA 1ABJH 2CJIA 4HI3A 2QF3A 3PO1B 4WJG2 1E37B 3SW2B 1TBRH 4F49A 1PPCE 2BLVA 3T25A 1BUIA 2UUFB 2FDAA 4NIXA 1GCDA 1C5TA 1H9LB 1RGQA 1O3PB 1GVKB 5DP5A 3QLPH 2VIPA 3TJOA 1O39A 1FMGA 2H5DA 3PYHA 3FANA 1HAXB 5JB9S 4ASHA 2QAAA 2Z3EA 2OXSA 1HAOH 3RP2A 2FEQH 2GV7A 2VGCC 3A7TA 3MTYA 1VCWA 2Y7ZA 4OGYA 1BMMH 1ZMLA 2AMQA 5T6GA 4AN7A 5EPNA 2SNWA 4UFDH 4LZ1H 4YLUA 1Z1IA 2ZWLH 3SI4H 5CHAC 3I29A 4TWWA 1L2EA 1UTNA 3BTDE 1HAIH 1L0ZA 2IOTA 1QR3E 2VWOA 1FV9A 2XBVA 5JYIA 1IHTH 2BQ6B 4K8YA 5FHTA 2C8WB 1GBHA 1AZ8A 1C2EA 1DWDH 1FZZA 1C5ZB 2V35A 5HM9A 1QY6A 1Z6JH 6LPRA 5G4BA 1LVMA 1AFQC 4I8GA 2XBYA 2VH0A 1XUHA 1OP2A 3O8RA 4UD9H 5E0HA 1NU9A 1D3DB 3GY5A 3TPIZ 5ESTE 2G52A 1TGTA 2BLQA 2TGTA 2VIWA 2BHGA 1QRZA 4D7FA 4Y8ZA 3UTUH 2ULLA 2AMDA 1TLDA 3SJOA 3HATH 1XUJA 2FESH 1C5SA 2VIVA 3SGBE 4ZKNU 3S9AA 2ANWA 3EDXB 3K6YA 2O9QA 2GZ8A 2Y7XA 1ZOMA 1LQEA 1SGFG 1AD8H 1JOUB 1ESAA 1PPEE 3AAVA 4Y0ZE 5FCKA 2ZTZA 1HPGA 3E91A 1S81A 2QXHA 1GHAG 4D8NA 2Y81A 1K1MA 1J8AA 1O2WA 3SUFA 1C5LH 4TYDA 1B0EA 3T29A 2WYGA 1FY1A 1EP5A 1G3BA 1BTWA 3SU3A 3LIWA 4K2YA 4ZXXH 4MNWA 4IC6A 5AVDA 1YP9A 1AE5A 1MAYA 1J16A 4LOYH 3ZVDA 1QJ6B 3A85A 3DA9B 1DWEH 3LGIA 1YYY1 2FLRH 4MTBA 7GCHF 2ZGJA 4ABJA 3RMNH 3STIA 2WPIS 3RXDA 2BZAA 1QL8A 5GDSH 3NUMA 1O2UA 3MMGA 1HXFH 1EB2A 1MKWK 2A7JA 3ENSB 3M61U 3UFAA 1MTVA 2O8LA 1A61H 1IOEA 1N6XA 1XUIA 2ZPRA 1EOLA 1O3LA 1DSUA 3LJJA 1G3CA 1PQ7A 1GBCA 1DM4B 1DLEA 4LK4A 3U69H 1OX1A 1DY9A 1Z7KA 4ISOA 4WH8A 2G5NA 5F03A 3RXFA 2FO9A 1AB9C 1SLVB 4X2XA 2PKSB 4FUGA 3A7VA 2G4UA 1GJBB 5JB8S 1EAXA 4Y0YE 5AFYH 3DFLA 1THSH 3BG4C 2Z3CA 5EOKA 1DANH 1JXPA 5C67A 4Q7XA 2ZZUH 2B9LA 1ANBA 3PWBA 1A5GH 1AMHA 1TMUH 4INLA 4Q7ZA 4BNRA 3MNXA 3MU5A 2BOHB 3VGCB 3G01A 4ZHMU 3TITA 1DPOA 1O3MA 1HGTH 2BX4A 2A4GA 