1E38B

Porcine pancreatic elastase complexed with (3s, 4s)n-para-nitrobenzenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one soaked in ph 9 buffer for 2 minutes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title 'Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
molecule tags Serine protease
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e38B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e38B01
2AGGX 3QGJA 2VIQA 3RC5A 1C5YB 4ZHMU 3N7OA 1E38B 4TY7A 1P11E 2ZF0H 4K5ZA 2ZWLH 1D6WA 1C5PA 1T31A 2UUKB 3SN8A 2GDDA 2Q6GA 4AB8A 1C5MD 4M7GA 2C93B 1DLKB 3UUZA 3ZVGA 4ZROA 1C5SA 2FMJA 3RMOH 3A86A 1RTLA 1UK4A 3RXUA 2P95A 1O3JA 3LIWA 1VITF 1T32A 4GPGA 1ACBE 1GJDB 1LHEH 1SFIA 4O97A 1NC6A 3QLPH 1C1RA 3LDXH 1TX8A 1Y3XA 2SFAA 3I77A 1M9UA 2FXRA 1FY8E 1QBNA 1YPHC 3SV8A 1UHBB 4A6LA 1ELFA 4K8YA 4BAMB 4AFSA 2ZDMA 1O39A 4OS7A 3A87A 3TITA 1H9IE 5JYIA 1PQ8A 4NWKA 1XXDA 3SUFA 4IBLH 2WV4A 3KCGH 1P2OA 3P70B 5A0AE 3HK6B 1O2NA 2RDLA 3LU9B 3SV2H 4LK4A 2AEIH 3BV9B 1LHFH 2NU0E 1BTWA 1F7ZA 3M36A 3BN9A 2W7UA 1AWHB 1UTKA 4Y79A 4AG2A 2VIDA 3PV4A 2G00A 3TNTA 1DICA 2BDIA 2A2XH 4PROA 4DCDA 2WPKS 1UO6A 2OC1A 4K60A 1J15A 3P8NA 1O3DA 1UVUH 3DHKH 4BOHA 2ZO3H 1LVMA 3A7WA 4WMEA 2AS9A 1BZXE 2HPQH 2AMPA 1VCWA 2D8WA 1MKWH 3MO3A 1D3TB 1MQ5A 3PWBA 1CT4E 2WYGA 1QL8A 1UVTH 2K1QA 2PKAA 3MMGA 1FLEE 1Z8GA 2A5AA 3VXFH 1AE8H 2B5TB 2VWLA 1HBTH 2Q1JA 1Y8TA 4X6PA 3MU1A 1HAPH 5T6GA 3S9AA 4BTTB 4KELA 2GTBA 1W10U 1QCPA 1P2IA 3D65E 3Q76A 1AB9C 1XVMA 3Q3KA 1NRNH 1HYLA 1HAHH 1TBRH 1IQNA 2FI5E 3V0XA 3PLPA 2ZDKA 1IQGA 1WAYB 4RN6A 5PTPA 4MNXA 1ZRBA 5A2MH 2I6QA 4MLFB 1BTUA 2FTLE 3A82A 2JH5D 4AGKA 1CBWB 2P16A 3KN2A 4BAQB 5HYOA 6GCHG 1GHWH 2GP9B 3LGTA 3A7ZA 2TPIZ 1O3HA 2C90B 1UTOA 1EPTA 3ATIA 4X6OA 3ZZBA 3RLYH 3SU5A 4I8LA 1F5KU 1O3NA 2BTCE 1WOFA 4FUCA 2BY5X 1O3MA 3RXDA 1EOJA 4FUGA 3A80A 4INKA 1NZQH 4E7NA 2AGEX 1MKWK 2EC9H 1TBZH 1DITH 1YPLH 4YZUA 4I8HA 4BXSA 4WH6A 1SGRE 1RRKA 2UUFB 1EATA 1TABE 3F1SB 1C4Y2 4GHQA 1NTPA 1TB6H 2Z9GA 3ODDA 2J9NA 3QK1A 4OGYA 4DW2U 2BYAX 1EP6A 2H2ZA 3BTWE 1XVOA 5CE1A 2CV3A 5C67A 1NN6A 1AKSB 5E0GA 1GCDA 1BDAA 2GT8A 1YYY1 3SNDA 3TJVA 3TK6A 5FX5A 3TVJB 4CH8B 1NS3A 4ISLA 1HAVB 5AHGH 3OX7U 4GSOA 4INHA 4AZ2B 1O2OA 3A84A 1GBMA 2ZU5A 3E1XB 2Z7FE 1V2TT 1GI2A 3GYLB 1CA0C 1AGJA 1SOZA 1O3FA 2FOAA 3TNSA 5CMXH 1WTHD 1GBLA 2BVSH 4Q7ZA 2KAIB 4Y0YE 2LNCA 1ID5H 4FUJA 4IC6A 2J38A 2ZC9H 2Y80A 4CBOA 3RXGA 5HXFA 4MPUA 1N8OC 1MQ6A 5CHAB 3A83A 1A61H 1YF4A 1W7XH 3HKJB 3IWMA 4RKOB 1N6XA 5GJ4B 2HNTF 2TRMA 2IJOB 3P6ZB 1HXEH 1K9OE 4A1VA 2HVXA 1AI8H 1O0DH 1G3DA 1GMDF 1O2MA 2FIRH 1YPJH 5EW1H 1TNLA 1GI0A 4AGJA 4YO9A 1PYTC 1O5AB 4FUEA 3TIUA 2BM2A 4HI3A 4D9RA 4WJG2 1ZTKA 2GCTB 1HB0B 3MU8A 1Y3VA 1QQ4A 1O5DH 2Q6DA 3UR9A 2A7JA 1DT2A 1QB1A 2NU3E 5BPEA 4TWWA 4HGCA 1C4V2 2FTMA 1YCPH 2HGTH 1ELBA 1KIGH 1E36B 4Q7YA 1FPHH 5DG6A 1GJBB 1C2GA 4CREA 5DP3A 2F9UA 1P2MA 5JBBS 3ZYDA 4NCYA 3ZV9A 3TK5A 2VVCA 5JB9S 5EPNA 3SGAE 5JBAS 2DE9A 3ZVAA 4D7GA 1TMBH 1ESAA 4ABGA 3MWIU 1HV7A 1NO9H 1AFQB 1V2LT 1YLCA 1IQEA 3UR6A 1C2JA 3I29A 4HTCH 1TFXA 1IQMA 3EE0B 2PSXA 5EGMA 3RXFA 1MCTA 1Y3YA 5IYTA 3D62A 1C1PA 4JK6A 1Z1JA 2UUYA 3F9HA 1Q3XA 3ZVBA 4X0WU 4HZHA 4XDEA 3T5FH 3UNRA 1BTXA 1GHZA 2J2UA 2ZECA 1AHTH 3MNCA 1IQKA 1GMHF 1G3CA 1MD8A 1P2JA 2BLOA 1DUAA 1HIAA 3T25A 4FU9A 1GBFA 2ALPA 1DX5M 1KLIH 1YCPK 4O03A 1HRTH 1GVZA 3RC4A 1LKAA 4WXIA 1PJPA 1SHHB 1NU9A 1ORFA 5FCKA 4ISHH 1A5HA 3AW0A 3D49H 1A0LA 1NY22 4X2XA 3QTVH 2VB0A 2VJ1A 4JZFH 2P8OB 1BRUP 3DA9B 3G01A 2P59A 5EODA 1LPKB 1EB1H 3SU0A 3SZNA 2XBWA 3AAVA 3QZQA 2BDCA 3TJNA 2FLBH 3UNSA 2V3OH 3VEQB 1MBQA 1S5SA 3BTTE 2F3CE 4MPXA 1S6FA 3OY5U 3RXSA 3DD2H 1C9PA 4TWYA 4YLUA 3EDXB 3RM2H 2BD4A 3F6UH 2VIVA 2QY0B 2CF9H 3M7TA 1DVAH 1AWFH 2D26C 2XBVA 3PTNA 3CP7A 4ZKNU 1BA8B 2ANMH 1C5VA 1P3CA 3ITIA 1OS8A 2ZU4A 2FX6A 2ULLA 1ELGA 1DXPA 1P8VC 2CMYA 4J2YB 4JCNA 1G9IE 1K1NA 3MU4A 1GMHG 1PPEE 4Q2KA 1BRBE 1NU7B 1JBUH 5AFYH 5GCHF 2Z6BD 1DY9A 2R0KA 3A8DA 2WPMS 3UNQA 2ZCKP 1BRCE 1P9SA 4OS4A 1V2PT 2OBOA 1P03A 3BF6H 4BTIB 1ABIH 3MH6A 3H5CB 2Y5GA 1LPGB 4X1PU 1FDPA 2R2WU 1GHBF 3L3TA 4IC5A 3KGPA 3ODFA 5ESBA 3U69H 4DG4A 1T4UH 2GZ7A 4U30A 1O35A 2RA3A 1A5GH 3GY8A 1NRRH 1TWXB 4CBNA 1G37A 3NK8A 1CHGA 1O2ZA 1EB2A 1KXCA 5FCRA 1FONA 4X8UH 2Y5FA 1GI6A 3M5LA 3GYMA 2BQ6B 3ZVEA 2WPLS 2A32A 1UHBA 1QRZA 3ATMA 5C5OA 3GY5A 1C1UH 3U8RH 3RMNH 4IMQA 5JBCS 1D4PB 2GVFA 1ZPZA 3ZZ5A 4ABBA 4NGAH 1S81A 2YNAA 3OSYA 5HM9A 1SL3A 3M5NA 1UTNA 1K1MA 1ZTLA 1WCZA 2ZTZA 3GY7A 4CRFA 1GHAF 1C5NH 1BMNH 2BDHA 2FPZA 1GI9B 1LVYA 2ZQ2A 1OKXA 1V2QT 2WUCA 1SGFG 1GDQA 2WINI 3LOXA 5DP5A 3E3TA 1AVWA 4GHTA 1T8LA 2FP7B 4CRBA 2BY6X 2FWWA 3GY6A 2XCFA 1XUKA 1EKBB 3F9EA 1O3KA 2W7SA 1A46H 3ZVFA 3R3GB 2ZHQH 4F49A 1QY6A 2A5KA 2STAE 1MAYA 3A85A 1C5ZB 3UQVA 2I6SA 2XNIA 4LXBH 3U8OH 1O5EH 3DT0H 4YOJA 1NFYA 1GJ6A 1GI7B 3GDSA 1GVKB 1ESBA 1L2EA 1EAWA 1V2OT 2ZQ1A 2FOEA 2QGRA 1FIZA 1VJ9U 1EZQA 3TH4H 1L1GA 1EASA 4UFFH 1OWIA 1O2QA 1FN6A 1AU8A 4D76A 1LKBA 1IAUA 1ZRKA 4X6MA 5E8EH 2ESTE 4Z0KA 6ESTA 3H7TA 2Y82A 1BIOA 2OLGA 1HJ8A 3HATH 2GCHF 3TU7H 2FOHA 1TX7A 