4B2AA

Structure of the factor xa-like trypsin variant triple-ala (tga) in complex with eglin c
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDAGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamic signatures in macromolecular interactions involving conformational flexibility.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CATIONIC TRYPSIN
total genus 58
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2aA02
5C3NA 2CN0H 3SNAA 1VITF 2BOKA 2B8OH 4CR9A 1HCGA 4D9RA 1W14U 4R8TB 1K1NA 2VIQA 1OWIA 1GMCG 2OTVA 3MH5A 4FUFA 5FCRA 3LGWA 1O30A 4BAHB 1GL0E 1OWKA 3OU0A 3ZVBA 2FIRH 1PPEE 1SI5H 1O2JA 1PPZA 4NFFA 8GCHF 2FS9A 1QL9A 7GCHG 1V2OT 5A8ZA 2FOBA 4AFSA 1MBQA 2ZGXH 2OC8A 3U98H 1O5CB 3TK5A 4E7NA 3EYDA 1W8BH 3VB3A 1MD8A 5HMAA 5DKMA 4JZEH 2G5VA 3TJUA 1V2VT 3M5NA 5EU8A 3TIUA 2QYIA 2PLXA 3MI4A 3GYMA 1SGNE 3PLKA 4BTIB 4E05H 1BBRH 3M61U 2PGQB 1O3DA 4X1PU 5L2ZH 1QNJA 3E6PH 2Y80A 4JZDH 4MPXA 5IDKA 1SBWA 1LVYA 1C2LA 2IPHA 1GBEA 3UFAA 1JIRA 3RXFA 1IHSH 1J8AA 2ZQ1A 4GCHF 3KL6A 3QWCH 2AMQA 3ESTA 1FAXA 3A86A 2V6NA 1X7AC 3BSQA 2AFQB 1FDPA 3EE0B 5SGAE 1Q3XA 2UWPA 1GI6A 2ZPRA 2FOAA 1UVOA 4CRGA 1WQSA 3ZZ5A 2P93A 3T27A 2XNIA 4AG2A 2Z3DA 3L3TA 3PMJA 5K0HA 2G8TA 2F9OA 2J4IA 1NZQH 2FOHA 2NU1E 2VWOA 4DOQA 3D49H 3MO9A 1F5LA 1Y3VA 1SGTA 3RXEA 3B23B 4H6TA 3MO6A 2Q6DA 2VWMA 1C1OA 3F68H 1UCYE 1GVZA 2XXLA 2ZFQH 1CGJE 3LIWA 1CSOE 2VVUA 2ODPA 3JZ2B 4DT7B 2Z3CA 3VPKA 2G81E 1KDQB 2JH0D 2VWNA 1MTSA 3HPTB 3RXBA 3I77A 3MNBA 1LHEH 1NFWA 1QQUA 4X6MA 3AASA 4TY6A 1TX7A 2R0LA 2RA0A 3GCHC 1TPOA 2FOGA 1A5GH 2G4TA 1QL8A 2C93B 1C5VA 3S9CA 1ZPCA 2WV5A 1SPJA 1MKXH 2AGEX 2BD5A 3HATH 3L6PA 1C2JA 1F0RA 2ZHFH 3OY6U 4UDWH 3TH4H 4KTUA 1P2JA 1GWAA 4WMDA 2NU0E 3QK1A 1ELVA 1FIWA 1H9LB 4MVNA 5BPEA 3VB6A 3BIUH 3EQ0H 4B2BA 1AIXH 1GBHA 1GMHF 1EB1H 1OKXA 3Q76A 2ZU5A 1G30B 1RIWC 1PPBH 1ELCA 2OC0A 2OUAA 2FX6A 1DWBH 3GDSA 3SUGA 2ZHDA 1SMFE 2C3SA 3ZZ8A 5LPRA 1SLVB 1VGCB 4ABIA 1UTQA 3A89A 2QXIA 1AWHB 2QCYA 4WF8A 3GY5A 1TNJA 4YOJA 1C4U2 3A85A 2PWXA 1XKBC 1KLIH 2JKHA 1BUIA 1V2LT 3FP8E 5CE1A 3SO3A 3ATWA 2VWLA 1IQEA 5C67A 3MO3A 1QURH 1QL7A 1J17T 1C2GA 3ZZ4A 1V2WT 1XKAC 5LGOA 1GHWH 1LVBA 1TWXB 6CHAC 6GCHG 2BDIA 1DWCH 1DM4B 1EOLA 1O3PB 1D6WA 1BJUA 2PFEA 3BIVH 1AE5A 1W0YH 3UNQA 4OGXA 4U30A 1TIOA 2AMPA 2GT8A 1KLTA 5AVDA 2FO9A 1V2JT 1BRBE 1P03A 2W3IA 3NXPA 3A8DA 2QXJA 1A7SA 4LXBH 1QGFA 1CT2E 1BQYA 3RXMA 3GY8A 1CHOF 3SU1A 1T8LA 1C5NH 4E06H 1E36B 4K8BA 4ZH8A 5TCAA 1TLDA 2C90B 3M7QA 3VXFH 3D23A 1NU9A 1ORFA 5FBEA 5LPFA 1THSH 1GI4A 1P9SA 3NPSA 3SU2A 1W10U 4JZIA 1GDUA 1QA7A 3U9AH 2ODQA 2RA3A 2ZU3A 3LGVA 4ZKSU 1V2PT 2XYAA 1C1UH 1FY3A 1QRZA 1FY5A 2Y7XA 5C1UA 3ZVFA 4BAQB 4X2XA 1SLWB 4ZXYH 1A46H 1XXFA 9ESTA 2BOHB 1BITA 3UY9A 1O2MA 2AYWA 4ISLA 2O8TA 3H5CB 5GXPA 1SHYA 5A2MH 2UUKB 1OYQA 4A92A 2EI8A 4ZAEA 3T5FH 2R0KA 5DJ7A 4K60A 1BMMH 2XBWA 1QB6A 4Y10E 4XBCA 1P11E 4ISOA 5ESBA 1Q2WA 4Y7AA 4NIXA 2ZNKH 3MMGA 3OYPA 1A5HA 1QCPA 4B73A 1V6DA 1JIMA 1WYKA 1O2IA 3RXAA 2BXUH 1J15A 2R3UA 1FIZA 1NRRH 3S7HB 2P59A 1HJAC 1AD8H 1C1QA 2AERH 1QA0A 1WBGB 3MHWU 4NCYA 4A5TS 4Y8ZA 3Q77A 2ZGJA 2H5CA 3VFEA 2F3CE 1MMJN 3C1KA 3MFJA 1O2ZA 4ZHMU 1O5EH 1NFUA 2ZEBA 4TPIZ 5I25A 4X2YA 1FQ3A 3UTUH 5C2ZA 1SLXB 1HPGA 2W7SA 1A3BH 3DA9B 4ESTE 3DD2H 2ZFRH 4YLUA 1TNLA 5ESTE 1GI9B 1SOTA 5CHAB 1YCPH 1GHAG 4ABBA 2K1QA 1O3KA 1Z7KA 4Q7XA 3S7KB 4CRCA 2FZZA 3JZ1B 2F9PA 2EI6A 3MNSA 1GPZA 2ODYB 1C5WB 3ZZCA 2Z9LA 1GCTC 2XW9A 1GJ6A 1GHBG 1FAKH 3KCGH 1GMDG 2Y82A 1GJ7B 1OWEA 3LT3A 4O9VA 4Y0YE 4NWLA 4O3UA 1BBRE 3FFGA 3UNRA 1EXFA 4MLFB 1ZTKA 3W94A 3MU8A 2XBXA 3UOUA 4WXVA 1TALA 1INCA 4INLA 4HTCH 5DP8A 3T28A 1P05A 2OCVB 1O5FH 3GCNA 1A0HB 1Z6EA 2TGPZ 3V7TA 4DW2U 4X8TH 1N8OB 3A80A 1BZXE 1DT2A 1EPTC 1XMNB 2GDEH 4BANB 2A5IA 3BEIB 1DOJA 2V35A 4GVUA 1AZZA 5AHGH 2P3FH 1O32A 1TRMA 4IGDA 3BTKE 6GCHF 5A0AE 4MNWA 5T6FA 2ZF0H 4WWYA 4NIYA 5JBBS 1HXFH 5FPYA 1DPOA 5EODA 1AFQC 2J9NA 5L2YH 1OOKB 2O8UA 3PLBA 1C5LH 2FMJA 1EKBB 1UTOA 1GI2A 2XC4A 2VVCA 2O8WA 1QIXB 1JBUH 4MDSA 3RXPA 2ZTZA 5HYOA 1H8DH 1TNIA 1Z1IA 1HAXB 1E0FD 1IOEA 2PGBB 5F8ZA 1RJXB 1RTFB 4GPGA 2JETB 1SB1H 1JXPA 2GCHF 1DY8A 2A5KA 3ATIA 5E0HA 2ZDMA 4SGAE 4X2VA 3CENA 4DIHH 3TPIZ 1EJNA 1HYLA 3K6YA 1RTKA 1C1TA 2KAIA 1QJ6B 1GVKB 1W3CA 1WQVH 3M37A 1PYTD 2A4QA 3BG4C 1C2MA 1Z1JA 3AW0A 2BDAA 1BMNH 4VGCB 1PQ7A 4QT8C 1OWJA 2B0FA 1JMOH 1UK3A 2HPPH 1ESTA 3SW2B 3M36A 3LU9B 2F9UA 5FX5A 1BRAA 2D1JA 3SGQE 1TONA 4Y7BA 1ETTH 1DLKB 5E2OA 1O33A 3TU7H 4X6NA 1KIGH 1GHYH 1EB2A 1TFXA 4H42U 4IC6A 5DK1A 3LC3A 2G5NA 1P01A 1PPCE 2GGVB 4B76A 9LPRA 3K9XB 3O8BA 1QBNA 2GZ9A 3U69H 1GBLA 3A82A 3TJVA 1O2LA 2XCFA 4GUXA 1ZOMA 1ZJKA 3GISB 4NIWA 3SHAH 1PPGE 2FI4E 2GT7A 4IMQA 3SNCA 3STJA 4OS4A 2YNAA 1HV7A 4ZROA 2ASUB 2Y6TA 1AY6H 3AAVA 1ZHRA 4FUEA 4BXWA 2BZAA 1V2TT 1GMDF 1AB9B 2HWLB 4JYUH 3M7TA 2A4GA 3F9FA 8GCHG 2DUCA 1F5KU 3A7VA 5TJXA 1S83A 4I8HA 1ELBA 1UTMA 2JETC 2FX4A 2QF0A 4WJG2 3RMMH 3RM2H 2ZFPH 4IN1A 2P8OC 2GMTB 2VNTA 3VGCB 1ZGIA 2ZQ2A 2ZG0H 2VIDA 4GAWA 3ZVCA 3DHKH 1FXYA 4Q2KA 3B8JA 1QBVH 4CHAC 1DFPA 4GCHG 4XBDA 4K8YA 1S85A 3BG4B 4YO9A 3GCTF 