4AB9A

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ab9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ab9A02
3SV6A 2ZHWH 3RXGA 1TABE 1GDUA 5CMXH 1XMNB 2A5AA 1HAOH 1J16A 2OBOA 3HKJB 1BT7A 1KXBA 5GWZA 3P92A 5LPEA 1GBMA 1SGDE 4MVNA 3FVFB 4X8VH 1Q3XA 4ZHLU 2R2MB 3PMBB 1KXDA 3PMHB 1NFUA 3ZZ4A 2PSYA 4OS5A 4HZHA 1C1UH 1C9PA 2BXUH 2Z9IA 2IN2A 1YF4A 4MPXA 1LHGH 1HJAC 1YPGH 2GTBA 2BD8A 4NSVA 4TY6A 3A86A 1V2RT 3PLPA 3A8BA 4X2VA 1ZHMA 1UTKA 1UK3A 1O2MA 3MU1A 1T4UH 1DY9A 5GIBA 4YOIA 3UWIA 4B2BA 4X1QU 4WMDA 1UCYE 3Q76A 1UO6A 4RN6A 3LC3A 2QC2A 3SNCA 1GHBF 4X1NU 5EPNA 4IS5A 1D3TB 3FAOA 5JBBS 1ESAA 1GJAB 2WV5A 3SV7A 4AN7A 3FP8E 3SU5A 3QDZB 5GPIB 1MQ6A 5B6OA 1P12E 3UWJH 2Z9KA 1BTYA 1O36A 1UVOA 4A92A 1TIOA 1DS2E 1G3EA 3E16B 1H9LB 2UWPA 3BTQE 2WYGA 1SR5C 1ORFA 2AGEX 1K1PA 2UWOA 3T5FH 4E05H 4OS2A 3EE0B 5TJXA 1GWAA 1KDQB 1U6QA 5F8ZA 2W26A 2XCNA 3F9HA 1SGFG 2ZG0H 1EZQA 3LGIA 4IBLH 1CBWB 1DITH 5K0HA 2FODA 2QGRA 2JKHA 1W7GH 3PO1C 1SBWA 1WYKA 5L2YH 1S82A 1XM1A 2SGEE 1QJ1B 4VGCB 1ZTJA 1C2MA 1WUNH 1C5UA 1A61H 4ZAEA 4I8KA 1TLDA 2J9NA 3CENA 1ANCA 1O3OA 4NIYA 3SUGA 1E35B 1CA0C 4E7RG 1GI5A 2AGIX 1GJ6A 5FPTA 3LH3A 5EQQA 3ZV8A 1C5WB 3TJVA 1NTPA 3TJOA 2ZTZA 5AVDA 2D8WA 2UUJB 2ZHFH 2PV9B 1C2FA 1TNKA 4YOGA 1G36A 2Y80A 2XCFA 2FXRA 4Q7YA 1XVOA 1O5BB 2GZ8A 2ZGXH 4I31A 1HGTH 1H9HE 2FM2A 1YGCH 4AG1A 1MD7A 3M37A 2STAE 1E36B 3MU0A 1AFQC 1O2GH 2GT7A 3L6PA 1CGJE 1MTVA 2A1DB 3A7WA 3GY4A 1TGNA 1A0HB 1LPGB 3AW0A 1TAWA 4H4FA 5J4QA 5F8TA 1EPTA 1GHAG 1V2QT 1ZYOA 2ALVA 2FZZA 2Y5GA 2R9PA 5DP4A 1HV7A 3OTJE 1RTKA 1MAYA 4X6NA 4BOHA 3TGIE 1NRPH 1JXPA 2XBVA 3T29A 5DG6A 2FS9A 2FP7B 8KME2 1TNGA 2O8TA 3JZ2B 1Z8GA 3RU4E 1O39A 4BNRA 4I8HA 3RC6A 4CHAC 5E0HA 2PUQH 4Q7ZA 3KNXA 1C1SA 2ZKSA 3SI3H 4K3JA 1GMCF 1O5DH 2ZIQH 5L30H 1DXWA 3QN7A 2ZFTA 1EKBB 3NK8A 1DWEH 3O8CA 1OP8A 1BRBE 2WV4A 1A4WH 1M9UA 3EYDA 2ZU1A 4BTIB 1SVPA 2ZO3H 2FLBH 2AERH 1VITG 3UR9A 3N7OA 1SFQB 2R2WU 3RXOA 5JBAS 4JZ1A 2C8ZB 2AIPA 4IGDA 1IQFA 5I46H 1EP5A 2ZDKA 2VVCA 3M5OA 1O2RA 4UD9H 4YLUA 3BTWE 4D8NA 8GCHF 3LC5A 2YNBA 2OLGA 2QIQA 3ZZ9A 3LKWA 1MCVA 1O37A 1V2OT 2H9EH 1F92A 3GY6A 5FXLA 2A31A 1L1JA 1GI7B 2UUKB 1TPOA 3SI4H 3RXRA 2VWNA 4NWLA 1QQUA 1BRAA 1N6XA 2VGCB 1O5CB 3PYHA 2DE9A 3A7XA 1WV7H 2FS8A 1YBWA 1DPOA 3A7YA 3A8CA 4UONA 3GICB 3SJIA 3TJUA 1CVWH 1O3EA 2GCHG 4CBNA 4Y0ZE 3TNTA 1QRWA 4X8TH 3SQHE 5C1XA 3MYWA 3K2UA 5EW2H 4BAMB 3HGNA 1Z8RA 2ZI2H 1NU7B 1MQ5A 4B76A 3TPIZ 1EOJA 2A2QH 1T8MA 1C2KA 1O38A 2ODQA 1EX3A 3QLPH 1KSNA 3L33A 1DLKB 4FUBA 5HM9A 2ZQ1A 1CHOG 1P9SA 2A5IA 2ZPSA 1JMOH 5J4SA 4WF8A 3P8GA 1J14A 4FXGH 1SLXB 4O97A 2HNTF 1YLCA 1LKBA 5JPMH 3DFLA 3A88A 2ZNKH 1DVAH 2NU0E 2A32A 2B0FA 1O5GH 4KP0A 2W3IA 4NZLA 2Q6DA 4DJZB 3MO3A 3PROA 3BG4B 2AGGX 1HXFH 2ZFQH 1V3XA 3MH4A 2V3HH 2ANYA 2VWMA 4NA8A 1CBWC 1PQ7A 3ZZ6A 2XRCA 4NFFA 2OXSA 3BSQA 1GBTA 4UFGH 4RKOB 1SGQE 1S0QA 2EA3A 2FOEA 2OINA 1GJ9B 1MH0A 4B71A 1C1NA 1BBRK 2G52A 4WWYA 1GCTB 3T2NA 3I77A 2FDAA 1HAGE 1BJVA 2FI3E 1GMDG 2NWNA 2BQ6B 3P8NA 3VB4A 4GUXA 1VCWA 1QTFA 1SQOA 2J38A 1TRMA 2BZ6H 3KN2A 3S7KB 1V6DA 3U69H 3NZIA 2DE8A 4BAQB 1VCPA 3KEEA 1XVMA 1IOEA 1UCYH 1HCGA 4Y8YA 1EOLA 1O3HA 1L1GA 1W0ZU 2QV1A 2A4GA 3ITIA 2GV7A 1MKWH 4AFSA 4WXVA 1ELGA 2OCVB 1FDPA 4OS1A 2HALA 1O34A 1AWHB 1O2IA 2Y5HA 3E8LA 1FV9A 1LVMA 1RTLA 2ASUB 2B8OH 1NM6A 3A83A 3QZRA 4TWYA 3BG8A 1O35A 3MO9A 1BTHH 2XC5A 2ZU4A 3M5NA 5DP9A 2ZGJA 2BY8X 2C3SA 1EZXC 3PB1E 3TH3H 3GCNA 6GCHF 1MUEB 1TMBH 1E0FD 3MU4A 1ELCA 3MWIU 3BTHE 3PWCA 1SSXA 1DUAA 1UJ1A 2AIQA 4MPWA 3D23A 3ATIA 1RS0A 1HDTH 2ZPQA 1IQIA 1C1RA 4E7NA 2WPKS 4HI3A 1QRXA 3ZVFA 3SOSA 2R0LA 3RXJA 1VGCC 1HAZB 1FY5A 3MH7A 1OWDA 4AFZA 2RG3A 1EXFA 1DANH 3P17H 2AH4X 3SU3A 1FAXA 1HAPH 1O2WA 5H4IB 3M5LA 4CRDA 2FOBA 1EAXA 2V3OH 4HFPB 2PKAA 4H42U 2HOBA 3TK6A 2BDAA 1SQTA 2FOHA 1KLJH 4WH6A 1LQDB 5T6DA 3FZZA 1T8LA 3RXPA 3UUZA 4XSKU 1HAYB 1ZMNA 3RXKA 3Q00A 1LHDH 1F5RA 1UTPA 2VNTA 2Z9JA 4HGCA 1QY6A 1FQ3A 4DGJA 3RXEA 1HYLA 4IMQA 2ZDMA 3ZZDA 1GJ4H 3SV9A 1PPEE 1AVWA 1SGPE 1PPFE 1EZSC 3GCTG 1OX1A 2Q6GA 2ZQ2A 4CH2B 5C20A 1OWIA 2ZFSA 4JCNA 1SC8U 1JOUB 3TIUA 1TB6H 1PQ8A 4B74A 1P2OA 4LZ4B 1CT2E 5JB9S 2FOFA 1GCDA 1GBHA 2NU1E 3VB5A 1TALA 3MU8A 4IC5A 3U98H 2P16A 1MBMA 4Y8ZA 1HLTH 3PO1B 1GBKA 1XUIA 4ZROA 5ETXA 1O3KA 3KIDU 5GJ4B 1YYY1 4K5ZA 