1W8BH 1O2KA 4XSKU 1GHAG 3BSQA 4KGAA 3QTOH 2FYQA 3T27A 3SNCA 1VJAU 1VCPA 1TONA 1HDTH 1NROH 4RSPA 1B0FA 1GBKA 3WY8A 1C1QA 4B1TA 1ZSKA 1SBWA 2CF8H 4MQAA 1EJNA 1VCQA 2XBXA 3LPRA 5LPRA 1HAXB 3GDUA 2H5DA 1GPZA 1IQFA 1GBBA 4IN1A 1C5UA 1T8NA 2WYJA 4IS5A 1V2UT 1XX9A 3TK9A 2OC8A 1AKSA 4BAKB 5E0JA 4TY6A 2VWMA 1HJ9A 1E37B 4MNVA 2BX4A 5EU8A 2O8LA 3E8LA 4ISIH 6LPRA 1Z1IA 3BIUH 4FUFA 2EI8A 3QO6A 1SC8U 3ZYEA 1NRQH 3P95A 1ARBA 3VB4A 1GMCF 2GGVB 4YOIA 1MUEB 1C4U2 4LZ1H 1HCGA 2O8UA 2XBYA 2KAIA 2PTNA 5J4SA 3KHVA 5ESTE 4A1TA 4CHAC 4Q80A 1W14U 1AZ8A 1AUJA 3FZDA 1LPZB 2Z9JA 1V2WT 5F03A 4YT7H 1EZXC 1UTLM 4BANB 2W26A 1GJ4H 2ZP0H 4NWLA 2QC2A 5FHTA 4K69A 3EQ0H 1OP8A 1F0SA 5FBIA 1DXWA 1SG8B 2PHBA 1K2I1 1SQOA 2ODPA 1JIMA 2PLXA 3NWUA 2CJIA 1O32A 2Y7XA 4ZUHA 4SGAE 3L33A 3ZV8A 1DS2E 1DWEH 1CO7E 3EYDA 1SGCA 2QN5T 5HGGA 3UPEA 5C20A 2F91A 1O3LA 5DJ7A 3Q3XA 3JZ1B 2ZDNA 2B9LA 1Q2WA 3SU2A 4MVNA 3DFLA 1BMMH 2FOBA 1QQUA 4XOJA 5FBEA 3ZZ6A 4JYVH 2R0LA 2SGAA 1UTQA 7ESTE 1C5QA 4AYYB 2BD5A 1YC0A 1IQIA 5ETXA 3O8RA 1Y3WA 1BCUH 2C8ZB 1MZDA 2G52A 1CHOG 3BTDE 3LGIA 3U9AH 1ANDA 1GMCG 2G51A 2XC5A 2ZPSA 6GCHF 3UFAA 1CA8B 1TPAE 2VVUA 1QBVH 2AYWA 2XTTB 4CRDA 4Y76A 1BRAA 1RIWC 5EXLA 1BOQA 1O38A 2ZCHP 1C5WB 2FZZA 3E90B 2Y7ZA 1VGCC 2G5NA 1A0JA 1DLEA 2JKHA 5AFZH 4B2AA 1BJVA 3EGKH 1LQDB 3VGCC 4YTAA 1F5RA 2HWLB 2XRCA 5GIBA 1N1LA 3FANA 4Y8ZA 1MKXH 1LHCH 4DIHH 1IOEA 4WF8A 3KQCA 1ARCA 4X8TH 5L2ZH 1VGCB 1EAIA 1BJUA 2VH0A 1UK3A 1CT0E 1Z7KA 1S83A 2FO9A 1KTSB 1O3BA 1TGSZ 3SJ8A 3TLOA 1TNIA 2ILNA 3A7YA 1MTWA 4THNH 3HGNA 2SGFE 4Q7XA 2Q6FA 4OS1A 4Y8XA 1OP0A 1C2EA 1TQ0B 1ZMJA 3T29A 2G55A 2R2MB 4GVUA 3STJA 3A89A 2SGPE 1MBMA 1C5OH 1KSNA 4MDSA 5DP4A 2SGDE 1AMHA 3BIVH 3B8JA 1CU1A 2FDAA 1FIWA 3B9FH 1DOJA 1AB9B 3VXEH 4A7IB 1C5TA 2ZHWH 1QNJA 2A5IA 1KXDA 1WQSA 1TGCA 1XM1A 2ZPRA 1EAUA 4U32A 3M7UA 4I8GA 3PMHB 2G4TA 4JYUH 3PMJA 1SI5H 1TMUH 1MKXK 1W2KH 3BG4C 2BQWB 1G3EA 1FY3A 2QXJA 1NM6A 1DWBH 1ZJKA 3SGQE 1HPGA 3SORA 2QXHA 3UQOA 3HK3B 2VIPA 4GAWA 5A0BA 3MU5A 1BMAA 3LONA 1OWKA 2R9PA 3MTYA 1HUTH 1YPKH 2A0QB 2GMTC 1KXAA 1RGQA 2C8XB 4VGCC 4NZLA 5EW2H 1FV9A 1GBJA 1SGYE 1ZHPA 2VINA 3BEFB 3STIA 3I78A 1GGDC 1V6DA 3RXOA 1W13U 2SNVA 1ZR0A 3NPSA 3IG6B 1EAXA 1O2RA 3RXMA 2BD3A 4VGCB 1C2LA 1P01A 4UD9H 4O3TA 2G4UA 1GI4A 5EQRA 1PQ5A 2O8MA 2WPHS 1GI5A 1S84A 1ELCA 3LJJA 3F68H 1ESTA 2XWAA 2ZHDA 3FVFB 5GPIB 5F6MA 4FVBA 1HAGE 1HLTH 3UREA 1FNIA 1KYNA 1VZQH 3O8CA 1S85A 1W0ZU 1GJCB 1THPB 3DFJA 4FUDA 5I25A 1D6RA 2Y81A 4WVPE 2A4QA 1GHVH 1RXPA 3CS0A 2C4FH 1P12E 1OWJA 2BD7A 1TGNA 1K21H 1O2XA 1ZGIA 1SGDE 3E16B 4UFGH 3RU4D 1CA0B 1MTNC 2TGAA 3RXIA 1LCYA 1TRNA 5C2ZA 2BDGA 3ZVDA 4UFDH 5GXPA 1DANH 1OWDA 1N8OB 5FX6A 4ZKRU 3QX5H 4K1SA 2SNWA 2GX4A 4FUBA 3SUEA 4BTUB 1A2CH 1DUEA 3FP7E 1LMWB 3PMAB 3T62A 3V7TA 3T2NA 1SQTA 2V3HH 2FEQH 1J16A 1C1SA 3A8CA 4YLQH 1TNJA 3LKWA 3K2UA 1DFPA 3E6PH 1ZMLA 1SGTA 1TNKA 1AO5A 3S7KB 4I32A 1O3OA 2Z9IA 1L1NA 1C2KA 1V2NT 2ZFFH 4X1RU 1IHTH 1QHRB 3SBKA 3PO1C 4NA7A 4WWYA 2HNTE 2ZNKH 3KQBA 1EOLA 2OD3B 2QCYA 2SGEE 3RU4T 2VH6A 3RXPA 1KXFA 1ELDE 5DP7A 3FZZA 1OOKB 1SQAA 1O3PB 2CHAC 1BBRE 4H42U 4E06H 1YPMH 1ZJDA 2BOHB 2A4RA 3A8AA 4NG9H 4AORA 4JZDH 2ZFRH 2BLVA 3GCTG 5A09A 8KME2 2VIOA 2CHAB 1V2MT 5JPMH 2XYAA 2BVRH 1CGJE 6CHAC 3JZ2B 5K7RA 1FZZA 3LGUA 4MPWA 1QRWA 5L30H 3O8BA 8GCHG 1FAXA 2AERH 3KL6A 4O3UA 4UONA 5A8YA 3RXBA 1B7XB 2BOKA 3W95A 4GCHF 6CHAB 4OGXA 2JETC 2IOTA 2CN0H 1GL0E 3SUDA 3KQEA 1H8IH 2SGQE 1ZYOA 2AGIX 1D3PB 1LHGH 4X1NU 1NPMA 4Y7BA 1C1WH 2JETB 5GWZA 2ZPQA 2AIPA 3LJOA 5EQSA 4R8TB 2PKAB 2ZFPH 1SB1H 1O3AA 1O2PA 2HLCA 4BAHB 1C1VH 1ZHMA 4D7FA 3P8GA 3Q3YA 5F8TA 2C3SA 1RJXB 1YPHE 3A7TA 2P3UB 2BD9A 3TPIZ 2AH4X 4Y10E 2W5EA 4ABFA 4NA8A 3EA7A 3U8TH 1K1OA 1Y3UA 1Y59T 3SV7A 5ABWA 4I8JA 1GCTC 1SGIB 3P17H 3A7VA 1WTGH 1EPTC 3QUMP 1J9CH 4ZAEA 3ZZ3A 3MO6A 3BTHE 4FVDA 1QJ6B 3VB5A 1F0UA 1SGQE 1C5XB 1SMFE 1PQAA 1GBCA 2ALVA 5H4IB 5FXLA 3RMMH 4Y7AA 1PQ7A 1BITA 2QAAA 1OSSA 3SJOA 4GCHG 3SNAA 1SGEE 1O2WA 4IW4E 1OWEA 1JWTA 1GG6C 2WPIS 1O3IA 3CS7A 4DY7B 1AZZA 1X7AC 1O2IA 5L6NH 4LZ4B 5FAHA 2WUBA 3QGNB 4JZEH 3RXKA 2Z3DA 1GBIA 1GDUA 1OWHA 4XBCA 3SJIA 1U6QA 4AN7A 3UWIA 4RKJB 4MTBA 1O3CA 2BY9X 1OPHB 3UWJH 1CGIE 1NRPH 2F9VA 1Y5BT 3GDVA 2GT7A 5FPSA 4TYDA 1AUTC 4AG1A 3S9CA 2CXVA 4Y8YA 4K2YA 5C5NA 4A92A 4OS2A 3LH1A 3UOUA 1E35B 3PM3A 3D23A 3MH4A 1THSH 1P10A 3TGKE 2EEKA 1TE0A 3ZZ8A 1JXPA 1YCPM 4NFFA 3RLWH 5C3NA 3P8OA 4KTUA 3ATWA 3V13A 4CRAA 3HGPA 5GDSH 1INCA 1THRH 2GDEH 1P2NA 2YNBA 5F8ZA 2FYRA 5TJXA 8ESTE 1QFKH 1C1NA 4ISOA 2YOLA 1KY9A 3A7XA 4ABEA 2GD4B 2PSYA 1H9LB 1NFWA 1XUFA 1ZMNA 1O5GH 1A3EH 1OYTH 2A2QH 4ZKSU 1A3BH 1GVLA 9ESTA 4ZKOU 3ZZ9A 3RC6A 1YM0A 2ZTYA 2IPHA 1EZUC 4B73A 2ZHFH 2R3YA 2ZU3A 1W12U 1VITH 3C1KA 5FPYA 4ZHAA 1C9TA 1O5FH 4NIYA 1QJ1B 3FFGA 2NU4E 1TPSA 3SI4H 3NCLA 2BHGA 1C1TA 2A4OA 1TX6A 4JYTA 1P57B 1QL9A 4AFQA 4E7RG 1TQ7B 1XUHA 1WBGB 2Z9KA 1ANBA 2NU2E 1KDQB 2RA0A 1XMNB 4X6NA 1B0EA 1O2VA 2ZFSA 1TLDA 1HGTH 1ZZZA 5IDKA 3CENA 4B2CA 2ZZUH 1V2JT 3VPKA 1O5BB 8LPRA 2H9HA 1S82A 2THFB 5E2OA 1ELAA 1B5GH 2A7CA 4CRGA 4X2VA 2F9NA 1TIOA 3VB6A 1JMOH 