1E38B

Porcine pancreatic elastase complexed with (3s, 4s)n-para-nitrobenzenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one soaked in ph 9 buffer for 2 minutes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords ELASTASE
publication title 'Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e38B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e38B01
1LPKB 2ZDNA 1ELVA 4UDWH 3PMBB 3ZZ7A 1F92A 1MKXK 2ZHEH 3LJJA 4I33A 3TK6A 5CMXH 5A09A 1GL0E 2BDGA 3KQEA 1C1PA 1CT4E 1BZXE 5ESBA 1EJNA 1X7AC 4K69A 1O2JA 4Y10E 1ELTA 1V2JT 5GIBA 2DE8A 3EGKH 3BTDE 1EB2A 1TGSZ 1XX9A 2ZTYA 2O8MA 2J34A 4YT6H 3UR9A 5CHAB 4K8BA 2G4TA 1AZZA 1RD3B 1P0SH 1S83A 2F9PA 1TWXB 3MU5A 9LPRA 2VVVA 1XKBC 3A83A 1Y3VA 3MU0A 2V35A 2H9HA 2V3HH 2BOHB 3RXOA 2PSYA 5L30H 3AVZA 1HJ8A 4IGDA 2VJ1A 1QB6A 5FBEA 3A8AA 4ABAA 5A8ZA 2GP9B 1O5DH 3A7YA 5K7RA 4AX9H 1HJAC 3Q77A 5EQQA 2VIDA 2FDAA 3HATH 1SL3A 3P70B 3QWCH 1LPZB 1PYTC 1O3NA 5C1XA 1O5CB 3M3SA 1QIXB 5E0HA 4Y11E 3E90B 1A5HA 1V2ST 1EAUA 1ZPZA 2BMGB 2PKSC 4WMFA 2FYRA 1O2TA 4NFFA 4A6LA 1TGNA 4ABFA 4D9RA 1PJPA 1W0YH 1MTNC 1IHTH 2FIRH 1BCUH 2PGBB 2QXHA 1T31A 3BSQA 4GCHF 2PSXA 3RXSA 3KQDA 1V2TT 1DICA 1P05A 3F68H 4DIIH 1DM4B 1IQLA 1SB1H 2EI8A 5ETXA 1C5WB 4XDEA 4SGBE 3ATKA 3MOCA 1YM0A 3AW0A 2IN2A 2A2QH 4B1TA 1LHEH 2B0FA 1CU1A 2ZCLP 4JZEH 4YLQH 3T27A 1AIXH 5A0BA 1LDTT 1L4ZA 2P94A 4JK5A 4R8TB 2BZAA 2CHAC 2ZDAH 1UVOA 2CMYA 1CBWC 1CHGA 5HXFA 1TALA 2IPHA 3T29A 3SZNA 3O8CA 1AFQB 1P2KA 4BTIB 2AGEX 1G32B 4NGAH 1GHAF 4BANB 1JIRA 3UPEA 1JXPA 1GI4A 1TRYA 3QK1A 1TOMH 1D9IA 4GHQA 3TGIE 3D65E 2ODQA 2Z3EA 4HI3A 1Z6JH 2NU4E 1C2EA 1ZGIA 4IW4E 2QXIA 1O36A 4K60A 3TK5A 5A2MH 5F6MA 1HAVB 2GD4B 2AEIH 1LVBA 2ZCHP 3I77A 2F9OA 3SNBA 1O2RA 1A0HB 1B0FA 1SGTA 2VU8E 3NPSA 4FUIA 5TCCA 1O2SA 3SV2H 2R2MB 1HCGA 1EXFA 5HMAA 1IQJA 1Q2WA 1WYKA 4XSKU 1HAHH 3SO3A 3RP2A 1EOJA 3D23A 3VGCB 1CGJE 3U8TH 1H9HE 2J92A 2VWOA 3SUGA 1DSUA 3GDUA 3H5CB 3VB7A 2OC7A 2D1JA 1AKSB 1WV7H 4NIYA 1OWHA 1O35A 1BUIA 1EP6A 1MAXA 4KELA 1QA0A 2HALA 2BXUH 1DT2A 1LMWB 2OC1A 1RIWC 1LTOA 1THPB 3SI3H 3MWIU 2XCNA 1CVWH 2FOBA 1O2LA 1Y59T 1ABIH 1YPJH 3NK8A 1SGRE 4GSOA 1GMCF 2FI3E 3SHCH 1C9PA 1XXDA 2W26A 1BHXB 1TOCB 2OQUA 1Z1IA 4ABEA 1BT7A 4BNRA 3VPKA 1GBEA 3PTBA 1SVPA 1B7XB 3KQCA 3ZV8A 3N7OA 1SI5H 2SGPE 2AGGX 1UO6A 1THSH 3BTWE 5HGGA 1AB9C 5E0JA 1EB1H 5EW1H 1RXPA 2ZP0H 4DW2U 1P12E 1G30B 3P17H 3PLBA 4FVBA 1FY3A 1ZSJA 4GLYA 3S9AA 4R0IA 1A1RA 1H8IH 4MG3A 3EQ0H 3M5MA 3F9HA 4CRDA 3GCTG 2XWBI 3RXBA 1SQTA 1MUEB 3B23B 3F9GA 1QRZA 1TIOA 3IITA 1U6QA 4X1RU 4I8KA 3RC4A 4BXWA 4KGAA 1HJAB 3U9AH 1DVAH 3ATIA 3UNQA 1TPOA 1Z8JB 3O8BA 1TNKA 3PO1C 3QX5H 1QR3E 1N1LA 1RJXB 1L4DA 1SGDE 2PKSB 1ZMNA 2ZU5A 1MTNB 1UTKA 2QC2A 1OP0A 1IQIA 4K2YA 2FOMB 4CR5A 4CRCA 3RXTA 2QY0B 4U01A 2HRVA 1GJCB 2Y5GA 4INLA 2FXRA 2Y5FA 5J4QA 1O34A 5F8TA 1OSSA 2H9TH 1QGFA 2GX4A 1RRKA 1GBIA 1UHBA 3GYLB 2VIVA 2WINI 2WPMS 1O38A 1ZSKA 5IYTA 4Y6DA 4OS5A 2ZNKH 3UOUA 5DP9A 2C90B 3C27B 1MCVA 1PPZA 4LXBH 1TX6A 1BOQA 5E0GA 1NM6A 1O3PB 1JRTA 4NIWA 2H9EH 1CBWB 4FUEA 1C5QA 2P3FH 3BG4C 1A2CH 4Y76A 2GVFA 2G5VA 6ESTA 4TY6A 5A8XA 1P3CA 4D8NA 2BY9X 1N6YA 1SHYA 1KXCA 4MNXA 1BBRK 1PFXC 3M7QA 3TJVA 1VJ9U 2ALVA 4IMQA 5JBBS 1HV7A 5GPIB 2DUCA 4BXSA 4D9QA 1NRQH 5EG4A 1NRRH 4DGJA 3AAUA 4KTUA 1NT1A 1S6FA 2IOTA 5A0CA 1C1RA 3QO6A 1FY4A 1QFKH 4IBLH 1F0SA 2P8OC 1D6RA 1BRAA 2PGQB 1SGPE 2ZFRH 2Y7ZA 2BQ6B 3LOXA 3SU6A 3MO3A 2HWLB 2STAE 4ZHAA 1UCYK 1C1VH 1RTKA 3RU4T 3FP7E 2A4QA 3F1SB 4OS6A 1EUFA 3A7XA 2A0QB 1DXPA 2BM2A 3BV9B 3NZIA 1C1NA 2YNAA 4CRBA 1SGNE 2OBOA 3MH5A 4NZQA 5F03A 1E37B 3RU4E 4FUDA 2QGRA 1CT2E 1IQEA 1MAYA 3SV8A 1QL8A 1O32A 4X1SU 4JYTA 1NFWA 3FANA 3ENSB 1AWFH 2Z9JA 1MU6B 1W2KH 3PM3A 2AMQA 2QXGA 1NFYA 1TFXA 1BMNH 1A0LA 5E2OA 1RIWB 3A86A 1C2DA 2A31A 4GVUA 1H4WA 4RKJB 1P9UA 1HIAB 1AVGH 1MU8B 1O2WA 1O2HA 5BRRE 1MCTA 5BPEA 2B8OH 1ETTH 2G52A 1PQAA 4IS5A 4ZMAH 1C1OA 2OQ5A 2ZDVH 3A7TA 2RCEA 3SN8A 4AB9A 1FMGA 2VVCA 1C2FA 2A5IA 1CO7E 2BD2A 3TK9A 3UQVA 1HBTH 1MKXH 2AMDA 3AAVA 2OC8A 1DITH 1AB9B 1S6HA 3ZZ8A 3RMOH 3ZVDA 2HGTH 5AVDA 2F9UA 1QBOA 1SLUB 2PUQH 3TH2H 8KME2 2QXJA 4FU9A 3TGKE 4AGKA 1C4Y2 2BYAX 3E16B 3M7TA 1O2GH 5DP3A 1C2JA 2ILNA 5DG6A 1P2IA 1WOFA 1HAIH 5C5OA 1VGCC 3ZVBA 3ZYDA 1OPHB 3LU9B 3ZYEA 1GCDA 1OX1A 4MTBA 1C1UH 1FIWA 1LO6A 1C1WH 1GBHA 1F0RA 4AG1A 1TGTA 2BD5A 1BJUA 4ZKSU 9ESTA 5EQSA 4BOHA 2I6SA 4NSVA 1P02A 2FS8A 3PO1B 2AFQB 3U8OH 1WU1A 4ASHA 1IHSH 1FY5A 4BTUB 1QL9A 1OP2A 3DA9B 2R3UA 1FJSA 1NC6A 3HGNA 1BDAA 3OYPA 4NFEA 1O3OA 4ZKRU 1XUKA 3HGPA 1W12U 4E06H 1S84A 2XRCA 4NA7A 1T8MA 2SNWA 3W94A 5C5NA 1C5TA 1INCA 3R3GB 1D3DB 1DWDH 3UQOA 2ZHWH 3SJIA 1G2MA 1XUJA 1V2OT 2XBWA 1W7GH 3BTME 4AZ2B 1XM1A 3B8JA 1Y3XA 1CE5A 2P93A 1ZMJA 2D26C 3V3MA 1SGFG 2J2UA 3K2UA 2OBQA 1CQQA 1EZUC 3RLWH 1NS3A 1FAKH 2XTTB 3OSYA 1FI8A 1PQ7A 1W10U 5DP6A 1QCPA 4MNWA 1AFEH 5EXLA 5L6NH 4WH8A 4J2YB 5C1YA 2Q6DA 3A85A 2ZU3A 3CENA 1AUJA 4X6OA 1GJAB 1EAIA 1MTSA 1V2QT 1GBLA 5LH8A 3BG4B 4ISLA 1P3EA 2ZECA 3E6PH 4LOYH 4OS1A 4O3UA 3F9FA 5DP4A 4JZFH 3PWCA 4ZHLU 3BEUA 1OP8A 2FOCA 2GDDA 4MPXA 1C5VA 