1VR1H 4GVUA 1W2KH 2JH6D 3MNBA 1T7CA 1CA0B 1DE7H 4TWWA 1SMFE 1TA2A 1TGSZ 1UTJA 1Y3XA 5DO4H 1GDQA 2FESH 4MPVA 1S6FA 1QCPA 7GCHG 1S6HA 1MTSA 4GAWA 3P95A 5T6FA 3W94A 3RXVA 1TNIA 1AZZA 1P02A 1GHVH 2GVFA 5F6MA 2W5EA 1BHXF 2QXHA 3O8RA 1PQ5A 1ZTKA 3EAJA 3OYPA 1BBRE 5A0BA 1XUFA 3B9FH 3IITA 1CGHA 2TRMA 1C5QA 4TPYA 1W3CA 4XBCA 2P8OC 4DURA 1S0RA 2BY9X 2ZCKP 2BD4A 1T8OA 1TNHA 1LHEH 1ARCA 3UQVA 1FY8E 3H7OA 1CHGA 1GI8B 2QN5T 4J2YB 4ZHAA 2P3TB 1RTFB 2VIPA 4D76A 9ESTA 1P2KA 1GHYH 1AVXA 2JH0D 3K9XB 4WVPE 2ZF0H 5FX6A 2FOMB 1EATA 2HNTE 3D65E 4CR9A 1JIMA 1Y5AT 3ESTA 1F0UA 3GCOA 4UFDH 1IQGA 5C1UA 3ZZCA 3MH5A 4ZH8A 3M3TA 1T31A 5C5OA 4FU9A 3F68H 1KLIH 3QGNB 1THPB 4AFUA 4SGBE 3DA9B 1HIAA 1QBOA 2EI8A 2D26C 4FUCA 1ZHRA 3URDA 1NY22 4A7IB 3H7TA 2ZU5A 4I8JA 3SUEA 3ZYDA 1F5KU 1O3BA 3A8DA 2XBXA 1O2NA 1NS3A 3UPEA 1ABIH 1WSSH 3MNCA 3TITA 1NN6A 2R3YA 2Z3EA 1S84A 1LVBA 3O8DA 1S5SA 4WH8A 1AU8A 1HJ9A 4ABHA 1UTOA 3MNSA 4AYVB 1O30A 1AB9B 1IQKA 1W14U 2ZHQH 3GDSA 4R8TB 1EJNA 3D49H 2XC0A 4NGAH 3NKKA 2WPHS 1O2QA 3LJJA 2PKSC 1SQAA 2BDYA 4LOYH 1FIZA 1Q31A 3TGJE 1LTOA 1NFYA 4FU7A 5HGGA 1P2IA 5GCHF 2O8LA 2VVUA 1SLVB 4LXBH 1HAVA 2WYJA 2BVRH 3GCHB 3TK5A 4Y6DA 2OBQA 1EP6A 1GL1A 2VB0A 5DJ7A 4AGKA 1Y8TA 3AAUA 1A1RA 1VJ9U 1DFPA 5L2ZH 4IW4E 2BLOA 3TJNA 3P8FA 4MNXA 1CE5A 4YO9A 3ATWA 1TMUH 1EASA 1QJ6B 1QFKH 1ZOMA 1C5OH 3ZVEA 1GBDA 2TGPZ 4ISLA 1V2ST 2PTCE 1YC0A 1O2OA 1UVSH 2GGVB 4INLA 1EAWA 1P03A 1FN6A 4A1VA 1ZSKA 1GMHG 1GI0A 2IJOB 1FONA 2XWAA 3NWUA 3PTNA 4H6TA 8GCHG 1P3EA 5E0GA 3OSYA 1KXCA 4WMFA 4J1YA 1K1IA 1SOZA 3A7VA 3U8OH 1GI2A 3SHAH 3SU6A 1JRSA 1TRYA 1OWHA 2A0QB 4K1EA 1BTZA 1Z8JB 4IMZA 3E91A 3ZVDA 4BXSA 1YPLH 3HPTB 1ZJKA 3A89A 4NWKA 4X2WA 2BDCA 3LJOA 3RXHA 4A1XA 1YPHC 4U32A 4ZHMU 1P01A 1GJDB 1QURH 2PTNA 5EXNA 1N8OC 3R3GB 1CSOE 1YKTA 3S9BA 3QWCH 1NFXA 4CRAA 3B8JA 3HKIB 5FBIA 1FY4A 1ABJH 2ULLA 2QCYA 3LH1A 1OPHB 1CO7E 3AW1A 2ZTYA 1GBCA 1KTSB 1NZQH 1P9UA 1KTTB 1GI3A 3FP7E 3LGTA 3KL6A 1C4U2 1DOJA 1FLEE 1OYQA 3DD2H 1TNLA 2FTMA 5E2OA 1MTWA 4KKDA 1G3CA 2AYWA 2O8MA 1TBRH 4BANB 4O3TA 1GBBA 5EODA 5DKMA 2SGAA 2QA9E 9LPRA 1C5TA 1BMNH 2RA0A 4Y79A 3V0XA 4NIVA 2ZDLA 1SLUB 4UFEH 2BB4A 1A2CH 1P0SH 1W10U 4ABGA 3FZDA 4X1SU 2BOKA 4AB8A 4OS7A 2GZ7A 4GCHF 2SGFE 2HLCA 5E2PA 1XUGA 2OUAA 3RDZA 1LPKB 3BN9A 4M7GA 1DWCH 1A5GH 2XBWA 3MHWU 2EEKA 3GY3A 4Z6AH 1TPSA 1DT2A 1H8DH 2H2ZA 4NZQA 2OC8A 1XUKA 4FUJA 1O3LA 2QAAA 1Y5BT 2FWWA 1GVKB 1ELDE 3GY7A 1ZZZA 4U30A 1B0FA 4FUFA 1BB0B 2PLXA 5E0JA 1Y3VA 1HNEE 1SPJA 1WOFA 2ZHEH 2GDEH 3ZZ8A 4I8LA 2BDHA 1C1PA 1OXGA 2ZCLP 4X6MA 1VGCB 1V2PT 3STJA 1BOQA 4RSPA 2A4QA 3MFJA 3L3TA 1RFNA 1L1NA 4BTTB 4Y11E 1P10A 3E0NB 2UWLA 3ZVCA 4JMYA 2ZFRH 3RXDA 3GYLB 1VCQA 4X0WU 1ANDA 3MU5A 3S9AA 3MOCA 1ESTA 3I29A 1C5XB 1AB9C 2G5NA 2ZGHA 1BTXA 2ESTE 3RXQA 2P95A 2XXLA 1W13U 1BBRH 3TK9A 4K1TA 1TX6A 4MDSA 3SZNA 1WTGH 4K69A 5AFZH 2OC0A 3ATMA 5C5NA 2GT8A 4Y71A 1CA8B 2BVXH 1EPTB 4DG4A 1C2DA 1G3BA 2O9QA 3GCHC 3RU4D 3SO3A 1GVZA 2GMTB 2G00A 3EQ0H 4ZUHA 4IC6A 2ANWA 2ZDVH 1LHCH 2Q1JA 5EGMA 1O3DA 1A3BH 3SU2A 3T26A 1DX5M 1AMHA 1ZPCA 3RUOA 4ISIH 3PWBA 5IYTA 3UY9A 2A7JA 3T28A 2QY0B 2H5DA 3QUMP 2V6NA 1QHRB 1AHTH 1PPBH 2SGDE 2LPRA 1TA6A 2OQ5A 2FOAA 2OD3B 3PMAB 4Y0YE 3VXEH 3VGCC 4CRGA 2SNWA 3I78A 2QXIA 2F9UA 3RM2H 3EA8A 3UREA 1RXPA 3ELAH 3M7TA 3ZVAA 2J95A 4JYUH 1SI5H 4I8GA 3D62A 3HATH 4GPGA 1SOTA 2YNAA 3QO6A 4GHTA 3TU7H 2W3KA 2SGPE 4AZ2B 1TGTA 5TCCA 5DK1A 1ELBA 1S83A 1TYNA 1J8AA 1ETRH 4B2CA 4FUIA 4ABIA 2P8OB 2KAIB 4WXIA 2ZWLH 1W8BH 4IN1A 3UNQA 3SHCH 4CR5A 1UTMA 2B9LA 1UMAH 2BM2A 1F0TA 1UHBA 1F0SA 2D1JA 3RXAA 3RXTA 1JWTA 1KY9A 1OWEA 3FFGA 1NC6A 4D9QA 2EI6A 1JBUH 1GHAF 1BZXE 1GL0E 2TGTA 2TGAA 1O32A 3IWMA 2H5CA 1EJMA 1C1OA 1IHSH 3ODFA 4O3UA 1RJXB 2VIOA 1BDAA 2AMPA 4I7YH 1C2JA 1E37B 1AKSA 2I6QA 3G01A 1C2LA 5PTPA 1RIWB 2R3UA 1Z7KA 4MNVA 1VZQH 4TY7A 4X6PA 1AUJA 3RLYH 1GBFA 3GY8A 1V2KT 1VITH 3H5CB 2JH5D 1FY1A 1O2HA 4BAKB 5IDKA 5LGOA 1C5PA 1PPHE 2FO9A 1NU9A 1FXYA 4WMEA 4NIWA 3W95A 1CT4E 1O2JA 1GJ7B 3RMMH 1J9CH 4INKA 5C3NA 1XUJA 3OY6U 1O2PA 2A5KA 1SGTA 1QIXB 1LCYA 3KF2A 2YOLA 2AMDA 3F9GA 3SBKA 2PUXB 1VITF 1MZAA 1A3EH 2G4UA 1SLWB 1Q2WA 1IQMA 8ESTE 3V12A 8LPRA 1YCPH 1FN8A 2HWLB 2TPIZ 2XW9A 3GDVA 4Z0KA 4FUEA 3S9CA 2PKSB 1DDJA 1L4DA 3TH2H 5EQSA 1SGFA 1AQ7A 1P04A 3M3SA 3GY2A 3RP2A 