4K2YA 3A87A 1O2KA 3SU3A 3G01A 1OX1A 2V3OH 2VH6A 1YBWA 1BHXB 3QZQA 1LHDH 5C5OA 3SUEA 5B6OA 1F5RA 1ZSLA 1U6QA 1C9PA 1HAGE 4RSPA 1FY1A 3P8NA 4B1TA 1H9IE 4U01A 5L30H 2Z9GA 2ZP0H 4BTUB 2QA9E 3P6ZB 1VJAU 1MQ6A 5JDUB 3LC5A 1OSSA 4JZFH 1ZTLA 4ZKNU 2C8WB 1O34A 3SU6A 1O39A 1VZQH 1ZLRA 4O3TA 5AFZH 1GJ8B 1LHCH 2GV7A 1P2NA 2FS8A 2OQUA 1HUTH 3RXLA 1AQ7A 3EAJA 3TNSA 1EATA 3GYLB 3PLPA 1NESE 2KAIB 1UTLM 5A0BA 1YPKH 1A61H 1NRSH 4A6LA 2ZPSA 1GJCB 4FU8A 1BTPA 4CRFA 1NU7B 3PB1E 1SFQB 1DS2E 3OY5U 1NROH 2DE8A 3ATLA 2BY8X 1UK4A 2H9TH 1Y8TA 2BVSH 2PKSB 5HM9A 4MPUA 3TGKE 1NC6A 2AS9A 1RS0A 2W3KA 1UTKA 3LONA 3UNSA 3TVJB 5J4QA 2ZKSA 5T3HA 1PPFE 1ARCA 2FESH 1C5MD 3SOSA 1QB1A 4JMYA 1GHVH 2ZU2A 1KTSB 5DGJA 1F0UA 4B74A 2ZU4A 1CHOG 2XWAA 4DG4A 1O3OA 4WH6A 2PSYA 3PMBB 1YM0A 2ILNA 2SGQE 5FXLA 1SOZA 2AGIX 3SV7A 4NWKA 1ANDA 1A0JA 1FUJA 3CS0A 2A5AA 1G3CA 2FTMA 2ZFFH 3SBKA 4CRAA 1TB6H 1K1JA 4NSYA 3GDVA 3A7ZA 3TH2H 5JB9S 1H9HE 1P0SH 2SFAA 3NZIA 1HAIH 2XCNA 4ABAA 2FM2A 2PTNA 2G52A 2H2ZA 3LGTA 2TIOA 3MNXA 1S82A 1QTFA 2IJOB 1P3EA 4U2WA 1EAWA 1TPAE 3GDUA 4NG9H 2ESTE 1NTPA 3KQDA 4MPWA 1GI1A 4FUCA 1ZMJA 3K6ZA 2BD7A 1O37A 1C1VH 1D3DB 2AEIH 3SNEA 3ZZDA 3VB4A 2CGAA 1VCWA 3PYHA 1ZHMA 3QDZB 1SQTA 1ANBA 4YT7H 3ODFA 1VJ9U 4CH2B 2FP7B 2PKSC 2F9VA 4THNH 1IHTH 1BMLA 1C4V2 1EZQA 1K22H 4ISHH 4AG1A 1T4UH 3OTJE 1UHBB 4I8KA 4YLQH 4AYYB 1V2RT 1B7XB 2WV4A 3U1IB 4H6SB 5EQQA 3OSYA 1GG6B 1LKAA 4FUGA 1C4Y2 4NGAH 1TRNA 1XUJA 1K21H 3STIA 2ALPA 4CH8B 3MWIU 2OD3B 5DP7A 5DP9A 4A1XA 1IQJA 2CHAC 1ELFA 4X8SH 1A5IA 1GCDA 1DX5M 2FOMB 1P02A 2Z3EA 2ZHQH 1CBWB 1SL3A 2Z9IA 2WPLS 2PKAB 4JK6A 1NO9H 3A7YA 2WUBA 2ZDVH 4MQAA 3RXJA 3E8LA 1XUHA 4IS5A 4CRDA 3GY4A 1TBQH 3BV9B 1YPLH 2QGRA 1O2SA 4IMZA 1ARBA 2GDDA 1AN1E 4WMFA 3ZYDA 3S9BA 3BTHE 1W2KH 2VIPA 2IOTA 2D8WA 3P17H 2BVXH 3UUZA 1ESBA 3SN8A 1HIAA 4PROA 1GI5A 2ZO3H 1UCYH 1D3TB 5JB8S 4ISIH 1QHRB 1OYTH 1XUFA 1H1BA 1GHXH 5EQRA 3ZV8A 1XVOA 1TOCB 2H6MA 1VGCC 3O8CA 3Q3YA 1AUJA 1KTTB 1L1JA 4I8LA 5EXMA 1EX3A 1TYNA 1OXGA 1LKBA 1C5TA 3T62A 3B9FH 1T8OA 5E2PA 4Y79A 3QX5H 1F2SE 1SGDE 2C8ZB 4DGJA 1AHTH 1B5GH 2VU8E 2W7UA 4D7GA 4D8NA 1EZUC 4X6OA 3T26A 4IN2A 2Y5FA 3BTTE 4YZUA 3T2NA 1TBRH 4OGYA 1XUKA 3TGIE 1ZR0A 4HI3A 1S84A 1P2KA 2J38A 3RMOH 3GCOA 1O2VA 3RLWH 1HAVB 5E0GA 2V3HH 3MH6A 1KXFA 2EC9H 4MPVA 1LMWB 3LDXH 1UVPA 3NCLA 3SQEE 2BQ6B 2QC2A 1TQ7B 2B9LA 3AAUA 2GX4A 1PPHE 4I7YH 3SV2H 1G36A 3K2UA 3P8GA 3QO6A 1GI3A 1E34B 5EW2H 4I31A 5JBTA 2Y5HA 2PUXB 1NN6A 2BX3A 3FAOA 3SV6A 3QGNB 1JWTA 2QY0B 1Z8IB 5GJ4B 2ZCHP 1EZSC 5DPAA 4NA8A 2VIVA 1UO6A 3ENSB 1YCPK 1NRNH 1Y3UA 1BRCE 1EAUA 1TAWA 1Z6JH 1GGDB 1YPHE 3ZZ6A 1KSNA 3V3MA 4OS7A 1GJ4H 3K65B 1BTUA 1GJ5H 1P10A 2ZCKP 2C4FH 1TMTH 3F6UH 1NFYA 2A45B 2VGCC 1P2MA 2CF9H 2O9QA 4K1EA 3SJ9A 4FUHA 2ANKH 8LPRA 2Y7ZA 5CMXH 2GKVE 2OINA 1LQDB 5HXFA 5LH8A 3LOXA 1W12U 3ZZ9A 1T32A 1BB0B 1JRTA 4WVPE 3RLYH 2ZZUH 4A1TA 4UE7H 2OP9A 3TH3H 1BTHH 1G32B 2BLQA 1S6FA 1VITH 3ZVDA 1V2QT 4XDEA 1H4WA 1RFNA 7LPRA 2SGDE 1ANEA 3UR9A 1C1WH 3FP6E 1FLEE 2BQ7B 4BOHA 3U1JB 5JBAS 4LZ4B 2CXVA 2PV9B 3LJOA 5C20A 1O2YA 3SV9A 2UUFB 1AUTC 1SFIA 1O2WA 4OS1A 3V12A 3SJKA 2EI7A 1C1NA 3RMLH 1C2FA 1TABE 3RXIA 1MAXA 4MNXA 4NSVA 1O3IA 3RXSA 2PSXA 2ANMH 3SGAE 3S69A 1MUEB 3NWUA 1Z71A 1XUGA 2VJ1A 5EW1H 1TOMH 1DY9A 3PV4A 4DIIH 4YTAA 4K1SA 1DITH 1GBIA 1FY8E 2Z6BD 5TCCA 1WAYB 3ELAH 3TJNA 6LPRA 2NU3E 2BD8A 1O5DH 3AW1A 3C27B 1EP5A 4UFGH 3BTQE 3P92A 5F8TA 1P04A 4X8VH 3RXVA 5A09A 1Y5AT 3BTGE 1KXEA 2HVXA 2VGCB 1TGCA 5DP3A 2BM2A 3BF6H 3F9EA 1G3BA 5FX6A 3TLOA 4TYDA 3LGYA 4OS6A 1OP2A 1FJSA 1O3GA 4H4FA 1Z8JB 1YPGH 2AH4X 2FI3E 4FU7A 4ABGA 1UTNA 3T25A 3NKKA 5EPNA 3PO1B 3PWCA 1BMAA 1O2UA 1MTWA 3GY3A 3UOPA 4LZ1H 1OP8A 3RXRA 1AKSA 4Q80A 1YP9A 1PYTC 5I46H 2OLGA 3E3TA 2BB4A 3F1SB 1GVLA 1F92A 1UTJA 2ZDAH 1P2OA 3EA8A 5A8XA 4AORA 4DY7B 1AFQB 2THFB 1LTOA 4ASHA 2BY9X 4UFDH 2RG3A 1TX6A 4FU9A 2XC5A 3TK9A 4NZQA 4KELA 4YT6H 5T6GA 2FYRA 1V3XA 1ABJH 1GBCA 5LPEA 2TGDA 1ID5H 1YCPM 1T7CA 1AVGH 2NU2E 3URDA 1S0RA 1LPGB 3HGNA 4Y8XA 1IQNA 1O3FA 1ANCA 3A7XA 2F83A 1NM6A 1GBBA 1YYY1 1V2UT 1NY22 4I32A 4X1RU 3GCTG 2ZU1A 1BHXF 2M5TA 2G55A 2BVRH 3A8AA 3RXKA 1GHAF 1C5UA 1O3JA 2A4OA 3GY7A 1MCTA 1UVTH 4JYVH 1G3EA 3QTVH 4K5ZA 2UWLA 1Y3YA 1C5YB 4J1YA 3BTME 2FODA 3MU0A 3SUDA 5JPMH 1DXPA 1UCYK 3M7UA 2UUYA 1UMAH 1CQQA 1HDTH 4JCNA 1GJ9B 2HLCA 2PR3A 2PW8H 5DP5A 2ZPQA 5C5NA 2Y81A 1LPZB 2DE9A 3RU4T 2ZECA 1QJ1B 4XOJA 2CHAB 1RRKA 5T6DA 3BTFE 3M35A 1NRPH 3H7TA 1MCVA 2SGPE 1L2EA 4K1TA 4YOIA 1WU1A 2A2QH 1BIOA 1RGQA 1YC0A 3HK6B 2F9BH 1QFKH 3M3VA 1P2IA 1XM1A 2HRVA 3LGIA 3W95A 1N1LA 5F6MA 1WTGH 3E90B 1Y3WA 3EGKH 5FAHA 3QTOH 2Q1JA 1DSUA 2PKAA 3QUMP 3M3TA 4AFZA 1E38B 4UONA 1DWDH 4CR5A 5F03A 5GCHG 2ANYA 4BAOB 1NT1A 2R2MB 2BD4A 2BMGB 1Y5UT 6ESTA 4AYVB 5AFYH 4DURA 1SGPE 3A81A 1YF4A 4Y71A 4X8UH 3KN2A 1THRH 3FP7E 1J9CH 3RXDA 1CT4E 3KIDU 3VGCC 5L6NH 2BXTH 3HKIB 3TJOA 2WUCA 2CMYA 3RXUA 3N7OA 2LNCA 1XXDA 2VINA 1OS8A 2IN2A 1K1PA 3RU4D 1HXEH 1W13U 3EA7A 1GBDA 1N6YA 3EA9A 4ZKRU 2C8YB 4TWYA 1NPMA 3KQBA 5EGMA 4FUIA 1O3HA 2WINI 1TNKA 1C2IA 1T4VH 1ELGA 2GD4B 2CF8H 4BAKB 