4JZ1A 1MH0A 2OINA 1ETTH 2Y6TA 2TBSA 4ZXYH 1FJSA 1KLTA 3NKKA 1RD3B 1A1RA 1TOCB 2OXSA 1O37A 4JZIA 3RUOA 1S6HA 2PGBB 3RMLH 3ZZAA 3K6ZA 3QWCH 5DP8A 3ENSB 4FU8A 3E0NB 4WMDA 5DP6A 5EXNA 5LPEA 1SGFA 1HIAB 2ODYB 2J94A 1BTYA 4NSVA 4MPVA 1MTVA 1TGBA 4UFEH 5EQQA 7GCHF 1JIRA 4F4OC 4AFZA 1JRTA 3AVZA 1GI3A 1ELVA 3P8FA 1EP5A 1F92A 4B75A 2ZDVH 4OS6A 2VGCC 4MG3A 1TMTH 1UVSH 4DVAU 1O2GH 4INLA 4DJZB 2HPPH 3HKIB 1K22H 1TA6A 2H9TH 1QGFA 1NT1A 3UOPA 3ZZ7A 4IMZA 3NXPA 5C1UA 1HAVA 5C1YA 4Z6AH 2HNTC 1EJMA 2PUXB 1EUFA 1UK2A 3FP6E 1CHOF 1MCVA 1HAOH 2OC0A 1PYTD 1TBQH 4IGDA 5DPAA 1GDNA 1BB0B 1ETSH 1T4VH 2FLRH 3BTKE 2BZ6H 1J14A 4BXWA 3RXLA 2ANKH 5HMAA 2FOMB 3SQHE 2AIQA 1UJ1A 1LVOA 4JK5A 1Z8JB 3SU3A 4H4FA 2VIWA 1YPGH 1HFDA 3EA9A 1LVBA 4CHAB 1FPCH 4DGJA 1WSSH 3S0NA 4I33A 3OYPA 3MO9A 1TRMA 7GCHG 1CGHA 1IQLA 4E05H 5L2YH 1G2LA 3M35A 5LGOA 1O2YA 3OU0A 1LTOA 2OQ5A 4DURA 1FY1A 1SHYA 1MD7A 1UCYE 1UMAH 1Z8RA 4XBBA 1V3XA 1ELTA 2F83A 3VB7A 1HNEE 1IQHA 2STBE 1XUGA 1BMLA 4MNYA 2PR3A 2H9EH 3T26A 1F2SE 3GY4A 2QF3A 3TH3H 1PPFE 1SFQB 1AE5A 3LC5A 2DE8A 1A5IA 1P06A 2O9QA 1UTMA 2IN2A 3LGYA 3ZZ4A 2FOFA 1QRXA 5A8ZA 2B8OH 1W11U 1P02A 2FESH 4K8BA 5T6DA 3OY6U 1XKAC 1V2RT 2GV6A 4DOQA 3BTQE 1NESE 3PTBA 2EI7A 1IQJA 1AVGH 2ODQA 4XFQA 4DT7B 3BEIB 3SV6A 1GHXH 2LPRA 1VR1H 1W0YH 3SU6A 2AMDA 4WH8A 1T8OA 1RIWB 1ZPBA 5G4BA 4WY3A 1O2LA 1BBRH 4UDWH 2UWOA 5EXMA 5T3HA 4ABAA 3VGCB 1NFXA 1NRSH 3MNXA 3AASA 4BAOB 4TPYA 3C27B 2OTVA 1P05A 1DE7H 1MAXA 1MMJN 1G32B 1YBWA 2H5CA 4Y0ZE 2VWOA 3RXHA 3ZVCA 2ZKSA 4CH2B 5TCCA 2ZGCA 3MHWU 1K1JA 3MOCA 4I31A 1VITG 4GLYA 2BLWA 4I7YH 1G2MA 1P2QA 1PPHE 1A0HB 3LH3A 2FX4A 2M5TA 1Z8IB 4JMYA 1G36A 3L6PA 1O2TA 2EA3A 1DSUA 3M61U 3RXCA 1O30A 2UWLA 4TPIZ 5A0CA 2C8WB 1O2JA 1FMGA 1DSTA 3BTEE 5TCAA 1SLUB 2GV7A 3P92A 1CBWC 1TNHA 1SR5C 2TIOA 2P93A 4YM9A 4YT6H 1GBTA 5C1XA 1O36A 2G8TA 2H6MA 2BZAA 3KEEA 3O8DA 1BBRK 2XW9A 5A8XA 3RU4E 1QL7A 1TA2A 3LT3A 3W94A 2OCVB 2WV5A 1Y5UT 1O34A 1SLWB 3BG4B 4O9VA 1Z6EA 1XXFA 5DGJA 1QIXB 4KKDA 1ZGVA 1PPZA 3SW2B 2HALA 2BDAA 1O3EA 2GMTB 1QBOA 2W3IA 4K1EA 1QJ7B 2ANYA 1EX3A 2ZU2A 3QN7A 1XKBC 4B71A 1H8DH 2OBQA 2A7HA 3T28A 1CE5A 1GGDB 3M5OA 2ANWA 3OTJE 1V2VT 3PMBB 1C1MA 1O31A 1FAKH 4ABJA 1SSXA 2ZFQH 1CQQA 1FQ3A 4ASHA 2D2DA 1P09A 1P0SH 1ZLRA 3BTME 3LC3A 2ZIQH 2ZHEH 1L1JA 4B2BA 3GCHC 3PLKA 2ASUB 2B7DH 5E0HA 3IITA 1ETRH 2ZFTA 3GCTF 3K65B 2JH6D 1C2FA 3SV9A 1S0QA 4FUHA 2A1DB 5CHAC 1QTFA 1GBAA 3GCHB 3RM0H 1GWAA 1MTNB 2VVVA 2PKSC 3F9FA 2CGAA 8GCHF 1EXFA 2GZ9A 1LQEA 2DUCA 4AB9A 1GJ5H 3RXAA 2XXLA 1V2KT 1S0RA 1MU8B 1AD8H 1GBHA 1H4WA 2PKSB 5JDUB 1HAZB 1E34B 3KF2A 1Q31A 3EAJA 1XUIA 1Z71A 3Q77A 2BB4A 1WU1A 1BHXB 2GCTC 1O2SA 1DWCH 3ZZDA 2PUQH 3K9XB 3QDZB 3SJKA 3SU4A 3U1JB 1H1BA 1ANEA 2G5VA 2Z3EA 2AMQA 2Z3CA 4KTSA 1YGCH 3SQEE 3GCNA 3LGWA 1SVPA 2H1UA 1GJ9B 2NU1E 5JBTA 3AW1A 4XBDA 2O8TA 4WXVA 4Y6DA 1JOUB 1RTFB 4IN2A 2V6NA 3PO1B 1EZSC 3M37A 4NSYA 2Y5HA 1SGPE 2QV1A 2W3KA 4BNRA 2FM2A 1HXFH 3A8BA 2OUAA 1AFQC 1DY8A 1F0TA 1G3BA 4WMFA 5DO4H 4NIVA 2UWPA 3U1IB 1C2HA 3GISB 3RXJA 2C8YB 4QT8C 1F5LA 1KDQA 1GJ8B 3MYWA 1G30B 3PB1E 3MU0A 1TRYA 2ZEBA 3M3SA 5LPFA 3GY3A 5SGAE 4X1QU 3KNXA 1KTTB 1BTHH 1YPEH 1LO6A 4KTCA 3F9GA 1Y5AT 1RFNA 2F9OA 3R0FA 2WPJS 5K0HA 5F8XA 4ZXXH 1DM4B 4SGBE 4X8VH 3FP8E 1ZTJA 3PYHA 3TJUA 1GMDG 1PFXC 4AOQA 1ZSJA 3SOSA 3SUGA 4NIXA 3ATKA 1DPOA 3MFJA 4FUIA 1YLDA 2QYIA 3TGJE 2HOBA 4AYVB 3A81A 4B74A 4KP0A 2VNTA 4D8NA 3TGIE 2J4IA 1BTZA 3BTGE 4ESTE 5LH8A 1TPOA 1MTSA 1SLVB 2P8OC 1DDJA 2ZU1A 5DK1A 4H6TA 2XCNA 3KIDU 1OYQA 2BMGB 3V3MA 1K1PA 1FY5A 3S7HB 2F9BH 2Z9LA 2BY7X 2PWXA 1GJ7B 1BUIA 4B76A 3BEUA 2XC0A 1ELEE 2A31A 5AVDA 1LHDH 1QB6A 2V0BA 1QR3E 3SO3A 3U98H 4UE7H 2FODA 4NIWA 1BQYA 1K28D 2EI6A 1ZPCA 3H7OA 5EPYA 3SU1A 3E91A 1GCTB 1PPBH 1GBEA 1EPTB 1GBDA 3VFEA 5T6FA 1ZSLA 1P04A 4K1TA 1PPGE 2P3FH 4DIIH 4K3JA 1MU6B 2FOGA 1UVPA 5DKMA 1YKTA 2PTCE 3VB3A 1C1OA 1W7GH 2R3UA 3V12A 3MH7A 2XC4A 4I8KA 3NUMA 2UUJB 1L4DA 1QURH 3SNEA 1KXBA 1AN1E 1GG6B 2BQ7B 3B23B 1K1IA 5EOKA 5J4QA 1AY6H 1CT2E 3Q00A 4CR9A 2ZGJA 1C2MA 4ABDA 5I46H 2P94A 1QB9A 1GI1A 1WQVH 2G81E 5B6OA 1J8AA 1MZAA 2NWNA 3PLBA 2FOCA 2TGDA 4CRCA 4CR5A 4NZQA 1GI8B 2QIQA 4NA9H 3MNBA 4MNWA 2PV9B 1SGNE 4ABIA 1D3QB 1GJAB 3BG8A 3ATLA 2ZCLP 1L4ZA 1UTPA 3RXEA 4Y71A 3RDZA 5EG4A 1C2DA 7KMEH 1O3GA 2ZA5A 2AFQB 3RXVA 1GL1A 4FU7A 2QF0A 4YESB 3ZZCA 1HAYB 4ZH8A 2OC7A 2BDBA 1UCYH 3MH5A 4ZMAH 1UVOA 4J1YA 2ZG0H 1BT7A 3SJ9A 3SHAH 4Y11E 2D1JA 3M5MA 1TNGA 2JH0D 2PW8H 1V2ST 2XWBI 3GY2A 1T7CA 1AIXH 1WUNH 2BLQA 1TPPA 1W3CA 2QXGA 2J92A 5JB8S 3PROA 2RCEA 2BD8A 4UEHH 4X2YA 4X1SU 3URDA 1ZHRA 1ANCA 5GCHG 3SHCH 3MNSA 1P3EA 1T8MA 2ZTXA 5HM2A 4U01A 3SNBA 3SGBE 2BY8X 2ZGHA 1FUJA 1FXYA 3M3TA 1ZOMA 1BHXF 2FI3E 1HJAC 2OP9A 4AFUA 1WYKA 2F9PA 1GHBG 3M7QA 1P2KA 4A5TS 4R0IA 2ZDAH 3A88A 1A4WH 4OS5A 4NFEA 1P9UA 1UCYK 3M3VA 3RXRA 1HJAB 2FS9A 2ZDLA 1F0RA 5DP9A 1SLXB 1Z6JH 3ESTA 3RP2A 2O8WA 2HRVA 2J34A 2QXIA 1BTPA 1PPCE 2BD2A 2A45B 3GICB 2VU8E 1H9HE 2BX3A 3UY9A 1CSOE 3MI4A 4ABHA 1TALA 1A7SA 1OX1A 1TYNA 1UTJA 1IHSH 1O2HA 2BDYA 3LGVA 7LPRA 3GOVB 2Z94A 4GUXA 1FN8A 1J17T 1LDTT 3UIRA 3TJOA 4ZHLU 1EJAA 4X8SH 2P3TB 4YOGA 2FI4E 1MTUA 2TGTA 1C5LH 3S69A 3UTUH 3DUXH 3FAOA 1JRSA 1WV7H 1TAWA 3EA8A 1C2IA 3NZIA 2VWNA 2ZGBH 5AF9H 1KXEA 1L0ZA 3URCA 1QA0A 4H6SB 1EQ9A 2RG3A 4HFPB 1RS0A 1AVXA 1CVWH 2ZI2H 3ELAH 4LOYH 2A4GA 2PGQB 3SI3H 3RXQA 1O33A 2BXUH 5FPTA 1DWDH 3K6YA 4A1XA 1E0FD 1TOMH 4D9QA 2ZGXH 1NFUA 2BVXH 2V35A 3BTFE 1O5CB 1KLJH 2GKVE 4ISNA 3S9BA 1O2UA 4U2WA 4FXGH 1TGTA 3KQDA 2VGCB 1GHYH 3E0PB 4XE4A 1SOTA 1D3DB 1RTKA 1D9IA 1FY4A 3GCOA 1FI8A 9LPRA 2QA9E 2FS8A 2B0FA 3HPTB 1YP9A 1SPJA 1C5RA 2GZ8A 1OXGA 3PWCA 1AFEH 2J95A 5E2PA 2TGPZ 2OQUA 1AQ7A 1XUJA 2BXTH 1ABJH 3RXTA 2PFEA 5BRRE 1K1LA 3QZRA 1QA7A 3AAUA 1OP2A 1HAIH 2GCHG 4X2WA 1N6YA 3TH2H 4AX9H
