4B2AA

Structure of the factor xa-like trypsin variant triple-ala (tga) in complex with eglin c
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDAGGPVVCSGKLQGIVSWGEGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Thermodynamic signatures in macromolecular interactions involving conformational flexibility.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2aA02
2A32A 1O2WA 3KQDA 4FU8A 2CXVA 1LDTT 2PKSC 3A84A 1V2NT 3LGIA 3UY9A 2A2QH 4GLYA 2FOAA 4JCNA 1TA6A 4X6OA 1W13U 1HUTH 2BM2A 1BIOA 4ISLA 4D7FA 3UWIA 1C5OH 2WPLS 3O8RA 1P2KA 2FI3E 4DY7B 1O3AA 4Y8ZA 3ZVDA 1SOTA 5EQQA 1GBJA 2G52A 1C5ZB 1KTSB 4Q7XA 1THPB 1Y3VA 1GHBG 2SFAA 2VWLA 1W11U 3I77A 3OYPA 3E0PB 1FONA 1A3EH 4GSOA 1TRYA 3T26A 2BY8X 4MG3A 2ZHFH 3PMBB 1D6WA 4J2YB 5EXNA 3MMGA 5I25A 1FNIA 2XWBI 1SOZA 1KLJH 1G3DA 4CH8B 1IQJA 3MNXA 1C2FA 1B0EA 2Y5FA 4X0WU 1UHBB 1WYKA 5ESBA 4NZLA 4MLFB 1A1RA 3ZV9A 2DE8A 3B9FH 1S84A 4XE4A 1OWEA 1UK3A 4YO9A 5JBAS 1J17T 1W14U 1AFQB 4X8TH 5T3HA 3BEFB 2FZZA 1CU1A 2V35A 1DWCH 2NU1E 4A7IB 3BV9B 4UE7H 3CS0A 2AGGX 2G4TA 1N8OC 1EZUC 3FANA 1ETSH 1IQHA 1GDNA 1GDUA 4GPGA 3M3SA 2F9VA 5B6OA 4JYVH 1JIRA 1VGCB 1O3BA 3SU2A 1DT2A 1G3EA 3P92A 5E2PA 1V2JT 3DUXH 3AVZA 1EJAA 4FXGH 1KXBA 1CA0C 3M5OA 2OBOA 2PUXB 1NFWA 1AMHA 1TMUH 1MTUA 5GXPA 1H1BA 1BRBE 1WTGH 4O9VA 4AGKA 4X6MA 4XDEA 4Y6DA 2C8YB 3DHKH 1D9IA 4OS1A 1DUEA 1QJ1B 7GCHF 1O5CB 1GBEA 3O8CA 1MAXA 4CR9A 1ZPBA 4B2BA 1ABJH 1G3BA 1NPMA 2A5IA 2BOHB 2RDLA 2B8OH 3KQEA 4DURA 1AO5A 3SU4A 2HGTH 3ZVGA 1C2LA 1ANBA 5C1UA 3VB4A 4CRFA 2BTCE 4CBOA 2F9PA 1A5GH 1QBNA 4INKA 1JXPA 1EPTA 4IMZA 2QC2A 1FIZA 2OD3B 1HPGA 5EPYA 1V2MT 3RLYH 4BAMB 3GY2A 1G32B 2AGEX 3UQOA 3GCTG 1QR3E 2VVVA 2ZGXH 1NM6A 2VIVA 3A88A 1V2ST 3AW0A 3UIRA 2ANWA 2NU3E 1ZRBA 1ZMJA 4B76A 4ZKRU 5GIBA 3A81A 3BTEE 1GI1A 4Y0YE 1ESBA 2FTLE 3BTFE 1P2JA 1P3EA 2J9NA 5F8TA 3KN2A 4OS4A 1SPJA 2OC0A 2BD2A 1ACBE 3M7UA 2QV1A 1DOJA 2BD8A 1C4Y2 2R9PA 2GTBA 2NU2E 1ZTJA 2W7SA 4MPVA 2RCEA 1VITH 3LGYA 1KYNA 4AORA 2SGAA 1SFIA 1UTLM 2GMTC 3LIWA 4DJZB 5LPEA 3TK5A 3SU0A 1GCTB 4HFPB 3SNBA 5T6FA 1QTFA 4HZHA 2PW8H 1E38B 1OXGA 3T62A 3M5LA 1YCPM 3A89A 4TYDA 4E05H 4B75A 2AYWA 3E0NB 2ZI2H 4Y7AA 3SU1A 1NROH 2P8OB 3KNXA 3RXBA 1BBRH 1CGHA 1MH0A 1QFKH 1XVOA 1TGNA 2HVXA 1GBLA 3KIDU 4RN6A 5EPNA 1AVGH 3WY8A 3BG4C 4XFQA 4ZKNU 1XKBC 2ZFFH 4ABGA 2P3UB 1O2MA 5LH8A 1MBMA 5IYTA 1SGFA 3RDZA 3SV8A 1FY1A 4X1SU 3SI3H 1O36A 3KGPA 1QHRB 2QYIA 2P95A 2ZTXA 1C5SA 2FOGA 5GJ4B 2OBQA 1KXAA 3RMLH 4MPUA 1XUFA 3PTNA 2XC5A 2B0FA 3RXAA 3D49H 5E0HA 1PYTD 1K1IA 2ZQ1A 3B8JA 1P10A 1LVMA 1S82A 1GBDA 1WQSA 1P11E 2B7DH 4QT8C 2IPHA 2GCTB 1ZGIA 1C1QA 4B73A 1K1PA 1BMMH 3S9BA 2F9OA 1G37A 4YLQH 1SGEE 4ZHMU 2BD7A 3U1IB 2WV5A 4Q7YA 2WV4A 3M61U 5DPAA 3TJUA 4AB8A 5A8YA 3JZ1B 4TWWA 4A1VA 1HAPH 1JRSA 1C1NA 2HRVA 1AUTC 4DIIH 2C8WB 2V3HH 1O33A 1O3LA 4X2WA 2Z3EA 4K69A 5SGAE 1ZPCA 1WCZA 4UFGH 2KAIA 3KQBA 4NSVA 3U1JB 3PMHB 1BRAA 2ODYB 2AIPA 1O3EA 1Q2WA 1WU1A 3LDXH 2STBE 2UWPA 4ABEA 1UTOA 4J1YA 2ZU2A 1Q31A 3SNCA 1DWDH 4FUDA 1MU6B 1P02A 4LOYH 1O32A 3GCOA 5F6MA 3S9CA 2VIQA 3PWCA 1AWHB 2BDHA 5TCCA 5E0JA 1IQFA 4BNRA 3T29A 1HXFH 4NSYA 1MZDA 2ANKH 1FQ3A 3PROA 1MTWA 7ESTE 1RD3B 4GHQA 4U32A 2PKAB 1QURH 5HGGA 1XUKA 4WMEA 1QGFA 4MNWA 2UUYA 1OKXA 2YNBA 3SQHE 1O2HA 2ZNKH 3GOVB 4JZEH 1BTUA 1TNLA 1SG8B 2EI7A 3GCHC 5CHAB 1PQ5A 1Y3YA 2ZF0H 1L0ZA 1LHFH 2HOBA 2Y82A 3BIUH 3TJOA 4UFDH 1YM0A 4X1NU 1V2PT 4Y7BA 1ZTKA 2ASUB 3VGCC 2ZCLP 5A8ZA 2WUBA 1H8IH 6CHAC 1C5QA 4FVBA 3RM0H 2VH6A 1Y3XA 1SGIB 4DCDA 2C8ZB 3SHAH 2H9EH 2Y5GA 1MTNC 2W3IA 3P17H 3PTBA 1NTPA 1TPAE 1ZSLA 4UEHH 3LGUA 2FOMB 1BT7A 3SU6A 4UDWH 3FP8E 1BTXA 2ALVA 3UOPA 1X7AC 4CREA 1TX6A 3BG8A 2K1QA 1BA8B 5HYOA 1GL0E 1JIMA 1RTLA 1AQ7A 3VEQB 2ZECA 1F7ZA 1NRSH 3ODDA 5AFYH 1GG6C 3RM2H 2ZA5A 1C1OA 3QX5H 1TB6H 4X2VA 4BXWA 1TPSA 2FO9A 2VGCC 4MNYA 1RTFB 3SNEA 4CHAB 4GHTA 3RMOH 2M5TA 1O3DA 2BLOA 4U01A 2AGIX 2ZCKP 3R0FA 3H7OA 1T8NA 2PWXA 4DT7B 3VXFH 4ISHH 2ZFQH 1QJ7B 2THFB 2YNAA 1W2KH 1N1LA 3ATWA 4TPYA 2ZGBH 1VCWA 3MH6A 2ZEBA 1W0ZU 4WXVA 2ZDNA 2G8TA 4AFUA 1K28D 1A61H 3PMAB 4BTTB 4AG1A 2Y7ZA 1L4ZA 2BMGB 4O3TA 3UNSA 1UTPA 1P2OA 4Y71A 1L1NA 1NC6A 1NESE 2AMQA 1S81A 1V2WT 3ZVCA 3HPTB 4BAKB 1K1MA 2J2UA 1KIGH 3TNTA 2ZPRA 2XBXA 2H9HA 1JWTA 2VB0A 2F9UA 1DFPA 2FESH 2PSXA 1H8DH 1GHWH 5GCHF 3TLOA 3FVFB 3BTWE 3ESTA 4NA8A 1GVZA 1FV9A 1NRQH 2ZGJA 2A45B 1GVKB 4A1TA 1QA7A 1P04A 2QXHA 3SN8A 4JZFH 1GVLA 3URDA 1L2EA 4TPIZ 1C2IA 1OWJA 5C5OA 1ZZZA 2EA3A 1YP9A 1VJAU 3NUMA 3E3TA 2VIWA 1KTTB 2EI6A 2TGAA 3QGNB 4MQAA 5ESTE 1ZRKA 3QDZB 1S5SA 2Z9LA 2QGRA 3VB6A 1F5RA 1VCQA 1C5VA 2O8MA 5DP8A 1D3TB 5E8EH 3E1XB 5DGJA 2A7JA 5CMXH 2CN0H 3HGNA 2Y81A 1OWIA 4ISNA 3RXKA 1GHZA 3W95A 1O3PB 2GVFA 1AN1E 3RXOA 1SGRE 1W7XH 3H5CB 1GMHG 1O3MA 3QZQA 1EB2A 1YLDA 5E0GA 1UTQA 2QF0A 2GX4A 2PGQB 4Z0KA 1KLIH 3MO6A 2QN5T 2H9TH 2UWOA 2FOBA 3O8DA 1EUFA 1H9HE 4Q7ZA 3E8LA 2FYQA 4BAHB 4K8YA 1GJAB 1GMDG 1C4U2 3EA8A 1K22H 1HIAA 4FUCA 5GWZA 3EYDA 3RC4A 3S7HB 2VINA 1RJXB 1EZQA 1DY8A 1XXFA 1IQNA 3SV9A 3UPEA 5C1XA 1SHYA 2A0QB 2D8WA 4I8LA 2VU8E 1EB1H 2ZDKA 1AD8H 2WPIS 