2R9PA 1K9OE 3L33A 1CA0B 4Y76A 2BY6X 1SQAA 1D4PB 3BEFB 5DP4A 4YOGA 1C5OH 4J2YB 2QIQA 1PQ8A 1EPTA 1O3BA 4I8JA 2BYAX 1ABIH 1SGRE 3A83A 1C2HA 4OS5A 3PO1C 1ZRBA 1P3CA 4VGCC 4AB9A 1ELEE 1DXWA 4I8GA 2STBE 3LH3A 3A8BA 1KXCA 3U8TH 1O2GH 1O2HA 2Z9JA 2TBSA 2SNWA 3UREA 5FHTA 4K69A 4Y11E 2LPRA 2ZTXA 1FY4A 3QZRA 1OWHA 4GLYA 1AMHA 1EQ9A 1IQFA 5FBIA 1G3DA 5E8EH 2EA3A 1AWFH 1ELDE 1IQHA 1L1NA 2BDGA 1WTHD 2ULLA 1SHHB 3BN9A 4AOQA 3SUFA 2BZ6H 2OC7A 2PUQH 1IAUA 1UVUH 7GCHF 1CE5A 1T8MA 2G51A 3F9GA 5GPIB 1CT0E 1RIWB 5PTPA 2CJIA 1K1MA 2STAE 3UWJH 1SR5C 1YPMH 2G4UA 4RKJB 1AKSB 3HKJB 2F91A 4O97A 1SGCA 3WY8A 2ZDNA 1NFXA 1GBKA 2A1DB 1Y59T 1GMHG 3A7TA 1SC8U 2FWWA 2NWNA 1HAOH 1G9IE 3T29A 2OBOA 2BY7X 4BAMB 5EQSA 3HK3B 4MNYA 1FPCH 1LPKB 1V2MT 1P8VC 5K7RA 1O3LA 3FANA 4Y0ZE 1ZSJA 2A31A 1MZDA 1O3AA 2ZIQH 3GOVB 3SQHE 4Q7YA 1F0SA 1MH0A 1GBAA 4ZKOU 1K2I1 4D7FA 1XVMA 3UWIA 2HGTH 4I33A 2BDBA 1O3CA 5GCHF 1YPEH 1O3EA 3U8RH 1BTXA 4HFPB 1WUNH 2UUJB 1HAZB 3PWBA 3RXQA 3DUXH 1HAVA 4F49A 4B2AA 4NA9H 2BLOA 1TMUH 1C5SA 2OXSA 2ZC9H 2FOEA 4O03A 2P3UB 4HZHA 1QR3E 1S81A 1O38A 1HBTH 5FCKA 1S6HA 1GJAB 1OP0A 2HNTF 4XSKU 1ETSH 2BDHA 1ZPZA 2ZGBH 4DJZB 1AFEH 3P8FA 3ZYEA 4AFUA 2JH6D 1UK2A 1FN6A 3MU1A 1WSSH 1OWDA 4WMEA 4GHQA 1O3NA 4XFQA 3MH7A 3CP7A 4FUBA 1YLDA 1LVMA 5GWZA 4ABJA 1DWEH 1JRSA 1M9UA 1SGEE 2A7HA 7KMEH 1QB9A 5DP6A 7ESTE 4AX9H 4ZXXH 2BY5X 3LGUA 4UEHH 1HNEE 1AVXA 1RXPA 3ZZ7A 2YOLA 2ZHEH 2VIOA 1SGFA 3E16B 1A2CH 1O2TA 3DFJA 2O8MA 1B0EA 3LPRA 2AIPA 3VB7A 2ANWA 5EOKA 5EXLA 1G2LA 1PJPA 2QF3A 2TRMA 1P09A 3SJ8A 2HOBA 1C5ZB 3QLPH 4AFQA 1BTYA 2XTTB 4DVAU 1IQGA 1SSXA 2CV3A 4UFFH 1MBMA 3MNCA 1JOUB 4INHA 2XBVA 3SU5A 4R0IA 2C8XB 4FUJA 1W7XH 3IWMA 1BA8B 1F0TA 1OPHB 2Y5GA 2WPIS 4TPYA 3RC5A 3GCHB 2BDCA 1Q31A 1A1RA 2YNBA 4LOYH 2FEQH 3MH4A 3BEUA 3URCA 1C2KA 2FYQA 3VB5A 2FPZA 1TRYA 2AIQA 3KEEA 2HALA 5DO4H 1GJDB 1THPB 1GI0A 4X1SU 3P8OA 4AN7A 1CU1A 3VXEH 1GBTA 3A84A 2WPJS 2ZI2H 4MNVA 1PQ5A 4GSOA 1SGYE 1L4DA 1ZMLA 1MQ5A 2P3TB 4CBOA 2BLWA 2ZDLA 1UHBA 3UR6A 1UTPA 4ZHLU 2GVFA 1DICA 4JZ1A 1AO5A 3DFLA 2BLVA 4AGJA 1FMGA 1HAPH 1IQIA 1KXBA 1DUAA 3A8CA 1D3QB 1P57B 1YPJH 4B75A 4F4OC 2A7JA 2SGAA 3RUOA 1J16A 2SGFE 4X0WU 1GHBF 1BRUP 1ZGVA 1T31A 5HM2A 4KTSA 1LHGH 5F8XA 1P12E 1N6XA 3ZZBA 3A7WA 2FOFA 1C5XB 2R3YA 2ZCLP 2BDYA 1VCQA 1ZMNA 1MTNC 4FVBA 1SG8B 1Z8GA 4TY7A 2BD3A 1RD3B 2A4RA 4AGKA 1ZPBA 4WH8A 1V2ST 3PMAB 3S9AA 3TGJE 4K3JA 1MTVA 1TPPA 4ZUHA 3OX7U 6CHAB 2WPMS 1A3EH 1O2NA 2ZFSA 3CS7A 4Y6DA 1EP6A 1N8OC 1ACBE 2Q6FA 1PFXC 1FZZA 3PMHB 1O2PA 3I78A 4FXGH 1CBWC 1FONA 1C5QA 1TX8A 1BBRK 1K1IA 3SU4A 1GBFA 4M7GA 4YM9A 1ZTJA 1HGTH 2Z94A 2FLBH 2A7CA 4DCDA 1TQ0B 2ZHWH 2F9NA 1XUIA 3ATKA 1B0FA 3KQCA 1HAYB 5JBCS 2FI5E 2ZWLH 1W0ZU 1C5RA 5DG6A 3ZVEA 3BTEE 1FI8A 3RDZA 5H4IB 1ZYOA 4TWWA 1HFDA 2VH0A 4Z6AH 2VIWA 2Z9KA 1GCTB 2GZ8A 2XRCA 3M3SA 1EAXA 1LVOA 2J34A 4CHAB 4UD9H 4MTBA 5EXNA 1C9TA 3MTYA 3SGBE 2NU4E 1Z8RA 2GCHG 2HNTE 1TA6A 3AVZA 2FDAA 2H9EH 1GDNA 3KHVA 2GCTB 3ODDA 5A8YA 1DSTA 1L0ZA 1GG6C 1AVWA 1GL1A 3PTNA 3KGPA 1L1GA 2BQWB 1UVSH 1CHGA 2WPKS 3P95A 4OS2A 2OQ5A 1C2EA 1C2DA 4WXIA 1DE7H 1MAYA 1GBMA 1VCPA 2QXGA 5E0JA 1S5SA 2AMDA 3SI3H 4D9QA 1BCUH 2GZ7A 3H7OA 1D6RA 5IYTA 4BTTB 5JYIA 1L4ZA 1EJMA 1TMBH 4JK5A 2BHGA 1MD7A 3Q00A 3MOCA 1KXDA 1RTLA 2QN5T 1NS3A 2P16A 4LK4A 3RXGA 2H1UA 1O3MA 1EJAA 1QQ4A 3SU0A 2SGEE 4NZLA 4B2CA 1GJBB 3E0NB 1SLUB 4X2WA 1BJVA 1VITG 1Y5BT 2I6SA 4X1NU 1Y3XA 1DANH 1LHFH 3R0FA 3R3GB 1IQKA 1QBOA 3KF2A 3O8RA 2QXHA 3MU5A 5J4SA 1TA2A 1MU6B 1V2KT 3DT0H 8KME2 2J2UA 1LQEA 2ZTYA 3V13A 3LH1A 1GBJA 3KNXA 3E0PB 4JYTA 1FPHH 1F7ZA 3SHCH 1MZAA 3SORA 1AZ8A 5GDSH 2D26C 2Q6GA 2XC0A 2BD2A 4ABEA 4XE4A 1DUEA 1EUFA 2OBQA 2AGGX 3M5LA 1GMCF 4UFEH 1HLTH 1O31A 1SGFG 2TPIZ 3RC4A 2P94A 4YESB 3ATMA 2ALVA 1YPHC 1FV9A 2GCTC 2QV1A 2V0BA 1AE8H 4KGAA 1WV7H 1ZRKA 3Q3XA 4NIVA 2SNVA 3RXOA 2GMTC 3ZZ3A 1TNHA 3O8DA 4Y8YA 1BOQA 3QGJA 3GICB 4Z0KA 1KYNA 2BD9A 1A0LA 2QAAA 1AGJA 1XX9A 1LDTT 1KXAA 2VVVA 2TGAA 3D62A 3P70B 1O5GH 2G00A 2P95A 4ABFA 1DLEA 1IQMA 1EPTB 3UQVA 3GY2A 1O0DH 5C1XA 4GHTA 1K1OA 1AB9C 2GTBA 1ZJDA 1D3PB 5AF9H 3SJIA 3SNDA 1YKTA 1O5BB 1BTWA 1MTUA 5EG4A 2W5EA 4E7RG 3KQEA 3RXCA 3ITIA 1O2QA 1BT7A 1KDQA 1GHZA 4CRBA 3D65E 1P06A 3FZDA 1EASA 1LCYA 3IG6B 2R2WU 1SGIB 2OC1A 5GIBA 1GGDC 3RU4E 4D76A 1C1SA 4AB8A 2VB0A 1G2MA 4BXSA 1H8IH 1FN8A 1MKWH 3ZV9A 1ELTA 1C1RA 1YGCH 1FNIA 1QJ7B 1K28D 3E1XB 2WPHS 1CGHA 1O35A 4RN6A 1MTNB 3MU4A 4A1VA 1P2QA 3UIRA 4IBLH 1QY6A 3VEQB 1TNGA 1HB0B 3LKWA 2ZDKA 1QRWA 3BTWE 4ISNA 1V2NT 2J95A 2B7DH 3FVFB 2J92A 3I29A 3TK6A 3FZZA 1HJ9A 1J14A 3RM0H 4B71A 3SJOA 3QN7A 1CGIE 1QRXA 3RXHA 1K1LA 2I6QA 3U8OH 2JH5D 1CA0C 2ZA5A 1TPSA 4NA7A 2GP9B 3RP2A 3S0NA 3E91A 3PM3A 5ABWA 1ESAA 1TGBA 3SNBA 2XBYA 4RKOB 1PQAA 1AI8H 3RMNH 4HGCA 3UQOA 1O2OA 3GY6A 2FLRH 1VR1H 3BTDE 3NK8A 1EZXC 2ZFTA 1MKWK 5G4BA 3RXTA 3HGPA 3SI4H 3M5MA 1P9UA 3SV8A 3M5OA 1C5PA 1ELAA 2W26A 1C1PA 1DDJA 1ZZZA 1HRTH 4KTCA 1WOFA 4X6PA 2TGTA 1W7GH 1ZSKA 3SZNA 1BTZA 4X1QU 2PTCE 5CHAC 2BTCE 1E37B 2BX4A 3BG8A 1O2RA 1TGSZ 2FXRA 2ZGHA 3TNTA 1G37A 8ESTE 4U32A 2RCEA 2H9HA 5FPTA 2A0QB 1MU8B 3V0XA 1HJ8A 5HGGA 1EOJA 1O2XA 1CVWH 2XWBI 4ABHA 1KY9A 2O8LA 2Z7FE 1TGTA 2ZGCA 3ZVAA 1SQOA 3IITA 1SVPA 4IW4E 1KLJH 3EDXB 1HAHH 1O36A 3ZVGA 1HJAB 1TGNA 1GI7B 4Q7ZA 4ZHAA 1SGQE 2D2DA 1GI8B 4INKA 2FOCA 4CREA 5ETXA 2PHBA 4A7IB 5A0CA 5FPSA 1C1MA 1CA8B 1W11U 1HIAB 5EPYA 1T8NA 4FVDA 1UJ1A 5C1YA 1MKXK 4BNRA 4ABDA 1ETRH 1LO6A 3Q3KA 2GV6A 1TBZH 4XBBA 1E35B 4SGBE 3A88A 3PROA 2B5TB 1GDQA 1DVAH 3MYWA 2A32A 4CBNA 1S0QA 2J94A 2WYJA 2A2XH 1AU8A 3PTBA 1BDAA 2HNTC 1IQLA 1CO7E 3ZZAA 1A4WH 1EAIA 1TE0A 2RDLA 4KP0A 2EEKA 4WY3A 4AZ2B 4ZMAH 2H5DA 1ZHPA 3F9HA 4MG3A 4NFEA 4IC5A 1YLCA 3UPEA 2UWOA 2P8OB 1D9IA 3RC6A 1O5AB 3TITA 1WCZA 3NUMA 2FTLE 3LJJA 4FUDA 2WYGA 1NRQH 4KKDA 2HPQH 5BRRE