1ZRKA 2XC4A 1SQTA 1YPEH 2A7HA 4JZEH 2CV3A 5A8ZA 4JZDH 1A3BH 1SFQB 1XMNB 1YCPK 2A5KA 1SL3A 3ATLA 3DT0H 4KP0A 3RMLH 3TNSA 2OTVA 2FOAA 3ZZDA 1FUJA 2BD8A 1GHBG 1CGJE 1PPHE 2QYIA 3CS7A 1OWKA 2R0LA 1UVPA 2WUCA 1CA8B 1F7ZA 1TX8A 1QNJA 1ZSLA 4Q80A 2BDBA 2GZ9A 2VB0A 2R3YA 5B6OA 1C4V2 2XNIA 4Z6AH 4Y76A 2W3IA 4JMYA 2H5CA 1G9IE 1HCGA 4X8SH 2GTBA 3ZZAA 2O8UA 3LC3A 1JRSA 1U6QA 2H9HA 4X6NA 1HRTH 1V2OT 2ZG0H 3GY8A 3MOCA 1O2XA 1Q31A 1SGCA 1DUEA 3PROA 1L4DA 2O8TA 1J9CH 1NN6A 2ZA5A 2BD5A 5DG6A 1MQ5A 2ZFPH 1KXEA 4TY7A 1O2MA 1VR1H 3D65E 1QRWA 2C8XB 1WCZA 4NIVA 2FOMB 2HPPH 1ETSH 1HLTH 1ELBA 3HGPA 3O8BA 1Z1JA 2ZF0H 5EODA 5FCRA 5TJXA 4B2BA 1KDQA 2EI8A 3Q00A 1E38B 4MQAA 4BAMB 4DW2U 1OP8A 2A7CA 1W7GH 1ETTH 1EQ9A 1XX9A 1EJAA 4CRCA 1ZTJA 2ZU1A 3BV9B 1DICA 1MTNC 4MLFB 4SGAE 1UO6A 2D8WA 5LPEA 1BJUA 4NSYA 3UR9A 3OSYA 3QO6A 5ESBA 2FIRH 1G3EA 4FUDA 4KTSA 1AIXH 2WPJS 3TH3H 1BBRE 2LNCA 1L1GA 2GD4B 2TGDA 3LKWA 1BTYA 4VGCC 1HIAA 2BYAX 2PKAB 1TIOA 1PJPA 2FOCA 1L1JA 3M36A 4XE4A 2GMTC 1GPZA 4E05H 6GCHF 1MZAA 4GVUA 1HNEE 2J38A 4K69A 5GIBA 1SC8U 2FS9A 2ZGXH 1DSTA 4A7IB 1LQDB 4BOHA 1C2DA 5HYOA 2P59A 1ZHMA 2PW8H 2OC1A 1YC0A 3F9GA 2SGDE 5JPMH 1GI6A 3CS0A 4X1PU 1P2NA 3F6UH 2P8OC 3MU0A 1YLCA 1YPHC 3GYMA 4KTUA 3TK5A 1P03A 4H6TA 2J94A 1SVPA 3P6ZB 1DT2A 4M7GA 4AB8A 1FN6A 2QCYA 1SOZA 5FBIA 2JETC 1OOKB 1T8NA 4I8JA 2VH6A 3KNXA 1O37A 6ESTA 1TONA 1F0SA 4DURA 1EPTB 1THPB 1GDQA 1N8OC 2C4FH 2BY5X 4FUIA 3NWUA 1GI4A 1O2SA 7GCHG 2ZHQH 5C1XA 1GJCB 1J14A 1ELVA 3M3VA 3R3GB 2D1JA 1OWDA 1BRBE 1ABIH 1NS3A 2BY7X 4I32A 2F9BH 2ZFFH 3QWCH 1O5GH 5E2PA 3AAUA 2BY6X 1HFDA 1KXAA 1V2KT 3U9AH 4DY7B 3T62A 2HNTC 2CGAA 2XYAA 1GBJA 3F1SB 2GCHF 5DP7A 2GDDA 4ABHA 1Q3XA 4MNXA 4NA8A 1DX5M 1GCTC 2B7DH 2PTNA 2OUAA 1ZHPA 4FXGH 