3SV8A 3SV2H 5EXLA 1GGDC 1H4WA 3KQBA 1XX9A 2PHBA 1EQ9A 1FPHH 1KXAA 1GI9B 1UVTH 1O3GA 1ANEA 2EI7A 1O3NA 1ELFA 3E90B 5E8EH 1ZTLA 1MMJN 5SGAE 2GDDA 4DIIH 1THSH 4TYDA 3U1IB 4KELA 1EB1H 2Y7ZA 1AE8H 2BD9A 2GCHF 2FTLE 2JETC 1SB1H 4NCYA 4XDEA 3RMOH 6CHAC 4DOQA 1BQYA 4ABAA 4X2XA 2NU4E 2Y7XA 3RC4A 1HAIH 1TMTH 3C27B 2B7DH 1PJPA 1FJSA 3QK1A 2A7CA 1TPAE 4B75A 4FUHA 2VJ1A 5I25A 3R0FA 2BDBA 1ELAA 4DIHH 1CHOF 1D3DB 3K6YA 1AVGH 3SUDA 1E38B 3S7HB 3RXIA 1D3PB 2TGDA 1EPTC 1C5YB 2BZAA 2ZCHP 2FOGA 1K21H 1BMLA 1K1JA 1E34B 4ZXYH 4ISNA 1K1OA 2GMTC 1V2NT 1GVLA 2Z9GA 3BTTE 1GI6A 1T4VH 1XXFA 3URCA 1N8OB 1D6WA 1BUIA 1GPZA 1GJ8B 1RRKA 2F9NA 2GV6A 1YCPK 4ZKOU 5F8XA 2G4TA 5LPFA 1YPJH 2CMYA 1N6YA 1A46H 1QA7A 3BIVH 4MQAA 1GG6C 4NG9H 2J2UA 1UVUH 3ZZBA 1G37A 4YM9A 3E0PB 1K22H 1GHBG 2ZDAH 3NCLA 1OOKB 5EQRA 3SU1A 1V2TT 1ETSH 4I32A 2W7UA 3SNEA 3RXSA 5EG4A 2A45B 3A84A 1DXPA 5ESBA 5GDSH 4Y76A 1TQ0B 2ZEBA 3OX7U 3A80A 3P6ZB 1CGIE 3T27A 2R0KA 2Y82A 3SORA 1P2JA 2Z3DA 4FVDA 2W7SA 2D2DA 3K65B 1GMDF 2EC9H 2Z9LA 1TGBA 1V2UT 3SN8A 1NT1A 3HGPA 2CHAB 1TWXB 1P3CA 2K1QA 2ZDNA 5T3HA 2CN0H 3ZZ3A 1C2EA 1WTHD 2PKAB 4DY7B 4YLQH 1INCA 5FAHA 2PSXA 3SNDA 2ZU3A 1OP0A 3ZZ7A 1GJCB 1SFIA 4X1RU 4X1PU 1TX8A 1MBQA 1TX7A 1C1MA 5C1YA 5JDUB 1B7XB 1XKBC 3ATLA 1QBNA 2WUBA 2O8WA 4WY3A 2ANMH 1GJBB 2GX4A 1AO5A 4D7GA 4F49A 3BTDE 2Y6TA 2ZZUH 3KCGH 1QB6A 3F1SB 1DWBH 2WPIS 2P3UB 3GDUA 1FPCH 4YZUA 1RIWC 1ANBA 3UTUH 1O33A 5DPAA 1XUHA 3F6UH 3E1XB 2VIVA 3M5MA 1QA0A 1SG8B 1HBTH 1NROH 4ABJA 3MNXA 4OGYA 5A09A 1EUFA 1C5LH 1DM4B 2XTTB 1BA8B 3QZQA 3RMLH 3SQEE 1ID5H 1NRNH 1QJ7B 2J94A 2LNCA 3NXPA 4KGAA 4OGXA 4ABFA 1Z6JH 5HXFA 1D4PB 1SGYE 2C90B 3UOPA 2QF3A 1LVOA 1ZHPA 1V2JT 1FY3A 5BPEA 1MAXA 3KGPA 4GCHG 4FUDA 3EA9A 2FYRA 4JZIA 4AFQA 1IQHA 7KMEH 5C67A 2RA3A 1D3QB 1NFWA 3UNSA 2THFB 4INHA 1FNIA 4MG3A 1WQSA 5FPSA 4AB9A 1C1WH 4Y10E 1W0YH 2ZHDA 3S0NA 2F83A 3HK3B 1BCUH 4ISOA 1UVPA 1KDQA 4Q80A 2P3FH 1C5NH 1O2SA 4GHQA 3RXCA 1GMCG 2GKVE 1YM0A 1C5MD 1AFEH 2Y5FA 6LPRA 1C2IA 3VPKA 1KXFA 2Z6BD 1C9TA 3GCTF 1DUEA 2G55A 2CV3A 2QXGA 1QB1A 3FP6E 3SNBA 2A4RA 3DT0H 4ZKSU 1GDNA 1C1TA 5JYIA 3UR6A 1C5ZB 1QR3E 2UUYA 4FU8A 3M7UA 4CBOA 3OY5U 2PW8H 1P11E 1HB0B 2UUFB 2VWLA 1AGJA 1GJ5H 2C8WB 5TCAA 1ETTH 2FPZA 1ZSJA 2QF0A 2C93B 5A0AE 4NA7A 1AD8H 3VGCB 4AX9H 2H9TH 4XE4A 1DSUA 1SGIB 4XBDA 2SGQE 1HIAB 1L2EA 2BDIA 1PPGE 1IAUA 4AORA 3AVZA 5K7RA 1O2KA 2BQ7B 4JZFH 4UDWH 3QX5H 1ZRKA 5A0CA 3LT3A 7GCHF 1ZR0A 4O03A 1P09A 1AWFH 1BTPA 2XYAA 2HRVA 4F4OC 1ZSLA 1TONA 3BTEE 4U01A 2FYQA 1RGQA 1NRSH 2VH6A 4OS4A 3UQOA 2BD7A 2VU8E 1ZGIA 2CF8H 3ZVGA 2VH0A 1G30B 1BITA 1BMAA 2F9BH 1O3FA 1O3CA 3LPRA 5FX5A 2RDLA 1TBZH 5ESTE 2VIDA 1O5EH 4ZKNU 3V7TA 2AFQB 3RXFA 1P05A 1KYNA 3LU9B 1AIXH 2FEQH 2VIWA 1O2ZA 2SNVA 2TIOA 3A7ZA 3LDXH 2STBE 2VWOA 1HAVB 2ODYB 5FCKA 2BX3A 1GI4A 5AFYH 2HNTC 4K60A 1MTNC 2F91A 3PTBA 1HUTH 1YCPM 2BY6X 5FBEA 1ZRBA 5JB8S 3KHVA 4FUGA 5HMAA 1UK4A 1BHXB 2BX4A 2CXVA 2BD3A 1P2QA 4Y7AA 2XWBI 5BRRE 2CHAC 1MU6B 3EDXB 4B1TA 2WINI 1C5SA 2WUCA 1F5LA 2HPQH 2ZGBH 5LPRA 2FIRH 4JYTA 4X8SH 4KTUA 1BRCE 1PYTD 1WU1A 4GSOA 2WPMS 4X8UH 1ZLRA 2ODPA 3GISB 1A5IA 4DW2U 1KXEA 1CQQA 1GBAA 1D6RA 1K1LA 1MCTA 3V3MA 3P70B 3TGKE 2OQUA 5DP7A 1QNJA 3LGVA 1S81A 3IG6B 3RLWH 3TVJB 3OU0A 3U9AH 2VINA 1GHZA 3DFJA 2XNIA 1OSSA 1BTWA 1WQVH 4RKJB 2SFAA 1IQEA 2BYAX 3SUFA 2VIQA 1GGDB 1N1LA 1T8NA 3SGAE 1TPPA 4Y8XA 3TH4H 1O2TA 1AZ8A 1K28D 3LONA 3DHKH 3RU4T 1SGNE 1O3JA 4TPIZ 1Z6EA 1TFXA 1FMGA 1HAXB 1G32B 1TRNA 4JZDH 1V2MT 2ZA5A 1EB2A 3Q3XA 3CP7A 3P8OA 1YLDA 1YPEH 4K8YA 3ATKA 2JETB 6CHAB 1H8IH 2HVXA 1WAYB 3BTGE 1NESE 1P8VC 2F9PA 1CT0E 2NU3E 3EGKH 5DP8A 3AAVA 2F3CE 4U2WA 3STIA 2AS9A 3VXFH 2PGBB 1GBLA 2IPHA 4KTSA 1OYTH 1ARBA 2Y81A 4JK6A 2BTCE 6GCHG 1TNJA 1CU1A 2KAIA 2BLQA 5EW1H 4YESB 2XBYA 5DP5A 1GMHF 1OWJA 1ZPBA 1S85A 1P2MA 4XFQA 1ELEE 1GBEA 1O0DH 1MTUA 1PFXC 2IOTA 2V0BA 3AASA 4ISHH 1H9IE 1AY6H 1Y59T 2WPLS 2GZ9A 2H1UA 4LK4A 2GD4B 4LZ1H 1PYTC 1ZJDA 3SJKA 6ESTA 3KQDA 1QGFA 1BIOA 1H1BA 4Q2KA 1OS8A 2ALPA 3ZVBA 4ASHA 4DVAU 3T25A 2AEIH 3E6PH 4Y7BA 1AI8H 3A82A 1PQAA 1EJAA 3B23B 1Y5UT 1GG6B 1EAIA 3MO6A 4NSYA 1O3IA 3BEIB 5EOKA 1QL9A 2BXTH 3GY5A 1TOMH 4UEHH 1V2LT 3SGQE 4OS6A 4THNH 3T62A 1YPKH 3BEFB 3KQCA 4ZKRU 3FANA 3V13A 3F9EA 2OP9A 3E3TA 1ZMJA 4MPUA 4CH8B 2F9VA 2G81E 4MNWA 