chains in the Genus database with same CATH superfamily
2AGGX 3QGJA 2VIQA 3RC5A 1C5YB 4ZHMU 3N7OA 1E38B 4TY7A 1P11E 2ZF0H 4K5ZA 2ZWLH 1D6WA 1C5PA 1T31A 2UUKB 3SN8A 2GDDA 1NBME 2Q6GA 4AB8A 1C5MD 4M7GA 2C93B 1DLKB 2LP6A 3UUZA 4ZROA 1C5SA 2FMJA 3RMOH 3ZVGA 3A86A 1RTLA 1UK4A 3RXUA 2P95A 1O3JA 3LIWA 1VITF 1T32A 3N7DA 4GPGA 1ACBE 1GJDB 1LHEH 1SFIA 4O97A 1NC6A 5FL7D 3QLPH 1C1RA 3LDXH 1TX8A 1Y3XA 2SFAA 3I77A 1M9UA 2FXRA 1FY8E 1QBNA 1YPHC 3SV8A 1UHBB 4A6LA 1ELFA 4K8YA 4BAMB 4AFSA 2ZDMA 1O39A 4OS7A 3A87A 3TITA 1H9IE 5JYIA 1PQ8A 4NWKA 1XXDA 3SUFA 4IBLH 2WV4A 3KCGH 3F2GA 1P2OA 3P70B 5A0AE 3HK6B 1O2NA 2RDLA 3LU9B 3SV2H 4LK4A 2AEIH 3BV9B 1LHFH 4FETA 2NU0E 1BTWA 1F7ZA 3M36A 3BN9A 2W7UA 1AWHB 1UTKA 4Y79A 4AG2A 2VIDA 3PV4A 2G00A 5DSFA 3TNTA 1DICA 2BDIA 2A2XH 4PROA 4DCDA 2WPKS 1UO6A 2OC1A 4K60A 1J15A 3P8NA 1O3DA 1UVUH 3DHKH 4BOHA 2ZO3H 1W0KD 1LVMA 3A7WA 4WMEA 2AS9A 1BZXE 2HPQH 2AMPA 1VCWA 4I86A 2D8WA 1MKWH 3MO3A 1D3TB 1MQ5A 3PWBA 1CT4E 2WYGA 1QL8A 1UVTH 2K1QA 2PKAA 3MMGA 1FLEE 1Z8GA 2A5AA 3VXFH 1AE8H 2B5TB 2VWLA 1HBTH 2Q1JA 1Y8TA 4X6PA 3MU1A 1HAPH 5T6GA 5GNDA 3S9AA 4BTTB 4KELA 2GTBA 1W10U 1QCPA 1P2IA 3D65E 3Q76A 1AB9C 1XVMA 3Q3KA 1NRNH 1HYLA 3SYJA 1HAHH 1TBRH 1IQNA 2FI5E 3V0XA 3PLPA 2ZDKA 1IQGA 1WAYB 4RN6A 5PTPA 4MNXA 1ZRBA 5A2MH 2I6QA 4MLFB 1BTUA 1W0JD 2FTLE 3A82A 2JH5D 4AGKA 1CBWB 2P16A 3KN2A 4BAQB 5HYOA 6GCHG 1GHWH 1MABB 2GP9B 3LGTA 3A7ZA 2TPIZ 1O3HA 2C90B 1UTOA 1EPTA 3ATIA 4X6OA 3ZZBA 3DSGA 3RLYH 3SU5A 4I8LA 1F5KU 1O3NA 2BTCE 1WOFA 4FUCA 2BY5X 1O3MA 3RXDA 1EOJA 3OE7D 4FUGA 3A80A 4INKA 1NZQH 4E7NA 2AGEX 1MKWK 2EC9H 1TBZH 1DITH 1YPLH 3GS9A 4YZUA 3WW7A 4I8HA 4BXSA 4WH6A 1SGRE 1RRKA 2UUFB 1EATA 1TABE 3F1SB 1C4Y2 4GHQA 1NTPA 1TB6H 2Z9GA 3ODDA 2J9NA 3QK1A 4OGYA 4DW2U 2BYAX 1EP6A 2H2ZA 3BTWE 1XVOA 5CE1A 2CV3A 5C67A 1NN6A 1AKSB 5E0GA 1GCDA 1BDAA 2GT8A 1YYY1 3SNDA 3TJVA 3TK6A 5FX5A 3TVJB 4CH8B 2W6JD 1NS3A 4ISLA 1HAVB 5AHGH 3OX7U 4GSOA 4INHA 4AZ2B 1O2OA 2QF5A 3A84A 1GBMA 2ZU5A 3E1XB 2Z7FE 1V2TT 1GI2A 3GYLB 1CA0C 1AGJA 1SOZA 1O3FA 2FOAA 3TNSA 5CMXH 1H8ED 1GBLA 1WTHD 2BVSH 4Q7ZA 2KAIB 4Y0YE 2LNCA 1ID5H 4FUJA 4IC6A 2J38A 2ZC9H 2Y80A 4CBOA 2JDID 3RXGA 5HXFA 3WWBA 4MPUA 1N8OC 1UW7A 1MQ6A 5CHAB 3A83A 1A61H 1YF4A 1W7XH 3HKJB 3IWMA 4RKOB 1N6XA 5GJ4B 2HNTF 2TRMA 2IJOB 3P6ZB 1HXEH 1K9OE 4A1VA 2HVXA 1AI8H 1O0DH 1G3DA 1GMDF 1O2MA 2J98A 2FIRH 1YPJH 5EW1H 1TNLA 1GI0A 4AGJA 4YO9A 1PYTC 1O5AB 4FUEA 3TIUA 2BM2A 4HI3A 4D9RA 4WJG2 2L74A 5CHBA 1ZTKA 2GCTB 1HB0B 3MU8A 1Y3VA 1QQ4A 1O5DH 2Q6DA 3UR9A 1SQRA 2A7JA 1DT2A 1QB1A 2NU3E 5BPEA 4TWWA 4HGCA 1C4V2 2FTMA 1YCPH 2HGTH 1ELBA 1KIGH 1E36B 2KCOA 4Q7YA 1FPHH 5DG6A 1GJBB 1C2GA 4CREA 5DP3A 2F9UA 1P2MA 5JBBS 3ZYDA 4NCYA 3ZV9A 3TK5A 2VVCA 5JB9S 2K8IA 2L6OA 5EPNA 3SGAE 5JBAS 2DE9A 3ZVAA 4D7GA 1TMBH 1ESAA 4ABGA 3MWIU 1HV7A 1NO9H 1AFQB 1V2LT 1YLCA 1IQEA 3UR6A 4AC9A 1C2JA 3I29A 4HTCH 1TFXA 1IQMA 3EE0B 2PSXA 5EGMA 3RXFA 1MCTA 1Y3YA 5IYTA 3D62A 1C1PA 4JK6A 1Z1JA 2KCAA 4ZCNA 2UUYA 3F9HA 1Q3XA 3ZVBA 4X0WU 4HZHA 4XDEA 3T5FH 3UNRA 1BTXA 1GHZA 2J2UA 2ZECA 1AHTH 3MNCA 1IQKA 1GMHF 1G3CA 1MD8A 1P2JA 2BLOA 1DUAA 1HIAA 3T25A 4FU9A 1GBFA 2ALPA 1DX5M 1KLIH 1YCPK 4O03A 1HRTH 1GVZA 3RC4A 1LKAA 4WXIA 1PJPA 1SHHB 1NU9A 1ORFA 5FCKA 4ISHH 1A5HA 3AW0A 3D49H 2WSSD 1A0LA 1NY22 4X2XA 3QTVH 2VB0A 2VJ1A 4JZFH 2P8OB 1BRUP 3DA9B 3G01A 2P59A 5EODA 1LPKB 1EB1H 3SU0A 3SZNA 2XBWA 3AAVA 3QZQA 2BDCA 3TJNA 2FLBH 3UNSA 2V3OH 3OAAD 3VEQB 1MBQA 1S5SA 3BTTE 2F3CE 4MPXA 1S6FA 3OY5U 3RXSA 3DD2H 1C9PA 5C17A 4TWYA 4YLUA 3EDXB 3RM2H 2BD4A 5IK2D 3F6UH 2VIVA 2QY0B 2CF9H 3M7TA 3H09A 1DVAH 1AWFH 3VG8A 5KECA 2D26C 2XBVA 3PTNA 3CP7A 4ZKNU 1BA8B 2ANMH 1C5VA 1P3CA 3ITIA 1OS8A 2ZU4A 2FX6A 2ULLA 4Q63A 1ELGA 1DXPA 1P8VC 2CMYA 4J2YB 4JCNA 1G9IE 1K1NA 3MU4A 1GMHG 1PPEE 3WWFA 4Q2KA 1BRBE 1NU7B 1JBUH 5AFYH 5GCHF 2Z6BD 1DY9A 2R0KA 3A8DA 4XD7D 2WPMS 3UNQA 2ZCKP 1BRCE 1P9SA 4OS4A 1V2PT 1P03A 2OBOA 3BF6H 4BTIB 1ABIH 3MH6A 4ASUD 3H5CB 3OFND 2Y5GA 1LPGB 4X1PU 1FDPA 2R2WU 1GHBF 3L3TA 4IC5A 2KZ4A 3KGPA 3FN8A 3ODFA 5ESBA 3U69H 4DG4A 1T4UH 2GZ7A 4U30A 1O35A 2RA3A 1A5GH 3GY8A 1NRRH 1TWXB 4CBNA 1G37A 3NK8A 1CHGA 1O2ZA 1EB2A 1WXRA 1KXCA 5FCRA 1FONA 4X8UH 2Y5FA 1K0HA 1GI6A 4Q4LA 3M5LA 3GYMA 2BQ6B 3ZVEA 2WPLS 2A32A 1UHBA 1QRZA 3ATMA 5C5OA 3GY5A 1C1UH 3U8RH 3RMNH 4IMQA 5JBCS 1D4PB 2GVFA 4FOUC 1ZPZA 3ZZ5A 4ABBA 4NGAH 1S81A 2YNAA 3OSYA 5HM9A 1SL3A 3M5NA 