3SNDA 2RA0A 1NFUA 1TABE 1UJ1A 1GI2A 3GDSA 1EAIA 1HBTH 1HAHH 4TY6A 1INCA 1C5PA 2I6QA 2UUKB 1E0FD 4ZHLU 3AW1A 5GDSH 3BTGE 4ABDA 1ESAA 2GGVB 3UFAA 1C1PA 1P12E 1SQOA 1GI9B 4BAQB 2ZU5A 1V2VT 1THSH 3SNAA 4AFQA 2CJIA 3A82A 1J9CH 3N7OA 4IC6A 4CRCA 2JH5D 2UUFB 3GICB 1NS3A 1GPZA 3AAUA 4ESTE 1LMWB 3ZV8A 1MCVA 2ZTYA 1Z71A 1UO6A 2PLXA 3ZVEA 1LKAA 3BTTE 1HAOH 1PQ8A 4Y11E 1BZXE 1E35B 1O2LA 2FODA 1BTZA 2ZGCA 2BVRH 2VIDA 4MNXA 1PJPA 5E2OA 1UVTH 1LHGH 1O0DH 1E36B 4GAWA 3F6UH 1AFEH 2BVSH 1IAUA 5AF9H 1XKAC 4R8TB 1AIXH 3RMMH 4NWKA 1LHCH 1NRNH 1V2UT 1ELGA 3RXFA 1GBIA 3HGPA 4KP0A 1F92A 4D9QA 2G5VA 3FFGA 1AFQC 1HB0B 4DVAU 4INLA 1GJ6A 3M35A 1GGDB 5JBCS 1TQ0B 1NT1A 1MUEB 2HNTE 1J15A 1CT2E 2ANYA 1EAUA 1EQ9A 2XWAA 3BSQA 1PPBH 3SUGA 2VVUA 1J16A 1RS0A 1KXFA 2FIRH 3RXQA 1RIWB 3MU5A 1SB1H 2GZ8A 2OUAA 1YPHC 1VGCC 1OOKB 2BQ7B 3UOUA 1IHSH 1C2MA 1A0HB 1Y59T 2OC7A 2ODQA 3CP7A 1C2KA 2ULLA 3K65B 4X2YA 1FXYA 1CSOE 1D6RA 3QZRA 1KDQB 2P93A 3HKJB 1TYNA 1GJ9B 1TONA 1UCYE 1TBRH 2PHBA 3MNSA 1WTHD 3V0XA 1YLCA 2A2XH 4DOQA 3L33A 5JPMH 3QN7A 1SMFE 2B9LA 2JH0D 1GMCG 3UTUH 1CGIE 1YC0A 2FS9A 1GBHA 4HGCA 3TK9A 2LPRA 4BTUB 3VB3A 1THRH 1O35A 3NZIA 1KXDA 3MH5A 4MNVA 1V2RT 2JETC 3GY4A 2UUJB 3MHWU 5EU8A 4B2AA 2Z3DA 1UVOA 3UNQA 1HJ9A 4NGAH 1F2SE 5LPRA 1GI5A 1EJNA 4Y10E 2PKSB 4FUFA 3SU3A 1DLEA 4GCHG 3ZZ7A 3EGKH 1C5XB 1NY22 1Z6JH 1YBWA 1ELAA 1EX3A 4YT7H 1C5WB 3A7YA 5A2MH 3BIVH 3M5NA 1LKBA 3RC5A 3BTME 1EOJA 1GDQA 3SUDA 1C2JA 2ILNA 3P8FA 2OQ5A 2XBWA 3K6ZA 1U6QA 2P59A 3NPSA 1O2XA 3VPKA 1ELEE 1MKXK 3GY3A 3LT3A 1SL3A 1GCTC 2GZ7A 5FBIA 1UK2A 3T28A 5FPSA 3KEEA 2BX4A 4CBNA 3UQVA 5JB9S 3SV2H 2ZZUH 5FX5A 3JZ2B 2VWMA 3RXGA 3OSYA 3F9GA 4AGJA 5FCRA 2P94A 2P8OC 6ESTA 2Z9KA 1YPGH 1QJ6B 3L3TA 1BJVA 1GHYH 1BTPA 4MPWA 2PSYA 1AB9B 1VITF 3V12A 5DP9A 2BY5X 3M3VA 3DT0H 5DP4A 1JOUB 1MKWK 2OC8A 4A1XA 1O3FA 1ORFA 2XBVA 2O8LA 4TWYA 3SORA 2OXSA 1HRTH 1KXCA 3LGTA 5DP5A 1IQIA 1GI7B 2H2ZA 3T2NA 3MH4A 2J38A 2VJ1A 2BOKA 3I29A 4XSKU 1NU7B 4NFFA 2FOFA 1XUIA 3RC6A 3RU4E 2OP9A 2BHGA 5FBEA 4BXSA 1ZHMA 3R3GB 1IQMA 2AH4X 1YPEH 3I78A 1AZZA 2UWLA 4MTBA 1TPOA 1HAZB 1GJDB 3EDXB 3TPIZ 2BZ6H 1NFYA 3TVJB 4A6LA 3VFEA 4H6TA 3ITIA 2XC4A 1FY3A 5FAHA 1CE5A 3ZZDA 2Q6DA 1ELTA 1T4UH 1Y3UA 1G3CA 5EODA 2WPKS 1F0RA 1DXWA 2GKVE 3GY6A 1O34A 1GL1A 1TFXA 1WAYB 2WYJA 2JKHA 3A80A 2BY7X 1O2PA 1SBWA 3TITA 7LPRA 3MU1A 4PROA 1O2OA 1HAVA 1TRMA 1YPJH 2EI8A 4I8GA 4FVDA 2ODPA 4WMDA 1ZSKA 1DSTA 1C1SA 1AHTH 1LPKB 1A7SA 2XYAA 3B23B 5F03A 2SNVA 2CV3A 1GMHF 1XXDA 3ZZCA 1OX1A 2G4UA 1XM1A 5JDUB 1NN6A 3SGBE 1ANEA 3F9EA 2HPQH 3ZVBA 5C2ZA 4A92A 4UFFH 2YOLA 2SGFE 4F49A 4XBCA 1BUIA 4Y76A 1Y5UT 2OQUA 1MAYA 4H6SB 2ZFPH 2PV9B 1B7XB 1UVUH 3C1KA 1FAKH 3ZVAA 2SNWA 1TX7A 2QXIA 4NCYA 4LZ1H 2WPJS 5DJ7A 3DFJA 1YCPK 2FYRA 5F8ZA 1BMNH 5CHAC 1UTNA 2H5CA 2GMTB 1ELCA 4AN7A 2Z3CA 1C2HA 4WXIA 3LPRA 3LJOA 4NA9H 1CHOG 3ODFA 1O5GH 3AAVA 2B5TB 3TIUA 1T4VH 2Y80A 1SGYE 1WOFA 2Y6TA 4I8HA 3TU7H 3PMJA 2TRMA 5JBTA 1S0RA 1GI8B 3EE0B 1TBQH 1A5IA 2O9QA 1C5TA 2DE9A 1C4V2 1OP0A 4MVNA 3ZZ6A 3E91A 1N6YA 2AFQB 3SGQE 2W7UA 3SJ8A 1RGQA 1YPMH 2VWNA 1GBKA 4NIXA 1XUHA 3QTVH 2FDAA 2ZFRH 3A7VA 1FI8A 4JZIA 4XOJA 5TJXA 3PB1E 3PLBA 2PGBB 1HGTH 1UCYK 4CHAC 1S0QA 2P3TB 5K0HA 1PQ7A 2H1UA 1V3XA 3MU4A 4FU9A 1V2KT 1FPCH 1HJAB 4ZHAA 3K2UA 5CE1A 1NU9A 1XUJA 1ESTA 3P8OA 3A83A 4KGAA 2AMDA 4R0IA 2FWWA 2ZU3A 1QB6A 2IN2A 5FX6A 4DW2U 2FS8A 5JBBS 1AKSA 1MCTA 1QQ4A 2O8TA 3CENA 1OWHA 1A46H 2F83A 1BOQA 3Q76A 4NZQA 4E7NA 1O3KA 3V7TA 3NWUA 2GV6A 1SLXB 4Y79A 4K3JA 4O3UA 1SGNE 1VZQH 1EKBB 1ZJKA 4BTIB 4DGJA 6GCHG 1GHBF 1W0YH 1KLTA 1HYLA 5C1YA 3E6PH 1P8VC 3M5MA 3ENSB 4X6PA 4ZKOU 2WUCA 2TGTA 1C2EA 3H7TA 1EZSC 1LQEA 1CBWB 5DP7A 1ZJDA 1PPFE 4ZUHA 1D3DB 1E37B 1O2UA 5AHGH 2ZFTA 1GMCF 3IG6B 3V3MA 2OCVB 1PPEE 2F3CE 5EG4A 2SGPE 3IITA 4O03A 3W94A 1C2GA 1H9LB 1TNJA 1EPTB 3RUOA 1GJBB 3U8OH 1IQEA 1MU8B 1P2MA 2TGDA 3LKWA 1HCGA 1Z1JA 2BX3A 3A7ZA 3SJIA 4NWLA 1HLTH 1T32A 1CQQA 3HK6B 3UR6A 3BEUA 3SUEA 3FZDA 3Q3YA 1AWFH 3FP7E 1OYQA 4HI3A 3P6ZB 3TH2H 3VXEH 4CRBA 1TRNA 3GCHB 1PPHE 2BY9X 4CH2B 1S85A 4E06H 1C1UH 2ZFSA 1JRTA 4X1QU 1GI3A 1UHBA 2VVCA 5L6NH 3QWCH 1A4WH 3C27B 2GCHG 3SOSA 1S6HA 1TGTA 1RFNA 1HAGE 1L1GA 1NO9H 1W3CA 1DANH 3M7QA 3UNRA 1C1MA 4ZAEA 1O5EH 2GP9B 1XVMA 1DXPA 1K9OE 1AI8H 1ZLRA 5DP3A 3RXRA 2ZG0H 1JBUH 1ZOMA 1TMBH 1SSXA 2BD3A 3ATKA 2NWNA 4IBLH 3U98H 1P2IA 1BDAA 1SGQE 1P2QA 2HWLB 1BHXB 2CF9H 5EQSA 1HFDA 3S69A 1GHAG 4D76A 1ABIH 2C93B 3STJA 3D62A 1O2ZA 2EEKA 5DP6A 2J34A 3S9AA 3SV7A 1PFXC 2Y7XA 1TIOA 1O2QA 2BXTH 1O2KA 1LHDH 1W12U 3SJOA 1QY6A 1NRPH 4DG4A 1H9IE 5ETXA 5EW1H 2BYAX 3PWBA 2NU4E 2I6SA 3GCTF 4KELA 4K1TA 1XX9A 1YF4A 4NA7A 4IC5A 3M37A 1O5BB 2SGEE 2WYGA 3GYLB 2ZDMA 4UONA 1F5LA 1RTKA 2BQ6B 1BBRE 3LJJA 3LOXA 2FI4E 2ZIQH 3A87A 1NRRH 1EP6A 1Z7KA 1L4DA 1T8LA 3PLKA 1O2JA 2VIOA 3ELAH 1FIWA 1ANDA 3P70B 3PM3A 1LVBA 4K2YA 1BMAA 4FUIA 3GCNA 1PQAA 1TNGA 3OY5U 3TH4H 3ZZAA 3E16B 1V2OT 4OS5A 1G36A 1B5GH 1ZHRA 5T6DA 2ZHQH 4LZ4B 4ABJA 2ZDLA 5AFZH 4ABFA 1TE0A 5A8XA 4X1PU 4I33A 3LONA 2A31A 4BANB 4B74A 1WV7H 1FPHH 1V2TT 4JMYA 4ZH8A 1SLVB 1GWAA 