1DWDH 4NIXA 1F7ZA 1QBVH 1HFDA 5A8XA 5CE1A 2FLRH 5F03A 1A7SA 3QGJA 5EPYA 1IQNA 4WJG2 4SGAE 4E06H 3DUXH 4Q7XA 5AF9H 2ZTXA 1AE5A 4MTBA 1HJ8A 1LMWB 1O2YA 1PPZA 4ABEA 3LGUA 2ILNA 2BD2A 1TOCB 1LDTT 2BY5X 3RMNH 1NO9H 2PWXA 3PMJA 1HPGA 1SGRE 2C8XB 1W7XH 5FCRA 4X6OA 4JYVH 1LKAA 3Q3YA 3U8TH 3SU0A 4BXWA 4NA9H 5CHAB 2CF9H 4NFEA 1WBGB 1F2SE 2OTVA 1UK2A 4XOJA 1GBIA 1LVYA 2J34A 3MI4A 4ESTE 2GCTB 1AUTC 2M5TA 3A81A 1O31A 1C1VH 3VB6A 3SJ9A 5A8YA 1ELVA 5EXMA 3BF6H 3M7QA 3BEUA 1L4ZA 4VGCC 1C2GA 1UTNA 1O2XA 3K6ZA 3NPSA 4A1TA 2FI5E 2XC4A 1YP9A 3GOVB 3VB7A 1OP2A 4XBBA 2GP9B 1IQJA 1Z1JA 3UNRA 3UIRA 2DUCA 3UOUA 3CS0A 2ANKH 3M36A 3PM3A 1GBJA 1ZMLA 2BMGB 1G3DA 1OKXA 4CREA 1V2WT 5T6GA 1UTLM 5JBCS 7ESTE 1BMMH 4MLFB 4MNYA 5HM2A 3VEQB 2A2XH 1G2LA 1X7AC 1B0EA 5EU8A 3M61U 1P57B 3LGWA 1THRH 3MTYA 1C2HA 2G8TA 3NUMA 5FPYA 2FI4E 3SW2B 3TLOA 1VJAU 2Z7FE 4K8BA 2HPPH 1UTQA 1C5VA 1Y3YA 3SJ8A 2P59A 4B2AA 1HXEH 2TBSA 3A87A 1ELTA 2AMQA 4D7FA 4BAOB 2C8YB 1K1NA 4ZXXH 4YTAA 1UHBB 1Y3UA 1IHTH 1MKXH 3PV4A 3RXBA 2BLVA 1XKAC 2HGTH 2A7HA 3A7TA 1K1MA 1TQ7B 1YPMH 1HJAB 1NRQH 2FX6A 2RCEA 2OC7A 3UFAA 1C1QA 2OC1A 1O2UA 1TGCA 1HRTH 3LIWA 4AYYB 4CRCA 1Z1IA 4QT8C 3QTVH 2PFEA 3HK6B 1KIGH 3RXLA 2G5VA 2Q6FA 3RC5A 1MZDA 3O8BA 2FX4A 1AKSB 7LPRA 5ABWA 3BV9B 1K2I1 5DGJA 3JZ1B 1O3PB 1V2VT 2BY7X 4I33A 5DP3A 3SNAA 4AGJA 1FZZA 4DT7B 4B73A 4CRBA 4ABDA 2FOCA 4JZEH 1PPCE 3U1JB 1FIWA 5LH8A 3WY8A 1O2LA 5C2ZA 2CGAA 4O9VA 1DICA 1Z71A 3SJOA 5A2MH 4IN2A 4FVBA 4KTCA 3LGYA 5GCHG 3MMGA 1A5HA 1UCYK 1SL3A 3LOXA 1P06A 5A8ZA 1LHFH 4K2YA 4PROA 3A85A 3VB3A 1ACBE 1QL8A 4BAHB 1D9IA 1MKWK 2BHGA 1GHXH 2CJIA 3BTFE 1KLTA 2QYIA 5GXPA 1J17T 1ESBA 2VGCC 1SHHB 2G51A 2ZFPH 1F0RA 1GI1A 3A8AA 1FUJA 4A5TS 1WCZA 2P94A 3ZZ5A 5FHTA 3RM0H 4YT7H 3CS7A 1SGCA 4YOJA 1AN1E 1LO6A 1QB9A 2ZU2A 3BTME 1FI8A 1O5AB 1Y3WA 1C5RA 4HTCH 3RXMA 1B5GH 1SHYA 2PGQB 3BTKE 3SU4A 1W12U 2F9OA 3TNSA 2Z3CA 5L6NH 3Q3KA 1Z8IB 3F9FA 4AG2A 1MKXK 1T32A 1W11U 5G4BA 1SGEE 2FMJA 4BTUB 3KQEA 1GHWH 1O5FH 4DCDA 1MTNB 1C4V2 1QRZA 3S69A 1DSTA 3BIUH 3PLKA 1L0ZA 2BDGA 2ZPRA 3ODDA 2A4OA 2BD5A 1FAKH 4UFFH 3U8RH 1NPMA 2Z94A 2P93A 1EAUA 2B5TB 1G9IE 3RXUA 1BRUP 4H6SB 3ZZAA 1EZUC 1P2NA 3M3VA 1J15A 3SGBE 1TE0A 1A0LA 2WPJS 4X2YA 1YPHE 4ABBA 3PLBA 5DP6A 1DLEA 1IQLA 4YT6H 1AFQB 1LPZB 2PR3A 2V35A 1O2VA 5CHAC 2BOHB 1MU8B 2O8UA 3ENSB 3BG4C 2ZGCA 1JIRA 2I6SA 1BJUA 2GCTC 3GYMA 3VFEA 4A6LA 3ZYEA 2BQWB 1XXDA 3Q77A 2J4IA 2ZC9H 3MH6A 4ZMAH 4JK5A 4R0IA 1LQEA 4UE7H 2H6MA 1K9OE 1GCTC 5HYOA 2VVVA 4K1SA 4GLYA 1O3MA 1A0JA 4D9RA 2ZP0H 1MD8A 1TBQH 3ZV9A 1ZPZA 4CRFA 4CHAB 2ZFFH 2J92A 5JBTA 2QXJA 1RD3B 3EA7A 2C4FH 2ZECA 4AOQA 3M35A 1HAHH 1O3AA 1OWKA 3QTOH 1DY8A 1QQ4A 1ZGVA 5AHGH 1NRRH 2BLWA 1C4Y2 1JRTA 3C1KA 2BVSH 2NU2E 1QL7A 1BTUA 2H9HA 1G2MA
chains in the Genus database with same CATH superfamily
3SV6A 2ZHWH 3RXGA 1TABE 1GDUA 5CMXH 1XMNB 2A5AA 1HAOH 1J16A 2OBOA 3HKJB 1BT7A 3KQ5A 1KXBA 5GWZA 3P92A 5LPEA 1GBMA 1SGDE 4MVNA 3FVFB 4X8VH 1Q3XA 4ZHLU 2R2MB 3PMBB 1KXDA 3PMHB 1NFUA 3ZZ4A 2PSYA 4OS5A 4HZHA 1C1UH 1C9PA 2OK5A 2BXUH 2Z9IA 2IN2A 1YF4A 4MPXA 1LHGH 1HJAC 1YPGH 2GTBA 2BD8A 4NSVA 4TY6A 3A86A 1V2RT 3PLPA 3OAAD 3A8BA 4X2VA 1ZHMA 1UTKA 2JJ1D 1UK3A 1O2MA 3MU1A 1T4UH 1DY9A 5GIBA 4YOIA 3UWIA 4B2BA 4X1QU 4WMDA 1UCYE 3FKSD 3Q76A 1UO6A 4RN6A 3LC3A 2QC2A 3SNCA 1GHBF 4X1NU 5EPNA 4IS5A 1D3TB 3FAOA 5JBBS 1ESAA 1GJAB 2WV5A 3SV7A 4AN7A 3FP8E 3SU5A 3QDZB 5GPIB 1MQ6A 5B6OA 1P12E 3UWJH 2Z9KA 1BTYA 1O36A 1UVOA 1NBMD 4A92A 2GJGA 1TIOA 1DS2E 3U28C 2AHME 1G3EA 3E16B 1H9LB 2UWPA 3BTQE 2WYGA 1SR5C 1ORFA 2AGEX 3NRLA 1K1PA 2UWOA 3T5FH 4E05H 4OS2A 3EE0B 5TJXA 1GWAA 1KDQB 1U6QA 5F8ZA 2W26A 2XCNA 3F9HA 1SGFG 2ZG0H 1EZQA 3LGIA 4IBLH 1CBWB 1DITH 5K0HA 5C94A 2FODA 2QGRA 2JKHA 1QZ8A 1W7GH 3PO1C 1SBWA 1WYKA 5L2YH 1S82A 1XM1A 2QE7D 2SGEE 1QJ1B 4VGCB 1ZTJA 1C2MA 1WUNH 4B6EA 1C5UA 1A61H 4ZAEA 4I8KA 1TLDA 2J9NA 3CENA 1ANCA 1O3OA 4NIYA 3SUGA 1E35B 1CA0C 4E7RG 1GI5A 2AGIX 1GJ6A 5FPTA 3LH3A 5EQQA 3ZV8A 1C5WB 3TJVA 1NTPA 3TJOA 2ZTZA 5AVDA 2D8WA 2UUJB 2ZHFH 2PV9B 1C2FA 1TNKA 4YOGA 1G36A 2Y80A 2XCFA 2FXRA 4Q7YA 1XVOA 1O5BB 3GS9A 2GZ8A 2ZGXH 4I31A 1HGTH 1H9HE 2FM2A 5B6LA 1E1RD 1YGCH 4AG1A 1MD7A 3M37A 2STAE 1E36B 3MU0A 1AFQC 1O2GH 2GT7A 3L6PA 1CGJE 1MTVA 2A1DB 3ZIAD 3A7WA 3GY4A 1TGNA 1A0HB 1LPGB 3AW0A 