1UTNA 1K1MA 1ZTLA 1WCZA 2ZTZA 3GY7A 4CRFA 1GHAF 1C5NH 1BMNH 2BDHA 2FPZA 1GI9B 1LVYA 2ZQ2A 1OKXA 1V2QT 2WUCA 2WPDD 1SGFG 1GDQA 2WINI 3LOXA 5DP5A 3E3TA 1AVWA 4GHTA 1T8LA 2FP7B 4CRBA 2BY6X 2FWWA 3GY6A 2XCFA 1XUKA 1EKBB 3F9EA 1O3KA 2W7SA 1A46H 3F0OA 3ZVFA 3R3GB 2ZHQH 4F49A 1QY6A 2A5KA 2STAE 1MAYA 3A85A 1C5ZB 3UQVA 2I6SA 2XNIA 4LXBH 3U8OH 1O5EH 3DT0H 4YOJA 1NFYA 4RI0A 3W1EA 1GJ6A 1GI7B 3GDSA 1GVKB 1ESBA 1L2EA 1EAWA 1V2OT 2ZQ1A 2FOEA 2QGRA 1FIZA 1VJ9U 1EZQA 3TH4H 1L1GA 4P00A 1EASA 4UFFH 1OWIA 1O2QA 1FN6A 1AU8A 4D76A 1LKBA 1IAUA 1ZRKA 4X6MA 5E8EH 2ESTE 4Z0KA 6ESTA 3H7TA 2Y82A 1BIOA 4M9FA 2OLGA 1HJ8A 3HATH 2CK3D 2GCHF 3TU7H 2FOHA 1TX7A 1W8BH 1O2KA 4XSKU 1GHAG 3BSQA 4KGAA 3DSOA 3QTOH 2F43B 2FYQA 3T27A 3SNCA 1VJAU 1VCPA 1TONA 1HDTH 1NROH 4RSPA 1B0FA 1GBKA 3OEHD 3WY8A 1C1QA 4B1TA 1ZSKA 1SBWA 2CF8H 4MQAA 1EJNA 1VCQA 2XBXA 3LPRA 5LPRA 1HAXB 3GDUA 2H5DA 1GPZA 1IQFA 4B6EA 1GBBA 4IN1A 1C5UA 1T8NA 2WYJA 4IS5A 1V2UT 1XX9A 3TK9A 2OC8A 1AKSA 4BAKB 2YMSC 5E0JA 4TY6A 2VWMA 1HJ9A 1E37B 4MNVA 2BX4A 5EU8A 2O8LA 3E8LA 4ISIH 6LPRA 1Z1IA 3BIUH 4FUFA 2EI8A 3QO6A 1SC8U 3ZYEA 1NRQH 2YMSB 3P95A 1ARBA 3VB4A 1GMCF 2GGVB 4YOIA 1MUEB 1C4U2 4LZ1H 1HCGA 2O8UA 2XBYA 2KAIA 2PTNA 5J4SA 3KHVA 5ESTE 4A1TA 4CHAC 4Q80A 2JIZD 1W14U 1AZ8A 1AUJA 3FZDA 1LPZB 2Z9JA 1V2WT 5F03A 4YT7H 1EZXC 1UTLM 4BANB 2W26A 1GJ4H 2ZP0H 4NWLA 2QC2A 5FHTA 4K69A 3EQ0H 1OP8A 1F0SA 3FKSD 1KMHB 5FBIA 1SG8B 1DXWA 2PHBA 1K2I1 1SQOA 2ODPA 1JIMA 2PLXA 3NWUA 2CJIA 1O32A 2Y7XA 4ZUHA 4SGAE 3L33A 3ZV8A 1DS2E 1DWEH 1CO7E 3EYDA 1SGCA 2QN5T 5HGGA 3UPEA 5C20A 2F91A 1O3LA 5DJ7A 3Q3XA 3JZ1B 2ZDNA 2B9LA 1Q2WA 3SU2A 4MVNA 3DFLA 1BMMH 2FOBA 1QQUA 4XOJA 5FBEA 3N7EA 3ZZ6A 4JYVH 2R0LA 2SGAA 1UTQA 7ESTE 1C5QA 4AYYB 2BD5A 1YC0A 1IQIA 5ETXA 3O8RA 1Y3WA 1BCUH 2C8ZB 1MZDA 2G52A 1CHOG 3BTDE 3LGIA 3U9AH 1ANDA 1GMCG 2G51A 2XC5A 2ZPSA 6GCHF 2OK5A 3UFAA 1CA8B 1TPAE 2VVUA 1QBVH 2AYWA 2XTTB 4CRDA 4Y76A 1BRAA 1RIWC 5EXLA 1BOQA 1O38A 2J5UA 2ZCHP 1C5WB 2FZZA 1EFRD 3E90B 2Y7ZA 1VGCC 2G5NA 1A0JA 1DLEA 2JKHA 5AFZH 4B2AA 1BJVA 2J97A 3EGKH 1LQDB 3VGCC 4YTAA 1F5RA 2HWLB 2XRCA 5GIBA 1N1LA 3FANA 4Y8ZA 1MKXH 1LHCH 5EJ1A 4DIHH 1IOEA 4WF8A 3KQCA 1ARCA 4X8TH 5L2ZH 1VGCB 1EAIA 1BJUA 2VH0A 1UK3A 1CT0E 5HIZA 5EIYA 1Z7KA 1S83A 2FO9A 1KTSB 1O3BA 1TGSZ 4P02A 3SJ8A 3TLOA 1TNIA 2ILNA 3A7YA 1MTWA 3PRBA 4THNH 3HGNA 2SGFE 4Q7XA 2Q6FA 4OS1A 4Y8XA 1OP0A 1C2EA 1E79D 1TQ0B 1ZMJA 3T29A 2G55A 2R2MB 4GVUA 1COWD 3STJA 3A89A 2SGPE 3SZEA 2K0QA 1MBMA 1C5OH 1KSNA 4MDSA 5DP4A 2SGDE 1AMHA 3BIVH 3B8JA 1CU1A 2FDAA 1FIWA 3B9FH 1DOJA 1AB9B 3VXEH 4A7IB 1C5TA 2ZHWH 1QNJA 2A5IA 1KXDA 1WQSA 1TGCA 1XM1A 2AHME 1EAUA 2ZPRA 3M7UA 3OTPA 4U32A 4I8GA 3PMHB 2G4TA 4JYUH 3PMJA 1SI5H 1TMUH 1MKXK 1W2KH 3BG4C 2BQWB 1G3EA 1FY3A 2QXJA 1NM6A 1DWBH 1ZJKA 3SGQE 1HPGA 3SORA 2QXHA 3UQOA 3HK3B 2VIPA 4GAWA 5A0BA 3MU5A 1BMAA 3LONA 1OWKA 2R9PA 3MTYA 1HUTH 1YPKH 2A0QB 2GMTC 1WDIA 1KXAA 1RGQA 2C8XB 4VGCC 4NZLA 5EW2H 1FV9A 1GBJA 1SGYE 1ZHPA 2VINA 3BEFB 3STIA 3I78A 1GGDC 1V6DA 3RXOA 1W13U 2SNVA 1ZR0A 3NPSA 3IG6B 1EAXA 1O2RA 3RXMA 2BD3A 4VGCB 1C2LA 1P01A 2WHXA 4UD9H 4O3TA 2G4UA 1GI4A 4YXWD 5EQRA 1PQ5A 2O8MA 2WPHS 1GI5A 1S84A 1BMFD 2HLDD 1ELCA 3LJJA 3F68H 1ESTA 2XWAA 2ZHDA 2WV9A 3FVFB 5GPIB 5F6MA 4FVBA 1HAGE 1HLTH 3UREA 1FNIA 1KYNA 1VZQH 3O8CA 1S85A 2XOKD 1W0ZU 1GJCB 1THPB 3DFJA 4FUDA 5I25A 1D6RA 2Y81A 4WVPE 2A4QA 1GHVH 1RXPA 3CS0A 2C4FH 1P12E 1OWJA 2BD7A 1TGNA 1K21H 2KX4A 1O2XA 1ZGIA 1SGDE 3E16B 3OEED 4UFGH 3RU4D 1CA0B 1MTNC 2TGAA 3RXIA 1LCYA 1TRNA 5C2ZA 2BDGA 3ZVDA 4UFDH 5GXPA 1DANH 1OWDA 1N8OB 5FX6A 4ZKRU 3QX5H 4K1SA 2SNWA 2GX4A 4FUBA 3SUEA 4BTUB 1A2CH 1DUEA 3FP7E 1LMWB 3PMAB 3T62A 3V7TA 3F3BA 3T2NA 1SQTA 2V3HH 2FEQH 1J16A 1C1SA 3A8CA 4YLQH 1TNJA 3LKWA 3K2UA 1DFPA 3E6PH 1ZMLA 1SGTA 1TNKA 1AO5A 3S7KB 5CDFE 4I32A 1O3OA 2Z9IA 1L1NA 1C2KA 5T1VA 1V2NT 2ZFFH 4X1RU 1IHTH 1QHRB 3SBKA 2W6ID 3PO1C 4NA7A 4WWYA 2HNTE 2ZNKH 3KQBA 1EOLA 5EJLA 2OD3B 2QCYA 2SGEE 3RU4T 2VH6A 3RXPA 1KXFA 1ELDE 5DP7A 3FZZA 1OOKB 1SQAA 1O3PB 2CHAC 1BBRE 4H42U 4E06H 1YPMH 1ZJDA 2BOHB 2A4RA 3A8AA 4NG9H 4AORA 4JZDH 2ZFRH 2BLVA 3GCTG 5A09A 8KME2 2VIOA 2CHAB 1V2MT 5JPMH 2XYAA 2BVRH 1CGJE 6CHAC 2VBCA 3JZ2B 5K7RA 1FZZA 3LGUA 4MPWA 1QRWA 5L30H 3O8BA 8GCHG 1FAXA 2AERH 3KL6A 4O3UA 4UONA 3CNRA 5A8YA 3RXBA 1B7XB 1YLNA 2BOKA 3W95A 4GCHF 6CHAB 4OGXA 2JETC 2IOTA 2CN0H 1GL0E 3SUDA 3PV2A 3KQEA 1H8IH 2SGQE 4F48B 1ZYOA 2AGIX 1D3PB 1LHGH 4X1NU 4Z1MD 1NPMA 4Y7BA 1C1WH 2JETB 5GWZA 2YMSD 2ZPQA 2AIPA 3LJOA 5EQSA 4R8TB 2PKAB 2ZFPH 4HG6A 1SB1H 1O3AA 1O2PA 2HLCA 4BAHB 1C1VH 5EJZA 1ZHMA 4D7FA 3P8GA 3Q3YA 5F8TA 2C3SA 1RJXB 1YPHE 4TSFD 3A7TA 2P3UB 2BD9A 3TPIZ 2AH4X 4Y10E 2W5EA 4ABFA 4NA8A 3EA7A 3U8TH 1K1OA 1Y3UA 1Y59T 3SV7A 5ABWA 2PP6A 4I8JA 1GCTC 1SGIB 3P17H 3A7VA 1WTGH 1EPTC 3QUMP 1J9CH 4ZAEA 3ZZ3A 3MO6A 3BTHE 4FVDA 1QJ6B 3VB5A 1F0UA 1SGQE 1C5XB 1SMFE 1PQAA 1GBCA 2ALVA 5H4IB 5FXLA 4OM9A 3RMMH 4Y7AA 1PQ7A 1BITA 2QAAA 1OSSA 3SJOA 4GCHG 3SNAA 1SGEE 1O2WA 4IW4E 1OWEA 1JWTA 1GG6C 2WPIS 1O3IA 3CS7A 4DY7B 1AZZA 1X7AC 1O2IA 5L6NH 4LZ4B 5FAHA 2WUBA 3QGNB 4JZEH 3RXKA 