4JK5A 1SGFG 5TCAA 1UVPA 1VCPA 2C4FH 3P8NA 1HJ8A 2FX4A 2W3KA 2CHAB 1K1OA 2KAIB 1GGDC 1CHGA 5T6GA 4FUGA 2BD9A 3HATH 4NIWA 4VGCB 4WMFA 8ESTE 5HM2A 2JH6D 3SQEE 8LPRA 5DO4H 1RXPA 3RLWH 3RXTA 2G5NA 1P9UA 3D65E 1IQGA 3MOCA 1RIWC 1SVPA 4I32A 3UUZA 1EJMA 3RXCA 4X6NA 5BPEA 3M7TA 4OS2A 1SLUB 1XMNB 1IQLA 4KTUA 1C5NH 2FMJA 4F4OC 3ZYEA 1FMGA 1AE8H 3BTHE 1Z8JB 3RXIA 2P3FH 1TGBA 3EA9A 2CMYA 1BTHH 3GYMA 5EGMA 1ELBA 3PO1B 4YZUA 4OGYA 2G55A 5H4IB 2FI5E 1P57B 1Z8GA 1FY8E 1TNHA 2R2WU 4ZROA 1LVOA 5FXLA 4KKDA 3UREA 4U30A 3TGIE 4NG9H 3A8DA 1ELFA 2V0BA 5DK1A 5HMAA 4YT6H 1TALA 3U9AH 1O2SA 4X8UH 1QL8A 1O2VA 1BITA 1EAXA 1F5KU 5PTPA 1FUJA 3GDVA 1TGSZ 1AU8A 1OP8A 2BZAA 2FXRA 2ZWLH 3MNBA 4YLUA 2Z9IA 3ZZBA 3G01A 3Q3XA 3RXDA 1J8AA 1DX5M 1UVSH 5HM9A 2A4OA 1NFXA 2R2MB 1QB1A 1ZPZA 1CO7E 2FP7B 1K2I1 1OWDA 1UK4A 4FUJA 1OSSA 3LU9B 3NKKA 1P09A 2J92A 2ZHDA 1O39A 2QCYA 1BCUH 1MD8A 2ZC9H 1O5DH 4Y8YA 5EQRA 4AFZA 2F9NA 3S7KB 3NCLA 3LH3A 3LGWA 1S6FA 3GDUA 5EOKA 1KY9A 1AZ8A 3MTYA 4K1SA 1GJ4H 4X8SH 3A8BA 1A0LA 3DD2H 2AS9A 2BDIA 3LC5A 3RXVA 2ZDVH 1TQ7B 1KSNA 1Q3XA 2HLCA 1O3HA 4IS5A 1IOEA 3RMNH 1YKTA 4X2XA 5L2ZH 2A7CA 3SJ9A 2G51A 3M3TA 5FPTA 3A8CA 1XUGA 1ZMLA 4ABIA 3K6YA 1ZTLA 2PKAA 1FAXA 4CRAA 1AB9C 1QA0A 1O2RA 2ZQ2A 2XNIA 6GCHF 3MH7A 1DDJA 1DY9A 3Q00A 1YGCH 1CT0E 3EQ0H 3EAJA 1DS2E 4WVPE 4Y8XA 1CT4E 5DG6A 3QLPH 1TX8A 1HXEH 2J4IA 2VWOA 3P95A 4Q2KA 2A7HA 2BQWB 2J95A 3Q3KA 4K8BA 1QNJA 3DA9B 4ISIH 1SLWB 4I7YH 3KCGH 5L2YH 3TNSA 1Z6EA 2VH0A 4LK4A 1A5HA 2GT7A 2QA9E 2G00A 2Z94A 1FJSA 4CR5A 2PTCE 1ARBA 1O5AB 5GCHG 5F8XA 2GV7A 2PFEA 5L30H 1EP5A 2LNCA 3BTDE 1ELVA 4ABBA 1MMJN 1A2CH 4H42U 2C3SA 3T25A 3SUFA 1ZHPA 5A0CA 1O3GA 1P05A 1PPCE 1T8MA 1F0UA 2D2DA 3LH1A 3BTKE 3KHVA 8GCHG 1D4PB 3RXEA 4K60A 4I8JA 4OGXA 1GBFA 2R3UA 4CRGA 1ZGVA 1CVWH 2AEIH 2PTNA 3LGVA 1O3NA 2JETB 4MPXA 1ID5H 2GCHF 1P0SH 3P8GA 2A5AA 1DE7H 4AFSA 1SGPE 8KME2 1G2LA 1DLKB 1N8OB 2J94A 4SGAE 3UWJH 1BBRK 1O5FH 3S0NA 1AE5A 2OINA 4BOHA 1HIAB 4NFEA 1GBBA 3CS7A 4NIVA 1SQTA 1IHTH 1YYY1 5ABWA 1V2LT 1C5MD 2HPPH 2FEQH 3FAOA 4UFEH 1CA0B 3TGJE 1MKXH 4X1RU 4E7RG 1JMOH 1DSUA 2BDBA 3U8TH 1DM4B 1HNEE 3MNCA 3HKIB 1YPHE 1TOMH 2BDYA 4FUEA 1O3IA 1O38A 1GHAF 1C1TA 2XBYA 3TJNA 2GCTC 2H6MA 4YOIA 3F9HA 1AVXA 4ZKSU 1CGJE 1K21H 1GJCB 3MFJA 1C1VH 2TIOA 3A7TA 2FM2A 1LO6A 3RXJA 1L1JA 1P01A 3TK6A 1C5RA 3RXUA 3SU5A 1MKWH 4AG2A 1QBOA 7KMEH 1Z8IB 2XXLA 2GDEH 1WUNH 2CF8H 3TH3H 3HK3B 3TGKE 1O37A 1ANCA 1HAXB 1ZR0A 1DPOA 4NIYA 1MQ6A 3F1SB 1SGDE 4BAOB 2ESTE 2GZ9A 4B2CA 2BD4A 2BD5A 1O30A 4RKOB 1N6XA 1BRCE 1QQUA 2H5DA 3URCA 2QXGA 3O8BA 2W5EA 3ZVFA 2QXJA 3MWIU 4XBDA 5DKMA 1W10U 2A1DB 1D3QB 4I8KA 3A8AA 4FUBA 1BHXF 4SGBE 1GMDF 2TBSA 4AB9A 2WPHS 1GBAA 3A85A 3RXMA 5FPYA 1YPLH 4XBBA 1T31A 4WF8A 4A5TS 1FDPA 3MYWA 2SGQE 1FY5A 1ELDE 1HJAC 1OWKA 3DFLA 1QB9A 3ZZ3A 3SO3A 1BTWA 3RP2A 4RKJB 1OP2A 4IMQA 3SBKA 5IDKA 1GBCA 2QAAA 1LPGB 1O3JA 1Y5AT 4UD9H 3EA7A 2OLGA 3PYHA 4LXBH 1EOLA 1O2NA 1ARCA 1DICA 5FHTA 2FOHA 3ATLA 2BXUH 3SV6A 4B1TA 4ASHA 2EC9H 1EASA 5A0BA 3MO9A 2XRCA 1GHXH 3BG4B 3MU8A 1TMTH 3OY6U 4Y0ZE 1MQ5A 2ZO3H 2NU0E 1OPHB 9LPRA 3BN9A 1DWEH 4WH6A 1P06A 3BF6H 1CBWC 3KQCA 1SI5H 3MI4A 3RU4T 2GDDA 1O2TA 2FOCA 2A5KA 5C67A 1RRKA 2ZU4A 4JK6A 1FY4A 2FOEA 4WWYA 1G30B 2BVXH 2HNTF 1UTKA 1GHVH 2F91A 3U8RH 1PPZA 1DVAH 1VJ9U 1YCPH 1J14A 1MBQA 4X8VH 1EPTC 3QTOH 2ZP0H 1GCDA 2AMPA 1FN6A 3ZZ9A 1TAWA 2RA3A 1CA8B 6LPRA 4O97A 1GI6A 3SGAE 2G81E 2FX6A 3QK1A 4RSPA 1HDTH 1T8OA 2ZTZA 3ZYDA 4B71A 1TLDA 4K1EA 3RXHA 2FLBH 4AOQA 4JYTA 5FCKA 2AIQA 1E34B 2STAE 1T7CA 1GBMA 2XTTB 2R0KA 1SFQB 2QIQA 3L6PA 4AX9H 2Z9JA 1BB0B 2A4RA 1SQAA 4ISOA 2D1JA 1C1WH 3A7WA 5JB8S 2XCNA 1ZSJA 3ZZ4A 1LQDB 5EXMA 3TJVA 2ZHWH 1ETTH 2CGAA 3SI4H 4KTSA 1TPPA 1HAIH 1UCYH 1SHHB 4WJG2 1B0FA 4ZXYH 3BTQE 1SGTA 1C5UA 3SJKA 3K9XB 2GD4B 2ZPQA 1FZZA 1AGJA 1ZMNA 1O31A 2Z6BD 3FP6E 1KDQA 1PYTC 7GCHG 1LPZB 1K1LA 4YESB 4WY3A 1WQVH 1OS8A 1Z1IA 2VIPA 2C8XB 1GJ7B 3SHCH 1F0SA 1HV7A 1KXEA 1QRZA 4H4FA 3ATMA 4JZDH 4ABHA 1VR1H 4GCHF 1O2GH 5J4SA 1QL7A 3E90B 2Y5HA 1MD7A 2BY6X 3F9FA 4Q80A 1BRUP 3RXPA 3U69H 1TOCB 2Q6GA 3T5FH 5J4QA 3NXPA 3VGCB 3IWMA 6CHAB 1SR5C 1Y5BT 1LHEH 1QCPA 1P9SA 2W26A 1G2MA 4IN1A 9ESTA 1ETRH 1MTNB 1NZQH 1VITG 5BRRE 5EXLA 3KL6A 4M7GA 4ZMAH 4WH8A 1PPGE 3SW2B 2BDCA 1GJ5H 1LCYA 3MU0A 5EW2H 2ZU1A 2A4QA 1IQKA 1O2YA 5G4BA 1V6DA 3D23A 5C3NA 2TPIZ 1S83A 2TGPZ 3RXSA 1GG6B 2Z9GA 1GJ8B 2ZCHP 1BJUA 2VGCB 5A0AE 2OC1A 1C1RA 1DITH 3VB7A 3ATIA 4GVUA 1LTOA 1AY6H 1GI4A 4JZ1A 2HALA 2HNTC 2O8UA 2PR3A 2QF3A 4YM9A 1C9PA 2P16A 1TWXB 2CHAC 1P2NA 1HAVB 4D7GA 2GT8A 8GCHF 1GI0A 4THNH 4VGCC 1G9IE 1QRXA 1BQYA 4HTCH 2XC0A 3ZZ5A 2BDAA 2FLRH 4Z6AH 1EZXC 2ANMH 1O3CA 4YTAA 2Q1JA 1P3CA 1SC8U 2F9BH 2BB4A 3GY7A 1V2QT 3RU4D 1UTMA 1YPKH 1C5YB 1WSSH 2BLVA 5JYIA 4AYYB 2BLQA 5K7RA 2Z7FE 5I46H 1FN8A 3Q77A 1W8BH 2V3OH 4AZ2B 2RG3A 4K5ZA 1C2DA 2C90B 3ZZ8A 1C9TA 4FU7A 2BDGA 3QGJA 3PO1C 3A7XA 1GBTA 3F68H 2IOTA 1TGCA 1F0TA 4IGDA 1WBGB 2R3YA 4IN2A 2Q6FA 4CRDA 1TBZH 3GY8A 1UMAH 1HAYB 2QY0B 1K1NA 1QIXB 1Y8TA 2XCFA 3M36A 3KF2A 1AVWA 3VB5A 1TNKA 3PLPA 1BTYA 2R0LA 1A3BH 3LC3A 2VNTA 5HXFA 1M9UA 2IJOB 3QUMP 5C20A 2ZPSA 1ZYOA 1P03A 1QBVH 2V6NA 4KTCA 1K1JA 3NK8A 1MZAA 3T27A 1TNIA 2OTVA 4IW4E 3QO6A 4U2WA 2ZDAH 5GPIB 1FLEE 4OS7A 2FPZA 2WPMS 4I31A 3RXLA 1QL9A 2FTMA 3GY5A 1DUAA 2D26C 2ZKSA 2XW9A 4INHA 5LPFA 1O3OA 2BLWA 1Y3WA 3UR9A 4FUHA 4ABAA 5AVDA 2ZGHA 1H4WA 1A0JA 1Z8RA 4D8NA 4YOJA 1EXFA 2WINI 1O2IA 4JYUH 3STIA 2A4GA 3GISB 3OTJE 2O8WA 3FZZA 5A09A 1QRWA 4YOGA 2PUQH 1W7GH 1EAWA 1MTVA 3PV4A 3A86A 2ALPA 4MDSA 4TY7A 3SZNA 2DUCA 3V13A 1AKSB 1BMLA 3OX7U 1UTJA 2AERH 1D3PB 1C5LH 3BEIB 1SGCA 1LVYA 3AASA 4OS6A 3MO3A 1CHOF 4AYVB 3OU0A 2SGDE 1AUJA 1MTSA 1TA2A 4GUXA 1EATA 4DIHH 1OYTH 4D9RA 1DWBH 2ZHEH 5LGOA 4ZXXH 5C5NA