1PYTD 3PYHA 4X2WA 1ZLRA 1P2QA 3ATWA 1AUTC 1WBGB 1J16A 2QV1A 2CF8H 3M3TA 1HAZB 2GZ8A 1Q3XA 4U30A 1GI2A 1EAXA 2B9LA 1C4V2 3ZVCA 2FS9A 1H9LB 4UFGH 4OGXA 2P8OB 3MH6A 2HLCA 2JH6D 2XBVA 3RXFA 2BY7X 2D8WA 1DPOA 2TPIZ 4M7GA 3KF2A 3BIVH 2XW9A 2Z7FE 2AH4X 1LVYA 4DOQA 2JETC 5EXNA 3UWIA 2NWNA 1EATA 2ZGJA 1AN1E 3P6ZB 3ESTA 4GCHG 4Q2KA 1GHXH 1S0RA 2QA9E 2YOLA 3RXHA 1O5BB 2PFEA 2WPJS 2ZI2H 3A89A 2O9QA 3LGVA 2CV3A 3K6ZA 5JDUB 1LQEA 2GMTC 2HNTF 3T2NA 3KEEA 3KGPA 3NUMA 1BB0B 1QL7A 4CR9A 1O3BA 2Q6GA 4X1PU 2A4GA 3M35A 3GDSA 3FVFB 4THNH 1BHXF 2RG3A 1GHZA 3KN2A 5F8ZA 3UREA 1GDQA 2VINA 3V12A 3EDXB 1WQVH 1GBKA 1ZTKA 2Z3DA 3NCLA 1RGQA 1DWCH 5E2PA 4NIVA 1ESAA 2BDCA 3RXQA 1TX7A 4H6TA 1AWHB 4FXGH 4IMZA 4ZKNU 1JRSA 2H6MA 2F83A 1P09A 2ZDKA 1BQYA 2OUAA 1ARCA 1O2QA 1GHAG 1O3EA 3TJUA 3OY5U 4ABGA 3RXLA 1MTWA 3NKKA 3ELAH 2O8TA 3K9XB 3M5LA 1EASA 3FAOA 1DDJA 5L2YH 1BTZA 2ZO3H 3KL6A 4X2YA 1P57B 2ZG0H 5LGOA 2BY8X 3RXUA 1KDQA 2J9NA 1QBVH 1XUIA 4FUBA 3TITA 5K0HA 2BVSH 2Z3CA 2FPZA 2FI5E 2XXLA 3ZZ5A 1EPTA 2W7SA 1HUTH 4AFZA 2BZ6H 2BDHA 2IJOB 3TH3H 5A8YA 3RXGA 1GI3A 1TMBH 4Y7AA 4DY7B 4UONA 3MNSA 1NU7B 1VGCB 4ZUHA 2HVXA 2LNCA 4YESB 4BTTB 4RSPA 1LKBA 1O2NA 1F0UA 1Z71A 2XC0A 2R0LA 3V13A 4AORA 1W7XH 2FEQH 4K3JA 1ZHPA 2J95A 1O5GH 1ZHRA 2ZDMA 1E36B 2Z9IA 1SGQE 2QCYA 2BB4A 4JCNA 3Q00A 3P8GA 1TNLA 5C20A 2SGQE 1MQ5A 4A1TA 4BAOB 1AZ8A 2BDYA 1Y8TA 1G2LA 3L33A 1ZJKA 1SFIA 5C1UA 1HFDA 1HRTH 5FPYA 1A4WH 1C9TA 4CBNA 1YPMH 2XCFA 3VB5A 3SJOA 1HGTH 4ISIH 3QZRA 3URDA 4F4OC 1ZTLA 1WAYB 5DP5A 1GMCG 4O9VA 1UTMA 3UUZA 4Z6AH 1O2UA 1LVOA 3A8CA 1MD7A 4AYVB 1E34B 3TIUA 1C2HA 1DFPA 1BMAA 1QB1A 2BHGA 2HPQH 1TLDA 3A84A 1WUNH 1Y3WA 1MQ6A 1GJ7B 1E35B 1GI7B 2C8WB 1CGIE 1L1NA 3SI4H 3LGWA 1VCQA 1UHBB 4WMDA 1QJ6B 3Q3XA 2Y82A 1YLCA 1O3GA 2HPPH 2OD3B 3ZVGA 1IQGA 4Q7ZA 3T5FH 1GGDC 1MBMA 2W5EA 3O8DA 1QJ1B 3U8RH 5JBCS 1O39A 3CP7A 2ZEBA 4Q7YA 5DPAA 1V2PT 1ZZZA 1YGCH 1C2MA 2ZFSA 4INKA 3GY8A 4UFEH 1BTHH 1EZQA 1O3HA 1NU9A 4DIHH 2YNBA 1NRSH 4YLUA 4NIXA 1RTLA 5GDSH 1CA0C 1ZMLA 3S7KB 2BTCE 4CRAA 1SLWB 1BBRH 1ELGA 4ESTE 1F0TA 1W0ZU 4GAWA 3RXRA 1N6XA 4XFQA 3HK6B 1D4PB 2BX3A 3M37A 3HK3B 5FPSA 1O2PA 2PLXA 4XOJA 2M5TA 4FVDA 4X0WU 1GHBF 1YPHE 2FLRH 4Y8YA 1HXEH 3SU3A 1BMLA 1BTYA 2JETB 3MO9A 1KY9A 2J94A 1P01A 4X8TH 3GOVB 2GTBA 4INHA 3ZVEA 3I78A 1TBZH 1TGCA 1QBNA 1UCYH 2ZF0H 1GBBA 4X6MA 1HB0B 4O3TA 1AE5A 2EA3A 1YPKH 2GMTB 3ZVAA 3ZZ3A 4CH8B 1GHVH 2NU0E 2THFB 4ISOA 1C5XB 2Y81A 2Z94A 3E1XB 1AHTH 4WXIA 1EAWA 3RMLH 3DHKH 1EZXC 4OS7A 3GY5A 3AW1A 2Y5HA 1OWKA 4MNYA 8GCHF 2P3TB 2FTLE 3B9FH 3K6YA 2ANYA 3MO6A 2GGVB 3ZZBA 2BQWB 1VITF 2WV4A 1GWAA 4O97A 5T6GA 2C3SA 1YPHC 3GISB 4AGJA 3EYDA 4D7GA 3M61U 5E8EH 2VIPA 1PPHE 2WUBA 2VVUA 1TONA 3EA7A 3E0NB 1GVZA 1C5SA 1GCTC 1LHGH 3SJKA 1TRNA 2Y6TA 3M7UA 1QQUA 1UTQA 3RXAA 3SU5A 3PMJA 3UY9A 2H1UA 5PTPA 2SGEE 1GG6C 2ALPA 4H42U 1H9IE 1SSXA 1ANDA 5EW2H 1UTJA 4MPVA 1K1LA 2A1DB 1O3KA 3P8FA 3QTVH 1ANCA 1LKAA 2LPRA 2F9VA 3H7TA 1BTXA 1ESTA 5T6FA 2VWMA 4GHTA 3VEQB 1NZQH 3RM0H 1SC8U 1YPLH 3BIUH 2CN0H 1GJ6A 1XVMA 2W3IA 1E0FD 1EPTC 1TBRH 5AF9H 2VIWA 4I32A 1K1JA 1N8OC 3STJA 1GDNA 3S0NA 4Y8XA 1PPFE 2AIPA 2BD9A 4MQAA 5FBIA 3VXFH 1DANH 1D3QB 1D3TB 4YO9A 4E7NA 1DLKB 3MMGA 1UCYE 2KAIB 4U32A 2O8WA 1ZSLA 1PPCE 3RUOA 1A61H 2A4OA 4KKDA 2WPIS 1IQHA 1T4UH 4SGAE 1SGIB 3WY8A 4TPYA 1O0DH 2CJIA 1NO9H 2P16A 3LH1A 4D76A 1AD8H 1ABJH 1ZPCA 2BDIA 3DFJA 1TX8A 3E3TA 3QTOH 3AASA 1FY1A 4CH2B 3QLPH 2XBXA 1T32A 1DUEA 3RM2H 1ELCA 2PTNA 5DP8A 5LPFA 1YC0A 1QHRB 1O37A 1FLEE 1A46H 3SNEA 5SGAE 3ZZ4A 1P2OA 2JKHA 1L2EA 4K1TA 1VZQH 1GJ9B 2ZIQH 2F9BH 1C5YB 3ODFA 1GI1A 3M5OA 1ZYOA 1J15A 1O2OA 1YPEH 3M36A 1W13U 1NTPA 1TMTH 4OS2A 5CE1A 3FP6E 5EGMA 2ZU2A 3TJNA 4NSYA 1FIZA 2XC4A 1C1TA 4MNVA 1GGDB 1OYTH 1P06A 4XBBA 1Y3YA 5F8XA 2FX4A 1AVXA 2RDLA 2ZC9H 5FAHA 2ZPRA 4X8SH 4Y79A 1EOLA 1SGFA 1TPAE 2ZFPH 3LONA 1AGJA 1SLXB 1TNHA 2TIOA 1GPZA 1ACBE 3RMMH 2G51A 1CA0B 3GY7A 2ZGBH 1A7SA 2H5CA 1O31A 2G5NA 4MPUA 1V6DA 3UR6A 1O3FA 2Q1JA 2PKAB 2BD3A 5FX5A 4UFDH 3TJOA 1SGCA 1TPPA 4ABHA 5C67A 1C5ZB 1BTWA 4KP0A 5C3NA 4IN2A 4TWYA 1VCPA 1XVOA 2EI7A 1KLTA 2AERH 2TGTA 1UVSH 2ZTZA 1LQDB 4E05H 2ZHFH 3KNXA 3BTTE 1K2I1 2ODPA 4JZIA 3SNAA 1XUFA 2F9NA 3SHAH 5LPRA 1IQMA 1O2MA 4YT7H 1G3DA 2Z6BD 6GCHG 2F3CE 4YOJA 5T6DA 2JH0D 1GDUA 1CT0E 1GMHF 1C5PA 2AIQA 4YTAA 1RFNA 2OTVA 1O3IA 3ZZAA 2UUJB 1G3CA 2ZGHA 1ETSH 2C4FH 3MYWA 2PR3A 1O5FH 1O3MA 5AFYH 1QNJA 3LC3A 1K1OA 3URCA 2XWAA 2ZA5A 2Z9LA 4UFFH 1C2GA 1OYQA 3W95A 1YYY1 3GICB 3KQBA 1UMAH 1ELFA 5IDKA 2BXTH 1T8OA 2UWPA 7ESTE 1PPGE 1LPGB 3ODDA 1BRCE 3SGQE 1GMDG 4IC6A 2H5DA 2SFAA 1LHCH 3FZDA 3RXDA 2GV6A 3LJOA 3P8NA 1GCTB 1QQ4A 1H1BA 3ZZCA 1FY8E 2GCHF 1SGYE 5HM2A 4A1VA 2ESTE 1GG6B 1TNIA 2QYIA 1BITA 2VNTA 4FUCA 3D62A 1V2RT 2R3YA 3S69A 2WPHS 1IOEA 4RKOB 1KSNA 2HOBA 1O3CA 1F5KU 3VB4A 3DFLA 3TNTA 2F91A 2A32A 3T26A 1KDQB 1QRWA 1YP9A 1JMOH 3VFEA 1TA2A 1OWDA 2FMJA 2GCTB 3UNRA 1G3BA 2EI6A 1EPTB 4XE4A 2ZQ2A 1V2WT 4FU7A 1TNJA 1N8OB 2WPKS 2FESH 3A8BA 1ELBA 6GCHF 1QB9A 2RA3A 2VIQA 3QUMP 1ZRKA 3P92A 5A0AE 3MHWU 1LHDH 3SGAE 1V2LT 1DLEA 2P3UB 3LIWA 1T8NA 