2Z3DA 1GBIA 1GDUA 1OWHA 4F55A 4XBCA 3SJIA 1U6QA 4AN7A 3UWIA 4RKJB 4MTBA 1O3CA 2BY9X 1OPHB 3UWJH 1CGIE 1NRPH 2F9VA 1Y5BT 3GDVA 2GT7A 5FPSA 4TYDA 4TT3D 1AUTC 4AG1A 3S9CA 2CXVA 1VKYA 4Y8YA 4K2YA 5C5NA 4A92A 4OS2A 3LH1A 3UOUA 1E35B 3PM3A 3D23A 3MH4A 1THSH 1P10A 3TGKE 2EEKA 1TE0A 3ZZ8A 1JXPA 1YCPM 4NFFA 3RLWH 5C3NA 3P8OA 3KQ5A 4KTUA 2KM0A 3PV5A 3ATWA 3V13A 4CRAA 3HGPA 5GDSH 1INCA 1THRH 2GDEH 1P2NA 2YNBA 5F8ZA 2FYRA 5TJXA 8ESTE 1QFKH 1C1NA 4ISOA 2YOLA 1KY9A 3A7XA 4ABEA 2GD4B 2PSYA 2J98B 1H9LB 1NFWA 2KR7A 1XUFA 1ZMNA 1O5GH 1A3EH 1OYTH 2A2QH 4ZKSU 1A3BH 1GVLA 9ESTA 4ZKOU 3ZZ9A 2JJ2D 3RC6A 1YM0A 2ZTYA 2IPHA 1EZUC 4B73A 2ZHFH 2R3YA 3MQKC 2ZU3A 1W12U 1VITH 3C1KA 5FPYA 4ZHAA 2KCPA 1C9TA 1O5FH 4NIYA 1QJ1B 3FFGA 2NU4E 1TPSA 3SI4H 3NCLA 2BHGA 1C1TA 2A4OA 1TX6A 4JYTA 1P57B 1QL9A 3NRLA 4AFQA 4E7RG 1TQ7B 1XUHA 1WBGB 2Z9KA 1ANBA 2NU2E 1KDQB 2RA0A 1XMNB 4X6NA 1B0EA 1O2VA 2ZFSA 1TLDA 1HGTH 1ZZZA 3F0PA 5IDKA 3CENA 4B2CA 2ZZUH 1V2JT 3VPKA 1O5BB 8LPRA 2H9HA 2IJD1 1S82A 2THFB 5E2OA 1ELAA 1B5GH 2A7CA 4CRGA 4X2VA 2F9NA 1TIOA 3VB6A 1JMOH 4JZ1A 1MH0A 2OINA 1ETTH 2Y6TA 2TBSA 4ZXYH 1FJSA 1KLTA 3NKKA 1RD3B 1A1RA 1TOCB 2OXSA 1O37A 4JZIA 3RUOA 1S6HA 2PGBB 3RMLH 3ZZAA 3K6ZA 3QWCH 5DP8A 3ENSB 4FU8A 3E0NB 4WMDA 5DP6A 5EXNA 5LPEA 1SGFA 1HIAB 2ODYB 2J94A 1BTYA 4NSVA 4MPVA 1MTVA 1TGBA 4UFEH 5EQQA 5F53A 1H8HD 7GCHF 1JIRA 4F4OC 4AFZA 1JRTA 3AVZA 1GI3A 1ELVA 3P8FA 1EP5A 1F92A 4B75A 2ZDVH 4OS6A 2VGCC 4MG3A 1TMTH 1UVSH 4DVAU 1O2GH 4INLA 4DJZB 2HPPH 3HKIB 1K22H 1TA6A 2H9TH 1QGFA 1NT1A 3UOPA 3ZZ7A 3U28C 4IMZA 3NXPA 5C1UA 1HAVA 5C1YA 4Z6AH 2HNTC 1EJMA 2PUXB 1EUFA 2QE7D 1UK2A 3FP6E 1CHOF 1MCVA 1HAOH 2OC0A 1PYTD 1TBQH 4IGDA 5DPAA 1GDNA 1BB0B 1ETSH 1T4VH 2FLRH 3BTKE 2BZ6H 1J14A 4BXWA 3RXLA 2ANKH 5HMAA 2FOMB 3SQHE 2AIQA 1UJ1A 1LVOA 4JK5A 1Z8JB 3SU3A 4ACBA 4H4FA 2VIWA 1FX0B 1YPGH 1HFDA 3EA9A 1LVBA 4CHAB 1FPCH 4DGJA 1WSSH 3S0NA 4I33A 3OYPA 3MO9A 1TRMA 7GCHG 1CGHA 1IQLA 4E05H 5L2YH 1G2LA 3M35A 5LGOA 1O2YA 3OU0A 5HKKD 1LTOA 2OQ5A 4DURA 1FY1A 1SHYA 1MD7A 1UCYE 1UMAH 5KGOA 1Z8RA 4XBBA 1V3XA 1ELTA 2F83A 3VB7A 1HNEE 5C0UA 1IQHA 2STBE 1XUGA 1BMLA 4MNYA 1E1RD 2PR3A 2H9EH 3T26A 1F2SE 3GY4A 2QF3A 3TH3H 1PPFE 1SFQB 1AE5A 2QF4A 3LC5A 2DE8A 1A5IA 1P06A 3ZIAD 2M2AA 2O9QA 1UTMA 2IN2A 3LGYA 3ZZ4A 2FOFA 1QRXA 5A8ZA 2B8OH 1W11U 1P02A 2FESH 4K8BA 5T6DA 3OY6U 1XKAC 1V2RT 2GV6A 4DOQA 3BTQE 1NESE 3PTBA 2EI7A 1IQJA 1AVGH 2ODQA 4XFQA 4DT7B 3BEIB 3SV6A 1GHXH 2LPRA 1VR1H 1W0YH 3SU6A 2AMDA 1NBMD 4WH8A 1T8OA 1RIWB 1ZPBA 5G4BA 4WY3A 1O2LA 1BBRH 4UDWH 2UWOA 5EXMA 5T3HA 4ABAA 3VGCB 1NFXA 1NRSH 3MNXA 3AASA 4BAOB 4TPYA 3C27B 2OTVA 1P05A 5C0TA 1DE7H 1MAXA 1MMJN 1G32B 1YBWA 2H5CA 4Y0ZE 2VWOA 3RXHA 3ZVCA 2ZKSA 4CH2B 5TCCA 2ZGCA 3MHWU 1K1JA 3MOCA 4I31A 1VITG 4GLYA 2BLWA 4I7YH 1G2MA 1S6LA 2IPQX 1P2QA 1PPHE 1A0HB 3LH3A 2FX4A 2M5TA 1Z8IB 4JMYA 1G36A 3L6PA 1O2TA 2EA3A 2RFKC 1DSUA 3M61U 3RXCA 1OHHD 1O30A 2UWLA 4TPIZ 5A0CA 2C8WB 1O2JA 1FMGA 1DSTA 3BTEE 5TCAA 1SLUB 2GV7A 3P92A 1CBWC 1TNHA 1SR5C 2TIOA 2P93A 5C94A 4YM9A 4YT6H 1GBTA 5C1XA 1O36A 4ACAA 2G8TA 2H6MA 2BZAA 3KEEA 3O8DA 1BBRK 2XW9A 5A8XA 3RU4E 1QL7A 2EQNA 1TA2A 3LT3A 3W94A 2OCVB 2WV5A 1Y5UT 1O34A 1SLWB 3BG4B 4O9VA 1Z6EA 1XXFA 5DGJA 1QIXB 4KKDA 1ZGVA 1PPZA 2F4LA 3SW2B 2HALA 2BDAA 1O3EA 2GMTB 2LELA 1QBOA 2W3IA 4K1EA 1QJ7B 2ANYA 1EX3A 2ZU2A 3QN7A 1XKBC 4B71A 1H8DH 2OBQA 2A7HA 3T28A 1CE5A 3F2HA 1GGDB 3M5OA 2ANWA 3OTJE 1V2VT 3PMBB 1C1MA 1O31A 1FAKH 4ABJA 1SSXA 2ZFQH 1CQQA 1FQ3A 4ASHA 2D2DA 1P09A 1P0SH 1ZLRA 3BTME 3LC3A 2ZIQH 2ZHEH 1L1JA 4B2BA 3GCHC 3PLKA 2ASUB 2B7DH 5E0HA 3IITA 1ETRH 2ZFTA 3GCTF 3K65B 2JH6D 3FOAA 1C2FA 3SV9A 1S0QA 4FUHA 2A1DB 4B6FA 4RT1A 5CHAC 1QTFA 1GBAA 3GCHB 3RM0H 1GWAA 1MTNB 2VVVA 2PKSC 3F9FA 2CGAA 8GCHF 1EXFA 2GZ9A 1LQEA 2DUCA 4AB9A 3EE7A 1GJ5H 3RXAA 2XXLA 1V2KT 1S0RA 1MU8B 1AD8H 1GBHA 1H4WA 2PKSB 5JDUB 1HAZB 1E34B 3KF2A 1Q31A 3EAJA 1XUIA 5HIYA 1Z71A 3Q77A 2BB4A 1WU1A 1BHXB 2GCTC 1O2SA 1DWCH 3ZZDA 2PUQH 3K9XB 3QDZB 3SJKA 3SU4A 3U1JB 1H1BA 1ANEA 2G5VA 2Z3EA 2AMQA 2Z3CA 4KTSA 1YGCH 3SQEE 3GCNA 3LGWA 1SVPA 2H1UA 1GJ9B 2NU1E 5JBTA 3AW1A 4XBDA 2O8TA 4WXVA 4Y6DA 1JOUB 1RTFB 4IN2A 2V6NA 3PO1B 1EZSC 3M37A 4NSYA 2Y5HA 1SGPE 2QV1A 2W3KA 4BNRA 2FM2A 1HXFH 3A8BA 2OUAA 1AFQC 1DY8A 1F0TA 1G3BA 4WMFA 5DO4H 4NIVA 2UWPA 3U1IB 1C2HA 3GISB 2KCYA 3RXJA 2C8YB 4QT8C 1F5LA 1KDQA 1GJ8B 1QZ8A 3MYWA 1G30B 3PB1E 3MU0A 1TRYA 2ZEBA 3M3SA 5LPFA 3GY3A 5SGAE 4X1QU 3KNXA 1KTTB 1BTHH 1YPEH 1LO6A 4KTCA 4XRNA 3F9GA 1Y5AT 1RFNA 2F9OA 3R0FA 2WPJS 5K0HA 5F8XA 4ZXXH 1DM4B 4SGBE 4X8VH 3FP8E 1ZTJA 3PYHA 3TJUA 1GMDG 1PFXC 4AOQA 1ZSJA 3SOSA 3SUGA 4NIXA 3ATKA 1DPOA 3MFJA 4FUIA 1YLDA 2QYIA 3TGJE 2HOBA 4AYVB 3A81A 4B74A 4KP0A 2VNTA 4D8NA 3TGIE 2J4IA 1BTZA 3BTGE 4ESTE 5LH8A 1TPOA 3DSPA 1MTSA 1SLVB 2P8OC 1DDJA 2ZU1A 5DK1A 4H6TA 2XCNA 3KIDU 1OYQA 2BMGB 3V3MA 1K1PA 1FY5A 3S7HB 2F9BH 2Z9LA 2BY7X 2PWXA 1GJ7B 1BUIA 4B76A 3BEUA 2XC0A 3DCLA 1ELEE 2A31A 5AVDA 1LHDH 1QB6A 2V0BA 5DN6D 1QR3E 3SO3A 3U98H 4UE7H 2FODA 4NIWA 1BQYA 1K28D 2EI6A 1ZPCA 3H7OA 5EPYA 3SU1A 3E91A 1GCTB 1PPBH 1GBEA 1EPTB 1GBDA 3VFEA 