chains in the Genus database with same CATH superfamily
2A32A 1O2WA 3KQDA 4FU8A 2CXVA 1LDTT 2PKSC 3A84A 1V2NT 3LGIA 3UY9A 3OEED 2A2QH 1UW7A 4GLYA 2FOAA 4JCNA 1TA6A 4X6OA 1W13U 1HUTH 2BM2A 1BIOA 3F2FA 4ISLA 4D7FA 3UWIA 1C5OH 2WPLS 3O8RA 1P2KA 2FI3E 2RDEA 4DY7B 1O3AA 4Y8ZA 3ZVDA 1SOTA 5EQQA 1GBJA 2G52A 1C5ZB 1KTSB 4Q7XA 1THPB 1Y3VA 1GHBG 2SFAA 2VWLA 1W11U 3I77A 3OYPA 3E0PB 1FONA 1A3EH 4GSOA 4ZCNA 2KCPA 1TRYA 3T26A 2BY8X 4MG3A 2ZHFH 3PMBB 1D6WA 4J2YB 5EXNA 3MMGA 5I25A 1FNIA 2XWBI 1SOZA 1KLJH 1G3DA 4TSFD 2W6ID 4CH8B 1IQJA 3MNXA 1C2FA 1B0EA 2Y5FA 4X0WU 1UHBB 1WYKA 5ESBA 4NZLA 4MLFB 1A1RA 3ZV9A 2DE8A 3B9FH 1S84A 4XE4A 1OWEA 1UK3A 4YO9A 5JBAS 1J17T 1W14U 1AFQB 4X8TH 5T3HA 2WZQA 3BEFB 2FZZA 1CU1A 2V35A 1DWCH 2NU1E 4A7IB 3BV9B 4UE7H 3CS0A 2AGGX 2G4TA 1N8OC 1EZUC 3FANA 1ETSH 1IQHA 1GDNA 4FOUC 1GDUA 4GPGA 5CHBA 1EFRD 3M3SA 2F9VA 5B6OA 4JYVH 1JIRA 1VGCB 1O3BA 3SU2A 1DT2A 1G3EA 3P92A 5E2PA 1V2JT 3DUXH 3AVZA 1EJAA 4FXGH 1KXBA 1CA0C 3M5OA 2OBOA 2PUXB 1NFWA 1AMHA 1TMUH 1MTUA 3FN8A 3F0OA 5GXPA 1H1BA 1BRBE 1WTGH 4O9VA 4AGKA 4X6MA 4XDEA 4Y6DA 2C8YB 3DHKH 1D9IA 4OS1A 1DUEA 1QJ1B 7GCHF 1O5CB 1GBEA 3O8CA 1MAXA 2GJGA 4CR9A 1ZPBA 4B2BA 1ABJH 1G3BA 1NPMA 2A5IA 2BOHB 2RDLA 2B8OH 3KQEA 4DURA 1AO5A 3SU4A 2HGTH 3ZVGA 1C2LA 1ANBA 5C1UA 3VB4A 4CRFA 2BTCE 4CBOA 2F9PA 1A5GH 1QBNA 4INKA 1JXPA 1EPTA 4IMZA 2QC2A 1FIZA 2OD3B 1HPGA 5EPYA 1V2MT 3RLYH 4BAMB 3GY2A 1G32B 2AGEX 3UQOA 3GCTG 1QR3E 2VVVA 2ZGXH 1NM6A 2VIVA 3A88A 1V2ST 3AW0A 3UIRA 2ANWA 2NU3E 1ZRBA 1ZMJA 3OE7D 4B76A 4ZKRU 5GIBA 3A81A 3BTEE 1GI1A 4Y0YE 1ESBA 2FTLE 3BTFE 1P2JA 1P3EA 2J9NA 5F8TA 3KN2A 3N99A 1SPJA 2OC0A 4OS4A 2BD2A 1ACBE 3M7UA 2QV1A 1DOJA 2BD8A 1C4Y2 2R9PA 2GTBA 2NU2E 1ZTJA 5KGOA 2W7SA 4MPVA 2RCEA 1VITH 3LGYA 1KYNA 4AORA 2SGAA 1SFIA 1UTLM 4RI0A 2GMTC 3LIWA 4DJZB 5LPEA 3TK5A 3SU0A 1GCTB 4HFPB 3SNBA 5T6FA 1QTFA 4HZHA 3WW7A 2PW8H 1E38B 1OXGA 3T62A 3M5LA 1YCPM 3A89A 3DSPA 4TYDA 4B75A 4E05H 2AYWA 3E0NB 2ZI2H 3KQ5A 4Y7AA 3SU1A 1NROH 2P8OB 3KNXA 3RXBA 1BBRH 1CGHA 1MH0A 1QFKH 1XVOA 1TGNA 2HVXA 1GBLA 3KIDU 4RN6A 5EPNA 5C0TA 1AVGH 3WY8A 3BG4C 4XFQA 4ZKNU 1XKBC 2ZFFH 4ABGA 2P3UB 3ZIAD 1O2MA 5LH8A 1MBMA 5IYTA 1SGFA 3RDZA 3SV8A 5EJZA 1FY1A 4F55A 4X1SU 3SI3H 1O36A 3KGPA 1QHRB 2QYIA 2P95A 2ZTXA 1C5SA 2FOGA 5GJ4B 2OBQA 1KXAA 3RMLH 4MPUA 1XUFA 3PTNA 2XC5A 2B0FA 3RXAA 3D49H 5E0HA 1PYTD 1K1IA 2ZQ1A 3B8JA 5EIYA 1P10A 1LVMA 1S82A 1GBDA 1WQSA 1P11E 2B7DH 4QT8C 2IPHA 2GCTB 1ZGIA 1C1QA 4B73A 1K1PA 1BMMH 3S9BA 2F9OA 1G37A 4YLQH 1SGEE 4ZHMU 2BD7A 3U1IB 2WV5A 4Q7YA 2WV4A 3M61U 5HKKD 5DPAA 3TJUA 4AB8A 5A8YA 3JZ1B 4TWWA 4A1VA 1HAPH 1JRSA 1C1NA 2HRVA 1AUTC 4DIIH 2C8WB 3DSOA 2V3HH 1O33A 1O3LA 4X2WA 2Z3EA 4K69A 5SGAE 1ZPCA 1WCZA 4UFGH 2KAIA 3KQBA 4NSVA 3U1JB 3PMHB 1BRAA 2ODYB 2AIPA 2F43B 1O3EA 1Q2WA 1WU1A 3EE7A 3LDXH 2STBE 2UWPA 4ABEA 1UTOA 4J1YA 2ZU2A 1Q31A 3SNCA 1DWDH 4FUDA 1MU6B 1P02A 4LOYH 1O32A 3GCOA 5F6MA 3S9CA 2J98A 2VIQA 3PWCA 1AWHB 1YWUA 2BDHA 5TCCA 5E0JA 1IQFA 1K0HA 4BNRA 3T29A 1HXFH 4NSYA 3AK5A 1MZDA 2ANKH 1FQ3A 3PROA 4XD7D 1MTWA 7ESTE 1RD3B 4GHQA 4U32A 2PKAB 1QURH 5HGGA 4Z1MD 1XUKA 4WMEA 1QGFA 4MNWA 2UUYA 2XNDD 1OKXA 2YNBA 3SQHE 1O2HA 2ZNKH 3GOVB 4JZEH 1BTUA 1TNLA 1SG8B 2AHME 2EI7A 3GCHC 5CHAB 1PQ5A 1Y3YA 2ZF0H 1L0ZA 4XRNA 1LHFH 2HOBA 2Y82A 2WPDD 3BIUH 3TJOA 4UFDH 1YM0A 4X1NU 1V2PT 3UB0A 4Y7BA 4DT4A 1ZTKA 2ASUB 3VGCC 2ZCLP 5A8ZA 2WUBA 1H8IH 6CHAC 1C5QA 4FVBA 1KMHB 3RM0H 2VH6A 1Y3XA 1SGIB 4DCDA 2C8ZB 3SHAH 2H9EH 2Y5GA 1MTNC 2W3IA 3P17H 3PTBA 1NTPA 1TPAE 1ZSLA 4UEHH 3LGUA 2FOMB 1BT7A 3SU6A 4UDWH 3FP8E 1BTXA 2ALVA 3UOPA 1X7AC 4CREA 1TX6A 3BG8A 2K1QA 1BA8B 5HYOA 1GL0E 1JIMA 1RTLA 1AQ7A 3VEQB 2ZECA 1F7ZA 1NRSH 3ODDA 5AFYH 1VKYA 1GG6C 3RM2H 2ZA5A 1C1OA 3QX5H 1TB6H 4X2VA 4BXWA 1TPSA 2FO9A 2VGCC 4MNYA 4TT3D 1RTFB 3SNEA 4CHAB 2IJD1 4GHTA 3RMOH 2M5TA 1O3DA 2BLOA 4U01A 2AGIX 2ZCKP 3R0FA 3H7OA 2VBCA 1T8NA 2PWXA 4DT7B 2QE7D 4ISHH 3VXFH 2ZFQH 1QJ7B 2THFB 2YNAA 1W2KH 1N1LA 3ATWA 4TPYA 2ZGBH 1VCWA 3MH6A 2ZEBA 3WWBA 1W0ZU 4WXVA 2ZDNA 2G8TA 4AFUA 1K28D 1A61H 3PMAB 4BTTB 4AG1A 2Y7ZA 1L4ZA 2BMGB 4O3TA 3UNSA 1UTPA 1H8HD 1P2OA 4Y71A 1L1NA 1NC6A 1NESE 2AMQA 1S81A 1V2WT 3ZVCA 3HPTB 4BAKB 1K1MA 2J2UA 1KIGH 3TNTA 2KM0A 2ZPRA 2XBXA 2H9HA 3PRDA 1BMFD 1JWTA 2VB0A 2F9UA 1DFPA 2FESH 2PSXA 1H8DH 1GHWH 5GCHF 3TLOA 3FVFB 3BTWE 3ESTA 4NA8A 1GVZA 3KYGA 1FV9A 4YXWD 1NRQH 2ZGJA 3WWFA 2A45B 1GVKB 4A1TA 1QA7A 