2ASUB 2G55A 1FPCH 4CREA 1MZDA 1FQ3A 3A80A 4CRFA 2C8ZB 3A81A 5EXMA 2FTMA 1WQSA 1C4U2 5ESTE 1ZGVA 1H8DH 3PLPA 1K1NA 4AN7A 4X2XA 2BX4A 1FAXA 1BJVA 3GCNA 1BRBE 4D7FA 3D49H 4E7RG 1HPGA 1HLTH 3MFJA 1GMDF 1O2KA 3GCHC 4O03A 1S81A 1LVMA 1QA7A 4LZ4B 2WUCA 2HNTE 1IQNA 1BMMH 3A87A 3UTUH 4NG9H 6CHAC 4K5ZA 3PTNA 1O3DA 3SNCA 3EA8A 3GY6A 5GCHF 6LPRA 1XMNB 5FHTA 1RTFB 2J38A 1JWTA 2FOHA 2FZZA 4QT8C 1IAUA 1QTFA 3RXPA 1NN6A 3RDZA 1SR5C 2ZFFH 4AG2A 1MKWK 1T7CA 3A88A 4XBDA 4AB8A 1SHHB 4JK6A 3PB1E 1HAXB 5FCRA 1ARBA 2XC5A 3U98H 1HAGE 2BVXH 5T3HA 1C2IA 4HFPB 1YPGH 2B5TB 4NWKA 1D3PB 1FN6A 2DE9A 3CS7A 4WXVA 1O33A 1HAYB 2A5KA 2RA0A 5H4IB 5JYIA 4CBOA 2VIOA 4MVNA 4TY7A 1E38B 2HNTC 3TGJE 1TA6A 2EC9H 2VGCC 1EP5A 3TNSA 3O8RA 4XBCA 1WSSH 2C8YB 3MU4A 3VB6A 3Q3YA 1C5RA 1GI9B 1XUHA 1GBTA 2NU3E 5EPNA 1CHOF 1MTVA 1Z7KA 1TBQH 3LDXH 1ANEA 4Y0ZE 3BTKE 4DG4A 2ZZUH 1GI8B 3SV7A 4DT7B 4Y71A 4FUGA 1F5RA 2I6QA 2P59A 1O30A 1UK2A 2GZ9A 1V2MT 4Z0KA 2K1QA 2TGDA 4Q7XA 1P2NA 1GBDA 3KHVA 3SORA 3SJ9A 2ZGCA 2ZWLH 4HZHA 1P2JA 1KIGH 3HPTB 1Y5AT 3QZQA 5JPMH 3PMHB 2BD8A 2FI4E 2ZPSA 1UK4A 3VXEH 1SQAA 2ZQ1A 1NFUA 1VJAU 1MBQA 1D6WA 1DWEH 3ZVFA 5EODA 1KYNA 1FDPA 5DJ7A 1XUGA 4ABIA 4GPGA 3RMNH 1HDTH 2OCVB 1C5MD 1AO5A 3IWMA 3JZ2B 4X8UH 4DVAU 3UFAA 1GJDB 1A0JA 3PLKA 4WMEA 1FZZA 1O2VA 1ZTJA 3FZZA 1AQ7A 4I7YH 1B5GH 2QN5T 4KTCA 4CRGA 1ZOMA 2UUYA 1KLIH 4BAHB 1GVKB 1VITH 3ZZ6A 2O8LA 4DURA 4ZXXH 1DY8A 3UIRA 5FCKA 4I8LA 2GT8A 2UWOA 2FP7B 3SU4A 2AS9A 1TNGA 2GV7A 4X6NA 2WV5A 2OP9A 1GHBG 1UTLM 2ZGXH 1J9CH 3T62A 1DWBH 1WCZA 3F6UH 1AU8A 2CXVA 1MZAA 1PPBH 1ZPBA 4ABJA 1RS0A 3BTHE 4B2BA 3E0PB 1Z8GA 2UUFB 1G3EA 1S82A 5TCAA 3MH4A 1PQ5A 3SGBE 1BTUA 5EQRA 1FV9A 1FPHH 1DS2E 1P04A 4VGCC 1G36A 4ZHMU 1MMJN 4NZLA 2FOFA 2ZFTA 2QF0A 5JBAS 2QF3A 2WYJA 4MPWA 5AHGH 1K1PA 1S0QA 3QN7A 3SNDA 1C1SA 3OU0A 1P8VC 2BVRH 4UE7H 8GCHG 3RLYH 1GJBB 1SOTA 2STBE 4Q80A 1QRXA 4DJZB 3NXPA 2C93B 1VITG 4CHAC 1YKTA 1O3AA 3TLOA 1TE0A 5FX6A 1NRNH 3LH3A 5GXPA 3GCHB 1ZHMA 2VB0A 4A1XA 7LPRA 3SUDA 2C8XB 1V2KT 1K1IA 1A3EH 6CHAB 2A7CA 4YOIA 1YCPK 4A5TS 1C5LH 2WYGA 4TPIZ 1M9UA 1ORFA 1XKAC 1P03A 5HYOA 2H2ZA 4I8GA 3KIDU 5FPTA 4FUJA 2GT7A 2TGAA 2PTCE 1HJ9A 1NRPH 2R2WU 3T25A 3V7TA 4YM9A 4JZDH 1TB6H 3A7VA 4FUFA 3ZV9A 1DSTA 1NY22 2AMPA 3SUFA 1FUJA 1ZR0A 3RXIA 1A5GH 2JH5D 1ESBA 1SLVB 2BDBA 3RXJA 3P95A 3LPRA 1K22H 1OWEA 1AY6H 1NPMA 1TAWA 1FN8A 1YBWA 3GY3A 1DOJA 4B71A 1NFXA 1OS8A 1C5OH 1F2SE 2ANKH 3EE0B 4H6SB 5JBTA 1PPEE 5B6OA 3SUEA 1W3CA 1HYLA 2VGCB 4K8YA 4AYYB 1C1QA 4I31A 1PQ8A 4H4FA 3DD2H 2BDAA 4JYUH 2AYWA 1KLJH 4WWYA 1Z8RA 3I29A 4JYVH 1GBAA 5DK1A 1G37A 4WY3A 1MH0A 3Q3KA 2ZU1A 1J17T 1EJAA 2PV9B 1L1GA 1AVWA 1L1JA 4ISHH 3BTFE 1DXWA 3HKJB 3S9BA 2QAAA 1O5EH 2G81E 2A5AA 1C5UA 3BG8A 2PHBA 1HXFH 2ANMH 3TPIZ 1C1MA 1TMUH 4NA8A 2GZ7A 2TRMA 1GBJA 1ZJDA 1THRH 1GJ4H 4FUHA 1KXDA 2FOEA 1YLDA 2W3KA 2BY6X 1MD8A 2G00A 3GYMA 1SBWA 1A5IA 4LZ1H 2FWWA 4ZAEA 4B73A 1O3JA 1BRUP 1F5LA 5AFZH 1DY9A 2G8TA 2OINA 3LGTA 5DGJA 1GI5A 3BTGE 4Y0YE 1BBRE 4B76A 1ELAA 1IQKA 2AGIX 2CGAA 5GJ4B 3SU2A 1T8LA 1Z6EA 1KXEA 3MNXA 4PROA 1QY6A 3RC6A 1Y5UT 2ZU4A 2GCTC 3PROA 2Q6FA 2QIQA 1WTHD 3UOPA 4X8VH 3CS0A 3SBKA 1W8BH 5JB9S 5DO4H 2A7HA 1V2UT 1UVTH 1EQ9A 1GI0A 2EEKA 3OX7U 4NCYA 2OC0A 3L6PA 1TYNA 3MU8A 4ZXYH 3ZZ9A 4WH6A 1TQ7B 2FYQA 1P9SA 1Z1JA 4AOQA 1Y3UA 2FODA 5EOKA 3Q76A 5TJXA 1JBUH 4J1YA 1JIMA 3MH7A 3P8OA 1UTOA 2VWLA 3SU0A 3RU4D 1GVLA 4AFSA 1OWIA 2Z9GA 3QGNB 5L2ZH 1Y5BT 1HAVA 1SMFE 1GBMA 4VGCB 2ULLA 4ABBA 1G9IE 1QURH 2FLBH 4I8HA 1GMHG 1BA8B 2CHAB 3PV4A 1LCYA 2R9PA 1TPSA 3GCTF 2ZPQA 2ZHDA 2BLWA 4K1EA 4UEHH 2Z9KA 5C2ZA 3SU1A 1CSOE 2CF9H 3RXEA 4WJG2 1B0EA 1DX5M 1QJ7B 2BOKA 3GY4A 1NESE 3EAJA 2FO9A 3MNCA 4WVPE 1K21H 1AKSA 1NROH 2FOGA 3RXCA 4CHAB 1UTPA 3BN9A 4B2AA 8ESTE 1SGEE 1EKBB 2BD4A 3M5NA 2ANWA 1OXGA 1K28D 1Q31A 2BD7A 1GJ5H 1KTTB 4MLFB 3BEIB 3E91A 3R0FA 1YF4A 3PMAB 4JZ1A 3JZ1B 3A82A 4X6PA 5JB8S 1ID5H 3PWBA 1OWJA 3E8LA 3A7WA 2GCHG 1GI6A 1FONA 5GWZA 3BF6H 3RXVA 3UNSA 1F7ZA 2V6NA 3SV9A 1K1MA 1GL1A 2P95A 2FM2A 3NWUA 1S85A 3SW2B 3KCGH 3SOSA 4YOGA 1O2YA 1SOZA 2GDEH 4JMYA 1SQOA 2BLQA 1KXBA 8LPRA 3SQEE 1SG8B 2A7JA 5FXLA 1GBCA 1VR1H 2J4IA 1EX3A 3U69H 2V3OH 3T28A 1MKWH 1IQFA 1UVUH 1W11U 3GCOA 5CHAC 1EZSC 1O2IA 2D2DA 4B2CA 2ZFQH 3LT3A 3U1IB 2BY5X 2Y7XA 4F49A 2A2XH 2BLVA 1HAOH 1HNEE 1SPJA 2PUXB 3UWJH 1AI8H 1EJMA 3V0XA 4UD9H 4BAQB 3ATMA 3EA9A 4LK4A 1GHYH 3A8DA 3GDVA 2NU1E 1ZRBA 3VB3A 4AFQA 1GBFA 5ABWA 3OY6U 4BAMB 7GCHG 2XBYA 1KXAA 4NWLA 4X1QU 4HTCH 2VH0A 2V0BA 3TU7H 4B74A 4X2VA 3M3VA 2SGFE 3DT0H 3U1JB 1T4VH 2PW8H 5EPYA 2O8UA 1O5AB 3BTEE 1C5NH 2UWLA 4ZROA 3LKWA 4ZKOU 2ZCKP 1C2LA 1UK3A 1P2MA 2OXSA 4A7IB 3TVJB 2VWNA 4NA9H 1V3XA 1K9OE 4KTSA 2Y80A 1P10A 3L3TA 5GCHG 4ISNA 3SQHE 4X1NU 1FNIA 3RXKA 4TYDA 1KXFA 1ANBA 5DP7A 2SGAA 3LGUA 1GHWH 2KAIA 7KMEH 2R0KA 3RXMA 3FFGA 3SV6A 1C2KA 1J14A 4OS4A 4MDSA 3QGJA 2PWXA 1L0ZA 3G01A 2FX6A 1UTNA 3H7OA 1GJ8B 3FP8E 3RC5A 3HKIB 2SGDE 4I8JA 2ODYB 4RN6A 1CA8B 3S7HB 4DCDA 4B75A 2TGPZ 2SNVA 2WPLS 3DUXH 3TH4H 5I46H 4AFUA 4ABDA 5LPEA 3MNBA 2ZTXA 2UUKB 1BIOA 3GY2A 4FU8A 3MU1A 1DUAA 1AFQC 4BAKB 1XXFA 4HGCA 2ZDLA 1VCWA 5I25A 4U2WA 1A3BH 2BLOA 2XNIA 7GCHF 1O2XA 1OOKB 1S5SA 4IC5A 3LC5A 3K65B 1V2VT 4Y7BA 1CHOG 2BQ7B 3QDZB 1O2ZA 3LGIA 3S9CA 1ELEE 1V2NT 2XYAA 1LHFH 3ATLA 3MTYA 1UJ1A 2GKVE 5EU8A 1JOUB 4OGYA 1ELDE 1W14U 5G4BA 1Z8IB 1OKXA 2A45B 3ITIA 4TWWA 3BEFB 1TRMA 3BTQE 2ZHQH 3A7ZA 4ZH8A 2G4UA 1FXYA 2A4RA 1HAPH 4Y8ZA 5HM9A 1SFQB 1TGBA 1J8AA 1TQ0B 5DKMA 4A92A 3IG6B 3STIA 2VH6A 2PKAA 2B7DH 3SJ8A 3OTJE 4WF8A 3C1KA 2W7UA 3MI4A 1O3LA 3VGCC 1YCPM 1WTGH 1KTSB 2FOAA 1HIAA 3LGYA 2ZKSA 4YZUA 3F9EA 1DE7H 5J4SA 1P11E 4IN1A 1UVPA 1BTPA 2OLGA 4K1SA 3ZZDA 1CGHA 2TBSA 4GUXA 2NU2E 1AMHA 1TABE 1YCPH 1ETRH 1AE8H 1MTUA