5T6FA 1ZSLA 1P04A 4K1TA 1PPGE 2P3FH 4DIIH 4K3JA 1MU6B 2FOGA 1UVPA 5DKMA 1YKTA 2PTCE 3F2FA 1C1OA 1W7GH 3VB3A 2R3UA 3V12A 3MH7A 2XC4A 4I8KA 3NUMA 2UUJB 1L4DA 1QURH 3SNEA 1KXBA 1AN1E 1GG6B 2BQ7B 3B23B 1K1IA 5EOKA 5J4QA 1AY6H 1CT2E 3Q00A 4CR9A 2ZGJA 1C2MA 4ABDA 5I46H 2P94A 1QB9A 1GI1A 1WQVH 2G81E 3AK5A 5B6OA 1J8AA 1MZAA 2NWNA 3PLBA 2FOCA 2TGDA 4CRCA 4CR5A 4NZQA 1GI8B 2QIQA 4NA9H 3MNBA 4MNWA 2PV9B 1SGNE 4ABIA 1D3QB 1GJAB 3BG8A 3ATLA 2ZCLP 1L4ZA 1UTPA 3RXEA 4Y71A 3RDZA 5EG4A 1C2DA 7KMEH 1O3GA 2ZA5A 2AFQB 5KEDA 3RXVA 1GL1A 4FU7A 2QF0A 4YESB 3ZZCA 1HAYB 4ZH8A 2OC7A 2JJ1D 2BDBA 3PRDA 1UCYH 3MH5A 4ZMAH 1UVOA 4J1YA 2ZG0H 1BT7A 3SJ9A 3SHAH 2HVYB 4Y11E 2D1JA 3M5MA 1TNGA 2JH0D 2PW8H 1V2ST 2XWBI 3GY2A 1T7CA 1AIXH 1WUNH 2BLQA 1TPPA 1W3CA 2QXGA 2J92A 5JB8S 3PROA 2RCEA 2BD8A 4UEHH 4X2YA 4X1SU 3URDA 1ZHRA 1ANCA 5GCHG 3SHCH 3MNSA 1P3EA 1T8MA 2ZTXA 5HM2A 4U01A 3SNBA 3SGBE 2EY4C 2BY8X 2ZGHA 1FUJA 1FXYA 3M3TA 2KFWA 1ZOMA 1BHXF 2FI3E 1HJAC 2OP9A 4AFUA 1WYKA 2F9PA 3N99A 3UB0A 1GHBG 3M7QA 3UAIC 1P2KA 4A5TS 4R0IA 2GJGA 2ZDAH 3A88A 1A4WH 4OS5A 4NFEA 1P9UA 1UCYK 3M3VA 3RXRA 1HJAB 2FS9A 2ZDLA 1F0RA 5DP9A 1E1QD 1SLXB 1Z6JH 3ESTA 3RP2A 2HRVA 2J34A 2O8WA 2QXIA 1BTPA 1PPCE 2BD2A 2A45B 3GICB 2VU8E 1H9HE 2BX3A 3UY9A 1CSOE 2V3MA 3MI4A 4ABHA 1TALA 1A7SA 1OX1A 1TYNA 1UTJA 1IHSH 1O2HA 2BDYA 2RDEA 3LGVA 7LPRA 3GOVB 2Z94A 4GUXA 1FN8A 1J17T 1LDTT 3UIRA 3TJOA 4ZHLU 1YY3A 1EJAA 4X8SH 2P3TB 4YOGA 2FI4E 1MTUA 2TGTA 1C5LH 3S69A 3UTUH 3DUXH 3FAOA 1JRSA 1WV7H 1TAWA 3EA8A 1C2IA 2V7QD 3NZIA 2VWNA 2ZGBH 5AF9H 4RT0A 1KXEA 1L0ZA 3URCA 1QA0A 4H6SB 1EQ9A 2RG3A 4HFPB 1RS0A 1AVXA 1CVWH 2ZI2H 3ELAH 4LOYH 2A4GA 2PGQB 3SI3H 3RXQA 1O33A 2BXUH 5FPTA 3KYGA 1DWDH 3K6YA 4A1XA 1E0FD 1TOMH 4D9QA 2ZGXH 1NFUA 2BVXH 2V35A 3BTFE 1O5CB 1KLJH 2GKVE 4ISNA 3S9BA 1O2UA 4U2WA 4FXGH 1TGTA 3KQDA 2VGCB 4DT4A 3KYFA 1GHYH 3E0PB 4XE4A 1SOTA 1D3DB 1RTKA 1D9IA 5B6LA 1FY4A 3GCOA 1FI8A 9LPRA 2QA9E 2FS8A 2B0FA 3HPTB 1YP9A 2WZQA 3FO8D 1SPJA 1C5RA 2GZ8A 1OXGA 3PWCA 1AFEH 2J95A 5E2PA 2TGPZ 2OQUA 1AQ7A 1XUJA 2BXTH 1ABJH 3RXTA 2PFEA 5BRRE 1SKYE 1K1LA 3QZRA 1QA7A 3AAUA 1OP2A 1HAIH 2XNDD 2GCHG 4X2WA 1N6YA 3TH2H 4AX9H 1YWUA
chains in the Genus database with same CATH topology
2AGGX 3QGJA 2VIQA 3RC5A 1C5YB 4ZHMU 3N7OA 1E38B 4TY7A 1P11E 2ZF0H 4K5ZA 2ZWLH 1D6WA 1C5PA 1T31A 2UUKB 3SN8A 2GDDA 2Q6GA 4AB8A 1C5MD 4M7GA 2C93B 1DLKB 3UUZA 3ZVGA 4ZROA 1C5SA 2FMJA 3RMOH 3A86A 1RTLA 1UK4A 3RXUA 2P95A 1O3JA 3LIWA 1VITF 1T32A 4GPGA 1ACBE 1GJDB 1LHEH 1SFIA 4O97A 1NC6A 3QLPH 1C1RA 3LDXH 1TX8A 1Y3XA 2SFAA 3I77A 1M9UA 2FXRA 1FY8E 1QBNA 1YPHC 3SV8A 1UHBB 4A6LA 1ELFA 4K8YA 4BAMB 4AFSA 2ZDMA 1O39A 4OS7A 3A87A 3TITA 1H9IE 5JYIA 1PQ8A 4NWKA 1XXDA 3SUFA 4IBLH 2WV4A 3KCGH 1P2OA 3P70B 5A0AE 3HK6B 1O2NA 2RDLA 3LU9B 3SV2H 4LK4A 2AEIH 3BV9B 1LHFH 2NU0E 1BTWA 1F7ZA 3M36A 3BN9A 2W7UA 1AWHB 1UTKA 4Y79A 4AG2A 2VIDA 3PV4A 2G00A 3TNTA 1DICA 2BDIA 2A2XH 4PROA 4DCDA 2WPKS 1UO6A 2OC1A 4K60A 1J15A 3P8NA 1O3DA 1UVUH 3DHKH 4BOHA 2ZO3H 1LVMA 3A7WA 4WMEA 2AS9A 1BZXE 2HPQH 2AMPA 1VCWA 2D8WA 1MKWH 3MO3A 1D3TB 1MQ5A 3PWBA 1CT4E 2WYGA 1QL8A 1UVTH 2K1QA 2PKAA 3MMGA 1FLEE 1Z8GA 2A5AA 3VXFH 1AE8H 2B5TB 2VWLA 1HBTH 2Q1JA 1Y8TA 4X6PA 3MU1A 1HAPH 5T6GA 3S9AA 4BTTB 4KELA 2GTBA 1W10U 1QCPA 1P2IA 3D65E 3Q76A 1AB9C 1XVMA 3Q3KA 1NRNH 1HYLA 1HAHH 1TBRH 1IQNA 2FI5E 3V0XA 3PLPA 2ZDKA 1IQGA 1WAYB 4RN6A 5PTPA 4MNXA 1ZRBA 5A2MH 2I6QA 4MLFB 1BTUA 2FTLE 3A82A 2JH5D 4AGKA 1CBWB 2P16A 3KN2A 4BAQB 5HYOA 6GCHG 1GHWH 2GP9B 3LGTA 3A7ZA 2TPIZ 1O3HA 2C90B 1UTOA 1EPTA 3ATIA 4X6OA 3ZZBA 3RLYH 3SU5A 4I8LA 1F5KU 1O3NA 2BTCE 1WOFA 4FUCA 2BY5X 1O3MA 3RXDA 1EOJA 4FUGA 3A80A 4INKA 1NZQH 4E7NA 2AGEX 1MKWK 2EC9H 1TBZH 1DITH 1YPLH 4YZUA 4I8HA 4BXSA 4WH6A 1SGRE 1RRKA 2UUFB 1EATA 1TABE 3F1SB 1C4Y2 4GHQA 1NTPA 1TB6H 2Z9GA 3ODDA 2J9NA 3QK1A 4OGYA 4DW2U 2BYAX 1EP6A 2H2ZA 3BTWE 1XVOA 5CE1A 2CV3A 5C67A 1NN6A 1AKSB 5E0GA 1GCDA 1BDAA 2GT8A 1YYY1 3SNDA 3TJVA 3TK6A 5FX5A 3TVJB 4CH8B 1NS3A 4ISLA 1HAVB 5AHGH 3OX7U 4GSOA 4INHA 4AZ2B 1O2OA 3A84A 1GBMA 2ZU5A 3E1XB 2Z7FE 1V2TT 1GI2A 3GYLB 1CA0C 1AGJA 1SOZA 1O3FA 2FOAA 3TNSA 5CMXH 1WTHD 1GBLA 2BVSH 4Q7ZA 2KAIB 4Y0YE 2LNCA 1ID5H 4FUJA 4IC6A 2J38A 2ZC9H 2Y80A 4CBOA 3RXGA 5HXFA 4MPUA 1N8OC 1MQ6A 5CHAB 3A83A 1A61H 1YF4A 1W7XH 3HKJB 3IWMA 4RKOB 1N6XA 5GJ4B 2HNTF 2TRMA 2IJOB 3P6ZB 1HXEH 1K9OE 4A1VA 2HVXA 1AI8H 1O0DH 1G3DA 1GMDF 1O2MA 2FIRH 1YPJH 5EW1H 1TNLA 1GI0A 4AGJA 4YO9A 1PYTC 1O5AB 4FUEA 3TIUA 2BM2A 4HI3A 4D9RA 4WJG2 1ZTKA 2GCTB 1HB0B 3MU8A 1Y3VA 1QQ4A 1O5DH 2Q6DA 3UR9A 2A7JA 1DT2A 1QB1A 2NU3E 5BPEA 4TWWA 4HGCA 1C4V2 2FTMA 1YCPH 2HGTH 1ELBA 1KIGH 1E36B 4Q7YA 1FPHH 5DG6A 1GJBB 1C2GA 4CREA 5DP3A 2F9UA 1P2MA 5JBBS 3ZYDA 4NCYA 3ZV9A 3TK5A 2VVCA 5JB9S 5EPNA 3SGAE 5JBAS 2DE9A 3ZVAA 4D7GA 1TMBH 1ESAA 4ABGA 3MWIU 1HV7A 1NO9H 1AFQB 1V2LT 1YLCA 1IQEA 3UR6A 1C2JA 3I29A 4HTCH 1TFXA 1IQMA 3EE0B 2PSXA 5EGMA 3RXFA 1MCTA 1Y3YA 5IYTA 3D62A 1C1PA 4JK6A 1Z1JA 2UUYA 3F9HA 1Q3XA 3ZVBA 4X0WU 4HZHA 4XDEA 3T5FH 3UNRA 1BTXA 1GHZA 2J2UA 2ZECA 1AHTH 3MNCA 1IQKA 1GMHF 1G3CA 1MD8A 1P2JA 2BLOA 