1TALA 5E0JA 1VITF 4B2CA 4TPIZ 1PYTD 1B7XB 1HYLA 1O3DA 1AO5A 2CN0H 2GGVB 1C5WB 1TNIA 4GLYA 1BHXF 3GCHB 4IMZA 4YZUA 1MBQA 4Y79A 1SLUB 4X8UH 3GY6A 3SGQE 1SBWA 3UQOA 4KTCA 2VVCA 3EAJA 4U32A 1T8OA 3EQ0H 3MH4A 1OWHA 2A2QH 4K5ZA 5GWZA 3H7TA 1QCPA 2DUCA 2AGGX 1WU1A 1EOJA 3RXUA 2BD7A 1NRPH 1LKBA 1F0RA 1O5CB 1O2PA 1P2MA 1WOFA 1A2CH 1TE0A 5IYTA 3UWJH 1ZTKA 1DVAH 1P02A 2ZQ1A 2ZU2A 2CHAC 1BJVA 1CT4E 2ZDVH 4ZMAH 2NU2E 3MWIU 2BVSH 1TRYA 4TWYA 1ZSJA 2Y80A 2A32A 1GJAB 2BQWB 2GT7A 4JYTA 3TLOA 5E0GA 5FPSA 1ELEE 3OYPA 1MTWA 1FPCH 5EXNA 3SZNA 4AB9A 1ZTLA 1YCPH 4Q2KA 3ZZ8A 3BIVH 1ARBA 5FPYA 1GBMA 1C5UA 1A3EH 1VITH 3UPEA 1FJSA 1K1NA 3FVFB 4Y8XA 5K0HA 1O3HA 3BEFB 1P06A 3DD2H 1GG6B 1O5FH 2ZDNA 1O5AB 3EE0B 3Q76A 1K1PA 1SMFE 1BMLA 2AMPA 4MDSA 3STJA 2G81E 1SGQE 2VU8E 4WXVA 1IQEA 9LPRA 4AOQA 1HAPH 5DP9A 7LPRA 3ATIA 3LGYA 1OXGA 2HVXA 1O3GA 3PMHB 3SJ9A 1BBRH 1ZLRA 1GJDB 2ZFSA 3P8OA 4TY6A 5L2YH 4BXWA 4ABIA 3RC5A 1BA8B 1EZSC 1NFWA 4NWLA 1GBTA 2BD3A 3A80A 3TGJE 3E8LA 2GDEH 1KIGH 1SSXA 2ZECA 1SOTA 1PYTC 4BXSA 1ESTA 1JBUH 1RIWC 2V0BA 1C1OA 4OS6A 3A82A 2VGCB 5F8TA 6GCHG 4A92A 1GMCF 2FP7B 1K9OE 3GICB 2WYJA 2ODPA 1DITH 5EW2H 3P8NA 5CHAB 5JBTA 1SHHB 2BM2A 1H4WA 3PWCA 1UMAH 1EJMA 4UONA 1ZRBA 3K65B 4HTCH 2Z6BD 1BRAA 2GX4A 2XCFA 2JH5D 3RXOA 2OC0A 2ALPA 1S6FA 2QF0A 4A1VA 2VVVA 3UY9A 1AVXA 3SU1A 1DWCH 4CR5A 3EGKH 1AFQB 3OU0A 2ILNA 4K8BA 3UNQA 1FPHH 1GBEA 1O3BA 1O2NA 2Y6TA 1ID5H 2VVUA 4AFSA 3O8CA 3RXGA 1ZYOA 3RXRA 1O3KA 3SNEA 1ELCA 1H8IH 1FY5A 3A7YA 1ORFA 3RU4D 1O32A 4MG3A 1BOQA 2OC7A 3M7UA 1O34A 2ZFTA 2ZDKA 4WY3A 4MPWA 1FI8A 1NRSH 1Y3UA 1P04A 3VXEH 2NU3E 1ARCA 5A0AE 1D9IA 2ZU5A 2SGPE 1G2MA 1GHZA 2PTCE 4NIWA 2C8ZB 1C2KA 3IWMA 3Q3KA 4PROA 2GCHG 1BHXB 2QC2A 3LONA 3F68H 5LPRA 2AS9A 2F9OA