1P04A 2QXHA 3SN8A 4JZFH 1GVLA 3URDA 1L2EA 4TPIZ 1C2IA 1OWJA 5C5OA 1ZZZA 2EA3A 1YP9A 1VJAU 3NUMA 3E3TA 2VIWA 1KTTB 2EI6A 2TGAA 3QGNB 4MQAA 5ESTE 1ZRKA 1H8ED 3QDZB 1S5SA 2EY4C 5FL7D 2Z9LA 2QGRA 3VB6A 1F5RA 1VCQA 1C5VA 2O8MA 5DP8A 3UAIC 2LP6A 1D3TB 5E8EH 3E1XB 5DGJA 2A7JA 5CMXH 2CN0H 3HGNA 2Y81A 1OWIA 4ISNA 3RXKA 1GHZA 3W95A 1O3PB 4P00A 2GVFA 1AN1E 3RXOA 1MABB 1SGRE 1W7XH 3H09A 3H5CB 1GMHG 1O3MA 3QZQA 1EB2A 1YLDA 5E0GA 1UTQA 2QF0A 2GX4A 2PGQB 4Z0KA 1KLIH 3MO6A 2QN5T 2H9TH 2UWOA 2FOBA 3O8DA 1EUFA 1H9HE 4Q7ZA 3E8LA 2FYQA 4BAHB 4K8YA 1GJAB 3PV5A 1GMDG 1C4U2 3EA8A 1K22H 1HIAA 4FUCA 5GWZA 3EYDA 3RC4A 3S7HB 2KR7A 2VINA 1RJXB 4B6FA 1EZQA 1DY8A 1XXFA 1IQNA 3SV9A 3UPEA 5C1XA 1SHYA 2A0QB 2D8WA 4I8LA 2VU8E 1EB1H 2ZDKA 1AD8H 2WPIS 3SNDA 2RA0A 1NFUA 1TABE 1UJ1A 1GI2A 3GDSA 2CK3D 1EAIA 1HBTH 1HAHH 4TY6A 1INCA 1C5PA 2I6QA 2UUKB 1E0FD 4ZHLU 3AW1A 5GDSH 3BTGE 4ABDA 1ESAA 2GGVB 3UFAA 1C1PA 1P12E 1SQOA 1GI9B 4BAQB 2ZU5A 1V2VT 1THSH 3SNAA 4AFQA 2CJIA 3A82A 1J9CH 3N7OA 4IC6A 4CRCA 2JH5D 2UUFB 3GICB 1NS3A 1GPZA 3AAUA 4ESTE 5DN6D 1LMWB 3ZV8A 1MCVA 2ZTYA 1Z71A 1UO6A 2PLXA 3ZVEA 1LKAA 3BTTE 1HAOH 1PQ8A 4Y11E 4M9FA 2KZ4A 1BZXE 2J97A 1E35B 1O2LA 2FODA 1BTZA 2ZGCA 2BVRH 2VIDA 4MNXA 1PJPA 5E2OA 1UVTH 1LHGH 1O0DH 1E36B 4GAWA 3F6UH 1AFEH 2BVSH 1IAUA 5AF9H 1XKAC 4R8TB 1AIXH 3RMMH 4NWKA 1LHCH 1NRNH 1V2UT 1ELGA 3RXFA 1GBIA 3HGPA 4KP0A 1F92A 4D9QA 2YMSB 2G5VA 3SZEA 3FFGA 1AFQC 1HB0B 4DVAU 4INLA 1GJ6A 1QZ8A 3M35A 1GGDB 5JBCS 1TQ0B 1NT1A 1MUEB 2HNTE 1J15A 1CT2E 2ANYA 1EAUA 1EQ9A 2XWAA 3BSQA 1PPBH 3SUGA 2VVUA 1J16A 1RS0A 2JJ2D 1KXFA 2FIRH 3RXQA 1RIWB 4OM9A 3MU5A 1SB1H 2GZ8A 2OUAA 1YPHC 1VGCC 3OEHD 1OOKB 2BQ7B 3UOUA 1IHSH 1C2MA 1A0HB 1Y59T 2OC7A 2ODQA 2WHXA 3CP7A 1C2KA 2ULLA 3K65B 4X2YA 1FXYA 1CSOE 1D6RA 3QZRA 1KDQB 2P93A 3HKJB 1TYNA 1GJ9B 1TONA 1UCYE 1W0JD 1TBRH 2PHBA 3MNSA 1WTHD 3V0XA 1YLCA 2A2XH 4DOQA 3L33A 5JPMH 3QN7A 1SMFE 2B9LA 2JH0D 1GMCG 3UTUH 1CGIE 1YC0A 2FS9A 1GBHA 4HGCA 3TK9A 2LPRA 4BTUB 3VB3A 1THRH 2RFKC 1O35A 5C17A 3NZIA 1KXDA 3MH5A 4MNVA 1V2RT 2JETC 4ACBA 3GY4A 2UUJB 3MHWU 5EU8A 5GNDA 4B2AA 2Z3DA 1UVOA 3UNQA 2QF5A 1HJ9A 4NGAH 1F2SE 5LPRA 1GI5A 1EJNA 4Y10E 2PKSB 3W1EA 4FUFA 3SU3A 1DLEA 4GCHG 3ZZ7A 3EGKH 1C5XB 1NY22 1Z6JH 1YBWA 1ELAA 1EX3A 4YT7H 2V3MA 1C5WB 3A7YA 5A2MH 3BIVH 3M5NA 1LKBA 3RC5A 3BTME 1EOJA 1GDQA 3SUDA 1C2JA 2ILNA 3P8FA 2OQ5A 2XBWA 3K6ZA 1U6QA 2P59A 3NPSA 1O2XA 3VPKA 1ELEE 1MKXK 3GY3A 3LT3A 1SL3A 1GCTC 2GZ7A 5FBIA 1UK2A 3T28A 5FPSA 3KEEA 2BX4A 4CBNA 3UQVA 5JB9S 3SV2H 2ZZUH 5FX5A 3JZ2B 2VWMA 2JIZD 3RXGA 3OSYA 2K0QA 3F9GA 4AGJA 5FCRA 2P94A 2P8OC 6ESTA 2Z9KA 1YPGH 1QJ6B 3L3TA 1BJVA 1GHYH 1BTPA 4MPWA 2PSYA 1AB9B 1VITF 3V12A 5DP9A 2BY5X 3M3VA 3DT0H 5DP4A 1JOUB 1MKWK 2JDID 2OC8A 4A1XA 1O3FA 1ORFA 2XBVA 2O8LA 4TWYA 2JJ1D 3SORA 2OXSA 3DSGA 1HRTH 1KXCA 3LGTA 5DP5A 1IQIA 1GI7B 2H2ZA 3T2NA 3MH4A 2J38A 2VJ1A 2BOKA 3I29A 4XSKU 1NU7B 4NFFA 2FOFA 1XUIA 3RC6A 3RU4E 2OP9A 2BHGA 5FBEA 4BXSA 1ZHMA 3R3GB 1IQMA 2AH4X 1YPEH 3I78A 1AZZA 2UWLA 4MTBA 1TPOA 2M2AA 1HAZB 1GJDB 3EDXB 3TPIZ 2BZ6H 1NFYA 3TVJB 4A6LA 3VFEA 4H6TA 3ITIA 2XC4A 1FY3A 5FAHA 1CE5A 3ZZDA 2Q6DA 1ELTA 1T4UH 1Y3UA 1G3CA 5EODA 2WPKS 1F0RA 1DXWA 2GKVE 3GY6A 3OTPA 2J5UA 1O34A 1GL1A 1TFXA 1WAYB 2WYJA 2JKHA 3A80A 2BY7X 1O2PA 2PP6A 1SBWA 3TITA 7LPRA 3MU1A 4PROA 1O2OA 1HAVA 1TRMA 1YPJH 2EI8A 4I8GA 4FVDA 2ODPA 4WMDA 1ZSKA 1DSTA 1C1SA 1AHTH 1LPKB 1A7SA 2XYAA 3B23B 5F03A 2SNVA 2CV3A 1GMHF 1XXDA 3ZZCA 1OX1A 2G4UA 5C94A 1XM1A 5JDUB 1NN6A 3SGBE 1ANEA 3F9EA 2HPQH 3F0PA 3ZVBA 5C2ZA 4A92A 4UFFH 2YOLA 2SGFE 4F49A 4XBCA 1BUIA 4Y76A 1Y5UT 2OQUA 1MAYA 4H6SB 2ZFPH 2PV9B 1B7XB 5T1VA 1UVUH 3C1KA 1FAKH 3ZVAA 2SNWA 1TX7A 2QXIA 4NCYA 4LZ1H 2WPJS 5DJ7A 3DFJA 1YCPK 2FYRA 5F8ZA 1BMNH 5CHAC 1UTNA 2H5CA 2GMTB 1ELCA 4AN7A 2Z3CA 1C2HA 4WXIA 3LPRA 3LJOA 4NA9H 1CHOG 3ODFA 1O5GH 3AAVA 2B5TB 3TIUA 1T4VH 2Y80A 1SGYE 1WOFA 1WDIA 2Y6TA 4I8HA 2WV9A 1E1QD 3TU7H 3PMJA 2TRMA 5JBTA 1S0RA 1GI8B 3EE0B 1TBQH 1A5IA 2O9QA 1C5TA 2DE9A 1C4V2 1OP0A 4MVNA 3ZZ6A 3E91A 1N6YA 2AFQB 3SGQE 2W7UA 3SJ8A 1RGQA 1YPMH 2VWNA 1GBKA 4NIXA 1E1RD 1XUHA 3QTVH 2FDAA 2ZFRH 3A7VA 1FI8A 4JZIA 4XOJA 5TJXA 3PB1E 3PLBA 2PGBB 1HGTH 1UCYK 4CHAC 1S0QA 2P3TB 5K0HA 1PQ7A 2H1UA 1V3XA 1FX0B 3MU4A 4FU9A 1V2KT 1FPCH 2KCYA 1HJAB 3K2UA 4ZHAA 5CE1A 1NU9A 1XUJA 1ESTA 3P8OA 3A83A 2V7QD 2K8IA 4KGAA 2AMDA 4R0IA 2FWWA 2ZU3A 1QB6A 2IN2A 5FX6A 4DW2U 2FS8A 5JBBS 1AKSA 1MCTA 1QQ4A 2O8TA 3CENA 1OWHA 1A46H 2F83A 1BOQA 3Q76A 4NZQA 4E7NA 1O3KA 3V7TA 3NWUA 2GV6A 5B6LA 1SLXB 4Y79A 4K3JA 4O3UA 1SGNE 1VZQH 1EKBB 1ZJKA 4BTIB 4DGJA 6GCHG 1GHBF 1W0YH 1KLTA 1HYLA 5C1YA 3E6PH 1P8VC 3M5MA 3ENSB 4X6PA 4ZKOU 2WUCA 2TGTA 1C2EA 3H7TA 1EZSC 1LQEA 1CBWB 5DP7A 1ZJDA 1PPFE 4ZUHA 1D3DB 1E37B 1O2UA 5AHGH 2ZFTA 1GMCF 3IG6B 3V3MA 2OCVB 1PPEE 2F3CE 5EG4A 2SGPE 3FOAA 2WSSD 3IITA 4O03A 3W94A 1C2GA 1H9LB 1TNJA 1EPTB 3RUOA 1GJBB 3U8OH 1IQEA 1MU8B 1P2MA 2TGDA 5EJLA 3LKWA 1HCGA 1Z1JA 2BX3A 3A7ZA 3SJIA 4NWLA 1HLTH 1T32A 1CQQA 3HK6B 3UR6A 3BEUA 3SUEA 3FZDA 3Q3YA 1AWFH 3FP7E 1OYQA 4HI3A 3P6ZB 3TH2H 3VXEH 4CRBA 1TRNA 