chains in the Genus database with same CATH superfamily
5C3NA 2CN0H 3SNAA 1VITF 2BOKA 2B8OH 4CR9A 1HCGA 4D9RA 1W14U 4R8TB 1K1NA 2VIQA 1OWIA 1GMCG 2OTVA 3MH5A 4FUFA 5FCRA 3LGWA 1O30A 4BAHB 1GL0E 1OWKA 3OU0A 3ZVBA 2FIRH 1PPEE 1SI5H 1O2JA 1PPZA 2IJD1 4NFFA 8GCHF 2FS9A 1QL9A 7GCHG 1V2OT 1UW7A 5A8ZA 2FOBA 4AFSA 1KMHB 1MBQA 2ZGXH 2OC8A 3U98H 1O5CB 3TK5A 4E7NA 3EYDA 1W8BH 3VB3A 1MD8A 5HMAA 5DKMA 4JZEH 2G5VA 3TJUA 1V2VT 3M5NA 5EU8A 3TIUA 2QYIA 2PLXA 3MI4A 3GYMA 1SGNE 3PLKA 4BTIB 4E05H 1BBRH 3M61U 2PGQB 1O3DA 4X1PU 5L2ZH 1QNJA 3E6PH 2Y80A 4JZDH 4MPXA 5IDKA 1SBWA 1LVYA 1C2LA 2IPHA 1GBEA 3UFAA 1JIRA 3RXFA 1IHSH 1J8AA 2ZQ1A 4GCHF 3KL6A 3QWCH 2AMQA 3ESTA 1FAXA 3A86A 2V6NA 1X7AC 3BSQA 2AFQB 4Q63A 1FDPA 1YLNA 3EE0B 5SGAE 1Q3XA 2UWPA 1GI6A 2ZPRA 2FOAA 1UVOA 4CRGA 1WQSA 3ZZ5A 2P93A 3T27A 2XNIA 4AG2A 2Z3DA 3L3TA 3PMJA 5K0HA 2G8TA 2F9OA 2J4IA 1NZQH 2FOHA 2NU1E 2VWOA 4DOQA 3D49H 3MO9A 1F5LA 1Y3VA 1SGTA 3RXEA 3B23B 4H6TA 3MO6A 2Q6DA 2VWMA 1C1OA 3F68H 1UCYE 1GVZA 2XXLA 2ZFQH 1CGJE 3LIWA 1CSOE 2VVUA 2ODPA 3JZ2B 4DT7B 2Z3CA 3VPKA 2G81E 1KDQB 2JJ1D 2JH0D 2VWNA 1MTSA 3HPTB 3RXBA 3I77A 3FKSD 3MNBA 1LHEH 1NFWA 1QQUA 4X6MA 3AASA 4TY6A 1TX7A 2R0LA 2RA0A 3GCHC 1TPOA 5B6LA 2FOGA 1A5GH 2G4TA 2WZQA 1QL8A 2C93B 1C5VA 2IPQX 3S9CA 1ZPCA 2WV5A 1SPJA 1MKXH 2AGEX 2BD5A 3F2HA 3HATH 3L6PA 1C2JA 1F0RA 2ZHFH 3OY6U 4UDWH 3TH4H 4KTUA 1P2JA 1GWAA 4WMDA 2NU0E 3QK1A 1ELVA 1FIWA 1H9LB 4MVNA 5BPEA 3VB6A 3BIUH 3EQ0H 4B2BA 1AIXH 1GBHA 1GMHF 5CHBA 1EB1H 1OKXA 3OTPA 3Q76A 2ZU5A 1G30B 1RIWC 1PPBH 1ELCA 2OC0A 2OUAA 2FX6A 1DWBH 3GDSA 3SUGA 2ZHDA 1SMFE 2C3SA 2EQNA 4F48B 3ZZ8A 5LPRA 1SLVB 1VGCB 4ABIA 1UTQA 3A89A 2PP6A 2QXIA 1AWHB 2QCYA 4WF8A 3GY5A 1TNJA 3N99A 4YOJA 1C4U2 3A85A 2PWXA 1XKBC 1KLIH 3PRBA 2JKHA 4HG6A 1BUIA 1V2LT 3FP8E 5CE1A 3SO3A 3ATWA 2VWLA 1IQEA 5C67A 3MO3A 1QURH 1QL7A 1J17T 1WXRA 1C2GA 3ZZ4A 1V2WT 1XKAC 5LGOA 1GHWH 2XOKD 1LVBA 1TWXB 6CHAC 6GCHG 2BDIA 1DWCH 1DM4B 1EOLA 1O3PB 1D6WA 1BJUA 2PFEA 3BIVH 1AE5A 1W0YH 3UNQA 4OGXA 4U30A 1TIOA 2AMPA 2GT8A 1KLTA 5AVDA 2FO9A 1V2JT 1BRBE 1P03A 2W3IA 3NXPA 3A8DA 2QXJA 1A7SA 4LXBH 1QGFA 1CT2E 1BQYA 3RXMA 3GY8A 1CHOF 3SU1A 1T8LA 1C5NH 4E06H 1E36B 4K8BA 4XD7D 5C0UA 4ZH8A 5TCAA 1TLDA 2C90B 3M7QA 3VXFH 3D23A 1NU9A 1ORFA 5FBEA 5LPFA 1THSH 1GI4A 1P9SA 3NPSA 3SU2A 1W10U 4JZIA 1GDUA 1QA7A 3U9AH 2ODQA 2J97A 2RA3A 2ZU3A 3LGVA 4ZKSU 1V2PT 2XYAA 1C1UH 1FY3A 1QRZA 1FY5A 2Y7XA 5C1UA 3ZVFA 4BAQB 4X2XA 1SLWB 4ZXYH 1A46H 1XXFA 9ESTA 2BOHB 1BITA 3UY9A 2EY4C 1O2MA 2AYWA 4ISLA 2O8TA 3H5CB 5GXPA 1SHYA 5A2MH 2UUKB 1OYQA 4A92A 2EI8A 4ZAEA 3T5FH 5FL7D 2R0KA 2KM0A 4K60A 5DJ7A 1BMMH 2XBWA 1QB6A 4Y10E 4RT1A 4XBCA 1P11E 4ISOA 5ESBA 1Q2WA 4Y7AA 4NIXA 2ZNKH 3MMGA 3OYPA 1A5HA 1QCPA 4B73A 1V6DA 1JIMA 1WYKA 1O2IA 3RXAA 2BXUH 1J15A 2R3UA 1FIZA 1NRRH 3S7HB 2P59A 1HJAC 3OEHD 2HLDD 1AD8H 1C1QA 2AERH 1QA0A 1WBGB 3MHWU 4NCYA 4A5TS 4Y8ZA 3Q77A 2ZGJA 2H5CA 3VFEA 2F3CE 1MMJN 3C1KA 3MFJA 1O2ZA 4ZHMU 1O5EH 1NFUA 1WDIA 2ZEBA 4TPIZ 5I25A 4X2YA 1FQ3A 3UTUH 5C2ZA 1SLXB 1HPGA 2W7SA 1A3BH 3VG8A 3DA9B 1NBMD 4ESTE 1FX0B 2ZFRH 4YLUA 3DD2H 2LP6A 1TNLA 5ESTE 4B6EA 1GI9B 1SOTA 5CHAB 1YCPH 1GHAG 4ABBA 2K1QA 1O3KA 1Z7KA 4Q7XA 3S7KB 4CRCA 2FZZA 3JZ1B 2F9PA 2EI6A 3MNSA 1GPZA 2ODYB 1C5WB 3W1EA 3ZZCA 2Z9LA 1GCTC 2XW9A 1GJ6A 1GHBG 1FAKH 3KCGH 1GMDG 2Y82A 1GJ7B 1OWEA 3LT3A 4O9VA 4Y0YE 4NWLA 4O3UA 1BBRE 3FFGA 3UNRA 1EXFA 4MLFB 1ZTKA 3W94A 4FETA 3MU8A 2XBXA 3UOUA 4WXVA 1TALA 1INCA 4INLA 4HTCH 5DP8A 3T28A 1P05A 2OCVB 1O5FH 3GCNA 3WWBA 1A0HB 1Z6EA 2TGPZ 3V7TA 4DW2U 4X8TH 1N8OB 3A80A 1BZXE 1DT2A 1EPTC 1XMNB 2GDEH 4BANB 2A5IA 3BEIB 1DOJA 2V35A 4GVUA 1AZZA 5AHGH 2P3FH 1O32A 1TRMA 4IGDA 3BTKE 6GCHF 5A0AE 4MNWA 2JIZD 5T6FA 2ZF0H 4WWYA 3H09A 4NIYA 5JBBS 1HXFH 5FPYA 1DPOA 5EODA 1AFQC 2J9NA 5L2YH 1OOKB 2O8UA 3PLBA 1C5LH 2FMJA 1EKBB 1UTOA 1GI2A 2XC4A 2VVCA 2O8WA 1QIXB 1JBUH 4MDSA 3RXPA 2ZTZA 5HYOA 1H8DH 1TNIA 1Z1IA 1HAXB 1E0FD 3CNRA 1IOEA 2PGBB 5F8ZA 1RJXB 3ZIAD 1RTFB 4GPGA 2JETB 1SB1H 1JXPA 2GCHF 1DY8A 2A5KA 3ATIA 5E0HA 2ZDMA 4SGAE 4X2VA 3CENA 4DIHH 3TPIZ 1EJNA 1HYLA 3K6YA 1RTKA 1C1TA 2KAIA 1QJ6B 1GVKB 1W3CA 1WQVH 1H8ED 1PYTD 2A4QA 3BG4C 3M37A 1C2MA 1Z1JA 3AW0A 2BDAA 1BMNH 4VGCB 1PQ7A 4QT8C 1OWJA 2B0FA 1JMOH 1UK3A 2HPPH 1SKYE 1ESTA 3SW2B 3M36A 3LU9B 2F9UA 5FX5A 1BRAA 2D1JA 3SGQE 1TONA 4Y7BA 1ETTH 1DLKB 5E2OA 1O33A 4FOUC 3TU7H 4X6NA 1KIGH 1GHYH 