chains in the Genus database with same CATH superfamily
1LPKB 2ZDNA 1ELVA 4UDWH 3PMBB 3ZZ7A 1F92A 1MKXK 2ZHEH 3LJJA 4I33A 3TK6A 5CMXH 5A09A 1GL0E 2BDGA 3KQEA 1C1PA 1CT4E 1BZXE 5ESBA 1EJNA 1X7AC 4K69A 1O2JA 2PP6A 4Y10E 1ELTA 1V2JT 5GIBA 2DE8A 3N99A 3EGKH 3BTDE 1EB2A 1TGSZ 1XX9A 2ZTYA 2O8MA 2J34A 1NBMD 4YT6H 3UR9A 5CHAB 4K8BA 2G4TA 1AZZA 1RD3B 3OEHD 1P0SH 1S83A 2F9PA 1TWXB 3MU5A 9LPRA 2XOKD 2VVVA 1XKBC 3A83A 1Y3VA 3MU0A 2V35A 2H9HA 2V3HH 2BOHB 2YMSD 3RXOA 2PSYA 3F2GA 5L30H 3AVZA 1OHHD 1HJ8A 4IGDA 2VJ1A 1QB6A 5FBEA 1COWD 3A8AA 4ABAA 5A8ZA 2GP9B 1O5DH 3A7YA 5K7RA 4AX9H 1HJAC 3Q77A 5EQQA 2VIDA 2FDAA 3HATH 1SL3A 3P70B 3QWCH 1LPZB 1PYTC 1O3NA 5C1XA 1O5CB 3M3SA 1QIXB 5E0HA 4Y11E 3E90B 1A5HA 1V2ST 1EAUA 1ZPZA 2BMGB 2PKSC 4WMFA 2FYRA 1O2TA 4NFFA 4A6LA 1TGNA 4ABFA 4D9RA 1PJPA 3DSPA 1W0YH 1MTNC 1IHTH 2FIRH 1BCUH 2PGBB 2QXHA 1T31A 3BSQA 4GCHF 2L6OA 2PSXA 3RXSA 3KQDA 1V2TT 5KECA 4M9FA 5C17A 1DICA 1P05A 3F68H 4DIIH 1DM4B 1IQLA 1SB1H 3SYJA 2EI8A 5ETXA 1C5WB 4XDEA 4SGBE 3ATKA 3MOCA 1YM0A 3AW0A 2IN2A 2A2QH 1K0HA 4B1TA 1LHEH 2B0FA 1CU1A 2ZCLP 4JZEH 4YLQH 3T27A 4Q4LA 1AIXH 5A0BA 1LDTT 1L4ZA 2P94A 1W0KD 4JK5A 4R8TB 2BZAA 2CHAC 2ZDAH 1UVOA 2CMYA 1CBWC 1CHGA 2WV9A 5HXFA 1TALA 2IPHA 5EJ1A 3T29A 3SZNA 3O8CA 1AFQB 1P2KA 4BTIB 2AGEX 3DSGA 1G32B 4NGAH 1GHAF 2LELA 5FL7D 4BANB 1JIRA 3UPEA 1JXPA 1GI4A 1TRYA 3QK1A 1TOMH 1YWUA 1D9IA 5F53A 4GHQA 3TGIE 3D65E 2ODQA 2RDEA 2Z3EA 4HI3A 1Z6JH 2NU4E 1C2EA 1ZGIA 4IW4E 2QXIA 1O36A 4K60A 3TK5A 5A2MH 5F6MA 1HAVB 2GD4B 2AEIH 1LVBA 2ZCHP 3I77A 2F9OA 3SNBA 1O2RA 1A0HB 1B0FA 2K8IA 1SGTA 2VU8E 3NPSA 4FUIA 5TCCA 1O2SA 3SV2H 2R2MB 1HCGA 1EXFA 5HMAA 1IQJA 1Q2WA 1WYKA 4XSKU 1HAHH 3SO3A 3RP2A 1EOJA 3D23A 3VGCB 1CGJE 3U8TH 1H9HE 2J92A 2VWOA 3SUGA 1DSUA 3GDUA 2J97A 3H5CB 3VB7A 2OC7A 2D1JA 1AKSB 1WV7H 4YXWD 4NIYA 1OWHA 1O35A 1BUIA 1EP6A 1MAXA 4KELA 1QA0A 2HALA 2BXUH 1DT2A 1LMWB 2OC1A 1RIWC 1LTOA 1THPB 3SI3H 3MWIU 2XCNA 1CVWH 2FOBA 1O2LA 1Y59T 1ABIH 1YPJH 3NK8A 1SGRE 4GSOA 1GMCF 2FI3E 3SHCH 2IJD1 1C9PA 1XXDA 2W26A 1BHXB 1TOCB 2OQUA 1Z1IA 4ABEA 1BT7A 4BNRA 3VPKA 1GBEA 3PTBA 1SVPA 1B7XB 3KQCA 3ZV8A 3N7OA 1SI5H 2SGPE 2AGGX 1UO6A 1THSH 2LP6A 3BTWE 5HGGA 1AB9C 5E0JA 1EB1H 2JJ2D 5EW1H 1RXPA 2ZP0H 4DW2U 1P12E 1G30B 3P17H 3PLBA 4FVBA 1FY3A 1ZSJA 4GLYA 3S9AA 4R0IA 1A1RA 1H8IH 4MG3A 3EQ0H 3M5MA 3F9HA 4CRDA 3GCTG 2XWBI 3RXBA 1SQTA 4TT3D 1MUEB 3B23B 3F9GA 1QRZA 1TIOA 3IITA 1U6QA 4X1RU 4I8KA 3RC4A 4BXWA 4KGAA 1H8HD 1HJAB 3U9AH 1DVAH 3ATIA 3UNQA 1TPOA 1Z8JB 3O8BA 1TNKA 3PO1C 3QX5H 1QR3E 1N1LA 1RJXB 1L4DA 1SGDE 2PKSB 1ZMNA 2ZU5A 1MTNB 1UTKA 5CHBA 2QC2A 1OP0A 1IQIA 4K2YA 2FOMB 4CR5A 4CRCA 3RXTA 2QY0B 4U01A 2HRVA 1GJCB 2Y5GA 4INLA 2FXRA 2Y5FA 5J4QA 1O34A 5F8TA 1OSSA 2H9TH 1QGFA 2GX4A 2XNDD 1RRKA 1GBIA 1UHBA 3GYLB 2VIVA 2WINI 2WPMS 1O38A 1ZSKA 5IYTA 4Y6DA 4OS5A 2ZNKH 3UOUA 5DP9A 2C90B 3C27B 1MCVA 1PPZA 4LXBH 1TX6A 1BOQA 5E0GA 1NM6A 1O3PB 1JRTA 3N7DA 4NIWA 2H9EH 1CBWB 4FUEA 1C5QA 2KX4A 2P3FH 3BG4C 1A2CH 4Y76A 2GVFA 2G5VA 6ESTA 4TY6A 5A8XA 1P3CA 4D8NA 2BY9X 1N6YA 1SHYA 1KXCA 4MNXA 1BBRK 1PFXC 3M7QA 3TJVA 1VJ9U 2ALVA 4IMQA 3F2FA 5JBBS 1HV7A 5GPIB 2DUCA 4BXSA 4D9QA 1NRQH 5EG4A 1NRRH 4DGJA 3AAUA 4KTUA 1NT1A 1S6FA 2IOTA 5A0CA 1C1RA 3QO6A 1FY4A 1QFKH 4IBLH 1F0SA 2P8OC 1D6RA 1BRAA 2PGQB 1SGPE 2ZFRH 2Y7ZA 2BQ6B 3LOXA 3SU6A 3MO3A 2J98A 2HWLB 3SZEA 2STAE 4ZHAA 1UCYK 1C1VH 1RTKA 3RU4T 3FP7E 2A4QA 3F1SB 4OS6A 1EUFA 3A7XA 2A0QB 1DXPA 2BM2A 3BV9B 3NZIA 1C1NA 2YNAA 4CRBA 1SGNE 2OBOA 4P02A 3MH5A 4NZQA 5F03A 1E37B 3RU4E 2QF5A 4FUDA 2QGRA 1CT2E 1IQEA 1MAYA 3SV8A 1QL8A 1O32A 4X1SU 4JYTA 1NFWA 3FANA 3ENSB 1AWFH 2Z9JA 1MU6B 1W2KH 3PM3A 2AMQA 2AHME 2QXGA 1NFYA 1TFXA 3MQKC 1BMNH 1A0LA 5E2OA 1RIWB 3A86A 1C2DA 2A31A 4GVUA 1H4WA 4RKJB 1P9UA 1HIAB 1AVGH 1MU8B 1O2WA 1O2HA 5BRRE 1MCTA 5BPEA 2B8OH 1ETTH 2G52A 1PQAA 4IS5A 4ZMAH 1C1OA 2OQ5A 2ZDVH 2WSSD 3A7TA 2RCEA 3SN8A 4AB9A 1FMGA 2VVCA 1C2FA 2A5IA 1CO7E 2BD2A 4F48B 3TK9A 3UQVA 1HBTH 1MKXH 2AMDA 3AAVA 2OC8A 1DITH 1AB9B 1S6HA 3ZZ8A 3RMOH 3ZVDA 2HGTH 5AVDA 2F9UA 1QBOA 1SLUB 2PUQH 3TH2H 8KME2 2QXJA 4FU9A 3TGKE 4AGKA 1C4Y2 2BYAX 3E16B 3M7TA 1O2GH 5DP3A 1C2JA 2ILNA 5DG6A 1P2IA 1WOFA 1HAIH 5C5OA 1VGCC 3ZVBA 3ZYDA 1OPHB 3LU9B 3ZYEA 1GCDA 1OX1A 1YLNA 1C1UH 1FIWA 4MTBA 1LO6A 1C1WH 1GBHA 1F0RA 4AG1A 1TGTA 2BD5A 1BJUA 4ZKSU 9ESTA 5EQSA 4BOHA 2I6SA 4NSVA 1P02A 2FS8A 3PO1B 2AFQB 3U8OH 1WU1A 4ASHA 1IHSH 1FY5A 4BTUB 1QL9A 