3GCHB 1PPHE 2BY9X 4CH2B 1S85A 4E06H 1C1UH 2ZFSA 1JRTA 4X1QU 1GI3A 1UHBA 2VVCA 2KFWA 5L6NH 3QWCH 1A4WH 3C27B 2GCHG 3SOSA 1S6HA 3PRBA 1TGTA 1RFNA 1HAGE 1L1GA 1NO9H 1W3CA 1DANH 3M7QA 3UNRA 1C1MA 2W6JD 4ZAEA 1O5EH 2GP9B 1XVMA 1DXPA 1K9OE 1AI8H 1ZLRA 2F4LA 5DP3A 3PV2A 3RXRA 2ZG0H 5DSFA 1JBUH 3N7DA 1ZOMA 1TMBH 1SSXA 2BD3A 3ATKA 2NWNA 4IBLH 3U98H 1P2IA 1BDAA 1SGQE 1P2QA 2HWLB 1BHXB 2CF9H 3FKSD 5EQSA 1HFDA 3S69A 1GHAG 4D76A 1ABIH 2C93B 3STJA 3D62A 1O2ZA 2EEKA 5DP6A 2J34A 3S9AA 3SV7A 1PFXC 2Y7XA 1TIOA 1O2QA 2BXTH 1O2KA 1LHDH 1W12U 3SJOA 1QY6A 1NRPH 4DG4A 1H9IE 5F53A 1SKYE 5ETXA 5EW1H 2BYAX 3PWBA 1COWD 2NU4E 2I6SA 3GCTF 3GS9A 4KELA 4K1TA 1XX9A 1YF4A 4NA7A 4IC5A 3M37A 1O5BB 2SGEE 2WYGA 3GYLB 2ZDMA 4UONA 1F5LA 1RTKA 2BQ6B 1BBRE 3LJJA 3LOXA 2FI4E 2ZIQH 3A87A 1NRRH 1EP6A 1Z7KA 1L4DA 1T8LA 3PLKA 1O2JA 2VIOA 3ELAH 1FIWA 1ANDA 3P70B 3PM3A 1LVBA 4Q4LA 4K2YA 1BMAA 3F2GA 4FUIA 3GCNA 3N7EA 1PQAA 1TNGA 3OY5U 3TH4H 3ZZAA 3E16B 1V2OT 4OS5A 1G36A 1B5GH 1ZHRA 5T6DA 2ZHQH 4LZ4B 4ABJA 2ZDLA 5AFZH 4ABFA 1TE0A 5A8XA 4X1PU 4I33A 3LONA 2A31A 4BANB 4B74A 1WV7H 1FPHH 1V2TT 4JMYA 4ZH8A 1SLVB 2XOKD 1GWAA 4JK5A 1SGFG 5TCAA 1UVPA 1VCPA 2YMSC 2C4FH 3P8NA 1HJ8A 2FX4A 2W3KA 2CHAB 1K1OA 2KAIB 1GGDC 1CHGA 5T6GA 4FUGA 2BD9A 3HATH 4NIWA 4VGCB 4WMFA 8ESTE 3F3BA 4P02A 5HM2A 2JH6D 3SQEE 8LPRA 5DO4H 1RXPA 3RLWH 3RXTA 2IPQX 2G5NA 1P9UA 3D65E 1IQGA 3MOCA 1RIWC 1SVPA 4I32A 3UUZA 1EJMA 3RXCA 4X6NA 5BPEA 3M7TA 4OS2A 1SLUB 1XMNB 1IQLA 4KTUA 1C5NH 2FMJA 4F4OC 3ZYEA 1FMGA 1AE8H 3BTHE 1Z8JB 3RXIA 2P3FH 1TGBA 3EA9A 2CMYA 1BTHH 3GYMA 2HVYB 5EGMA 1ELBA 3VG8A 3PO1B 4YZUA 4OGYA 2G55A 5H4IB 2FI5E 1P57B 1Z8GA 1FY8E 1TNHA 2R2WU 4ZROA 1LVOA 5FXLA 4KKDA 3UREA 4U30A 3TGIE 4NG9H 3A8DA 1ELFA 2V0BA 5DK1A 5HMAA 4YT6H 1TALA 3U9AH 1E79D 1O2SA 4X8UH 1QL8A 1O2VA 1BITA 1EAXA 1F5KU 5PTPA 1FUJA 3GDVA 1TGSZ 1AU8A 1OP8A 2BZAA 2FXRA 2ZWLH 3MNBA 4YLUA 2Z9IA 3ZZBA 3G01A 3Q3XA 3RXDA 1J8AA 1DX5M 1UVSH 5HM9A 2A4OA 1NFXA 2R2MB 1QB1A 1ZPZA 1CO7E 2FP7B 2KCOA 1K2I1 3NRLA 1OWDA 1UK4A 4FUJA 1OSSA 3LU9B 3NKKA 1P09A 2J92A 2ZHDA 1O39A 2OK5A 2QCYA 1BCUH 1MD8A 2ZC9H 1O5DH 4Y8YA 5EQRA 4AFZA 2F9NA 3S7KB 3NCLA 3LH3A 3LGWA 1S6FA 3GDUA 5EOKA 1KY9A 3F2HA 1AZ8A 3MTYA 4K1SA 1GJ4H 4X8SH 3A8BA 1A0LA 3DD2H 2AS9A 2BDIA 3LC5A 3RXVA 2ZDVH 1TQ7B 1KSNA 1Q3XA 2HLCA 1O3HA 4IS5A 1IOEA 3RMNH 1YKTA 4X2XA 5L2ZH 2A7CA 2KCAA 3SJ9A 2G51A 3M3TA 5FPTA 3A8CA 1XUGA 1ZMLA 4ABIA 3K6YA 1ZTLA 2PKAA 1FAXA 4CRAA 1AB9C 1QA0A 1O2RA 2ZQ2A 2XNIA 6GCHF 3MH7A 1DDJA 1DY9A 3Q00A 1YGCH 1CT0E 3EQ0H 3EAJA 1DS2E 4WVPE 4Y8XA 1CT4E 5DG6A 3QLPH 1TX8A 1HXEH 2J4IA 2VWOA 3P95A 4Q2KA 2A7HA 2BQWB 2J95A 3Q3KA 4K8BA 1QNJA 3DA9B 4ISIH 1SLWB 4I7YH 3KCGH 5L2YH 3TNSA 1Z6EA 2VH0A 4LK4A 1A5HA 2GT7A 2QA9E 4RT0A 2G00A 2Z94A 1FJSA 4CR5A 2PTCE 1ARBA 1O5AB 5GCHG 5F8XA 2GV7A 2PFEA 5L30H 1EP5A 2LNCA 3BTDE 1ELVA 4ABBA 1MMJN 1A2CH 4H42U 2C3SA 3T25A 3SUFA 1ZHPA 5A0CA 1O3GA 1P05A 1PPCE 1T8MA 4RT1A 1F0UA 2D2DA 3LH1A 3BTKE 3KHVA 8GCHG 1D4PB 3RXEA 4K60A 4I8JA 4OGXA 1GBFA 2R3UA 4CRGA 1ZGVA 1CVWH 2AEIH 2PTNA 3LGVA 4ACAA 1O3NA 2JETB 1NBMD 4MPXA 1ID5H 2GCHF 1P0SH 3P8GA 2A5AA 1DE7H 4AFSA 1SGPE 8KME2 1G2LA 1DLKB 1N8OB 2J94A 4SGAE 3UWJH 1BBRK 1O5FH 3S0NA 1AE5A 2OINA 4BOHA 1HIAB 4NFEA 1GBBA 3CS7A 4NIVA 1SQTA 1IHTH 1YYY1 5ABWA 1V2LT 1C5MD 2HPPH 2FEQH 3FAOA 4UFEH 1CA0B 3TGJE 1MKXH 4X1RU 4B6EA 1JMOH 4E7RG 1DSUA 2BDBA 3U8TH 1DM4B 1HNEE 3MNCA 3HKIB 1YPHE 1TOMH 2BDYA 4FUEA 1O3IA 1O38A 1GHAF 1C1TA 2XBYA 3TJNA 2GCTC 2H6MA 4YOIA 3F9HA 1AVXA 3U28C 4ZKSU 1CGJE 1K21H 1GJCB 3MFJA 1C1VH 2TIOA 3A7TA 2FM2A 1LO6A 3RXJA 1L1JA 1P01A 3TK6A 1C5RA 3RXUA 3SU5A 1MKWH 4AG2A 1QBOA 3MQKC 7KMEH 1Z8IB 2XXLA 2GDEH 1WUNH 2CF8H 3TH3H 3HK3B 3TGKE 1O37A 1ANCA 1HAXB 1ZR0A 1DPOA 4NIYA 1MQ6A 3F1SB 1SGDE 4BAOB 2ESTE 2GZ9A 4B2CA 2BD4A 2BD5A 1O30A 4RKOB 1N6XA 1BRCE 1QQUA 2H5DA 3URCA 2QXGA 3O8BA 2W5EA 4HG6A 3ZVFA 2QXJA 3MWIU 4XBDA 5DKMA 1W10U 1S6LA 2A1DB 1D3QB 4I8KA 3A8AA 4FUBA 1BHXF 4SGBE 1GMDF 2TBSA 4AB9A 2WPHS 1GBAA 3A85A 3RXMA 5FPYA 1YPLH 4XBBA 1T31A 4WF8A 5KEDA 4A5TS 1FDPA 3MYWA 2SGQE 4I86A 1FY5A 1ELDE 1HJAC 1OWKA 3DFLA 1QB9A 3ZZ3A 3SO3A 1BTWA 3RP2A 3SYJA 4RKJB 1OP2A 4IMQA 3SBKA 5IDKA 1GBCA 2QAAA 1LPGB 1O3JA 3DCLA 1Y5AT 4UD9H 3EA7A 2OLGA 4AC9A 3PYHA 4LXBH 1EOLA 1O2NA 1ARCA 1DICA 5FHTA 2FOHA 3ATLA 2BXUH 3SV6A 4B1TA 4ASHA 2EC9H 1EASA 5A0BA 3OFND 3MO9A 2XRCA 1GHXH 3BG4B 3MU8A 1TMTH 3OY6U 4Y0ZE 1MQ5A 2ZO3H 2NU0E 1OPHB 9LPRA 3BN9A 1DWEH 4WH6A 1P06A 3BF6H 1CBWC 3KQCA 1SI5H 3MI4A 3RU4T 2GDDA 1O2TA 2FOCA 2A5KA 5C67A 1RRKA 2ZU4A 4JK6A 1FY4A 2FOEA 4WWYA 1G30B 2BVXH 2HNTF 1UTKA 1GHVH 2F91A 3U8RH 1PPZA 1DVAH 1YLNA 1VJ9U 1YCPH 2LELA 1J14A 1MBQA 4X8VH 1EPTC 3QTOH 2ZP0H 1GCDA 2AMPA 1FN6A 3ZZ9A 1TAWA 2RA3A 1CA8B 6LPRA 4O97A 1GI6A 3SGAE 2G81E 2FX6A 3QK1A 4RSPA 1HDTH 1T8OA 2ZTZA 3ZYDA 4B71A 1TLDA 4K1EA 3RXHA 2FLBH 4AOQA 4JYTA 5FCKA 2AIQA 1E34B 2STAE 1T7CA 1GBMA 2XTTB 2R0KA 1SFQB 2QIQA 3L6PA 4AX9H 2Z9JA 1BB0B 2A4RA 1SQAA 4ISOA 2D1JA 1C1WH 3A7WA 5JB8S 2XCNA 1ZSJA 3ZZ4A 1LQDB 5EXMA 3TJVA 2ZHWH 1ETTH 4Q63A 2CGAA 3SI4H 4KTSA 1TPPA 1HAIH 1UCYH 