1TAWA 4H4FA 5J4QA 5F8TA 1EPTA 1GHAG 1V2QT 1ZYOA 2ALVA 2FZZA 2Y5GA 2R9PA 5DP4A 1HV7A 3OTJE 1RTKA 1MAYA 4X6NA 4BOHA 3TGIE 1NRPH 1JXPA 2XBVA 2KCOA 3T29A 5DG6A 2FS9A 2FP7B 8KME2 1TNGA 2O8TA 3JZ2B 1Z8GA 3RU4E 1O39A 4BNRA 4I8HA 3RC6A 4CHAC 5E0HA 2PUQH 4Q7ZA 3KNXA 1C1SA 2ZKSA 3SI3H 4K3JA 1GMCF 1O5DH 2ZIQH 5L30H 1DXWA 3QN7A 2ZFTA 1EKBB 3NK8A 1DWEH 2XOKD 3O8CA 1OP8A 1BRBE 2WV4A 1A4WH 1M9UA 3EYDA 2ZU1A 4BTIB 1SVPA 2ZO3H 2FLBH 2AERH 1VITG 3UR9A 3N7OA 2W6JD 1SFQB 2R2WU 5KGOA 3RXOA 5JBAS 4JZ1A 2C8ZB 2AIPA 4IGDA 1IQFA 5I46H 1WXRA 1EP5A 2ZDKA 2VVCA 3M5OA 1O2RA 4UD9H 4YLUA 3BTWE 4D8NA 8GCHF 3LC5A 2YNBA 2OLGA 2QIQA 3ZZ9A 3LKWA 1MCVA 1O37A 1V2OT 2H9EH 1F92A 3GY6A 5FXLA 2HVYB 2A31A 1L1JA 1GI7B 2UUKB 1TPOA 3SI4H 3RXRA 2VWNA 4NWLA 1QQUA 1BRAA 1N6XA 2VGCB 1O5CB 3PYHA 2DE9A 3A7XA 1WV7H 2QF4A 2FS8A 1YBWA 1DPOA 3A7YA 3A8CA 4UONA 3GICB 3SJIA 3TJUA 1CVWH 1O3EA 2EY4C 2GCHG 4CBNA 4Y0ZE 3TNTA 1QRWA 4X8TH 3SQHE 5C1XA 3MYWA 3K2UA 5EW2H 4BAMB 3HGNA 1Z8RA 2ZI2H 1NU7B 1MQ5A 4B76A 3TPIZ 1EOJA 2A2QH 1T8MA 1C2KA 1O38A 2ODQA 1EX3A 3QLPH 1KSNA 3L33A 1DLKB 4FUBA 5HM9A 2ZQ1A 1CHOG 1P9SA 2A5IA 2ZPSA 1JMOH 5J4SA 4WF8A 3P8GA 1J14A 4FXGH 1SLXB 4O97A 2HNTF 1YLCA 1LKBA 5JPMH 3DFLA 3A88A 2ZNKH 1DVAH 2NU0E 2A32A 2B0FA 1O5GH 4KP0A 2W3IA 4NZLA 2Q6DA 4DJZB 3MO3A 3PROA 3BG4B 2AGGX 4TT3D 1HXFH 2ZFQH 1V3XA 3MH4A 2V3HH 2ANYA 2VWMA 4NA8A 1CBWC 1PQ7A 3ZZ6A 2XRCA 4NFFA 2OXSA 2PP6A 3BSQA 1GBTA 4UFGH 4RKOB 1SGQE 1S0QA 2EA3A 2FOEA 2OINA 1GJ9B 1MH0A 4B71A 1C1NA 1BBRK 2G52A 4WWYA 1GCTB 3T2NA 3I77A 2FDAA 2J98B 1HAGE 1BJVA 2FI3E 1GMDG 2NWNA 2BQ6B 3P8NA 3N99A 3VB4A 4GUXA 1VCWA 1QTFA 1SQOA 2J38A 1TRMA 2BZ6H 3KN2A 3S7KB 1V6DA 3U69H 3NZIA 2DE8A 4BAQB 1VCPA 3KEEA 1XVMA 1IOEA 1UCYH 1HCGA 4Y8YA 2HLDD 1EOLA 1O3HA 1L1GA 1W0ZU 2QV1A 2A4GA 3ITIA 2GV7A 1MKWH 4AFSA 5HIYA 4WXVA 1ELGA 2OCVB 1FDPA 4OS1A 2HALA 1O34A 1AWHB 1O2IA 2Y5HA 3E8LA 1FV9A 1LVMA 1RTLA 2ASUB 2B8OH 1NM6A 3A83A 3QZRA 4TWYA 3BG8A 5EJZA 1O35A 3MO9A 1BTHH 2XC5A 2ZU4A 3M5NA 5DP9A 2ZGJA 2BY8X 2C3SA 1EZXC 3PB1E 3TH3H 3GCNA 6GCHF 1MUEB 1TMBH 1E0FD 3MU4A 1ELCA 3MWIU 3BTHE 3PWCA 1SSXA 1DUAA 1UJ1A 2AIQA 4MPWA 3D23A 3ATIA 1RS0A 1HDTH 2ZPQA 1IQIA 1C1RA 4E7NA 2WPKS 4HI3A 1QRXA 3ZVFA 3SOSA 2R0LA 3RXJA 1VGCC 1HAZB 5CDFE 1FY5A 3MH7A 1OWDA 4AFZA 2RG3A 1EXFA 1DANH 3P17H 2AH4X 3SU3A 1FAXA 1HAPH 1O2WA 5H4IB 3M5LA 4CRDA 2FOBA 1EAXA 2V3OH 4HFPB 2PKAA 4H42U 2HOBA 3TK6A 2BDAA 1SQTA 2FOHA 1KLJH 4WH6A 1LQDB 5T6DA 3FZZA 1T8LA 3RXPA 3UUZA 4XSKU 1HAYB 1ZMNA 3RXKA 3Q00A 2L6OA 1LHDH 1F5RA 1UTPA 2VNTA 2Z9JA 4HGCA 1QY6A 1FQ3A 4DGJA 3RXEA 1HYLA 4IMQA 2ZDMA 3ZZDA 1GJ4H 3SV9A 5C0UA 1PPEE 1AVWA 1SGPE 1PPFE 1EZSC 3GCTG 1OX1A 2Q6GA 2KX4A 2ZQ2A 4CH2B 5C20A 1OWIA 2ZFSA 4JCNA 1SC8U 3OTPA 1JOUB 3TIUA 1TB6H 1PQ8A 3PRBA 4B74A 1P2OA 4LZ4B 1CT2E 5JB9S 2FOFA 1GCDA 1GBHA 2NU1E 3VB5A 1TALA 3MU8A 4IC5A 3U98H 2P16A 1MBMA 4Y8ZA 1HLTH 3PO1B 1GBKA 1XUIA 4ZROA 5ETXA 1O3KA 3KIDU 5GJ4B 1YYY1 3W1EA 4K5ZA 1VR1H 2F43B 4GVUA 1W2KH 2JH6D 3MNBA 1T7CA 1CA0B 1DE7H 4TWWA 1SMFE 1TA2A 1TGSZ 1UTJA 1Y3XA 5DO4H 1GDQA 2FESH 4MPVA 1S6FA 1QCPA 7GCHG 1S6HA 1MTSA 4GAWA 3P95A 5T6FA 4TSFD 3W94A 3RXVA 1TNIA 1AZZA 1P02A 1GHVH 2GVFA 5F6MA 3AK5A 2W5EA 1BHXF 2QXHA 3O8RA 1PQ5A 1ZTKA 3EAJA 3OYPA 1BBRE 5A0BA 1XUFA 3B9FH 3IITA 1CGHA 2TRMA 1C5QA 4TPYA 1W3CA 4XBCA 2P8OC 4DURA 1S0RA 2BY9X 2ZCKP 2BD4A 1T8OA 2LP6A 1TNHA 1LHEH 1ARCA 3UQVA 1FY8E 3H7OA 2KCAA 1CHGA 1GI8B 2QN5T 4J2YB 4ZHAA 2P3TB 2K0QA 1RTFB 2VIPA 4D76A 9ESTA 1P2KA 1GHYH 1AVXA 2JH0D 3K9XB 4WVPE 2ZF0H 5FX6A 2FOMB 1EATA 2HNTE 3D65E 4CR9A 1JIMA 1Y5AT 3ESTA 1F0UA 3GCOA 3N7EA 4UFDH 1IQGA 5C1UA 3ZZCA 3MH5A 4ZH8A 3M3TA 1T31A 5C5OA 1UW7A 4FU9A 3F68H 1KLIH 1SKYE 3QGNB 3F0PA 1THPB 4AFUA 1OHHD 4SGBE 1YLNA 3DA9B 1HIAA 1QBOA 2EI8A 2D26C 4FUCA 1ZHRA 3URDA 1NY22 3SYJA 4A7IB 3H7TA 2ZU5A 4I8JA 3SUEA 3ZYDA 1F5KU 1O3BA 3A8DA 2XBXA 3FN8A 1O2NA 1NS3A 3UPEA 1ABIH 1WSSH 3MNCA 3TITA 1NN6A 2R3YA 2Z3EA 1S84A 1LVBA 3O8DA 1S5SA 4WH8A 1AU8A 1HJ9A 4ASUD 4ABHA 1UTOA 3MNSA 4AYVB 1O30A 1AB9B 1IQKA 1W14U 2ZHQH 3GDSA 4HG6A 1EJNA 4R8TB 3D49H 2XC0A 4NGAH 3NKKA 2WPHS 1O2QA 3LJJA 2PKSC 1SQAA 2BDYA 4LOYH 1FIZA 1Q31A 3TGJE 4RT1A 1LTOA 1NFYA 4FU7A 5EIYA 5HGGA 1P2IA 5GCHF 2O8LA 2VVUA 1SLVB 4LXBH 1HAVA 2WYJA 2BVRH 3GCHB 3TK5A 4Y6DA 2OBQA 1EP6A 1GL1A 2VB0A 5DJ7A 4AGKA 