1EB2A 1TFXA 4H42U 4IC6A 5DK1A 3LC3A 2G5NA 1P01A 1PPCE 2GGVB 4B76A 9LPRA 3K9XB 3O8BA 3KYFA 1QBNA 2GZ9A 3U69H 1GBLA 3A82A 3TJVA 1O2LA 2XCFA 4GUXA 1ZOMA 1ZJKA 3GISB 4NIWA 3SHAH 1PPGE 2FI4E 2GT7A 4IMQA 3SNCA 3STJA 4OS4A 2YNAA 1HV7A 4ZROA 2ASUB 2Y6TA 1AY6H 3AAVA 1ZHRA 4FUEA 4BXWA 2BZAA 1V2TT 1GMDF 1AB9B 2HWLB 4JYUH 3M7TA 2A4GA 3F9FA 8GCHG 2DUCA 1F5KU 3A7VA 5TJXA 1S83A 3U28C 4I8HA 1ELBA 1UTMA 2JETC 3F0PA 2FX4A 2QF0A 4WJG2 3RMMH 3RM2H 2J98A 2ZFPH 4IN1A 2P8OC 2GMTB 2VNTA 3VGCB 1ZGIA 3EE7A 2ZQ2A 2ZG0H 2VIDA 4GAWA 3ZVCA 4Q4LA 3DHKH 1FXYA 4Q2KA 3B8JA 1QBVH 4CHAC 1DFPA 4GCHG 4XBDA 4K8YA 1S85A 3BG4B 4YO9A 3GCTF 4K2YA 3A87A 1O2KA 3SU3A 3G01A 1OX1A 2V3OH 2VH6A 1YBWA 1BHXB 3QZQA 1LHDH 5C5OA 3SUEA 5B6OA 1F5RA 1ZSLA 1U6QA 1C9PA 1HAGE 4RSPA 5F53A 1FY1A 3P8NA 4B1TA 1H9IE 4U01A 5L30H 2Z9GA 2ZP0H 4BTUB 2QA9E 3P6ZB 1VJAU 1MQ6A 2HVYB 5JDUB 3LC5A 1OSSA 4JZFH 1ZTLA 4ZKNU 2C8WB 1O34A 3SU6A 2KCPA 1O39A 1VZQH 1ZLRA 4O3TA 5AFZH 1GJ8B 1LHCH 2GV7A 1P2NA 4RI0A 2FS8A 2OQUA 1HUTH 3RXLA 1AQ7A 3EAJA 3TNSA 1EATA 1COWD 1YY3A 3GYLB 3PLPA 1NESE 2KAIB 1UTLM 5A0BA 1YPKH 1A61H 1NRSH 4A6LA 2ZPSA 1GJCB 4FU8A 1BTPA 4CRFA 1E79D 1NU7B 3PB1E 1SFQB 1DS2E 3OY5U 1NROH 2DE8A 3ATLA 2BY8X 1UK4A 2H9TH 1Y8TA 2BVSH 2PKSB 5HM9A 4MPUA 3TGKE 2LELA 1NC6A 2AS9A 1RS0A 2W3KA 1UTKA 3LONA 3DSPA 3UNSA 3TVJB 5J4QA 2ZKSA 5T3HA 1PPFE 1ARCA 2FESH 1C5MD 3SOSA 1QB1A 4JMYA 1GHVH 2ZU2A 1KTSB 5DGJA 1F0UA 4B74A 2ZU4A 1CHOG 2XWAA 4DG4A 1O3OA 4WH6A 2PSYA 3PMBB 1YM0A 2ILNA 2SGQE 5FXLA 1SOZA 2AGIX 3SV7A 1K0HA 4NWKA 1ANDA 1A0JA 1FUJA 3CS0A 2A5AA 2J5UA 1G3CA 2FTMA 2ZFFH 3SBKA 4CRAA 1TB6H 1K1JA 4NSYA 3GDVA 3A7ZA 3TH2H 3F0OA 5JB9S 1H9HE 1P0SH 2SFAA 3NZIA 1HAIH 2XCNA 4ABAA 2FM2A 2PTNA 2G52A 2H2ZA 3LGTA 2TIOA 3OFND 3MNXA 1S82A 1QTFA 2IJOB 1P3EA 4U2WA 1EAWA 1TPAE 3GDUA 4NG9H 2ESTE 1NTPA 3KQDA 4MPWA 1GI1A 4FUCA 1ZMJA 3K6ZA 2BD7A 1O37A 3DCLA 1C1VH 1D3DB 2AEIH 3SNEA 3ZZDA 3VB4A 2CGAA 1VCWA 3PYHA 1ZHMA 3QDZB 1SQTA 1ANBA 4YT7H 3ODFA 1VJ9U 4CH2B 2FP7B 2PKSC 2F9VA 4THNH 1IHTH 1BMLA 1C4V2 1EZQA 1K22H 4ISHH 4AG1A 1T4UH 3OTJE 1UHBB 4I8KA 4YLQH 4AYYB 1V2RT 1B7XB 2WV4A 3U1IB 4H6SB 5EQQA 4ACAA 3OSYA 1GG6B 1LKAA 4FUGA 3N7DA 1C4Y2 2V3MA 4NGAH 1TRNA 1XUJA 1K21H 3STIA 2ALPA 4CH8B 3MWIU 2CK3D 2OD3B 5DP7A 5DP9A 4A1XA 1IQJA 2CHAC 1ELFA 4X8SH 1A5IA 1GCDA 1DX5M 2FOMB 1P02A 2Z3EA 2ZHQH 1CBWB 1SL3A 2Z9IA 2WPLS 2PKAB 4JK6A 3DSOA 1NO9H 3A7YA 2WUBA 2ZDVH 4MQAA 3N7EA 3RXJA 5C94A 3E8LA 1XUHA 4IS5A 4CRDA 3GY4A 1TBQH 3BV9B 1YPLH 2QGRA 1O2SA 4IMZA 1ARBA 2GDDA 1AN1E 4WMFA 3ZYDA 3S9BA 3BTHE 1W2KH 2VIPA 2IOTA 2D8WA 3P17H 3F2FA 2BVXH 2OK5A 3UUZA 1ESBA 3SN8A 1HIAA 4PROA 1GI5A 2ZO3H 1UCYH 1D3TB 5JB8S 5EJ1A 4ISIH 1QHRB 3GS9A 1OYTH 1XUFA 1H1BA 1GHXH 5EQRA 3ZV8A 1XVOA 1TOCB 2H6MA 1VGCC 3O8CA 3Q3YA 1AUJA 1KTTB 1L1JA 4I8LA 5EXMA 1EX3A 1TYNA 1OXGA 1LKBA 1C5TA 3T62A 3B9FH 1T8OA 5E2PA 4Y79A 3QX5H 1F2SE 1SGDE 2C8ZB 4DGJA 1AHTH 1B5GH 2VU8E 2W7UA 4D7GA 4D8NA 1EZUC 4X6OA 3T26A 4IN2A 2Y5FA 3BTTE 4YZUA 3T2NA 1TBRH 4OGYA 1XUKA 3TGIE 1ZR0A 4HI3A 1S84A 1P2KA 2J38A 3RMOH 2K0QA 3GCOA 1O2VA 3RLWH 1HAVB 5E0GA 2V3HH 3MH6A 2KZ4A 1SQRA 1KXFA 2EC9H 4MPVA 1LMWB 3LDXH 1UVPA 3NCLA 3SQEE 2BQ6B 2QC2A 1TQ7B 2B9LA 3AAUA 2GX4A 1PPHE 4I7YH 3SV2H 1G36A 3K2UA 3P8GA 3QO6A 1GI3A 1E34B 5EW2H 4I31A 5JBTA 2Y5HA 2PUXB 1NN6A 2BX3A 3FAOA 3SV6A 3QGNB 1JWTA 2QY0B 1Z8IB 5GJ4B 2ZCHP 1EZSC 5DPAA 4NA8A 2VIVA 1UO6A 3ENSB 4AC9A 1YCPK 1NRNH 1Y3UA 1BRCE 1EAUA 1TAWA 1Z6JH 1GGDB 1YPHE 3ZZ6A 1KSNA 3V3MA 4OS7A 1GJ4H 3K65B 1BTUA 1GJ5H 1P10A 2ZCKP 2C4FH 1TMTH 3F6UH 1NFYA 2A45B 2VGCC 1P2MA 2CF9H 2O9QA 4K1EA 3SJ9A 4FUHA 2ANKH 8LPRA 2Y7ZA 5CMXH 2GKVE 2OINA 1LQDB 5HXFA 5LH8A 3LOXA 1W12U 3ZZ9A 1T32A 1BB0B 1JRTA 4WVPE 3RLYH 3NRLA 2ZZUH 4A1TA 4UE7H 2OP9A 3TH3H 1BTHH 1G32B 2BLQA 2W6JD 1S6FA 1S6LA 1VITH 3ZVDA 1V2QT 4XDEA 1H4WA 1RFNA 7LPRA 2SGDE 1ANEA 3UR9A 3UB0A 1C1WH 3FP6E 1FLEE 2BQ7B 4BOHA 3U1JB 5JBAS 4LZ4B 2CXVA 2PV9B 3LJOA 5C20A 1O2YA 3SV9A 2UUFB 1AUTC 1SFIA 1O2WA 4OS1A 3V12A 3SJKA 2EI7A 1C1NA 3RMLH 1C2FA 5DSFA 1TABE 3RXIA 1MAXA 4MNXA 4NSVA 1O3IA 3RXSA 2PSXA 2ANMH 3SGAE 3S69A 1MUEB 3NWUA 1Z71A 1XUGA 2VJ1A 5EW1H 1TOMH 1DY9A 3PV4A 4DIIH 5EIYA 4YTAA 2WSSD 4K1SA 1DITH 1GBIA 1FY8E 2Z6BD 5TCCA 1WAYB 3ELAH 3TJNA 6LPRA 2NU3E 2WV9A 2BD8A 1O5DH 3AW1A 3C27B 1EP5A 4UFGH 3BTQE 3P92A 5F8TA 1P04A 3FN8A 4X8VH 3RXVA 5A09A 1Y5AT 3BTGE 1KXEA 2HVXA 4I86A 2VGCB 1TGCA 5DP3A 2BM2A 3BF6H 3F9EA 1G3BA 5FX6A 3TLOA 4TYDA 3LGYA 4OS6A 1OP2A 1FJSA 1O3GA 4H4FA 1Z8JB 1YPGH 2AH4X 2FI3E 4FU7A 4ABGA 1UTNA 3T25A 3NKKA 5EPNA 3PO1B 3PWCA 1BMAA 1O2UA 1MTWA 3GY3A 3UOPA 4LZ1H 1OP8A 3RXRA 1AKSA 4Q80A 1YP9A 1PYTC 2QF5A 5I46H 2OLGA 3E3TA 2BB4A 3F1SB 1GVLA 1F92A 1UTJA 2ZDAH 1P2OA 3EA8A 5A8XA 4AORA 4DY7B 1AFQB 2THFB 1LTOA 3F2GA 4ASHA 2BY9X 4UFDH 2RG3A 3WWFA 1TX6A 2KR7A 4FU9A 2XC5A 2QF4A 3TK9A 4NZQA 4KELA 4YT6H 5T6GA 2FYRA 1V3XA 1ABJH 1GBCA 5LPEA 2TGDA 1ID5H 1YCPM 5CDFE 1T7CA 1AVGH 2NU2E 3URDA 1S0RA 1LPGB 3HGNA 4Y8XA 1IQNA 1O3FA 1ANCA 3A7XA 2F83A 1NM6A 2K8IA 1GBBA 1YYY1 2KCYA 1V2UT 1NY22 4I32A 4X1RU 3GCTG 2ZU1A 1BHXF 2M5TA 2G55A 2BVRH 3A8AA 3RXKA 1GHAF 