1SHHB 4WJG2 1B0FA 4ZXYH 3BTQE 1SGTA 1C5UA 3SJKA 3K9XB 2GD4B 2ZPQA 1FZZA 1AGJA 1ZMNA 1O31A 2Z6BD 3FP6E 1KDQA 2YMSD 1PYTC 7GCHG 1LPZB 1K1LA 2HLDD 4YESB 1SQRA 4WY3A 5CDFE 1WQVH 1OS8A 1Z1IA 2VIPA 2C8XB 1GJ7B 3SHCH 1F0SA 1HV7A 1KXEA 1QRZA 4H4FA 3ATMA 4JZDH 4ABHA 1VR1H 4GCHF 1O2GH 5J4SA 1QL7A 3E90B 2Y5HA 1MD7A 1OHHD 2BY6X 3F9FA 4Q80A 1BRUP 3RXPA 3U69H 1TOCB 2Q6GA 3T5FH 5J4QA 3NXPA 3VGCB 3IWMA 6CHAB 1SR5C 1Y5BT 1LHEH 1QCPA 1P9SA 2W26A 1G2MA 4IN1A 9ESTA 1ETRH 1MTNB 1NZQH 1VITG 5BRRE 5EXLA 3KL6A 4M7GA 4ZMAH 4WH8A 1PPGE 3SW2B 2BDCA 3KYFA 3CNRA 1GJ5H 1LCYA 3MU0A 5C0UA 5EW2H 2ZU1A 2A4QA 1IQKA 1O2YA 5G4BA 5KECA 1V6DA 3D23A 5C3NA 2TPIZ 1NBME 1S83A 2TGPZ 3RXSA 1GG6B 2Z9GA 1GJ8B 2ZCHP 1BJUA 2VGCB 5A0AE 2OC1A 1C1RA 1DITH 3VB7A 3ATIA 4GVUA 5HIYA 1LTOA 1AY6H 1GI4A 4JZ1A 2QF4A 2HALA 2HNTC 2O8UA 2PR3A 2QF3A 4YM9A 1C9PA 2P16A 1TWXB 2CHAC 1P2NA 1HAVB 4D7GA 2GT8A 8GCHF 1GI0A 4THNH 4VGCC 1G9IE 1QRXA 5HIZA 1BQYA 4HTCH 4F48B 2XC0A 3ZZ5A 2BDAA 2FLRH 4Z6AH 1EZXC 2ANMH 1YY3A 1O3CA 4YTAA 4FETA 2Q1JA 1P3CA 1SC8U 2F9BH 2BB4A 3GY7A 1V2QT 3RU4D 5EJ1A 1UTMA 1YPKH 1C5YB 1WSSH 2BLVA 5JYIA 4AYYB 2BLQA 5K7RA 2Z7FE 5I46H 1FN8A 3Q77A 1W8BH 2V3OH 4AZ2B 2RG3A 4K5ZA 1C2DA 2C90B 3ZZ8A 1C9TA 4FU7A 2KX4A 2BDGA 3QGJA 3PO1C 3A7XA 1GBTA 3F68H 2IOTA 1TGCA 1F0TA 4IGDA 1WBGB 2R3YA 4IN2A 2Q6FA 4CRDA 1TBZH 3GY8A 1UMAH 1HAYB 2QY0B 1K1NA 1QIXB 1Y8TA 2XCFA 3M36A 2L6OA 3KF2A 1AVWA 3VB5A 1TNKA 3PLPA 1BTYA 2R0LA 1A3BH 3LC3A 2VNTA 5HXFA 3OAAD 1M9UA 2IJOB 3QUMP 5C20A 2ZPSA 1ZYOA 1P03A 1QBVH 2V6NA 4KTCA 1K1JA 3NK8A 1MZAA 3T27A 1TNIA 2OTVA 4IW4E 3QO6A 4U2WA 2ZDAH 5GPIB 1FLEE 4OS7A 2FPZA 2WPMS 4I31A 3RXLA 3FO8D 1WXRA 1QL9A 1W0KD 2FTMA 3GY5A 1DUAA 2D26C 2J98B 2ZKSA 2XW9A 4INHA 5LPFA 1O3OA 2BLWA 1Y3WA 3UR9A 4FUHA 4ABAA 5AVDA 2ZGHA 1H4WA 5IK2D 1A0JA 1Z8RA 4D8NA 4YOJA 1EXFA 2WINI 1O2IA 4JYUH 3STIA 2A4GA 3GISB 3OTJE 4ASUD 2O8WA 3FZZA 2L74A 1QRWA 4YOGA 5A09A 2PUQH 1W7GH 1EAWA 1MTVA 3PV4A 3A86A 2ALPA 4MDSA 4TY7A 3SZNA 2DUCA 3V13A 1AKSB 1BMLA 3OX7U 1UTJA 2AERH 1D3PB 1C5LH 3BEIB 1SGCA 1LVYA 3AASA 4OS6A 3MO3A 1CHOF 4AYVB 3OU0A 2SGDE 1AUJA 1MTSA 1TA2A 4GUXA 1EATA 4DIHH 2EQNA 1OYTH 4D9RA 1DWBH 2ZHEH 5LGOA 4ZXXH 5C5NA
chains in the Genus database with same CATH topology
2A32A 1O2WA 3KQDA 4FU8A 2CXVA 1LDTT 2PKSC 3A84A 1V2NT 3LGIA 3UY9A 2A2QH 4GLYA 2FOAA 4JCNA 1TA6A 4X6OA 1W13U 1HUTH 2BM2A 1BIOA 4ISLA 4D7FA 3UWIA 1C5OH 2WPLS 3O8RA 1P2KA 2FI3E 4DY7B 1O3AA 4Y8ZA 3ZVDA 1SOTA 5EQQA 1GBJA 2G52A 1C5ZB 1KTSB 4Q7XA 1THPB 1Y3VA 1GHBG 2SFAA 2VWLA 1W11U 3I77A 3OYPA 3E0PB 1FONA 1A3EH 4GSOA 1TRYA 3T26A 2BY8X 4MG3A 2ZHFH 3PMBB 1D6WA 4J2YB 5EXNA 3MMGA 5I25A 1FNIA 2XWBI 1SOZA 1KLJH 1G3DA 4CH8B 1IQJA 3MNXA 1C2FA 1B0EA 2Y5FA 4X0WU 1UHBB 1WYKA 5ESBA 4NZLA 4MLFB 1A1RA 3ZV9A 2DE8A 3B9FH 1S84A 4XE4A 1OWEA 1UK3A 4YO9A 5JBAS 1J17T 1W14U 1AFQB 4X8TH 5T3HA 3BEFB 2FZZA 1CU1A 2V35A 1DWCH 2NU1E 4A7IB 3BV9B 4UE7H 3CS0A 2AGGX 2G4TA 1N8OC 1EZUC 3FANA 1ETSH 1IQHA 1GDNA 1GDUA 4GPGA 3M3SA 2F9VA 5B6OA 4JYVH 1JIRA 1VGCB 1O3BA 3SU2A 1DT2A 1G3EA 3P92A 5E2PA 1V2JT 3DUXH 3AVZA 1EJAA 4FXGH 1KXBA 1CA0C 3M5OA 2OBOA 2PUXB 1NFWA 1AMHA 1TMUH 1MTUA 5GXPA 1H1BA 1BRBE 1WTGH 4O9VA 4AGKA 4X6MA 4XDEA 4Y6DA 2C8YB 3DHKH 1D9IA 4OS1A 1DUEA 1QJ1B 7GCHF 1O5CB 1GBEA 3O8CA 1MAXA 4CR9A 1ZPBA 4B2BA 1ABJH 1G3BA 1NPMA 2A5IA 2BOHB 2RDLA 2B8OH 3KQEA 4DURA 1AO5A 3SU4A 2HGTH 3ZVGA 1C2LA 1ANBA 5C1UA 3VB4A 4CRFA 2BTCE 4CBOA 2F9PA 1A5GH 1QBNA 4INKA 1JXPA 1EPTA 4IMZA 2QC2A 1FIZA 2OD3B 1HPGA 5EPYA 1V2MT 3RLYH 4BAMB 3GY2A 1G32B 2AGEX 3UQOA 3GCTG 1QR3E 2VVVA 2ZGXH 1NM6A 2VIVA 3A88A 1V2ST 3AW0A 3UIRA 2ANWA 2NU3E 1ZRBA 1ZMJA 4B76A 4ZKRU 5GIBA 3A81A 3BTEE 1GI1A 4Y0YE 1ESBA 2FTLE 3BTFE 1P2JA 1P3EA 2J9NA 5F8TA 3KN2A 4OS4A 1SPJA 2OC0A 2BD2A 1ACBE 3M7UA 2QV1A 1DOJA 2BD8A 1C4Y2 2R9PA 2GTBA 2NU2E 1ZTJA 2W7SA 4MPVA 2RCEA 1VITH 3LGYA 1KYNA 4AORA 2SGAA 1SFIA 1UTLM 2GMTC 3LIWA 4DJZB 5LPEA 3TK5A 3SU0A 1GCTB 4HFPB 3SNBA 5T6FA 1QTFA 4HZHA 2PW8H 1E38B 1OXGA 3T62A 3M5LA 1YCPM 3A89A 4TYDA 4E05H 4B75A 2AYWA 3E0NB 2ZI2H 4Y7AA 3SU1A 1NROH 2P8OB 3KNXA 3RXBA 1BBRH 1CGHA 1MH0A 1QFKH 1XVOA 1TGNA 2HVXA 1GBLA 3KIDU 4RN6A 5EPNA 1AVGH 3WY8A 3BG4C 4XFQA 4ZKNU 1XKBC 2ZFFH 4ABGA 2P3UB 1O2MA 5LH8A 1MBMA 5IYTA 1SGFA 3RDZA 3SV8A 1FY1A 4X1SU 3SI3H 1O36A 3KGPA 1QHRB 2QYIA 2P95A 2ZTXA 1C5SA 2FOGA 5GJ4B 2OBQA 1KXAA 3RMLH 4MPUA 1XUFA 3PTNA 2XC5A 2B0FA 3RXAA 3D49H 5E0HA 1PYTD 1K1IA 2ZQ1A 3B8JA 1P10A 1LVMA 1S82A 1GBDA 1WQSA 1P11E 2B7DH 4QT8C 2IPHA 2GCTB 1ZGIA 1C1QA 4B73A 1K1PA 1BMMH 3S9BA 2F9OA 1G37A 4YLQH 1SGEE 4ZHMU 2BD7A 3U1IB 2WV5A 4Q7YA 2WV4A 3M61U 5DPAA 3TJUA 4AB8A 5A8YA 3JZ1B 4TWWA 4A1VA 1HAPH 1JRSA 1C1NA 2HRVA 1AUTC 4DIIH 2C8WB 2V3HH 1O33A 1O3LA 4X2WA 2Z3EA 4K69A 5SGAE 1ZPCA 1WCZA 4UFGH 2KAIA 3KQBA 4NSVA 3U1JB 3PMHB 1BRAA 2ODYB 2AIPA 1O3EA 1Q2WA 1WU1A 3LDXH 2STBE 2UWPA 4ABEA 1UTOA 4J1YA 2ZU2A 1Q31A 3SNCA 1DWDH 4FUDA 1MU6B 1P02A 4LOYH 1O32A 3GCOA 5F6MA 3S9CA 2VIQA 3PWCA 1AWHB 2BDHA 5TCCA 5E0JA 1IQFA 4BNRA 3T29A 1HXFH 4NSYA 1MZDA 2ANKH 1FQ3A 3PROA 1MTWA 7ESTE 1RD3B 4GHQA 4U32A 2PKAB 1QURH 5HGGA 1XUKA 