1Y8TA 3AAUA 1A1RA 1VJ9U 1DFPA 5L2ZH 2RFKC 1W0KD 4IW4E 2BLOA 3TJNA 3P8FA 4MNXA 1CE5A 4YO9A 3ATWA 1TMUH 1EASA 1QJ6B 1QFKH 1ZOMA 3F3BA 1C5OH 3ZVEA 1GBDA 2TGPZ 4ISLA 1V2ST 2PTCE 4FOUC 1YC0A 1O2OA 1UVSH 2GGVB 4INLA 1EAWA 1P03A 1FN6A 4A1VA 1ZSKA 1GMHG 1GI0A 2IJOB 1FONA 2XWAA 3NWUA 3PTNA 4H6TA 8GCHG 1P3EA 5E0GA 3OSYA 1KXCA 4WMFA 5HIZA 4J1YA 2KZ4A 1K1IA 1SOZA 3A7VA 3U8OH 1GI2A 3SHAH 3SU6A 1JRSA 1TRYA 3DSGA 1OWHA 2A0QB 4K1EA 1BTZA 1Z8JB 4IMZA 3E91A 3ZVDA 4BXSA 2M2AA 1YPLH 3HPTB 4XRNA 2LELA 1ZJKA 3A89A 4NWKA 2KM0A 4X2WA 2BDCA 4Q63A 3LJOA 3RXHA 4A1XA 2L74A 1YPHC 4U32A 4ZHMU 1P01A 1GJDB 1QURH 2CK3D 2PTNA 5EXNA 1N8OC 3R3GB 1CSOE 1YKTA 3S9BA 3QWCH 5CHBA 1NFXA 3KYFA 4CRAA 3B8JA 3HKIB 5FBIA 1FY4A 1ABJH 2ULLA 2QCYA 3LH1A 3OEED 1OPHB 1CO7E 3AW1A 2ZTYA 1GBCA 1KTSB 1NZQH 4Z1MD 5GNDA 3WWFA 1P9UA 1KTTB 1GI3A 3FP7E 3LGTA 3KL6A 1C4U2 1DOJA 1FLEE 1OYQA 3DD2H 1TNLA 2FTMA 5E2OA 1MTWA 4KKDA 1G3CA 2AYWA 2O8MA 1TBRH 4BANB 4O3TA 1GBBA 5EODA 5DKMA 2SGAA 2QA9E 9LPRA 1C5TA 1BMNH 2RA0A 3FO8D 4Y79A 3V0XA 3DCLA 4NIVA 2ZDLA 1SLUB 4UFEH 2BB4A 1A2CH 1P0SH 1W10U 4ABGA 3FZDA 4X1SU 2BOKA 4AB8A 4OS7A 2IPQX 2GZ7A 4GCHF 2SGFE 2HLCA 5E2PA 1XUGA 2OUAA 3RDZA 1LPKB 3BN9A 4M7GA 1DWCH 1A5GH 2XBWA 3MHWU 2EEKA 3GY3A 4Z6AH 4P00A 1TPSA 5C17A 1DT2A 1H8DH 2H2ZA 4NZQA 1XUKA 2OC8A 4FUJA 1O3LA 2QAAA 1Y5BT 2FWWA 1GVKB 1ELDE 3GY7A 1ZZZA 4U30A 1B0FA 4FUFA 1BB0B 2PLXA 3PV5A 5E0JA 1Y3VA 1HNEE 1SPJA 1WOFA 2ZHEH 2GDEH 3F0OA 3ZZ8A 4I8LA 2BDHA 1C1PA 1OXGA 2ZCLP 4X6MA 1VGCB 1V2PT 3STJA 5HKKD 1BOQA 4RSPA 2A4QA 3MFJA 3L3TA 1RFNA 1L1NA 3CNRA 4BTTB 4Y11E 1P10A 4B6FA 3E0NB 2UWLA 3ZVCA 4JMYA 2ZFRH 3RXDA 3GYLB 1VCQA 4X0WU 1ANDA 3MU5A 3S9AA 3MOCA 1ESTA 3I29A 1C5XB 1AB9C 2G5NA 2ZGHA 4M9FA 1BTXA 2ESTE 2F4LA 3RXQA 2P95A 2XXLA 1W13U 1BBRH 3TK9A 4K1TA 1TX6A 4MDSA 3SZNA 1WTGH 4K69A 5AFZH 2OC0A 3ATMA 5C5NA 2GT8A 4Y71A 1CA8B 2BVXH 1EPTB 4DG4A 1C2DA 1G3BA 2O9QA 3GCHC 3RU4D 3SO3A 1GVZA 2GMTB 2G00A 3EQ0H 4ZUHA 4IC6A 1K0HA 3F2FA 2ANWA 2ZDVH 1LHCH 2Q1JA 5EGMA 1O3DA 1A3BH 3SU2A 3OE7D 3T26A 1DX5M 1AMHA 1ZPCA 3RUOA 2J98A 4ISIH 3PWBA 5IYTA 3UY9A 1SQRA 2A7JA 3T28A 2QY0B 2H5DA 3QUMP 2V6NA 1QHRB 1AHTH 1PPBH 2SGDE 2LPRA 1TA6A 2OQ5A 2FOAA 2OD3B 3PMAB 4Y0YE 3VXEH 3VGCC 4CRGA 2SNWA 3I78A 2QXIA 2F9UA 3RM2H 3EA8A 3UREA 1RXPA 3ELAH 3M7TA 3ZVAA 2J95A 4JYUH 1SI5H 4RI0A 4I8GA 3D62A 3HATH 4GPGA 1SOTA 2YNAA 3QO6A 4GHTA 3TU7H 2W3KA 2SGPE 4AZ2B 1TGTA 5TCCA 5DK1A 1ELBA 1S83A 1TYNA 1J8AA 1ETRH 4B2CA 4FUIA 4ABIA 2XNDD 2P8OB 2KAIB 4WXIA 2ZWLH 1W8BH 5DN6D 4IN1A 3UNQA 4P02A 3SHCH 3SZEA 4CR5A 1UTMA 2B9LA 1UMAH 2BM2A 1F0TA 1UHBA 1F0SA 2D1JA 3RXAA 3RXTA 1JWTA 2WHXA 1KY9A 1OWEA 3FFGA 1NC6A 4D9QA 2EI6A 1JBUH 1GHAF 1BZXE 1GL0E 2TGTA 2TGAA 1O32A 3IWMA 2H5CA 1EJMA 1C1OA 1IHSH 3ODFA 4O3UA 1RJXB 2VIOA 1BDAA 2AMPA 4I7YH 1C2JA 1E37B 1AKSA 2I6QA 3G01A 1C2LA 5PTPA 1RIWB 2R3UA 1Z7KA 4MNVA 1VZQH 4TY7A 4X6PA 1AUJA 3RLYH 1GBFA 3GY8A 1V2KT 1VITH 3H5CB 2JH5D 1FY1A 1O2HA 4BAKB 5IDKA 5LGOA 1C5PA 1PPHE 2FO9A 1NU9A 1FXYA 4WMEA 4NIWA 3W95A 1CT4E 1O2JA 1GJ7B 3RMMH 1J9CH 4INKA 5C3NA 1XUJA 3OY6U 1O2PA 2A5KA 1SGTA 1QIXB 1LCYA 3KF2A 2YOLA 2AMDA 3F9GA 3SBKA 2PUXB 1VITF 1MZAA 1A3EH 2G4UA 4ACBA 1SLWB 1Q2WA 5KECA 1IQMA 8ESTE 3V12A 8LPRA 1BMFD 1YCPH 1FN8A 2HWLB 2TPIZ 2XW9A 3GDVA 5EJLA 4Z0KA 4FUEA 3S9CA 2PKSB 1DDJA 1L4DA 3TH2H 5EQSA 1SGFA 1AQ7A 1P04A 3M3SA 3GY2A 3RP2A 3SV8A 3SV2H 5EXLA 1GGDC 1H4WA 3KQBA 1XX9A 2PHBA 1EQ9A 1FPHH 1KXAA 1GI9B 1UVTH 1O3GA 1ANEA 2EI7A 1O3NA 1ELFA 3E90B 5E8EH 1ZTLA 1MMJN 5SGAE 2GDDA 4DIIH 1THSH 4TYDA 3U1IB 4KELA 1EB1H 2Y7ZA 1AE8H 2BD9A 3FOAA 2GCHF 2FTLE 2JETC 1SB1H 4NCYA 4XDEA 3RMOH 6CHAC 4DOQA 1BQYA 4ABAA 1EFRD 4X2XA 2NU4E 2Y7XA 3RC4A 1HAIH 1TMTH 3C27B 2B7DH 1PJPA 1FJSA 3QK1A 2A7CA 1TPAE 4B75A 4FUHA 2VJ1A 5I25A 3R0FA 2BDBA 1ELAA 4DIHH 1CHOF 1D3DB 3K6YA 1AVGH 3SUDA 1E38B 3S7HB 3RXIA 1D3PB 2TGDA 2K8IA 1EPTC 1C5YB 2BZAA 2ZCHP 2FOGA 1K21H 1BMLA 1K1JA 1E34B 4ZXYH 4ISNA 1K1OA 2GMTC 1V2NT 1GVLA 2Z9GA 3BTTE 1GI6A 1T4VH 1XXFA 3URCA 1N8OB 1D6WA 1BUIA 1GPZA 1GJ8B 1RRKA 2F9NA 2GV6A 1YCPK 4YXWD 3OFND 4ZKOU 5F8XA 2G4TA 5LPFA 1YPJH 1YWUA 2CMYA 1N6YA 1A46H 1QA7A 3BIVH 4I86A 4MQAA 1GG6C 4NG9H 2J2UA 1UVUH 3ZZBA 1G37A 4YM9A 3E0PB 1K22H 1GHBG 2ZDAH 3NCLA 1OOKB 5EQRA 3SU1A 1V2TT 1ETSH 4I32A 2W7UA 3SNEA 3RXSA 5EG4A 2J97A 2A45B 