1OP2A 3DA9B 2R3UA 1FJSA 1NC6A 3HGNA 1BDAA 3OYPA 4NFEA 1O3OA 4ZKRU 1XUKA 3HGPA 1W12U 4E06H 1S84A 2XRCA 4NA7A 1T8MA 2SNWA 3W94A 3KYFA 5C5NA 1C5TA 1INCA 3R3GB 1D3DB 1DWDH 3UQOA 1E1QD 2ZHWH 3SJIA 1G2MA 1XUJA 1V2OT 2XBWA 1W7GH 3BTME 1BMFD 4AZ2B 1XM1A 3B8JA 1Y3XA 1CE5A 2P93A 1ZMJA 2D26C 3V3MA 1SGFG 2J2UA 3K2UA 2OBQA 1CQQA 1EZUC 3RLWH 2JJ1D 1NS3A 1FAKH 2XTTB 3OSYA 1FI8A 1PQ7A 1W10U 5DP6A 1QCPA 4MNWA 1AFEH 5EXLA 5L6NH 4WH8A 4J2YB 5C1YA 2Q6DA 3A85A 2ZU3A 3CENA 1AUJA 1QZ8A 4X6OA 1GJAB 1EAIA 1MTSA 1V2QT 1GBLA 5LH8A 3BG4B 4ISLA 1P3EA 2ZECA 3E6PH 4LOYH 4OS1A 4O3UA 3F9FA 5DP4A 4JZFH 3PWCA 4ZHLU 3BEUA 1OP8A 2FOCA 2GDDA 4MPXA 1C5VA 1E1RD 1PYTD 3PYHA 4X2WA 1ZLRA 1P2QA 3ATWA 1AUTC 1WBGB 1J16A 2QV1A 2CF8H 3M3TA 1HAZB 2GZ8A 1Q3XA 4U30A 1GI2A 1EAXA 2B9LA 1C4V2 3ZVCA 1SKYE 2FS9A 1H9LB 4UFGH 3PV2A 4OGXA 2P8OB 3MH6A 2HLCA 2JH6D 2XBVA 3N7EA 3RXFA 2BY7X 2D8WA 1DPOA 2TPIZ 4M7GA 3KF2A 3BIVH 2XW9A 2Z7FE 2AH4X 1LVYA 3FOAA 4DOQA 2JETC 5EXNA 3UWIA 2NWNA 1EATA 2ZGJA 1AN1E 3P6ZB 3ESTA 4GCHG 4Q2KA 1GHXH 1S0RA 2QA9E 2YOLA 3RXHA 1O5BB 2PFEA 2WPJS 3OFND 2ZI2H 3A89A 2O9QA 3LGVA 2CV3A 3K6ZA 5JDUB 1LQEA 1S6LA 2GMTC 2HNTF 3T2NA 4ACBA 3KEEA 3KGPA 3NUMA 1BB0B 1QL7A 4CR9A 1O3BA 2Q6GA 4X1PU 2A4GA 3M35A 3GDSA 3FVFB 4THNH 5C0TA 1BHXF 2RG3A 1GHZA 3KN2A 5F8ZA 3UREA 1GDQA 2VINA 3V12A 3EDXB 1WQVH 1GBKA 1ZTKA 2Z3DA 3NCLA 1RGQA 1DWCH 5E2PA 2WZQA 4NIVA 1ESAA 2BDCA 3RXQA 1TX7A 4H6TA 1AWHB 4FXGH 4IMZA 4ZKNU 1JRSA 2H6MA 2F83A 1P09A 2ZDKA 1BQYA 2OUAA 1ARCA 1O2QA 1GHAG 1O3EA 3TJUA 3OY5U 4ABGA 3RXLA 1MTWA 3NKKA 3ELAH 2O8TA 3K9XB 3M5LA 1EASA 3FAOA 1DDJA 5L2YH 1BTZA 2ZO3H 3KL6A 4X2YA 1P57B 1WDIA 2ZG0H 3UAIC 5LGOA 2BY8X 3RXUA 1KDQA 2J9NA 1QBVH 1XUIA 4FUBA 3TITA 5K0HA 2BVSH 2Z3CA 2FPZA 2FI5E 2XXLA 3ZZ5A 1EPTA 2W7SA 1HUTH 4AFZA 2BZ6H 2BDHA 2IJOB 3TH3H 5A8YA 3RXGA 1GI3A 1TMBH 4Y7AA 3F2HA 4DY7B 4UONA 3MNSA 1NU7B 1VGCB 4ZUHA 4Z1MD 2HVXA 3U28C 2LNCA 4YESB 4BTTB 4RSPA 1LKBA 1O2NA 1F0UA 1Z71A 2XC0A 2KR7A 2R0LA 3V13A 4AORA 1W7XH 2FEQH 4K3JA 1ZHPA 2J95A 1O5GH 1ZHRA 2ZDMA 3FO8D 1E36B 2Z9IA 1SGQE 2QCYA 2BB4A 4JCNA 1NBME 3Q00A 3P8GA 1TNLA 5C20A 2SGQE 1MQ5A 4A1TA 4BAOB 1AZ8A 2BDYA 1Y8TA 1G2LA 3L33A 4P00A 1ZJKA 1SFIA 5KGOA 1HFDA 1HRTH 5FPYA 1A4WH 5C1UA 5IK2D 1C9TA 4CBNA 1YPMH 2XCFA 3VB5A 3SJOA 1HGTH 4ISIH 3QZRA 3URDA 4F4OC 1ZTLA 1WAYB 5DP5A 1GMCG 4O9VA 1UTMA 3UUZA 4Z6AH 3WW7A 1O2UA 1LVOA 3A8CA 1MD7A 4AYVB 1E34B 3TIUA 1C2HA 1DFPA 1BMAA 1QB1A 2BHGA 2HPQH 1TLDA 3A84A 1WUNH 1Y3WA 1MQ6A 1GJ7B 1E35B 1GI7B 2C8WB 5EJZA 1CGIE 1L1NA 3SI4H 3LGWA 1VCQA 1UHBB 4WMDA 1QJ6B 3Q3XA 2Y82A 1YLCA 1O3GA 2HPPH 2OD3B 3ZVGA 1IQGA 4Q7ZA 3T5FH 1GGDC 3OAAD 3UB0A 1MBMA 2W5EA 3O8DA 1QJ1B 3U8RH 5JBCS 1O39A 3CP7A 2ZEBA 4Q7YA 5DPAA 1V2PT 1ZZZA 3VG8A 1YGCH 1C2MA 2ZFSA 4INKA 3GY8A 4UFEH 1BTHH 1EZQA 1O3HA 1NU9A 4DIHH 2YNBA 1NRSH 4YLUA 4NIXA 1RTLA 5GDSH 1CA0C 1ZMLA 3S7KB 2BTCE 4CRAA 1SLWB 1BBRH 1ELGA 4ESTE 1F0TA 1W0ZU 4GAWA 3RXRA 1N6XA 4XFQA 3HK6B 1D4PB 2BX3A 3M37A 3HK3B 5FPSA 1O2PA 2PLXA 4XOJA 2KCPA 2M5TA 4FVDA 4X0WU 1GHBF 5GNDA 3OE7D 1YPHE 2KCOA 2FLRH 4Y8YA 1HXEH 3SU3A 1BMLA 1BTYA 2JETB 3MO9A 1KY9A 2J94A 1P01A 4X8TH 3GOVB 2GTBA 4INHA 3ZVEA 3I78A 1TBZH 1TGCA 1QBNA 1UCYH 2ZF0H 1GBBA 4X6MA 1HB0B 4O3TA 1AE5A 2EA3A 1YPKH 2GMTB 3ZVAA 3ZZ3A 4CH8B 1FX0B 1GHVH 2NU0E 2THFB 4ISOA 1C5XB 2Y81A 2Z94A 3E1XB 1AHTH 4WXIA 1EAWA 2VBCA 3RMLH 3DHKH 1EZXC 4OS7A 3GY5A 3AW1A 2Y5HA 1OWKA 4MNYA 2GJGA 8GCHF 2P3TB 2FTLE 3B9FH 3K6YA 2ANYA 3MO6A 2GGVB 3ZZBA 2BQWB 3WWFA 1VITF 2WV4A 1GWAA 4O97A 5T6GA 2C3SA 1YPHC 3GISB 4AGJA 3EYDA 4D7GA 3M61U 5E8EH 2VIPA 1PPHE 2WUBA 2VVUA 1TONA 3EA7A 3E0NB 1GVZA 1C5SA 1GCTC 1LHGH 3SJKA 1TRNA 2Y6TA 3M7UA 1QQUA 1UTQA 3RXAA 3SU5A 3PMJA 3UY9A 2H1UA 5PTPA 2SGEE 1GG6C 2ALPA 4H42U 1H9IE 1SSXA 1ANDA 5EW2H 1UTJA 4MPVA 1K1LA 2A1DB 1O3KA 3P8FA 3QTVH 1ANCA 1LKAA 2LPRA 1YY3A 2F9VA 1BTXA 1ESTA 3H7TA 2VWMA 4GHTA 5T6FA 3VEQB 1NZQH 3RM0H 1SC8U 1YPLH 3BIUH 5EJLA 2CN0H 2JIZD 1GJ6A 1XVMA 2W3IA 1E0FD 1EPTC 1TBRH 5AF9H 2VIWA 4I32A 1K1JA 1N8OC 3STJA 1GDNA 3S0NA 4Y8XA 1PPFE 2AIPA 2BD9A 4MQAA 2J5UA 5FBIA 3VXFH 1DANH 1D3QB 2HVYB 1D3TB 4YO9A 4E7NA 1DLKB 3MMGA 1UCYE 2KAIB 4U32A 2O8WA 1ZSLA 1PPCE 3RUOA 1A61H 2A4OA 4KKDA 2WPIS 1IQHA 1T4UH 4SGAE 1SGIB 3WY8A 4TPYA 1O0DH 2CJIA 1NO9H 2P16A 3LH1A 3WWBA 1AD8H 4D76A 1ABJH 1ZPCA 2BDIA 3DFJA 1TX8A 4B6FA 3PRDA 5KEDA 3E3TA 4RI0A 3QTOH 3AASA 1FY1A 4CH2B 3QLPH 2XBXA 1T32A 1DUEA 3RM2H 1ELCA 2PTNA 5DP8A 5LPFA 1YC0A 1QHRB 1O37A 1FLEE 1A46H 3SNEA 5SGAE 3ZZ4A 1MABB 1P2OA 2JKHA 1L2EA 4K1TA 1VZQH 1GJ9B 5HIYA 2ZIQH 2F9BH 1C5YB 3ODFA 3W1EA 1GI1A 3M5OA 1ZYOA 1J15A 1O2OA 1YPEH 4FOUC 3M36A 5DSFA 1W13U 1NTPA 1TMTH 2EY4C 4OS2A 5CE1A 3FP6E 5EGMA 2ZU2A 3TJNA 4NSYA 1FIZA 2XC4A 1C1TA 4MNVA 1GGDB 1OYTH 1P06A 4XBBA 1Y3YA 5F8XA 2FX4A 1AVXA 2RDLA 2ZC9H 5FAHA 2ZPRA 4X8SH 4Y79A 1EOLA 1SGFA 1TPAE 2ZFPH 3LONA 1AGJA 1SLXB 1TNHA 2TIOA 1GPZA 1ACBE 3RMMH 2G51A 1CA0B 3GY7A 2ZGBH 1A7SA 2H5CA 1O31A 2G5NA 4MPUA 1V6DA 3UR6A 1O3FA 2Q1JA 2PKAB 2BD3A 5FX5A 4UFDH 3TJOA 1SGCA 1TPPA 4ABHA 5C67A 1C5ZB 1BTWA 4KP0A 5C3NA 4IN2A 4TWYA 1VCPA 1XVOA 2EI7A 1KLTA 