4WMEA 1QGFA 4MNWA 2UUYA 1OKXA 2YNBA 3SQHE 1O2HA 2ZNKH 3GOVB 4JZEH 1BTUA 1TNLA 1SG8B 2EI7A 3GCHC 5CHAB 1PQ5A 1Y3YA 2ZF0H 1L0ZA 1LHFH 2HOBA 2Y82A 3BIUH 3TJOA 4UFDH 1YM0A 4X1NU 1V2PT 4Y7BA 1ZTKA 2ASUB 3VGCC 2ZCLP 5A8ZA 2WUBA 1H8IH 6CHAC 1C5QA 4FVBA 3RM0H 2VH6A 1Y3XA 1SGIB 4DCDA 2C8ZB 3SHAH 2H9EH 2Y5GA 1MTNC 2W3IA 3P17H 3PTBA 1NTPA 1TPAE 1ZSLA 4UEHH 3LGUA 2FOMB 1BT7A 3SU6A 4UDWH 3FP8E 1BTXA 2ALVA 3UOPA 1X7AC 4CREA 1TX6A 3BG8A 2K1QA 1BA8B 5HYOA 1GL0E 1JIMA 1RTLA 1AQ7A 3VEQB 2ZECA 1F7ZA 1NRSH 3ODDA 5AFYH 1GG6C 3RM2H 2ZA5A 1C1OA 3QX5H 1TB6H 4X2VA 4BXWA 1TPSA 2FO9A 2VGCC 4MNYA 1RTFB 3SNEA 4CHAB 4GHTA 3RMOH 2M5TA 1O3DA 2BLOA 4U01A 2AGIX 2ZCKP 3R0FA 3H7OA 1T8NA 2PWXA 4DT7B 3VXFH 4ISHH 2ZFQH 1QJ7B 2THFB 2YNAA 1W2KH 1N1LA 3ATWA 4TPYA 2ZGBH 1VCWA 3MH6A 2ZEBA 1W0ZU 4WXVA 2ZDNA 2G8TA 4AFUA 1K28D 1A61H 3PMAB 4BTTB 4AG1A 2Y7ZA 1L4ZA 2BMGB 4O3TA 3UNSA 1UTPA 1P2OA 4Y71A 1L1NA 1NC6A 1NESE 2AMQA 1S81A 1V2WT 3ZVCA 3HPTB 4BAKB 1K1MA 2J2UA 1KIGH 3TNTA 2ZPRA 2XBXA 2H9HA 1JWTA 2VB0A 2F9UA 1DFPA 2FESH 2PSXA 1H8DH 1GHWH 5GCHF 3TLOA 3FVFB 3BTWE 3ESTA 4NA8A 1GVZA 1FV9A 1NRQH 2ZGJA 2A45B 1GVKB 4A1TA 1QA7A 1P04A 2QXHA 3SN8A 4JZFH 1GVLA 3URDA 1L2EA 4TPIZ 1C2IA 1OWJA 5C5OA 1ZZZA 2EA3A 1YP9A 1VJAU 3NUMA 3E3TA 2VIWA 1KTTB 2EI6A 2TGAA 3QGNB 4MQAA 5ESTE 1ZRKA 3QDZB 1S5SA 2Z9LA 2QGRA 3VB6A 1F5RA 1VCQA 1C5VA 2O8MA 5DP8A 1D3TB 5E8EH 3E1XB 5DGJA 2A7JA 5CMXH 2CN0H 3HGNA 2Y81A 1OWIA 4ISNA 3RXKA 1GHZA 3W95A 1O3PB 2GVFA 1AN1E 3RXOA 1SGRE 1W7XH 3H5CB 1GMHG 1O3MA 3QZQA 1EB2A 1YLDA 5E0GA 1UTQA 2QF0A 2GX4A 2PGQB 4Z0KA 1KLIH 3MO6A 2QN5T 2H9TH 2UWOA 2FOBA 3O8DA 1EUFA 1H9HE 4Q7ZA 3E8LA 2FYQA 4BAHB 4K8YA 1GJAB 1GMDG 1C4U2 3EA8A 1K22H 1HIAA 4FUCA 5GWZA 3EYDA 3RC4A 3S7HB 2VINA 1RJXB 1EZQA 1DY8A 1XXFA 1IQNA 3SV9A 3UPEA 5C1XA 1SHYA 2A0QB 2D8WA 4I8LA 2VU8E 1EB1H 2ZDKA 1AD8H 2WPIS 3SNDA 2RA0A 1NFUA 1TABE 1UJ1A 1GI2A 3GDSA 1EAIA 1HBTH 1HAHH 4TY6A 1INCA 1C5PA 2I6QA 2UUKB 1E0FD 4ZHLU 3AW1A 5GDSH 3BTGE 4ABDA 1ESAA 2GGVB 3UFAA 1C1PA 1P12E 1SQOA 1GI9B 4BAQB 2ZU5A 1V2VT 1THSH 3SNAA 4AFQA 2CJIA 3A82A 1J9CH 3N7OA 4IC6A 4CRCA 2JH5D 2UUFB 3GICB 1NS3A 1GPZA 3AAUA 4ESTE 1LMWB 3ZV8A 1MCVA 2ZTYA 1Z71A 1UO6A 2PLXA 3ZVEA 1LKAA 3BTTE 1HAOH 1PQ8A 4Y11E 1BZXE 1E35B 1O2LA 2FODA 1BTZA 2ZGCA 2BVRH 2VIDA 4MNXA 1PJPA 5E2OA 1UVTH 1LHGH 1O0DH 1E36B 4GAWA 3F6UH 1AFEH 2BVSH 1IAUA 5AF9H 1XKAC 4R8TB 1AIXH 3RMMH 4NWKA 1LHCH 1NRNH 1V2UT 1ELGA 3RXFA 1GBIA 3HGPA 4KP0A 1F92A 4D9QA 2G5VA 3FFGA 1AFQC 1HB0B 4DVAU 4INLA 1GJ6A 3M35A 1GGDB 5JBCS 1TQ0B 1NT1A 1MUEB 2HNTE 1J15A 1CT2E 2ANYA 1EAUA 1EQ9A 2XWAA 3BSQA 1PPBH 3SUGA 2VVUA 1J16A 1RS0A 1KXFA 2FIRH 3RXQA 1RIWB 3MU5A 1SB1H 2GZ8A 2OUAA 1YPHC 1VGCC 1OOKB 2BQ7B 3UOUA 1IHSH 1C2MA 1A0HB 1Y59T 2OC7A 2ODQA 3CP7A 1C2KA 2ULLA 3K65B 4X2YA 1FXYA 1CSOE 1D6RA 3QZRA 1KDQB 2P93A 3HKJB 1TYNA 1GJ9B 1TONA 1UCYE 1TBRH 2PHBA 3MNSA 1WTHD 3V0XA 1YLCA 2A2XH 4DOQA 3L33A 5JPMH 3QN7A 1SMFE 2B9LA 2JH0D 1GMCG 3UTUH 1CGIE 1YC0A 2FS9A 1GBHA 4HGCA 3TK9A 2LPRA 4BTUB 3VB3A 1THRH 1O35A 3NZIA 1KXDA 3MH5A 4MNVA 1V2RT 2JETC 3GY4A 2UUJB 3MHWU 5EU8A 4B2AA 2Z3DA 1UVOA 3UNQA 1HJ9A 4NGAH 1F2SE 5LPRA 1GI5A 1EJNA 4Y10E 2PKSB 4FUFA 3SU3A 1DLEA 4GCHG 3ZZ7A 3EGKH 1C5XB 1NY22 1Z6JH 1YBWA 1ELAA 1EX3A 4YT7H 1C5WB 3A7YA 5A2MH 3BIVH 3M5NA 1LKBA 3RC5A 3BTME 1EOJA 1GDQA 3SUDA 1C2JA 2ILNA 3P8FA 2OQ5A 2XBWA 3K6ZA 1U6QA 2P59A 3NPSA 1O2XA 3VPKA 1ELEE 1MKXK 3GY3A 3LT3A 1SL3A 1GCTC 2GZ7A 5FBIA 1UK2A 3T28A 5FPSA 3KEEA 2BX4A 4CBNA 3UQVA 5JB9S 3SV2H 2ZZUH 5FX5A 3JZ2B 2VWMA 3RXGA 3OSYA 3F9GA 4AGJA 5FCRA 2P94A 2P8OC 6ESTA 2Z9KA 1YPGH 1QJ6B 3L3TA 1BJVA 1GHYH 1BTPA 4MPWA 2PSYA 1AB9B 1VITF 3V12A 5DP9A 2BY5X 3M3VA 3DT0H 5DP4A 1JOUB 1MKWK 2OC8A 4A1XA 1O3FA 1ORFA 2XBVA 2O8LA 4TWYA 3SORA 2OXSA 1HRTH 1KXCA 3LGTA 5DP5A 1IQIA 1GI7B 2H2ZA 3T2NA 3MH4A 2J38A 2VJ1A 2BOKA 3I29A 4XSKU 1NU7B 4NFFA 2FOFA 1XUIA 3RC6A 3RU4E 2OP9A 2BHGA 5FBEA 4BXSA 1ZHMA 3R3GB 1IQMA 2AH4X 1YPEH 3I78A 1AZZA 2UWLA 4MTBA 1TPOA 1HAZB 1GJDB 3EDXB 3TPIZ 2BZ6H 1NFYA 3TVJB 4A6LA 3VFEA 4H6TA 3ITIA 2XC4A 1FY3A 5FAHA 1CE5A 3ZZDA 2Q6DA 1ELTA 1T4UH 1Y3UA 1G3CA 5EODA 2WPKS 1F0RA 1DXWA 2GKVE 3GY6A 1O34A 1GL1A 1TFXA 1WAYB 2WYJA 2JKHA 3A80A 2BY7X 1O2PA 1SBWA 3TITA 7LPRA 3MU1A 4PROA 1O2OA 1HAVA 1TRMA 1YPJH 2EI8A 4I8GA 4FVDA 2ODPA 4WMDA 1ZSKA 1DSTA 1C1SA 1AHTH 1LPKB 1A7SA 2XYAA 3B23B 5F03A 2SNVA 2CV3A 1GMHF 1XXDA 3ZZCA 1OX1A 2G4UA 1XM1A 5JDUB 1NN6A 3SGBE 1ANEA 3F9EA 2HPQH 3ZVBA 5C2ZA 4A92A 4UFFH 2YOLA 2SGFE 4F49A 4XBCA 1BUIA 4Y76A 1Y5UT 2OQUA 1MAYA 4H6SB 2ZFPH 2PV9B 1B7XB 1UVUH 3C1KA 1FAKH 3ZVAA 2SNWA 1TX7A 2QXIA 4NCYA 4LZ1H 2WPJS 5DJ7A 3DFJA 1YCPK 2FYRA 5F8ZA 1BMNH 5CHAC 1UTNA 2H5CA 2GMTB 1ELCA 4AN7A 2Z3CA 1C2HA 4WXIA 3LPRA 3LJOA 4NA9H 1CHOG 3ODFA 1O5GH 3AAVA 2B5TB 3TIUA 1T4VH 2Y80A 1SGYE 1WOFA 2Y6TA 4I8HA 3TU7H 3PMJA 2TRMA 5JBTA 1S0RA 1GI8B 3EE0B 1TBQH 1A5IA 2O9QA 1C5TA 2DE9A 1C4V2 1OP0A 4MVNA 3ZZ6A 3E91A 1N6YA 2AFQB 3SGQE 2W7UA 3SJ8A 1RGQA 1YPMH 2VWNA 1GBKA 4NIXA 1XUHA 3QTVH 2FDAA 2ZFRH 3A7VA 1FI8A 4JZIA 4XOJA 5TJXA 3PB1E 3PLBA 2PGBB 1HGTH 1UCYK 4CHAC 1S0QA 2P3TB 5K0HA 1PQ7A