2V7QD 1DXPA 3A84A 5ESBA 5GDSH 4Y76A 1TQ0B 2ZEBA 3OX7U 3A80A 3P6ZB 1CGIE 3T27A 2R0KA 2Y82A 3SORA 1P2JA 2Z3DA 4FVDA 4RT0A 2W7SA 2D2DA 3K65B 1GMDF 2EC9H 2Z9LA 1TGBA 1V2UT 3SN8A 1NT1A 3HGPA 2CHAB 1TWXB 1P3CA 2K1QA 2ZDNA 5T3HA 2CN0H 3ZZ3A 1C2EA 1WTHD 2PKAB 4DY7B 2IJD1 4YLQH 1INCA 5FAHA 2PSXA 3SNDA 2ZU3A 1OP0A 3ZZ7A 1GJCB 1SFIA 4X1RU 4X1PU 1TX8A 1MBQA 1TX7A 1C1MA 5C1YA 5JDUB 1B7XB 1XKBC 3ATLA 1QBNA 3VG8A 2WUBA 2O8WA 4WY3A 2ANMH 1GJBB 2GX4A 1AO5A 4D7GA 4F49A 3BTDE 2Y6TA 2ZZUH 3KCGH 1QB6A 3F1SB 1DWBH 2WPIS 1FX0B 2P3UB 1E1QD 3GDUA 1FPCH 4YZUA 4XD7D 1RIWC 1ANBA 3UTUH 1O33A 5DPAA 1XUHA 3F6UH 2WZQA 3E1XB 2VIVA 3M5MA 1QA0A 1SG8B 1HBTH 1NROH 4ABJA 3MNXA 4OGYA 5A09A 1EUFA 1C5LH 3DSOA 1DM4B 2XTTB 1BA8B 3QZQA 3RMLH 3SQEE 1ID5H 1NRNH 1QJ7B 2J94A 2LNCA 2WSSD 3NXPA 4KGAA 4OGXA 4ABFA 1Z6JH 5HXFA 1D4PB 1SGYE 2C90B 3UOPA 2QF3A 1LVOA 1ZHPA 1V2JT 1FY3A 5BPEA 1MAXA 3KGPA 4GCHG 3PV2A 4FUDA 3EA9A 2FYRA 4JZIA 4AFQA 1IQHA 4F55A 7KMEH 5C67A 2RA3A 1D3QB 1NFWA 3UNSA 2THFB 1NBME 4INHA 1FNIA 4MG3A 1WQSA 5FPSA 4AB9A 1C1WH 1WDIA 4Y10E 1W0YH 2ZHDA 3S0NA 2F83A 3HK3B 1BCUH 4ISOA 1UVPA 1KDQA 4Q80A 2P3FH 1C5NH 1O2SA 4GHQA 3RXCA 5DSFA 1GMCG 2GKVE 1YM0A 1C5MD 3N7DA 1AFEH 2Y5FA 6LPRA 1C2IA 3EE7A 3VPKA 1KXFA 2Z6BD 1C9TA 3GCTF 1DUEA 2G55A 2CV3A 2QXGA 1QB1A 3FP6E 3SNBA 2A4RA 3DT0H 4ZKSU 1GDNA 1C1TA 5JYIA 3UR6A 1C5ZB 1QR3E 2UUYA 4FU8A 3M7UA 4CBOA 3OY5U 2PW8H 1P11E 1HB0B 2UUFB 2VWLA 1AGJA 1GJ5H 2C8WB 5TCAA 1ETTH 2FPZA 1ZSJA 2QF0A 2C93B 5A0AE 4NA7A 1AD8H 5F53A 3VGCB 4AX9H 2H9TH 4XE4A 1DSUA 1SGIB 4XBDA 2SGQE 1HIAB 1L2EA 2BDIA 1PPGE 1IAUA 4AORA 3AVZA 5K7RA 1O2KA 2BQ7B 4JZFH 5C0TA 4UDWH 3QX5H 1ZRKA 5A0CA 3LT3A 7GCHF 1ZR0A 4O03A 1P09A 1AWFH 1BTPA 2XYAA 2HRVA 4F4OC 1ZSLA 1TONA 3BTEE 4U01A 2FYQA 1RGQA 1NRSH 2VH6A 4OS4A 3UQOA 2BD7A 2VU8E 1ZGIA 2CF8H 3ZVGA 2VH0A 2KR7A 1G30B 1BITA 1BMAA 2F9BH 1O3FA 2JDID 1O3CA 3LPRA 5FX5A 2RDLA 1TBZH 5ESTE 2VIDA 1O5EH 4ZKNU 3V7TA 2AFQB 3RXFA 1P05A 1KYNA 3LU9B 1AIXH 2FEQH 2VIWA 1O2ZA 2SNVA 2TIOA 3A7ZA 3LDXH 2STBE 2VWOA 1HAVB 2ODYB 5FCKA 2BX3A 1GI4A 5AFYH 2HNTC 4K60A 1MTNC 2F91A 3PTBA 1HUTH 1YCPM 2BY6X 5FBEA 1ZRBA 5JB8S 3KHVA 4FUGA 5HMAA 1UK4A 5EJ1A 1BHXB 2BX4A 2CXVA 2BD3A 1P2QA 4Y7AA 2XWBI 2KCPA 5BRRE 2CHAC 1MU6B 3EDXB 4B1TA 2WINI 1C5SA 2WUCA 1F5LA 2HPQH 2ZGBH 5LPRA 2FIRH 4JYTA 4X8SH 4KTUA 1BRCE 1PYTD 1WU1A 4GSOA 2WPMS 4X8UH 1ZLRA 2ODPA 3GISB 1A5IA 3OEHD 4DW2U 1KXEA 1CQQA 1GBAA 1D6RA 1K1LA 1MCTA 3V3MA 3P70B 3TGKE 2OQUA 5DP7A 5IK2D 1QNJA 3LGVA 1S81A 3IG6B 3RLWH 3TVJB 3OU0A 3U9AH 2VINA 1GHZA 3DFJA 2XNIA 1OSSA 1BTWA 1WQVH 4RKJB 2SFAA 1IQEA 2BYAX 3SUFA 4FETA 2VIQA 1GGDB 1N1LA 1T8NA 3SGAE 1TPPA 4Y8XA 3TH4H 1O2TA 1AZ8A 1K28D 4F48B 3LONA 3DHKH 3RU4T 1SGNE 1O3JA 4TPIZ 1Z6EA 4AC9A 1TFXA 1FMGA 1HAXB 1G32B 1TRNA 4JZDH 1V2MT 2ZA5A 1EB2A 3Q3XA 3CP7A 3P8OA 1YLDA 1YPEH 4K8YA 3ATKA 4ACAA 2JETB 6CHAB 1H8IH 2HVXA 1WAYB 3BTGE 1NESE 1P8VC 2F9PA 1CT0E 2NU3E 3EGKH 5DP8A 3AAVA 2F3CE 4U2WA 3STIA 2AS9A 3VXFH 2PGBB 1GBLA 2IPHA 4KTSA 1OYTH 1ARBA 2Y81A 4JK6A 2BTCE 6GCHG 1TNJA 3PRDA 1CU1A 2KAIA 2BLQA 5EW1H 4YESB 2XBYA 5DP5A 1GMHF 1OWJA 1ZPBA 1S85A 1P2MA 4XFQA 1ELEE 1GBEA 1O0DH 1MTUA 1PFXC 2IOTA 2V0BA 3AASA 4ISHH 1H9IE 1AY6H 1Y59T 2WPLS 2GZ9A 2H1UA 4LK4A 2GD4B 4LZ1H 1PYTC 1ZJDA 3SJKA 6ESTA 3KQDA 1QGFA 1BIOA 1H1BA 4Q2KA 1OS8A 2ALPA 3ZVBA 4ASHA 4DVAU 3T25A 5KEDA 2AEIH 3E6PH 4Y7BA 3WWBA 1AI8H 3A82A 1PQAA 1EJAA 3B23B 1Y5UT 3MQKC 1GG6B 1EAIA 3MO6A 4NSYA 1O3IA 3BEIB 5EOKA 1QL9A 2BXTH 3GY5A 1TOMH 4UEHH 1V2LT 3SGQE 4OS6A 4THNH 3T62A 1YPKH 3BEFB 3KQCA 4ZKRU 3FANA 3V13A 3F9EA 2OP9A 3E3TA 1ZMJA 4MPUA 4DT4A 4CH8B 2F9VA 2G81E 2QF5A 4MNWA 1DWDH 4NIXA 1F7ZA 1QBVH 1HFDA 5A8XA 5CE1A 2FLRH 5F03A 1A7SA 3QGJA 1H8ED 5EPYA 1IQNA 4WJG2 4SGAE 4E06H 3DUXH 4Q7XA 2WPDD 3KYGA 5AF9H 2ZTXA 1AE5A 4MTBA 1HJ8A 1LMWB 1O2YA 1PPZA 3UAIC 4ABEA 3LGUA 2ILNA 2BD2A 1TOCB 1LDTT 2BY5X 3RMNH 1NO9H 2PWXA 3PMJA 1HPGA 1SGRE 2C8XB 1W7XH 5FCRA 4X6OA 4JYVH 1LKAA 3Q3YA 3U8TH 3SU0A 4BXWA 4NA9H 5CHAB 2CF9H 4NFEA 1WBGB 1F2SE 2OTVA 1UK2A 4XOJA 1GBIA 1VKYA 1LVYA 2J34A 1S6LA 3MI4A 4ESTE 2GCTB 1AUTC 2M5TA 3A81A 1O31A 1C1VH 3VB6A 3SJ9A 5A8YA 1ELVA 5EXMA 3BF6H 3M7QA 3BEUA 1L4ZA 4VGCC 1C2GA 1UTNA 1O2XA 3K6ZA 3NPSA 4A1TA 2FI5E 2XC4A 1YP9A 3GOVB 3VB7A 1OP2A 2YMSB 4XBBA 2GP9B 1IQJA 1Z1JA 3WW7A 3UIRA 