2AERH 2TGTA 1UVSH 2ZTZA 1LQDB 2HLDD 4E05H 2ZHFH 3KNXA 3BTTE 1K2I1 2ODPA 4JZIA 3SNAA 1XUFA 2F9NA 3SHAH 5LPRA 1IQMA 1O2MA 4YT7H 1G3DA 2Z6BD 6GCHG 2F3CE 4I86A 5T6DA 4YOJA 2JH0D 1GDUA 1CT0E 1GMHF 1C5PA 2AIQA 4YTAA 1RFNA 2OTVA 1O3IA 3ZZAA 2UUJB 1G3CA 2ZGHA 1ETSH 2C4FH 3MYWA 2PR3A 3CNRA 4ZCNA 1O5FH 1O3MA 5AFYH 1QNJA 3LC3A 1K1OA 3URCA 2XWAA 2ZA5A 2Z9LA 4UFFH 1C2GA 2CK3D 1OYQA 3W95A 1YYY1 3GICB 3KQBA 1UMAH 1ELFA 5IDKA 2BXTH 1T8OA 2UWPA 7ESTE 1PPGE 1LPGB 3PRBA 3ODDA 1BRCE 3SGQE 1GMDG 4IC6A 2H5DA 2SFAA 1LHCH 3FZDA 3RXDA 2GV6A 3LJOA 3P8NA 1GCTB 1QQ4A 1H1BA 3ZZCA 1FY8E 2GCHF 1SGYE 5HM2A 4A1VA 2ESTE 1GG6B 1TNIA 2QYIA 1BITA 2VNTA 4FUCA 3D62A 1V2RT 2R3YA 3S69A 2WPHS 1IOEA 4RKOB 1KSNA 4ACAA 2HOBA 1O3CA 1F5KU 3NRLA 3VB4A 2JDID 3DFLA 3TNTA 2F91A 2A32A 3T26A 1KDQB 1QRWA 1YP9A 1JMOH 3KQ5A 3VFEA 1TA2A 1OWDA 2FMJA 2GCTB 3UNRA 1G3BA 2EI6A 1EPTB 4XE4A 2ZQ2A 1V2WT 4FU7A 1TNJA 1N8OB 2WPKS 2FESH 3A8BA 1ELBA 6GCHF 1QB9A 2RA3A 2VIQA 3QUMP 1ZRKA 3P92A 5A0AE 3MHWU 1LHDH 3SGAE 2F4LA 1V2LT 1DLEA 2P3UB 3LIWA 2F43B 1T8NA 2ASUB 2G55A 1FPCH 4CREA 1MZDA 1FQ3A 3A80A 4CRFA 2C8ZB 3A81A 5EXMA 2FTMA 1WQSA 1C4U2 5ESTE 1ZGVA 1H8DH 3PLPA 1K1NA 4AN7A 4X2XA 2WHXA 5T1VA 2BX4A 1FAXA 5C0UA 1BJVA 3GCNA 1BRBE 4D7FA 3D49H 4E7RG 1HPGA 1HLTH 3MFJA 1GMDF 1O2KA 3GCHC 4O03A 1S81A 1LVMA 1QA7A 4LZ4B 2WUCA 2HNTE 4XD7D 1IQNA 1BMMH 3A87A 3UTUH 4NG9H 6CHAC 4F55A 4K5ZA 3PTNA 1O3DA 2L74A 3SNCA 3EA8A 3GY6A 5GCHF 6LPRA 1XMNB 5FHTA 1RTFB 2J38A 2KM0A 1JWTA 2FOHA 2FZZA 4QT8C 1IAUA 1QTFA 3RXPA 1NN6A 3RDZA 1SR5C 2ZFFH 4AG2A 1MKWK 1T7CA 3A88A 4Q63A 4XBDA 4AB8A 1SHHB 4JK6A 3PB1E 5HKKD 1HAXB 5FCRA 1ARBA 2XC5A 3U98H 1HAGE 2BVXH 5T3HA 1C2IA 4HFPB 1YPGH 2B5TB 4NWKA 1D3PB 1FN6A 2DE9A 3CS7A 4WXVA 1O33A 1HAYB 2A5KA 2RA0A 5H4IB 5JYIA 1EFRD 4CBOA 2VIOA 4MVNA 4TY7A 1E38B 2HNTC 3TGJE 1TA6A 2EC9H 2VGCC 1EP5A 3TNSA 3O8RA 4XBCA 1WSSH 2C8YB 3MU4A 3VB6A 3Q3YA 1C5RA 1GI9B 1XUHA 1GBTA 2NU3E 5EPNA 1CHOF 1MTVA 1Z7KA 1TBQH 3LDXH 1ANEA 2EQNA 2W6ID 1E79D 3EE7A 4Y0ZE 3BTKE 4DG4A 2ZZUH 1GI8B 3SV7A 4DT7B 4Y71A 4FUGA 4TSFD 1F5RA 2I6QA 2GZ9A 1O30A 1UK2A 2P59A 1V2MT 4Z0KA 2K1QA 2TGDA 4Q7XA 1P2NA 1GBDA 3KHVA 3SORA 3SJ9A 3F0PA 2ZGCA 2ZWLH 4HZHA 1P2JA 1KIGH 3HPTB 1Y5AT 3QZQA 4OM9A 3PMHB 5JPMH 2BD8A 2FI4E 5HIZA 2ZPSA 1UK4A 3VXEH 1SQAA 2ZQ1A 1NFUA 1VJAU 1MBQA 1D6WA 1DWEH 3ZVFA 5EODA 1KYNA 1FDPA 5DJ7A 1XUGA 4ABIA 4GPGA 3RMNH 1HDTH 2OCVB 1C5MD 1AO5A 3IWMA 3JZ2B 4X8UH 4DVAU 3UFAA 1GJDB 1A0JA 3PLKA 4WMEA 1FZZA 1O2VA 1ZTJA 3FZZA 1AQ7A 4I7YH 1B5GH 2QN5T 4KTCA 4CRGA 3DSOA 1ZOMA 2UUYA 1KLIH 2M2AA 2KFWA 4BAHB 1GVKB 1VITH 3ZZ6A 5CDFE 2O8LA 4DURA 4ZXXH 1DY8A 3UIRA 5FCKA 4I8LA 2GT8A 2UWOA 2FP7B 3SU4A 2AS9A 1TNGA 2GV7A 4X6NA 2WV5A 2OP9A 1GHBG 1UTLM 4ASUD 2ZGXH 1J9CH 3T62A 1DWBH 1WCZA 3F6UH 1AU8A 2CXVA 1MZAA 1PPBH 1ZPBA 4ABJA 1RS0A 3BTHE 4B2BA 3E0PB 1Z8GA 2UUFB 1G3EA 1S82A 5TCAA 3MH4A 1PQ5A 3SGBE 1BTUA 5EQRA 1FV9A 1FPHH 1DS2E 1P04A 4FETA 4VGCC 1G36A 4ZHMU 1MMJN 4NZLA 2FOFA 2ZFTA 3H09A 2QF0A 2W6JD 5JBAS 2QF3A 2WYJA 4MPWA 5AHGH 1K1PA 1S0QA 3QN7A 1W0JD 3OEED 3DCLA 1H8ED 3SNDA 1C1SA 3OU0A 1P8VC 2BVRH 4UE7H 8GCHG 3RLYH 1GJBB 1SOTA 2STBE 4Q80A 1QRXA 4DJZB 1MTUA 3NXPA 2C93B 1VITG 4CHAC 1YKTA 1O3AA 3TLOA 1TE0A 5FX6A 1NRNH 3LH3A 5GXPA 3GCHB 1ZHMA 2VB0A 4A1XA 2YMSC 7LPRA 1VKYA 2KCYA 2C8XB 3SUDA 1V2KT 1K1IA 1A3EH 6CHAB 2A7CA 4YOIA 1YCPK 4A5TS 1C5LH 2WYGA 4TPIZ 1M9UA 1ORFA 1XKAC 5B6LA 1P03A 5HYOA 3KYGA 2H2ZA 4I8GA 3KIDU 5FPTA 4FUJA 2GT7A 2TGAA 2PTCE 1HJ9A 1NRPH 2R2WU 3T25A 3V7TA 4YM9A 4JZDH 1TB6H 3A7VA 4FUFA 3ZV9A 1DSTA 1NY22 2AMPA 3SUFA 1FUJA 1ZR0A 3RXIA 1A5GH 2JH5D 1ESBA 1SLVB 2BDBA 3RXJA 3P95A 3LPRA 1K22H 1OWEA 1AY6H 1NPMA 1TAWA 1FN8A 1YBWA 3GY3A 1DOJA 2J98B 4B71A 1NFXA 1OS8A 1C5OH 1F2SE 2ANKH 3EE0B 4H6SB 5JBTA 1UW7A 1PPEE 2V7QD 3F3BA 5B6OA 3SUEA 1W3CA 1HYLA 2VGCB 4K8YA 4AYYB 1C1QA 4I31A 1PQ8A 4H4FA 3DD2H 2BDAA 4JYUH 2AYWA 1KLJH 4WWYA 1Z8RA 3I29A 4JYVH 1GBAA 5DK1A 1G37A 4WY3A 1MH0A 3Q3KA 2ZU1A 1J17T 1EJAA 2K0QA 4HG6A 2PV9B 1L1GA 1AVWA 1L1JA 4ISHH 3BTFE 1DXWA 3HKJB 3S9BA 2QAAA 1O5EH 2G81E 2A5AA 1C5UA 3BG8A 2PHBA 1HXFH 2ANMH 3TPIZ 1C1MA 1TMUH 4NA8A 2GZ7A 2TRMA 1GBJA 1ZJDA 1THRH 1GJ4H 4FUHA 1KXDA 2FOEA 1YLDA 2W3KA 2BY6X 1MD8A 2G00A 3GYMA 1SBWA 1A5IA 4LZ1H 2FWWA 4ZAEA 4B73A 1O3JA 1BRUP 1F5LA 2V3MA 5AFZH 1DY9A 2G8TA 2OINA 3LGTA 5DGJA 1GI5A 3BTGE 4Y0YE 1BBRE 4B76A 1ELAA 1IQKA 2AGIX 2CGAA 5GJ4B 3FN8A 1T8LA 1Z6EA 3SU2A 1KXEA 3MNXA 4PROA 1QY6A 3RC6A 1Y5UT 2ZU4A 2GCTC 3PROA 2Q6FA 2QIQA 1WTHD 3UOPA 4X8VH 3CS0A 3SBKA 1W8BH 5JB9S 5DO4H 2A7HA 3ZIAD 2QF4A 1V2UT 1UVTH 1EQ9A 1GI0A 2EEKA 3OX7U 4NCYA 2OC0A 3L6PA 1TYNA 3MU8A 4ZXYH 3ZZ9A 4WH6A 1TQ7B 2FYQA 1P9SA 3F0OA 1Z1JA 4AOQA 1Y3UA 2FODA 5EOKA 3Q76A 5TJXA 1JBUH 4J1YA 1JIMA 3MH7A 3P8OA 1UTOA 2VWLA 3SU0A 3RU4D 1GVLA 4AFSA 1OWIA 2Z9GA 3QGNB 5L2ZH 1Y5BT 1HAVA 1SMFE 1GBMA 4VGCB 2ULLA 4ABBA 1G9IE 1QURH 2FLBH 4I8HA 1GMHG 1BA8B 2CHAB 3FKSD 3PV4A 1LCYA 2R9PA 1TPSA 3GCTF 2ZPQA 2ZHDA 2BLWA 4K1EA 4UEHH 2Z9KA 5C2ZA 3SU1A 1CSOE 2CF9H 3RXEA 4WJG2 1B0EA 1DX5M 1QJ7B 2BOKA 3GY4A 1NESE 3EAJA 2FO9A 3MNCA 4WVPE 1K21H 1AKSA 1NROH 