1C5UA 1O3JA 2A4OA 1NBME 3GY7A 1MCTA 1UVTH 4JYVH 1G3EA 3QTVH 4K5ZA 2UWLA 1Y3YA 1C5YB 2L74A 4J1YA 3BTME 2FODA 3MU0A 3SUDA 5JPMH 1DXPA 1UCYK 3M7UA 2UUYA 1UMAH 1CQQA 1HDTH 4JCNA 1GJ9B 2HLCA 2PR3A 2PW8H 5DP5A 2ZPQA 5C5NA 2Y81A 1LPZB 2DE9A 5EJLA 3RU4T 2ZECA 1QJ1B 4XOJA 2YMSC 2CHAB 1RRKA 5T6DA 3BTFE 3M35A 1NRPH 3H7TA 1MCVA 2SGPE 1L2EA 4K1TA 4YOIA 1WU1A 2A2QH 1BIOA 1RGQA 1YC0A 3HK6B 2F9BH 1QFKH 3M3VA 1P2IA 1XM1A 2HRVA 3LGIA 3W95A 2AHME 1N1LA 5F6MA 1WTGH 3E90B 1Y3WA 3EGKH 5FAHA 3QTOH 2Q1JA 1DSUA 2PKAA 3QUMP 3M3TA 4AFZA 1E38B 4UONA 1DWDH 4CR5A 5F03A 5GCHG 2ANYA 4BAOB 1NT1A 2R2MB 2BD4A 2BMGB 1Y5UT 6ESTA 4AYVB 5AFYH 4DURA 1SGPE 3A81A 1YF4A 3SYJA 3OEED 4Y71A 4X8UH 3KN2A 1THRH 3FP7E 2RFKC 3AK5A 1J9CH 3RXDA 1CT4E 3KIDU 3VGCC 5L6NH 2BXTH 3HKIB 3TJOA 2WUCA 2CMYA 3RXUA 5C17A 3N7OA 2LNCA 1XXDA 2VINA 1OS8A 2IN2A 1K1PA 4ASUD 3RU4D 1HXEH 1W13U 3EA7A 1GBDA 1N6YA 3UAIC 3EA9A 4ZKRU 2C8YB 4TWYA 1NPMA 3KQBA 2QE7D 5EGMA 4FUIA 1O3HA 2WINI 1TNKA 1C2IA 1E1QD 1T4VH 1ELGA 2GD4B 2CF8H 4BAKB 2R9PA 1K9OE 3L33A 1CA0B 4Y76A 2BY6X 1SQAA 1D4PB 3BEFB 5DP4A 4YOGA 1C5OH 4J2YB 2QIQA 1PQ8A 1EPTA 1O3BA 4I8JA 2BYAX 1ABIH 1SGRE 3A83A 1C2HA 1E1RD 4OS5A 3PO1C 1ZRBA 1P3CA 4VGCC 4AB9A 1ELEE 1DXWA 4I8GA 2STBE 3LH3A 3A8BA 1KXCA 3U8TH 1O2GH 1O2HA 2Z9JA 2TBSA 2SNWA 3UREA 5FHTA 4K69A 4Y11E 2LPRA 2ZTXA 1FY4A 3QZRA 3PV5A 1OWHA 4GLYA 1AMHA 1EQ9A 1IQFA 5FBIA 1G3DA 5E8EH 2EA3A 1AWFH 1ELDE 1IQHA 1L1NA 2BDGA 1WTHD 2ULLA 1SHHB 3BN9A 4AOQA 3SUFA 2BZ6H 2OC7A 2PUQH 1IAUA 1UVUH 7GCHF 1CE5A 1T8MA 2G51A 3F9GA 5GPIB 1CT0E 1RIWB 5PTPA 2CJIA 4ACBA 1K1MA 2STAE 3UWJH 1SR5C 1YPMH 2G4UA 4RKJB 1AKSB 3HKJB 2F91A 4O97A 1SGCA 3WY8A 2ZDNA 1NFXA 1GBKA 2A1DB 1Y59T 5T1VA 1GMHG 3A7TA 2J98B 1SC8U 4ZCNA 2FWWA 2NWNA 1HAOH 1G9IE 3T29A 2OBOA 1YWUA 2BY7X 2XNDD 5HIYA 5EQSA 3HK3B 4MNYA 4BAMB 1FPCH 1LPKB 1V2MT 3FO8D 1P8VC 1QZ8A 5K7RA 1O3LA 3FANA 2JJ2D 4Y0ZE 1ZSJA 2A31A 1MZDA 1O3AA 2ZIQH 3GOVB 1OHHD 3SQHE 4Q7YA 1F0SA 1MH0A 1GBAA 4ZKOU 1K2I1 4D7FA 1XVMA 3UWIA 2HGTH 4I33A 2BDBA 1O3CA 5GCHF 1YPEH 1O3EA 3U8RH 1BTXA 4HFPB 1WUNH 3FOAA 2UUJB 5KECA 1HAZB 3PWBA 3RXQA 3DUXH 1HAVA 4F49A 4B2AA 2L6OA 4NA9H 2BLOA 1TMUH 1C5SA 2OXSA 2ZC9H 2FOEA 4O03A 2P3UB 4HZHA 1QR3E 1S81A 1O38A 1HBTH 5FCKA 1S6HA 1GJAB 1OP0A 2HNTF 4XSKU 1ETSH 2BDHA 1ZPZA 2ZGBH 4DJZB 1AFEH 3P8FA 3ZYEA 4AFUA 2JH6D 1UK2A 1FN6A 2F43B 3MU1A 1WSSH 1OWDA 4WMEA 4GHQA 1O3NA 4XFQA 3MH7A 3CP7A 4FUBA 1YLDA 1LVMA 5GWZA 4ABJA 1DWEH 1JRSA 1M9UA 1SGEE 2A7HA 7KMEH 1QB9A 5DP6A 7ESTE 4AX9H 4ZXXH 2BY5X 3LGUA 4UEHH 3OAAD 1HNEE 1AVXA 1RXPA 3ZZ7A 2YOLA 2ZHEH 2VIOA 1SGFA 3E16B 1A2CH 1O2TA 3DFJA 2O8MA 1B0EA 3LPRA 4OM9A 2AIPA 3VB7A 2ANWA 5EOKA 5EXLA 1G2LA 1PJPA 2QF3A 2TRMA 1P09A 4TSFD 3SJ8A 2HOBA 1C5ZB 3QLPH 4AFQA 1BTYA 2XTTB 4DVAU 1IQGA 1SSXA 2CV3A 2GJGA 4UFFH 1MBMA 3MNCA 1JOUB 4INHA 2XBVA 3SU5A 4R0IA 2C8XB 4FUJA 1W7XH 3IWMA 1BA8B 1F0TA 1OPHB 2Y5GA 2WPIS 4TPYA 3RC5A 3GCHB 2BDCA 1Q31A 1A1RA 2YNBA 4LOYH 2FEQH 3MH4A 3BEUA 3URCA 1C2KA 2FYQA 3VB5A 2FPZA 1TRYA 2AIQA 3KEEA 2HALA 4F55A 5DO4H 1GJDB 1THPB 1GI0A 4X1SU 3P8OA 4AN7A 1CU1A 3VXEH 1GBTA 3A84A 2WPJS 2ZI2H 4MNVA 1PQ5A 4GSOA 1SGYE 1L4DA 1ZMLA 1MQ5A 2P3TB 4CBOA 2BLWA 2ZDLA 1MABB 1UHBA 3UR6A 1UTPA 4ZHLU 2GVFA 1DICA 4JZ1A 4P00A 1AO5A 3DFLA 2BLVA 4AGJA 1FMGA 1HAPH 1IQIA 1KXBA 1DUAA 3A8CA 1D3QB 1P57B 1YPJH 4B75A 4F4OC 2A7JA 2SGAA 3RUOA 1J16A 2SGFE 4X0WU 1GHBF 1BRUP 1ZGVA 1T31A 5HM2A 4KTSA 1LHGH 5F8XA 1P12E 1N6XA 3ZZBA 2V7QD 3A7WA 2FOFA 1C5XB 2R3YA 2ZCLP 2BDYA 1VCQA 1ZMNA 1MTNC 4FVBA 1SG8B 1Z8GA 4TY7A 2BD3A 1RD3B 2A4RA 4AGKA 1ZPBA 4WH8A 1V2ST 3PMAB 3S9AA 3TGJE 4K3JA 1MTVA 1TPPA 4ZUHA 3OX7U 6CHAB 2WPMS 1A3EH 1O2NA 2ZFSA 3CS7A 4Y6DA 1EP6A 1N8OC 1ACBE 2Q6FA 1PFXC 1FZZA 3PMHB 1O2PA 2VBCA 3I78A 4FXGH 1CBWC 1FONA 1C5QA 1TX8A 2KCAA 1BBRK 1K1IA 3SU4A 1GBFA 4M7GA 4YM9A 1ZTJA 1HGTH 2Z94A 2FLBH 2A7CA 4DCDA 1TQ0B 2ZHWH 2F9NA 1XUIA 3ATKA 1B0FA 3KQCA 1HAYB 5JBCS 2FI5E 2ZWLH 1W0ZU 1C5RA 5DG6A 3ZVEA 3BTEE 1FI8A 3RDZA 5H4IB 1ZYOA 4TWWA 1HFDA 2VH0A 4Z6AH 2VIWA 2Z9KA 1GCTB 2GZ8A 2W6ID 2XRCA 3M3SA 1EAXA 1LVOA 2J34A 4CHAB 4UD9H 4MTBA 5EXNA 1C9TA 3MTYA 5C0TA 3SGBE 2NU4E 1Z8RA 2GCHG 5KEDA 1BMFD 2HNTE 1TA6A 3AVZA 2FDAA 2H9EH 1GDNA 3KHVA 2GCTB 3ODDA 5A8YA 1DSTA 1L0ZA 1GG6C 1AVWA 1GL1A 3PTNA 3KGPA 1L1GA 2BQWB 1UVSH 2WPDD 1CHGA 2WPKS 3P95A 4OS2A 3WW7A 2OQ5A 1C2EA 2KCOA 1C2DA 4Z1MD 4WXIA 1DE7H 1MAYA 1VKYA 5EJZA 1EFRD 1GBMA 1VCPA 2QXGA 5E0JA 1S5SA 2AMDA 3SI3H 4D9QA 1BCUH 2GZ7A 3H7OA 1D6RA 5IYTA 4DT4A 4BTTB 5JYIA 1L4ZA 1EJMA 1TMBH 4JK5A 3MQKC 2BHGA 1MD7A 3Q00A 3MOCA 1KXDA 1RTLA 2QN5T 1NS3A 2P16A 4LK4A 3RXGA 2H1UA 1O3MA 2KFWA 1EJAA 1QQ4A 3SU0A 2SGEE 4NZLA 4B2CA 1GJBB 3E0NB 1SLUB 4RT0A 4X2WA 1BJVA 1VITG 1Y5BT 2I6SA 2JDID 4X1NU 1Y3XA 1DANH 1LHFH 3R0FA 3R3GB 1IQKA 1QBOA 3KF2A 2WHXA 3PV2A 3O8RA 2QXHA 3MU5A 5J4SA 1TA2A 1MU6B 1V2KT 3DT0H 8KME2 2J2UA 1LQEA 2ZTYA 3V13A 3LH1A 1GBJA 3KNXA 3E0PB 4JYTA 1FPHH 1F7ZA 3SHCH 1MZAA 3SORA 1AZ8A 5DN6D 5GDSH 2D26C 2Q6GA 2XC0A 4YXWD 2BD2A 4ABEA 4XE4A 1DUEA 1EUFA 2OBQA 2AGGX 3M5LA 1GMCF 4UFEH 1HLTH 1O31A 1SGFG 2TPIZ 3RC4A 2P94A 4YESB 3ATMA 5KGOA 