1DUAA 1HIAA 3T25A 4FU9A 1GBFA 2ALPA 1DX5M 1KLIH 1YCPK 4O03A 1HRTH 1GVZA 3RC4A 1LKAA 4WXIA 1PJPA 1SHHB 1NU9A 1ORFA 5FCKA 4ISHH 1A5HA 3AW0A 3D49H 1A0LA 1NY22 4X2XA 3QTVH 2VB0A 2VJ1A 4JZFH 2P8OB 1BRUP 3DA9B 3G01A 2P59A 5EODA 1LPKB 1EB1H 3SU0A 3SZNA 2XBWA 3AAVA 3QZQA 2BDCA 3TJNA 2FLBH 3UNSA 2V3OH 3VEQB 1MBQA 1S5SA 3BTTE 2F3CE 4MPXA 1S6FA 3OY5U 3RXSA 3DD2H 1C9PA 4TWYA 4YLUA 3EDXB 3RM2H 2BD4A 3F6UH 2VIVA 2QY0B 2CF9H 3M7TA 1DVAH 1AWFH 2D26C 2XBVA 3PTNA 3CP7A 4ZKNU 1BA8B 2ANMH 1C5VA 1P3CA 3ITIA 1OS8A 2ZU4A 2FX6A 2ULLA 1ELGA 1DXPA 1P8VC 2CMYA 4J2YB 4JCNA 1G9IE 1K1NA 3MU4A 1GMHG 1PPEE 4Q2KA 1BRBE 1NU7B 1JBUH 5AFYH 5GCHF 2Z6BD 1DY9A 2R0KA 3A8DA 2WPMS 3UNQA 2ZCKP 1BRCE 1P9SA 4OS4A 1V2PT 2OBOA 1P03A 3BF6H 4BTIB 1ABIH 3MH6A 3H5CB 2Y5GA 1LPGB 4X1PU 1FDPA 2R2WU 1GHBF 3L3TA 4IC5A 3KGPA 3ODFA 5ESBA 3U69H 4DG4A 1T4UH 2GZ7A 4U30A 1O35A 2RA3A 1A5GH 3GY8A 1NRRH 1TWXB 4CBNA 1G37A 3NK8A 1CHGA 1O2ZA 1EB2A 1KXCA 5FCRA 1FONA 4X8UH 2Y5FA 1GI6A 3M5LA 3GYMA 2BQ6B 3ZVEA 2WPLS 2A32A 1UHBA 1QRZA 3ATMA 5C5OA 3GY5A 1C1UH 3U8RH 3RMNH 4IMQA 5JBCS 1D4PB 2GVFA 1ZPZA 3ZZ5A 4ABBA 4NGAH 1S81A 2YNAA 3OSYA 5HM9A 1SL3A 3M5NA 1UTNA 1K1MA 1ZTLA 1WCZA 2ZTZA 3GY7A 4CRFA 1GHAF 1C5NH 1BMNH 2BDHA 2FPZA 1GI9B 1LVYA 2ZQ2A 1OKXA 1V2QT 2WUCA 1SGFG 1GDQA 2WINI 3LOXA 5DP5A 3E3TA 1AVWA 4GHTA 1T8LA 2FP7B 4CRBA 2BY6X 2FWWA 3GY6A 2XCFA 1XUKA 1EKBB 3F9EA 1O3KA 2W7SA 1A46H 3ZVFA 3R3GB 2ZHQH 4F49A 1QY6A 2A5KA 2STAE 1MAYA 3A85A 1C5ZB 3UQVA 2I6SA 2XNIA 4LXBH 3U8OH 1O5EH 3DT0H 4YOJA 1NFYA 1GJ6A 1GI7B 3GDSA 1GVKB 1ESBA 1L2EA 1EAWA 1V2OT 2ZQ1A 2FOEA 2QGRA 1FIZA 1VJ9U 1EZQA 3TH4H 1L1GA 1EASA 4UFFH 1OWIA 1O2QA 1FN6A 1AU8A 4D76A 1LKBA 1IAUA 1ZRKA 4X6MA 5E8EH 2ESTE 4Z0KA 6ESTA 3H7TA 2Y82A 1BIOA 2OLGA 1HJ8A 3HATH 2GCHF 3TU7H 2FOHA 1TX7A 1W8BH 1O2KA 4XSKU 1GHAG 3BSQA 4KGAA 3QTOH 2FYQA 3T27A 3SNCA 1VJAU 1VCPA 1TONA 1HDTH 1NROH 4RSPA 1B0FA 1GBKA 3WY8A 1C1QA 4B1TA 1ZSKA 1SBWA 2CF8H 4MQAA 1EJNA 1VCQA 2XBXA 3LPRA 5LPRA 1HAXB 3GDUA 2H5DA 1GPZA 1IQFA 1GBBA 4IN1A 1C5UA 1T8NA 2WYJA 4IS5A 1V2UT 1XX9A 3TK9A 2OC8A 1AKSA 4BAKB 5E0JA 4TY6A 2VWMA 1HJ9A 1E37B 4MNVA 2BX4A 5EU8A 2O8LA 3E8LA 4ISIH 6LPRA 1Z1IA 3BIUH 4FUFA 2EI8A 3QO6A 1SC8U 3ZYEA 1NRQH 3P95A 1ARBA 3VB4A 1GMCF 2GGVB 4YOIA 1MUEB 1C4U2 4LZ1H 1HCGA 2O8UA 2XBYA 2KAIA 2PTNA 5J4SA 3KHVA 5ESTE 4A1TA 4CHAC 4Q80A 1W14U 1AZ8A 1AUJA 3FZDA 1LPZB 2Z9JA 1V2WT 5F03A 4YT7H 1EZXC 1UTLM 4BANB 2W26A 1GJ4H 2ZP0H 4NWLA 2QC2A 5FHTA 4K69A 3EQ0H 1OP8A 1F0SA 5FBIA 1DXWA 1SG8B 2PHBA 1K2I1 1SQOA 2ODPA 1JIMA 2PLXA 3NWUA 2CJIA 1O32A 2Y7XA 4ZUHA 4SGAE 3L33A 3ZV8A 1DS2E 1DWEH 1CO7E 3EYDA 1SGCA 2QN5T 5HGGA 3UPEA 5C20A 2F91A 1O3LA 5DJ7A 3Q3XA 3JZ1B 2ZDNA 2B9LA 1Q2WA 3SU2A 4MVNA 3DFLA 1BMMH 2FOBA 1QQUA 4XOJA 5FBEA 3ZZ6A 4JYVH 2R0LA 2SGAA 1UTQA 7ESTE 1C5QA 4AYYB 2BD5A 1YC0A 1IQIA 5ETXA 3O8RA 1Y3WA 1BCUH 2C8ZB 1MZDA 2G52A 1CHOG 3BTDE 3LGIA 3U9AH 1ANDA 1GMCG 2G51A 2XC5A 2ZPSA 6GCHF 3UFAA 1CA8B 1TPAE 2VVUA 1QBVH 2AYWA 2XTTB 4CRDA 4Y76A 1BRAA 1RIWC 5EXLA 1BOQA 1O38A 2ZCHP 1C5WB 2FZZA 3E90B 2Y7ZA 1VGCC 2G5NA 1A0JA 1DLEA 2JKHA 5AFZH 4B2AA 1BJVA 3EGKH 1LQDB 3VGCC 4YTAA 1F5RA 2HWLB 2XRCA 5GIBA 1N1LA 3FANA 4Y8ZA 1MKXH 1LHCH 4DIHH 1IOEA 4WF8A 3KQCA 1ARCA 4X8TH 5L2ZH 1VGCB 1EAIA 1BJUA 2VH0A 1UK3A 1CT0E 1Z7KA 1S83A 2FO9A 1KTSB 1O3BA 1TGSZ 3SJ8A 3TLOA 1TNIA 2ILNA 3A7YA 1MTWA 4THNH 3HGNA 2SGFE 4Q7XA 2Q6FA 4OS1A 4Y8XA 1OP0A 1C2EA 1TQ0B 1ZMJA 3T29A 2G55A 2R2MB 4GVUA 3STJA 3A89A 2SGPE 1MBMA 1C5OH 1KSNA 4MDSA 5DP4A 2SGDE 1AMHA 3BIVH 3B8JA 1CU1A 2FDAA 1FIWA 3B9FH 1DOJA 1AB9B 3VXEH 4A7IB 1C5TA 2ZHWH 1QNJA 2A5IA 1KXDA 1WQSA 1TGCA 1XM1A 2ZPRA 1EAUA 4U32A 3M7UA 4I8GA 3PMHB 2G4TA 4JYUH 3PMJA 1SI5H 1TMUH 1MKXK 1W2KH 3BG4C 2BQWB 1G3EA 1FY3A 2QXJA 1NM6A 1DWBH 1ZJKA 3SGQE 1HPGA 3SORA 2QXHA 3UQOA 3HK3B 2VIPA 4GAWA 5A0BA 3MU5A 1BMAA 3LONA 1OWKA 2R9PA 3MTYA 1HUTH 1YPKH 2A0QB 2GMTC 1KXAA 1RGQA 2C8XB 4VGCC 4NZLA 5EW2H 1FV9A 1GBJA 1SGYE 1ZHPA 2VINA 3BEFB 3STIA 3I78A 1GGDC 1V6DA 3RXOA 1W13U 2SNVA 1ZR0A 3NPSA 3IG6B 1EAXA 1O2RA 3RXMA 2BD3A 4VGCB 1C2LA 1P01A 4UD9H 4O3TA 2G4UA 1GI4A 5EQRA 1PQ5A 2O8MA 2WPHS 1GI5A 1S84A 1ELCA 3LJJA 3F68H 1ESTA 2XWAA 2ZHDA 3FVFB 5GPIB 5F6MA 4FVBA 1HAGE 1HLTH 3UREA 1FNIA 1KYNA 1VZQH 3O8CA 1S85A 1W0ZU 1GJCB 1THPB 3DFJA 4FUDA 5I25A 1D6RA 2Y81A 4WVPE 2A4QA 1GHVH 1RXPA 3CS0A 2C4FH 1P12E 1OWJA 2BD7A 1TGNA 1K21H 1O2XA 1ZGIA 1SGDE 3E16B 4UFGH 3RU4D 1CA0B 1MTNC 2TGAA 3RXIA 1LCYA 1TRNA 5C2ZA 2BDGA 3ZVDA 4UFDH 5GXPA 1DANH 1OWDA 1N8OB 5FX6A 4ZKRU 3QX5H 4K1SA 2SNWA 2GX4A 4FUBA 3SUEA 4BTUB 1A2CH 1DUEA 3FP7E 1LMWB 3PMAB 3T62A 3V7TA 3T2NA 1SQTA 2V3HH 2FEQH 1J16A 1C1SA 3A8CA 4YLQH 1TNJA 3LKWA 3K2UA 1DFPA 3E6PH 1ZMLA 1SGTA 1TNKA 1AO5A 3S7KB 4I32A 1O3OA 2Z9IA 1L1NA 1C2KA 1V2NT 2ZFFH 4X1RU 1IHTH 1QHRB 3SBKA 3PO1C 4NA7A 4WWYA 2HNTE 2ZNKH 3KQBA 1EOLA 2OD3B 2QCYA 2SGEE 3RU4T 2VH6A 3RXPA 1KXFA 1ELDE 5DP7A 3FZZA 1OOKB 1SQAA 1O3PB 2CHAC 1BBRE 4H42U 4E06H 1YPMH 1ZJDA 2BOHB 2A4RA 3A8AA 4NG9H 4AORA 4JZDH 2ZFRH 2BLVA 3GCTG 5A09A 8KME2 2VIOA 2CHAB 1V2MT 5JPMH 2XYAA 2BVRH 1CGJE 6CHAC 3JZ2B 5K7RA 1FZZA 3LGUA 4MPWA 1QRWA 5L30H