2FOGA 3RXCA 4CHAB 1UTPA 3BN9A 4B2AA 8ESTE 1SGEE 1EKBB 2BD4A 3M5NA 2ANWA 5C94A 1OXGA 1K28D 1Q31A 2BD7A 1GJ5H 1KTTB 4MLFB 2YMSB 2WPDD 3BEIB 3E91A 3R0FA 1YF4A 3PMAB 4JZ1A 4XRNA 3JZ1B 3A82A 4X6PA 5JB8S 4DT4A 1ID5H 3PWBA 1OWJA 3E8LA 2OK5A 3A7WA 2GCHG 1GI6A 1FONA 5GWZA 3BF6H 3RXVA 3UNSA 1F7ZA 2V6NA 3SV9A 1K1MA 1GL1A 2P95A 2FM2A 3NWUA 1S85A 3SW2B 3KCGH 3SOSA 4YOGA 1O2YA 1SOZA 2GDEH 4JMYA 1SQOA 2BLQA 1KXBA 8LPRA 2IPQX 3SQEE 1SG8B 2A7JA 5FXLA 1GBCA 1VR1H 2J4IA 1EX3A 3U69H 2V3OH 3T28A 1MKWH 1IQFA 1UVUH 1W11U 3GCOA 5CHAC 1EZSC 1O2IA 2D2DA 4B2CA 2ZFQH 3LT3A 3U1IB 2BY5X 2Y7XA 4F49A 1WXRA 2A2XH 2BLVA 1HAOH 1HNEE 1SPJA 2PUXB 3UWJH 1AI8H 1EJMA 3V0XA 4UD9H 4BAQB 2KZ4A 3ATMA 3EA9A 4LK4A 1GHYH 3A8DA 3GDVA 2NU1E 1ZRBA 3VB3A 4AFQA 1GBFA 5ABWA 3OY6U 4BAMB 7GCHG 2XBYA 1KXAA 4NWLA 4X1QU 4HTCH 2VH0A 2V0BA 3TU7H 4B74A 4X2VA 3M3VA 2SGFE 3DT0H 3U1JB 1T4VH 2PW8H 5EPYA 2O8UA 1O5AB 3BTEE 1C5NH 2UWLA 4ZROA 3LKWA 4ZKOU 2ZCKP 1C2LA 1UK3A 1P2MA 2OXSA 4A7IB 3TVJB 4RT0A 2VWNA 4NA9H 1V3XA 1K9OE 4KTSA 2Y80A 1P10A 3L3TA 5GCHG 4ISNA 3SQHE 4X1NU 1FNIA 3RXKA 4TYDA 1KXFA 1ANBA 5DP7A 2SGAA 3LGUA 1GHWH 4AC9A 2KAIA 7KMEH 2R0KA 3RXMA 3FFGA 3SV6A 2RFKC 1C2KA 1J14A 4OS4A 4MDSA 3QGJA 2PWXA 1L0ZA 3G01A 2FX6A 1UTNA 3H7OA 1GJ8B 3FP8E 3RC5A 3HKIB 2SGDE 4I8JA 2ODYB 4RN6A 1CA8B 3S7HB 4DCDA 4B75A 2TGPZ 2SNVA 2WPLS 3DUXH 3TH4H 5I46H 4AFUA 1KMHB 4ABDA 5LPEA 3MNBA 2ZTXA 2UUKB 1BIOA 3GY2A 4FU8A 3MU1A 1DUAA 1AFQC 4BAKB 1XXFA 4HGCA 2ZDLA 1VCWA 5I25A 4U2WA 1A3BH 2BLOA 2XNIA 7GCHF 1O2XA 1OOKB 1S5SA 4IC5A 3LC5A 3K65B 1V2VT 4Y7BA 3AK5A 1CHOG 2BQ7B 3QDZB 1O2ZA 2QE7D 3GS9A 3LGIA 3S9CA 1ELEE 1V2NT 2XYAA 1LHFH 3ATLA 3MTYA 1UJ1A 2GKVE 5EU8A 1JOUB 4OGYA 1ELDE 1W14U 5G4BA 1Z8IB 1OKXA 2A45B 3ITIA 4TWWA 3BEFB 1TRMA 3BTQE 2ZHQH 3A7ZA 4ZH8A 2G4UA 1FXYA 2A4RA 1HAPH 4Y8ZA 5HM9A 1SFQB 1TGBA 4RT1A 1J8AA 1TQ0B 5DKMA 4A92A 3IG6B 3STIA 5DN6D 2VH6A 2PKAA 2B7DH 3SJ8A 3OTJE 4WF8A 3C1KA 2W7UA 3MI4A 1O3LA 3VGCC 1YCPM 1WTGH 1KTSB 2FOAA 1HIAA 3LGYA 3OTPA 5EIYA 2ZKSA 2KCAA 4YZUA 3F9EA 1DE7H 5J4SA 1P11E 3PV5A 4IN1A 1UVPA 1BTPA 2OLGA 4K1SA 3ZZDA 1CGHA 2TBSA 4GUXA 2NU2E 1AMHA 1TABE 1YCPH 1ETRH 1AE8H 4B6EA 1SQRA
chains in the Genus database with same CATH topology
1LPKB 2ZDNA 1ELVA 4UDWH 3PMBB 3ZZ7A 1F92A 1MKXK 2ZHEH 3LJJA 4I33A 3TK6A 5CMXH 5A09A 1GL0E 2BDGA 3KQEA 1C1PA 1CT4E 1BZXE 5ESBA 1EJNA 1X7AC 4K69A 1O2JA 4Y10E 1ELTA 1V2JT 5GIBA 2DE8A 3EGKH 3BTDE 1EB2A 1TGSZ 1XX9A 2ZTYA 2O8MA 2J34A 4YT6H 3UR9A 5CHAB 4K8BA 2G4TA 1AZZA 1RD3B 1P0SH 1S83A 2F9PA 1TWXB 3MU5A 9LPRA 2VVVA 1XKBC 3A83A 1Y3VA 3MU0A 2V35A 2H9HA 2V3HH 2BOHB 3RXOA 2PSYA 5L30H 3AVZA 1HJ8A 4IGDA 2VJ1A 1QB6A 5FBEA 3A8AA 4ABAA 5A8ZA 2GP9B 1O5DH 3A7YA 5K7RA 4AX9H 1HJAC 3Q77A 5EQQA 2VIDA 2FDAA 3HATH 1SL3A 3P70B 3QWCH 1LPZB 1PYTC 1O3NA 5C1XA 1O5CB 3M3SA 1QIXB 5E0HA 4Y11E 3E90B 1A5HA 1V2ST 1EAUA 1ZPZA 2BMGB 2PKSC 4WMFA 2FYRA 1O2TA 4NFFA 4A6LA 1TGNA 4ABFA 4D9RA 1PJPA 1W0YH 1MTNC 1IHTH 2FIRH 1BCUH 2PGBB 2QXHA 1T31A 3BSQA 4GCHF 2PSXA 3RXSA 3KQDA 1V2TT 1DICA 1P05A 3F68H 4DIIH 1DM4B 1IQLA 1SB1H 2EI8A 5ETXA 1C5WB 4XDEA 4SGBE 3ATKA 3MOCA 1YM0A 3AW0A 2IN2A 2A2QH 4B1TA 1LHEH 2B0FA 1CU1A 2ZCLP 4JZEH 4YLQH 3T27A 1AIXH 5A0BA 1LDTT 1L4ZA 2P94A 4JK5A 4R8TB 2BZAA 2CHAC 2ZDAH 1UVOA 2CMYA 1CBWC 1CHGA 5HXFA 1TALA 2IPHA 3T29A 3SZNA 3O8CA 1AFQB 1P2KA 4BTIB 2AGEX 1G32B 4NGAH 1GHAF 4BANB 1JIRA 3UPEA 1JXPA 1GI4A 1TRYA 3QK1A 1TOMH 1D9IA 4GHQA 3TGIE 3D65E 2ODQA 2Z3EA 4HI3A 1Z6JH 2NU4E 1C2EA 1ZGIA 4IW4E 2QXIA 1O36A 4K60A 3TK5A 5A2MH 5F6MA 1HAVB 2GD4B 2AEIH 1LVBA 2ZCHP 3I77A 2F9OA 3SNBA 1O2RA 1A0HB 1B0FA 1SGTA 2VU8E 3NPSA 4FUIA 5TCCA 1O2SA 3SV2H 2R2MB 1HCGA 1EXFA 5HMAA 1IQJA 1Q2WA 1WYKA 4XSKU 1HAHH 3SO3A 3RP2A 1EOJA 3D23A 3VGCB 1CGJE 3U8TH 1H9HE 2J92A 2VWOA 3SUGA 1DSUA 3GDUA 3H5CB 3VB7A 2OC7A 2D1JA 1AKSB 1WV7H 4NIYA 1OWHA 1O35A 1BUIA 1EP6A 1MAXA 4KELA 1QA0A 2HALA 2BXUH 1DT2A 1LMWB 2OC1A 1RIWC 1LTOA 1THPB 3SI3H 3MWIU 2XCNA 1CVWH 2FOBA 1O2LA 1Y59T 1ABIH 1YPJH 3NK8A 1SGRE 4GSOA 1GMCF 2FI3E 3SHCH 1C9PA 1XXDA 2W26A 1BHXB 1TOCB 2OQUA 1Z1IA 4ABEA 1BT7A 4BNRA 3VPKA 1GBEA 3PTBA 1SVPA 1B7XB 3KQCA 3ZV8A 3N7OA 1SI5H 2SGPE 2AGGX 1UO6A 1THSH 3BTWE 5HGGA 1AB9C 5E0JA 1EB1H 5EW1H 1RXPA 2ZP0H 4DW2U 1P12E 1G30B 3P17H 3PLBA 4FVBA 1FY3A 1ZSJA 4GLYA 3S9AA 4R0IA 1A1RA 1H8IH 4MG3A 3EQ0H 3M5MA 3F9HA 4CRDA 3GCTG 2XWBI 3RXBA 1SQTA 1MUEB 3B23B 3F9GA 1QRZA 1TIOA 3IITA 1U6QA 4X1RU 4I8KA 3RC4A 4BXWA 4KGAA 1HJAB 3U9AH 1DVAH 3ATIA 3UNQA 1TPOA 1Z8JB 3O8BA 1TNKA 3PO1C 3QX5H 1QR3E 1N1LA 1RJXB 1L4DA 1SGDE 2PKSB 1ZMNA 2ZU5A 1MTNB 1UTKA 2QC2A 1OP0A 1IQIA 4K2YA 2FOMB 4CR5A 4CRCA 3RXTA 2QY0B 4U01A 2HRVA 1GJCB 2Y5GA 4INLA 2FXRA 2Y5FA 5J4QA 1O34A 5F8TA 1OSSA 2H9TH 1QGFA 2GX4A 1RRKA 1GBIA 1UHBA 3GYLB 2VIVA 2WINI 2WPMS 1O38A 1ZSKA 5IYTA 4Y6DA 4OS5A 2ZNKH 3UOUA 5DP9A 2C90B 3C27B 1MCVA 1PPZA 4LXBH 1TX6A 1BOQA 5E0GA 1NM6A 1O3PB 1JRTA 4NIWA 2H9EH 1CBWB 4FUEA 1C5QA 2P3FH 3BG4C 1A2CH 4Y76A 2GVFA 2G5VA 6ESTA 4TY6A 5A8XA 1P3CA 4D8NA 2BY9X 1N6YA 1SHYA 1KXCA 4MNXA 1BBRK 1PFXC 3M7QA 3TJVA 1VJ9U 2ALVA 4IMQA 5JBBS 1HV7A 5GPIB 2DUCA 4BXSA 4D9QA 