2ALVA 1YPHC 1FV9A 2GCTC 2QV1A 2V0BA 1AE8H 4KGAA 1WV7H 1ZRKA 3Q3XA 4NIVA 2SNVA 3RXOA 2GMTC 3ZZ3A 1TNHA 3O8DA 4Y8YA 1BOQA 3QGJA 3GICB 4Z0KA 1KYNA 2BD9A 1A0LA 2QAAA 1AGJA 1XX9A 1LDTT 1KXAA 2VVVA 2TGAA 3D62A 3P70B 1O5GH 2G00A 2P95A 4ABFA 1DLEA 1IQMA 1EPTB 3UQVA 3GY2A 1O0DH 5C1XA 4GHTA 1K1OA 1AB9C 2GTBA 1ZJDA 1D3PB 5AF9H 3SJIA 3SNDA 1YKTA 1O5BB 1BTWA 1MTUA 5EG4A 2W5EA 4E7RG 3KQEA 2F4LA 3RXCA 3ITIA 1O2QA 4XRNA 1BT7A 3KYGA 1KDQA 1GHZA 5GNDA 4CRBA 3D65E 1P06A 3FZDA 1EASA 1LCYA 3IG6B 2R2WU 1SGIB 2OC1A 3PRDA 5GIBA 1GGDC 3RU4E 4D76A 1C1SA 3DSGA 4AB8A 2VB0A 1G2MA 4BXSA 1H8IH 1FN8A 1MKWH 3ZV9A 1ELTA 1C1RA 1YGCH 1FNIA 1H8HD 1QJ7B 1K28D 3E1XB 2WPHS 1CGHA 1O35A 4RN6A 1MTNB 3MU4A 4A1VA 2KX4A 1W0JD 1P2QA 3UIRA 3OE7D 1QY6A 4IBLH 3VEQB 1TNGA 1HB0B 3LKWA 2ZDKA 1QRWA 3BTWE 4ISNA 1V2NT 2J95A 2B7DH 3FVFB 2J92A 3I29A 3TK6A 3FZZA 1HJ9A 1J14A 3RM0H 4B71A 3SJOA 3QN7A 1CGIE 1QRXA 3RXHA 1K1LA 2I6QA 3U8OH 2JH5D 1CA0C 2ZA5A 1TPSA 4NA7A 2GP9B 3RP2A 3S0NA 2M2AA 3E91A 3PM3A 5ABWA 4P02A 1ESAA 1TGBA 3SNBA 2XBYA 4RKOB 1PQAA 1AI8H 3RMNH 4HGCA 3UQOA 1O2OA 3GY6A 2FLRH 1VR1H 3BTDE 3KQ5A 3NK8A 1EZXC 2ZFTA 1MKWK 5G4BA 3RXTA 3HGPA 4M9FA 3SI4H 3M5MA 1P9UA 3SV8A 3M5OA 1C5PA 1ELAA 2W26A 1C1PA 5IK2D 1DDJA 1ZZZA 1HRTH 4KTCA 1WOFA 4X6PA 2TGTA 1W7GH 1ZSKA 3SZNA 1BTZA 4X1QU 2PTCE 5CHAC 2BTCE 1E37B 2BX4A 2RDEA 3BG8A 1O2RA 1TGSZ 2FXRA 2ZGHA 3TNTA 1G37A 8ESTE 4U32A 2RCEA 2H9HA 5FPTA 2A0QB 1MU8B 3V0XA 1HJ8A 5HGGA 1EOJA 1O2XA 1CVWH 2XWBI 4ABHA 1KY9A 2O8LA 2Z7FE 1TGTA 2ZGCA 3ZVAA 1SQOA 3IITA 1SVPA 4IW4E 1KLJH 3EDXB 1HAHH 1O36A 3ZVGA 1HJAB 1TGNA 1GI7B 4Q7ZA 4ZHAA 1SGQE 2D2DA 1GI8B 4INKA 2YMSD 2FOCA 4CREA 5ETXA 2PHBA 5HIZA 4A7IB 5A0CA 5FPSA 1C1MA 1CA8B 1W11U 1HIAB 5EPYA 1T8NA 4FVDA 1UJ1A 5C1YA 1MKXK 4BNRA 4ABDA 1ETRH 1LO6A 3Q3KA 4B6FA 2GV6A 1TBZH 4XBBA 1E35B 4SGBE 3A88A 3PROA 2B5TB 1GDQA 1DVAH 3MYWA 2A32A 4CBNA 1S0QA 1W0KD 2J94A 2WYJA 2A2XH 2YMSB 1AU8A 3PTBA 1BDAA 2HNTC 5HKKD 1IQLA 1CO7E 3ZZAA 1A4WH 1EAIA 1TE0A 2RDLA 4KP0A 2EEKA 4WY3A 3SZEA 4AZ2B 4ZMAH 2H5DA 1ZHPA 3F9HA 4MG3A 4NFEA 4IC5A 1YLCA 3UPEA 2UWOA 2P8OB 1D9IA 3RC6A 1O5AB 3TITA 1WCZA 3F3BA 3NUMA 2FTLE 3LJJA 4FUDA 2WYGA 1NRQH 4KKDA 2HPQH 4TT3D 5BRRE
chains in the Genus database with same CATH topology
5C3NA 2CN0H 3SNAA 1VITF 2BOKA 2B8OH 4CR9A 1HCGA 4D9RA 1W14U 4R8TB 1K1NA 2VIQA 1OWIA 1GMCG 2OTVA 3MH5A 4FUFA 5FCRA 3LGWA 1O30A 4BAHB 1GL0E 1OWKA 3OU0A 3ZVBA 2FIRH 1PPEE 1SI5H 1O2JA 1PPZA 4NFFA 8GCHF 2FS9A 1QL9A 7GCHG 1V2OT 5A8ZA 2FOBA 4AFSA 1MBQA 2ZGXH 2OC8A 3U98H 1O5CB 3TK5A 4E7NA 3EYDA 1W8BH 3VB3A 1MD8A 5HMAA 5DKMA 4JZEH 2G5VA 3TJUA 1V2VT 3M5NA 5EU8A 3TIUA 2QYIA 2PLXA 3MI4A 3GYMA 1SGNE 3PLKA 4BTIB 4E05H 1BBRH 3M61U 2PGQB 1O3DA 4X1PU 5L2ZH 1QNJA 3E6PH 2Y80A 4JZDH 4MPXA 5IDKA 1SBWA 1LVYA 1C2LA 2IPHA 1GBEA 3UFAA 1JIRA 3RXFA 1IHSH 1J8AA 2ZQ1A 4GCHF 3KL6A 3QWCH 2AMQA 3ESTA 1FAXA 3A86A 2V6NA 1X7AC 3BSQA 2AFQB 1FDPA 3EE0B 5SGAE 1Q3XA 2UWPA 1GI6A 2ZPRA 2FOAA 1UVOA 4CRGA 1WQSA 3ZZ5A 2P93A 3T27A 2XNIA 4AG2A 2Z3DA 3L3TA 3PMJA 5K0HA 2G8TA 2F9OA 2J4IA 1NZQH 2FOHA 2NU1E 2VWOA 4DOQA 3D49H 3MO9A 1F5LA 1Y3VA 1SGTA 3RXEA 3B23B 4H6TA 3MO6A 2Q6DA 2VWMA 1C1OA 3F68H 1UCYE 1GVZA 2XXLA 2ZFQH 1CGJE 3LIWA 1CSOE 2VVUA 2ODPA 3JZ2B 4DT7B 2Z3CA 3VPKA 2G81E 1KDQB 2JH0D 2VWNA 1MTSA 3HPTB 3RXBA 3I77A 3MNBA 1LHEH 1NFWA 1QQUA 4X6MA 3AASA 4TY6A 1TX7A 2R0LA 2RA0A 3GCHC 1TPOA 2FOGA 1A5GH 2G4TA 1QL8A 2C93B 1C5VA 3S9CA 1ZPCA 2WV5A 1SPJA 1MKXH 2AGEX 2BD5A 3HATH 3L6PA 1C2JA 1F0RA 2ZHFH 3OY6U 4UDWH 3TH4H 4KTUA 1P2JA 1GWAA 4WMDA 2NU0E 3QK1A 1ELVA 1FIWA 1H9LB 4MVNA 5BPEA 3VB6A 3BIUH 3EQ0H 4B2BA 1AIXH 1GBHA 1GMHF 1EB1H 1OKXA 3Q76A 2ZU5A 1G30B 1RIWC 1PPBH 1ELCA 2OC0A 2OUAA 2FX6A 1DWBH 3GDSA 3SUGA 2ZHDA 1SMFE 2C3SA 3ZZ8A 5LPRA 1SLVB 1VGCB 4ABIA 1UTQA 3A89A 2QXIA 1AWHB 2QCYA 4WF8A 3GY5A 1TNJA 4YOJA 1C4U2 3A85A 2PWXA 1XKBC 1KLIH 2JKHA 1BUIA 1V2LT 3FP8E 5CE1A 3SO3A 3ATWA 2VWLA 1IQEA 5C67A 3MO3A 1QURH 1QL7A 1J17T 1C2GA 3ZZ4A 1V2WT 1XKAC 5LGOA 1GHWH 1LVBA 1TWXB 6CHAC 6GCHG 2BDIA 1DWCH 1DM4B 1EOLA 1O3PB 1D6WA 1BJUA 2PFEA 3BIVH 1AE5A 1W0YH 3UNQA 4OGXA 4U30A 1TIOA 2AMPA 2GT8A 1KLTA 5AVDA 2FO9A 1V2JT 1BRBE 1P03A 2W3IA 3NXPA 3A8DA 2QXJA 1A7SA 4LXBH 1QGFA 1CT2E 1BQYA 3RXMA 3GY8A 1CHOF 3SU1A 1T8LA 1C5NH 4E06H 1E36B 4K8BA 4ZH8A 5TCAA 1TLDA 2C90B 3M7QA 3VXFH 3D23A 1NU9A 1ORFA 5FBEA 5LPFA 1THSH 1GI4A 1P9SA 3NPSA 3SU2A 1W10U 4JZIA 1GDUA 1QA7A 3U9AH 2ODQA 2RA3A 2ZU3A 3LGVA 4ZKSU 1V2PT 2XYAA 1C1UH 1FY3A 1QRZA 1FY5A 2Y7XA 5C1UA 3ZVFA 4BAQB 4X2XA 1SLWB 4ZXYH 1A46H 1XXFA 9ESTA 2BOHB 1BITA 3UY9A 1O2MA 2AYWA 4ISLA 2O8TA 3H5CB 5GXPA 1SHYA 5A2MH 2UUKB 1OYQA 4A92A 2EI8A 4ZAEA 3T5FH 2R0KA 5DJ7A 4K60A 1BMMH 2XBWA 1QB6A 4Y10E 4XBCA 1P11E 4ISOA 5ESBA 1Q2WA 4Y7AA 4NIXA 2ZNKH 3MMGA 3OYPA 1A5HA 1QCPA 4B73A 1V6DA 1JIMA 1WYKA 1O2IA 3RXAA 2BXUH 1J15A 2R3UA 1FIZA 1NRRH 3S7HB 2P59A 1HJAC 1AD8H 1C1QA 2AERH 1QA0A 1WBGB 3MHWU 4NCYA 4A5TS 4Y8ZA 3Q77A 2ZGJA 2H5CA 3VFEA 2F3CE 1MMJN 3C1KA 3MFJA 1O2ZA 4ZHMU 1O5EH 1NFUA 2ZEBA 4TPIZ 5I25A 4X2YA 1FQ3A 3UTUH 5C2ZA 1SLXB 1HPGA 2W7SA 1A3BH 3DA9B 4ESTE 3DD2H 2ZFRH 4YLUA 