1NRQH 5EG4A 1NRRH 4DGJA 3AAUA 4KTUA 1NT1A 1S6FA 2IOTA 5A0CA 1C1RA 3QO6A 1FY4A 1QFKH 4IBLH 1F0SA 2P8OC 1D6RA 1BRAA 2PGQB 1SGPE 2ZFRH 2Y7ZA 2BQ6B 3LOXA 3SU6A 3MO3A 2HWLB 2STAE 4ZHAA 1UCYK 1C1VH 1RTKA 3RU4T 3FP7E 2A4QA 3F1SB 4OS6A 1EUFA 3A7XA 2A0QB 1DXPA 2BM2A 3BV9B 3NZIA 1C1NA 2YNAA 4CRBA 1SGNE 2OBOA 3MH5A 4NZQA 5F03A 1E37B 3RU4E 4FUDA 2QGRA 1CT2E 1IQEA 1MAYA 3SV8A 1QL8A 1O32A 4X1SU 4JYTA 1NFWA 3FANA 3ENSB 1AWFH 2Z9JA 1MU6B 1W2KH 3PM3A 2AMQA 2QXGA 1NFYA 1TFXA 1BMNH 1A0LA 5E2OA 1RIWB 3A86A 1C2DA 2A31A 4GVUA 1H4WA 4RKJB 1P9UA 1HIAB 1AVGH 1MU8B 1O2WA 1O2HA 5BRRE 1MCTA 5BPEA 2B8OH 1ETTH 2G52A 1PQAA 4IS5A 4ZMAH 1C1OA 2OQ5A 2ZDVH 3A7TA 2RCEA 3SN8A 4AB9A 1FMGA 2VVCA 1C2FA 2A5IA 1CO7E 2BD2A 3TK9A 3UQVA 1HBTH 1MKXH 2AMDA 3AAVA 2OC8A 1DITH 1AB9B 1S6HA 3ZZ8A 3RMOH 3ZVDA 2HGTH 5AVDA 2F9UA 1QBOA 1SLUB 2PUQH 3TH2H 8KME2 2QXJA 4FU9A 3TGKE 4AGKA 1C4Y2 2BYAX 3E16B 3M7TA 1O2GH 5DP3A 1C2JA 2ILNA 5DG6A 1P2IA 1WOFA 1HAIH 5C5OA 1VGCC 3ZVBA 3ZYDA 1OPHB 3LU9B 3ZYEA 1GCDA 1OX1A 4MTBA 1C1UH 1FIWA 1LO6A 1C1WH 1GBHA 1F0RA 4AG1A 1TGTA 2BD5A 1BJUA 4ZKSU 9ESTA 5EQSA 4BOHA 2I6SA 4NSVA 1P02A 2FS8A 3PO1B 2AFQB 3U8OH 1WU1A 4ASHA 1IHSH 1FY5A 4BTUB 1QL9A 1OP2A 3DA9B 2R3UA 1FJSA 1NC6A 3HGNA 1BDAA 3OYPA 4NFEA 1O3OA 4ZKRU 1XUKA 3HGPA 1W12U 4E06H 1S84A 2XRCA 4NA7A 1T8MA 2SNWA 3W94A 5C5NA 1C5TA 1INCA 3R3GB 1D3DB 1DWDH 3UQOA 2ZHWH 3SJIA 1G2MA 1XUJA 1V2OT 2XBWA 1W7GH 3BTME 4AZ2B 1XM1A 3B8JA 1Y3XA 1CE5A 2P93A 1ZMJA 2D26C 3V3MA 1SGFG 2J2UA 3K2UA 2OBQA 1CQQA 1EZUC 3RLWH 1NS3A 1FAKH 2XTTB 3OSYA 1FI8A 1PQ7A 1W10U 5DP6A 1QCPA 4MNWA 1AFEH 5EXLA 5L6NH 4WH8A 4J2YB 5C1YA 2Q6DA 3A85A 2ZU3A 3CENA 1AUJA 4X6OA 1GJAB 1EAIA 1MTSA 1V2QT 1GBLA 5LH8A 3BG4B 4ISLA 1P3EA 2ZECA 3E6PH 4LOYH 4OS1A 4O3UA 3F9FA 5DP4A 4JZFH 3PWCA 4ZHLU 3BEUA 1OP8A 2FOCA 2GDDA 4MPXA 1C5VA 1PYTD 3PYHA 4X2WA 1ZLRA 1P2QA 3ATWA 1AUTC 1WBGB 1J16A 2QV1A 2CF8H 3M3TA 1HAZB 2GZ8A 1Q3XA 4U30A 1GI2A 1EAXA 2B9LA 1C4V2 3ZVCA 2FS9A 1H9LB 4UFGH 4OGXA 2P8OB 3MH6A 2HLCA 2JH6D 2XBVA 3RXFA 2BY7X 2D8WA 1DPOA 2TPIZ 4M7GA 3KF2A 3BIVH 2XW9A 2Z7FE 2AH4X 1LVYA 4DOQA 2JETC 5EXNA 3UWIA 2NWNA 1EATA 2ZGJA 1AN1E 3P6ZB 3ESTA 4GCHG 4Q2KA 1GHXH 1S0RA 2QA9E 2YOLA 3RXHA 1O5BB 2PFEA 2WPJS 2ZI2H 3A89A 2O9QA 3LGVA 2CV3A 3K6ZA 5JDUB 1LQEA 2GMTC 2HNTF 3T2NA 3KEEA 3KGPA 3NUMA 1BB0B 1QL7A 4CR9A 1O3BA 2Q6GA 4X1PU 2A4GA 3M35A 3GDSA 3FVFB 4THNH 1BHXF 2RG3A 1GHZA 3KN2A 5F8ZA 3UREA 1GDQA 2VINA 3V12A 3EDXB 1WQVH 1GBKA 1ZTKA 2Z3DA 3NCLA 1RGQA 1DWCH 5E2PA 4NIVA 1ESAA 2BDCA 3RXQA 1TX7A 4H6TA 1AWHB 4FXGH 4IMZA 4ZKNU 1JRSA 2H6MA 2F83A 1P09A 2ZDKA 1BQYA 2OUAA 1ARCA 1O2QA 1GHAG 1O3EA 3TJUA 3OY5U 4ABGA 3RXLA 1MTWA 3NKKA 3ELAH 2O8TA 3K9XB 3M5LA 1EASA 3FAOA 1DDJA 5L2YH 1BTZA 2ZO3H 3KL6A 4X2YA 1P57B 2ZG0H 5LGOA 2BY8X 3RXUA 1KDQA 2J9NA 1QBVH 1XUIA 4FUBA 3TITA 5K0HA 2BVSH 2Z3CA 2FPZA 2FI5E 2XXLA 3ZZ5A 1EPTA 2W7SA 1HUTH 4AFZA 2BZ6H 2BDHA 2IJOB 3TH3H 5A8YA 3RXGA 1GI3A 1TMBH 4Y7AA 4DY7B 4UONA 3MNSA 1NU7B 1VGCB 4ZUHA 2HVXA 2LNCA 4YESB 4BTTB 4RSPA 1LKBA 1O2NA 1F0UA 1Z71A 2XC0A 2R0LA 3V13A 4AORA 1W7XH 2FEQH 4K3JA 1ZHPA 2J95A 1O5GH 1ZHRA 2ZDMA 1E36B 2Z9IA 1SGQE 2QCYA 2BB4A 4JCNA 3Q00A 3P8GA 1TNLA 5C20A 2SGQE 1MQ5A 4A1TA 4BAOB 1AZ8A 2BDYA 1Y8TA 1G2LA 3L33A 1ZJKA 1SFIA 5C1UA 1HFDA 1HRTH 5FPYA 1A4WH 1C9TA 4CBNA 1YPMH 2XCFA 3VB5A 3SJOA 1HGTH 4ISIH 3QZRA 3URDA 4F4OC 1ZTLA 1WAYB 5DP5A 1GMCG 4O9VA 1UTMA 3UUZA 4Z6AH 1O2UA 1LVOA 3A8CA 1MD7A 4AYVB 1E34B 3TIUA 1C2HA 1DFPA 1BMAA 1QB1A 2BHGA 2HPQH 1TLDA 3A84A 1WUNH 1Y3WA 1MQ6A 1GJ7B 1E35B 1GI7B 2C8WB 1CGIE 1L1NA 3SI4H 3LGWA 1VCQA 1UHBB 4WMDA 1QJ6B 3Q3XA 2Y82A 1YLCA 1O3GA 2HPPH 2OD3B 3ZVGA 1IQGA 4Q7ZA 3T5FH 1GGDC 1MBMA 2W5EA 3O8DA 1QJ1B 3U8RH 5JBCS 1O39A 3CP7A 2ZEBA 4Q7YA 5DPAA 1V2PT 1ZZZA 1YGCH 1C2MA 2ZFSA 4INKA 3GY8A 4UFEH 1BTHH 1EZQA 1O3HA 1NU9A 4DIHH 2YNBA 1NRSH 4YLUA 4NIXA 1RTLA 5GDSH 1CA0C 1ZMLA 3S7KB 2BTCE 4CRAA 1SLWB 1BBRH 1ELGA 4ESTE 1F0TA 1W0ZU 4GAWA 3RXRA 1N6XA 4XFQA 3HK6B 1D4PB 2BX3A 3M37A 3HK3B 5FPSA 1O2PA 2PLXA 4XOJA 2M5TA 4FVDA 4X0WU 1GHBF 1YPHE 2FLRH 4Y8YA 1HXEH 3SU3A 1BMLA 1BTYA 2JETB 3MO9A 1KY9A 2J94A 1P01A 4X8TH 3GOVB 2GTBA 4INHA 3ZVEA 3I78A 1TBZH 1TGCA 1QBNA 1UCYH 2ZF0H 1GBBA 4X6MA 1HB0B 4O3TA 1AE5A 2EA3A 1YPKH 2GMTB 3ZVAA 3ZZ3A 4CH8B 1GHVH 2NU0E 2THFB 4ISOA 1C5XB 2Y81A 2Z94A 3E1XB 1AHTH 4WXIA 1EAWA 3RMLH 3DHKH 1EZXC 4OS7A 3GY5A 3AW1A 2Y5HA 1OWKA 4MNYA 8GCHF 2P3TB 2FTLE 3B9FH 3K6YA 2ANYA 3MO6A 2GGVB 3ZZBA 2BQWB 1VITF 2WV4A 1GWAA 4O97A 5T6GA 2C3SA 1YPHC 3GISB 4AGJA 3EYDA 4D7GA 3M61U 5E8EH 2VIPA 1PPHE 2WUBA 2VVUA 1TONA 3EA7A 3E0NB 1GVZA 1C5SA 1GCTC 1LHGH 3SJKA 1TRNA 2Y6TA 3M7UA 1QQUA 1UTQA 3RXAA 3SU5A 3PMJA 3UY9A 2H1UA 5PTPA 2SGEE 1GG6C 2ALPA 4H42U 1H9IE 1SSXA 1ANDA 5EW2H 1UTJA 4MPVA 1K1LA 2A1DB 1O3KA 3P8FA 3QTVH 1ANCA 1LKAA 2LPRA 2F9VA 3H7TA 1BTXA 1ESTA 5T6FA 2VWMA 4GHTA 3VEQB 1NZQH 3RM0H 1SC8U 1YPLH 3BIUH 2CN0H 1GJ6A 1XVMA 2W3IA 1E0FD 1EPTC 1TBRH 5AF9H 2VIWA 4I32A 1K1JA 1N8OC 3STJA 1GDNA 3S0NA 4Y8XA 1PPFE 2AIPA 2BD9A 4MQAA 5FBIA 3VXFH 1DANH 1D3QB 1D3TB 4YO9A 4E7NA 1DLKB 3MMGA 1UCYE 2KAIB 4U32A 2O8WA 1ZSLA 1PPCE