1TNLA 5ESTE 1GI9B 1SOTA 5CHAB 1YCPH 1GHAG 4ABBA 2K1QA 1O3KA 1Z7KA 4Q7XA 3S7KB 4CRCA 2FZZA 3JZ1B 2F9PA 2EI6A 3MNSA 1GPZA 2ODYB 1C5WB 3ZZCA 2Z9LA 1GCTC 2XW9A 1GJ6A 1GHBG 1FAKH 3KCGH 1GMDG 2Y82A 1GJ7B 1OWEA 3LT3A 4O9VA 4Y0YE 4NWLA 4O3UA 1BBRE 3FFGA 3UNRA 1EXFA 4MLFB 1ZTKA 3W94A 3MU8A 2XBXA 3UOUA 4WXVA 1TALA 1INCA 4INLA 4HTCH 5DP8A 3T28A 1P05A 2OCVB 1O5FH 3GCNA 1A0HB 1Z6EA 2TGPZ 3V7TA 4DW2U 4X8TH 1N8OB 3A80A 1BZXE 1DT2A 1EPTC 1XMNB 2GDEH 4BANB 2A5IA 3BEIB 1DOJA 2V35A 4GVUA 1AZZA 5AHGH 2P3FH 1O32A 1TRMA 4IGDA 3BTKE 6GCHF 5A0AE 4MNWA 5T6FA 2ZF0H 4WWYA 4NIYA 5JBBS 1HXFH 5FPYA 1DPOA 5EODA 1AFQC 2J9NA 5L2YH 1OOKB 2O8UA 3PLBA 1C5LH 2FMJA 1EKBB 1UTOA 1GI2A 2XC4A 2VVCA 2O8WA 1QIXB 1JBUH 4MDSA 3RXPA 2ZTZA 5HYOA 1H8DH 1TNIA 1Z1IA 1HAXB 1E0FD 1IOEA 2PGBB 5F8ZA 1RJXB 1RTFB 4GPGA 2JETB 1SB1H 1JXPA 2GCHF 1DY8A 2A5KA 3ATIA 5E0HA 2ZDMA 4SGAE 4X2VA 3CENA 4DIHH 3TPIZ 1EJNA 1HYLA 3K6YA 1RTKA 1C1TA 2KAIA 1QJ6B 1GVKB 1W3CA 1WQVH 3M37A 1PYTD 2A4QA 3BG4C 1C2MA 1Z1JA 3AW0A 2BDAA 1BMNH 4VGCB 1PQ7A 4QT8C 1OWJA 2B0FA 1JMOH 1UK3A 2HPPH 1ESTA 3SW2B 3M36A 3LU9B 2F9UA 5FX5A 1BRAA 2D1JA 3SGQE 1TONA 4Y7BA 1ETTH 1DLKB 5E2OA 1O33A 3TU7H 4X6NA 1KIGH 1GHYH 1EB2A 1TFXA 4H42U 4IC6A 5DK1A 3LC3A 2G5NA 1P01A 1PPCE 2GGVB 4B76A 9LPRA 3K9XB 3O8BA 1QBNA 2GZ9A 3U69H 1GBLA 3A82A 3TJVA 1O2LA 2XCFA 4GUXA 1ZOMA 1ZJKA 3GISB 4NIWA 3SHAH 1PPGE 2FI4E 2GT7A 4IMQA 3SNCA 3STJA 4OS4A 2YNAA 1HV7A 4ZROA 2ASUB 2Y6TA 1AY6H 3AAVA 1ZHRA 4FUEA 4BXWA 2BZAA 1V2TT 1GMDF 1AB9B 2HWLB 4JYUH 3M7TA 2A4GA 3F9FA 8GCHG 2DUCA 1F5KU 3A7VA 5TJXA 1S83A 4I8HA 1ELBA 1UTMA 2JETC 2FX4A 2QF0A 4WJG2 3RMMH 3RM2H 2ZFPH 4IN1A 2P8OC 2GMTB 2VNTA 3VGCB 1ZGIA 2ZQ2A 2ZG0H 2VIDA 4GAWA 3ZVCA 3DHKH 1FXYA 4Q2KA 3B8JA 1QBVH 4CHAC 1DFPA 4GCHG 4XBDA 4K8YA 1S85A 3BG4B 4YO9A 3GCTF 4K2YA 3A87A 1O2KA 3SU3A 3G01A 1OX1A 2V3OH 2VH6A 1YBWA 1BHXB 3QZQA 1LHDH 5C5OA 3SUEA 5B6OA 1F5RA 1ZSLA 1U6QA 1C9PA 1HAGE 4RSPA 1FY1A 3P8NA 4B1TA 1H9IE 4U01A 5L30H 2Z9GA 2ZP0H 4BTUB 2QA9E 3P6ZB 1VJAU 1MQ6A 5JDUB 3LC5A 1OSSA 4JZFH 1ZTLA 4ZKNU 2C8WB 1O34A 3SU6A 1O39A 1VZQH 1ZLRA 4O3TA 5AFZH 1GJ8B 1LHCH 2GV7A 1P2NA 2FS8A 2OQUA 1HUTH 3RXLA 1AQ7A 3EAJA 3TNSA 1EATA 3GYLB 3PLPA 1NESE 2KAIB 1UTLM 5A0BA 1YPKH 1A61H 1NRSH 4A6LA 2ZPSA 1GJCB 4FU8A 1BTPA 4CRFA 1NU7B 3PB1E 1SFQB 1DS2E 3OY5U 1NROH 2DE8A 3ATLA 2BY8X 1UK4A 2H9TH 1Y8TA 2BVSH 2PKSB 5HM9A 4MPUA 3TGKE 1NC6A 2AS9A 1RS0A 2W3KA 1UTKA 3LONA 3UNSA 3TVJB 5J4QA 2ZKSA 5T3HA 1PPFE 1ARCA 2FESH 1C5MD 3SOSA 1QB1A 4JMYA 1GHVH 2ZU2A 1KTSB 5DGJA 1F0UA 4B74A 2ZU4A 1CHOG 2XWAA 4DG4A 1O3OA 4WH6A 2PSYA 3PMBB 1YM0A 2ILNA 2SGQE 5FXLA 1SOZA 2AGIX 3SV7A 4NWKA 1ANDA 1A0JA 1FUJA 3CS0A 2A5AA 1G3CA 2FTMA 2ZFFH 3SBKA 4CRAA 1TB6H 1K1JA 4NSYA 3GDVA 3A7ZA 3TH2H 5JB9S 1H9HE 1P0SH 2SFAA 3NZIA 1HAIH 2XCNA 4ABAA 2FM2A 2PTNA 2G52A 2H2ZA 3LGTA 2TIOA 3MNXA 1S82A 1QTFA 2IJOB 1P3EA 4U2WA 1EAWA 1TPAE 3GDUA 4NG9H 2ESTE 1NTPA 3KQDA 4MPWA 1GI1A 4FUCA 1ZMJA 3K6ZA 2BD7A 1O37A 1C1VH 1D3DB 2AEIH 3SNEA 3ZZDA 3VB4A 2CGAA 1VCWA 3PYHA 1ZHMA 3QDZB 1SQTA 1ANBA 4YT7H 3ODFA 1VJ9U 4CH2B 2FP7B 2PKSC 2F9VA 4THNH 1IHTH 1BMLA 1C4V2 1EZQA 1K22H 4ISHH 4AG1A 1T4UH 3OTJE 1UHBB 4I8KA 4YLQH 4AYYB 1V2RT 1B7XB 2WV4A 3U1IB 4H6SB 5EQQA 3OSYA 1GG6B 1LKAA 4FUGA 1C4Y2 4NGAH 1TRNA 1XUJA 1K21H 3STIA 2ALPA 4CH8B 3MWIU 2OD3B 5DP7A 5DP9A 4A1XA 1IQJA 2CHAC 1ELFA 4X8SH 1A5IA 1GCDA 1DX5M 2FOMB 1P02A 2Z3EA 2ZHQH 1CBWB 1SL3A 2Z9IA 2WPLS 2PKAB 4JK6A 1NO9H 3A7YA 2WUBA 2ZDVH 4MQAA 3RXJA 3E8LA 1XUHA 4IS5A 4CRDA 3GY4A 1TBQH 3BV9B 1YPLH 2QGRA 1O2SA 4IMZA 1ARBA 2GDDA 1AN1E 4WMFA 3ZYDA 3S9BA 3BTHE 1W2KH 2VIPA 2IOTA 2D8WA 3P17H 2BVXH 3UUZA 1ESBA 3SN8A 1HIAA 4PROA 1GI5A 2ZO3H 1UCYH 1D3TB 5JB8S 4ISIH 1QHRB 1OYTH 1XUFA 1H1BA 1GHXH 5EQRA 3ZV8A 1XVOA 1TOCB 2H6MA 1VGCC 3O8CA 3Q3YA 1AUJA 1KTTB 1L1JA 4I8LA 5EXMA 1EX3A 1TYNA 1OXGA 1LKBA 1C5TA 3T62A 3B9FH 1T8OA 5E2PA 4Y79A 3QX5H 1F2SE 1SGDE 2C8ZB 4DGJA 1AHTH 1B5GH 2VU8E 2W7UA 4D7GA 4D8NA 1EZUC 4X6OA 3T26A 4IN2A 2Y5FA 3BTTE 4YZUA 3T2NA 1TBRH 4OGYA 1XUKA 3TGIE 1ZR0A 4HI3A 1S84A 1P2KA 2J38A 3RMOH 3GCOA 1O2VA 3RLWH 1HAVB 5E0GA 2V3HH 3MH6A 1KXFA 2EC9H 4MPVA 1LMWB 3LDXH 1UVPA 3NCLA 3SQEE 2BQ6B 2QC2A 1TQ7B 2B9LA 3AAUA 2GX4A 1PPHE 4I7YH 3SV2H 1G36A 3K2UA 3P8GA 3QO6A 1GI3A 1E34B 5EW2H 4I31A 5JBTA 2Y5HA 2PUXB 1NN6A 2BX3A 3FAOA 3SV6A 3QGNB 1JWTA 2QY0B 1Z8IB 5GJ4B 2ZCHP 1EZSC 5DPAA 4NA8A 2VIVA 1UO6A 3ENSB 1YCPK 1NRNH 1Y3UA 1BRCE 1EAUA 1TAWA 1Z6JH 1GGDB 1YPHE 3ZZ6A 1KSNA 3V3MA 4OS7A 1GJ4H 3K65B 1BTUA 1GJ5H 1P10A 2ZCKP 2C4FH 1TMTH 3F6UH 1NFYA 2A45B 2VGCC 1P2MA 2CF9H 2O9QA 4K1EA 3SJ9A 4FUHA 2ANKH 8LPRA 2Y7ZA 5CMXH 2GKVE 2OINA 1LQDB 5HXFA 5LH8A 3LOXA 1W12U 3ZZ9A 1T32A 1BB0B 1JRTA 4WVPE 3RLYH 2ZZUH 4A1TA 4UE7H 2OP9A 3TH3H 1BTHH 1G32B 2BLQA 1S6FA 1VITH 3ZVDA 1V2QT 4XDEA 1H4WA 1RFNA 7LPRA 2SGDE 1ANEA 3UR9A 1C1WH 3FP6E 1FLEE 2BQ7B 4BOHA 3U1JB 5JBAS 4LZ4B 2CXVA 2PV9B 3LJOA 5C20A 1O2YA 3SV9A 2UUFB 1AUTC 1SFIA 1O2WA 4OS1A 3V12A 3SJKA 2EI7A 1C1NA 3RMLH 1C2FA 1TABE 3RXIA 1MAXA 4MNXA 4NSVA 1O3IA 3RXSA 2PSXA 2ANMH 3SGAE 3S69A 1MUEB 3NWUA 1Z71A 1XUGA 2VJ1A 5EW1H 1TOMH 1DY9A 3PV4A