3UNRA 2DUCA 3UOUA 3CS0A 2ANKH 2VBCA 3M36A 1GBJA 3PM3A 1ZMLA 2BMGB 1G3DA 1OKXA 4CREA 1V2WT 5T6GA 1UTLM 1KMHB 5JBCS 7ESTE 1BMMH 2RDEA 4MLFB 4MNYA 5HM2A 3VEQB 2A2XH 1G2LA 1X7AC 1B0EA 5EU8A 3M61U 1P57B 3LGWA 1H8HD 3H09A 5T1VA 1THRH 3UB0A 3MTYA 1C2HA 2G8TA 3NUMA 5FPYA 2FI4E 3SW2B 3TLOA 1VJAU 2Z7FE 4K8BA 2HPPH 1UTQA 1C5VA 1Y3YA 3SJ8A 4ZCNA 2P59A 4B2AA 1HXEH 2TBSA 3A87A 1ELTA 2AMQA 4D7FA 4BAOB 2W6ID 3DSPA 2C8YB 1K1NA 4ZXXH 4YTAA 1UHBB 1Y3UA 1IHTH 1MKXH 3PV4A 3RXBA 2BLVA 1XKAC 2HGTH 2A7HA 2KFWA 3A7TA 1K1MA 1TQ7B 1YPMH 1HJAB 1NRQH 2FX6A 2RCEA 2OC7A 3UFAA 1C1QA 2OC1A 1O2UA 1TGCA 1HRTH 3LIWA 4AYYB 4CRCA 1Z1IA 4QT8C 3QTVH 2PFEA 3HK6B 1KIGH 3RXLA 2G5VA 2Q6FA 3RC5A 1MZDA 3O8BA 2FX4A 1AKSB 7LPRA 5ABWA 3BV9B 1K2I1 5DGJA 3JZ1B 1O3PB 1V2VT 2BY7X 4I33A 5DP3A 3SNAA 4AGJA 2WV9A 1FZZA 4DT7B 4B73A 4CRBA 4ABDA 4OM9A 2FOCA 1YY3A 4JZEH 1PPCE 3U1JB 1FIWA 5LH8A 3WY8A 1O2LA 5C2ZA 2CGAA 4O9VA 1DICA 1Z71A 3SJOA 5A2MH 4IN2A 4FVBA 4KTCA 3LGYA 5GCHG 3MMGA 1A5HA 1UCYK 1SL3A 3LOXA 1P06A 5A8ZA 1LHFH 4K2YA 3F2GA 4PROA 3A85A 3VB3A 1ACBE 1QL8A 4BAHB 1D9IA 2JIZD 1MKWK 2BHGA 1GHXH 2CJIA 2YMSD 3F2HA 3BTFE 1KLTA 2QYIA 5GXPA 1J17T 1ESBA 2JJ2D 2VGCC 1SHHB 2G51A 2ZFPH 1F0RA 1GI1A 3A8AA 1FUJA 4A5TS 1WCZA 2P94A 3ZZ5A 5FHTA 3RM0H 4YT7H 3CS7A 1SGCA 4YOJA 1AN1E 1LO6A 1QB9A 2ZU2A 3BTME 1FI8A 1O5AB 1Y3WA 1C5RA 4HTCH 3RXMA 1B5GH 1SHYA 2J5UA 2PGQB 3BTKE 5FL7D 3SU4A 1W12U 2F9OA 3TNSA 2Z3CA 5L6NH 3Q3KA 1W0JD 1Z8IB 3F9FA 4AG2A 1MKXK 1T32A 1W11U 5G4BA 1SGEE 2FMJA 4BTUB 3KQEA 1GHWH 1O5FH 4DCDA 1MTNB 1C4V2 1QRZA 3S69A 1DSTA 3BIUH 3PLKA 1L0ZA 2BDGA 2ZPRA 3ODDA 2A4OA 2BD5A 1FAKH 4UFFH 2EQNA 3U8RH 1NPMA 1E79D 2Z94A 2P93A 1EAUA 2B5TB 1G9IE 3RXUA 1BRUP 4H6SB 3ZZAA 1EZUC 1P2NA 3M3VA 1J15A 3SGBE 1TE0A 1A0LA 2WPJS 4X2YA 1YPHE 4ABBA 3PLBA 5DP6A 1DLEA 1IQLA 4YT6H 1AFQB 1LPZB 2PR3A 2V35A 1O2VA 5CHAC 2BOHB 1MU8B 2O8UA 3ENSB 3BG4C 2ZGCA 1JIRA 2I6SA 1BJUA 2GCTC 3GYMA 3VFEA 4A6LA 3ZYEA 2BQWB 1XXDA 3Q77A 2J4IA 2ZC9H 3MH6A 4ZMAH 4JK5A 4R0IA 1LQEA 4UE7H 2H6MA 1K9OE 1GCTC 5HYOA 2VVVA 4K1SA 4GLYA 1O3MA 1A0JA 4D9RA 2ZP0H 1MD8A 2YMSC 1TBQH 3ZV9A 1ZPZA 4CRFA 4CHAB 2ZFFH 2J92A 5JBTA 2QXJA 1RD3B 4Q4LA 3EA7A 2C4FH 2ZECA 4AOQA 3M35A 1HAHH 1O3AA 1COWD 1OWKA 1MABB 1DY8A 3QTOH 1QQ4A 2KCYA 1ZGVA 5AHGH 1NRRH 2BLWA 1C4Y2 1JRTA 3C1KA 2BVSH 2NU2E 1QL7A 1BTUA 2H9HA 1G2MA 2V3MA
chains in the Genus database with same CATH topology
3SV6A 2ZHWH 3RXGA 1TABE 1GDUA 5CMXH 1XMNB 2A5AA 1HAOH 1J16A 2OBOA 3HKJB 1BT7A 1KXBA 5GWZA 3P92A 5LPEA 1GBMA 1SGDE 4MVNA 3FVFB 4X8VH 1Q3XA 4ZHLU 2R2MB 3PMBB 1KXDA 3PMHB 1NFUA 3ZZ4A 2PSYA 4OS5A 4HZHA 1C1UH 1C9PA 2BXUH 2Z9IA 2IN2A 1YF4A 4MPXA 1LHGH 1HJAC 1YPGH 2GTBA 2BD8A 4NSVA 4TY6A 3A86A 1V2RT 3PLPA 3A8BA 4X2VA 1ZHMA 1UTKA 1UK3A 1O2MA 3MU1A 1T4UH 1DY9A 5GIBA 4YOIA 3UWIA 4B2BA 4X1QU 4WMDA 1UCYE 3Q76A 1UO6A 4RN6A 3LC3A 2QC2A 3SNCA 1GHBF 4X1NU 5EPNA 4IS5A 1D3TB 3FAOA 5JBBS 1ESAA 1GJAB 2WV5A 3SV7A 4AN7A 3FP8E 3SU5A 3QDZB 5GPIB 1MQ6A 5B6OA 1P12E 3UWJH 2Z9KA 1BTYA 1O36A 1UVOA 4A92A 1TIOA 1DS2E 1G3EA 3E16B 1H9LB 2UWPA 3BTQE 2WYGA 1SR5C 1ORFA 2AGEX 1K1PA 2UWOA 3T5FH 4E05H 4OS2A 3EE0B 5TJXA 1GWAA 1KDQB 1U6QA 5F8ZA 2W26A 2XCNA 3F9HA 1SGFG 2ZG0H 1EZQA 3LGIA 4IBLH 1CBWB 1DITH 5K0HA 2FODA 2QGRA 2JKHA 1W7GH 3PO1C 1SBWA 1WYKA 5L2YH 1S82A 1XM1A 2SGEE 1QJ1B 4VGCB 1ZTJA 1C2MA 1WUNH 1C5UA 1A61H 4ZAEA 4I8KA 1TLDA 2J9NA 3CENA 1ANCA 1O3OA 4NIYA 3SUGA 1E35B 1CA0C 4E7RG 1GI5A 2AGIX 1GJ6A 5FPTA 3LH3A 5EQQA 3ZV8A 1C5WB 3TJVA 1NTPA 3TJOA 2ZTZA 5AVDA 2D8WA 2UUJB 2ZHFH 2PV9B 1C2FA 1TNKA 4YOGA 1G36A 2Y80A 2XCFA 2FXRA 4Q7YA 1XVOA 1O5BB 2GZ8A 2ZGXH 4I31A 1HGTH 1H9HE 2FM2A 1YGCH 4AG1A 1MD7A 3M37A 2STAE 1E36B 3MU0A 1AFQC 1O2GH 2GT7A 3L6PA 1CGJE 1MTVA 2A1DB 3A7WA 3GY4A 1TGNA 1A0HB 1LPGB 3AW0A 1TAWA 4H4FA 5J4QA 5F8TA 1EPTA 1GHAG 1V2QT 1ZYOA 2ALVA 2FZZA 2Y5GA 2R9PA 5DP4A 1HV7A 3OTJE 1RTKA 1MAYA 4X6NA 4BOHA 3TGIE 1NRPH 1JXPA 2XBVA 3T29A 5DG6A 2FS9A 2FP7B 8KME2 1TNGA 2O8TA 3JZ2B 1Z8GA 3RU4E 1O39A 4BNRA 4I8HA 3RC6A 4CHAC 5E0HA 2PUQH 4Q7ZA 3KNXA 1C1SA 2ZKSA 3SI3H 4K3JA 1GMCF 1O5DH 2ZIQH 5L30H 1DXWA 3QN7A 2ZFTA 1EKBB 3NK8A 1DWEH 3O8CA 1OP8A 1BRBE 2WV4A 1A4WH 1M9UA 3EYDA 2ZU1A 4BTIB 1SVPA 2ZO3H 2FLBH 2AERH 1VITG 3UR9A 3N7OA 1SFQB 2R2WU 3RXOA 5JBAS 4JZ1A 2C8ZB 2AIPA 4IGDA 1IQFA 5I46H 1EP5A 2ZDKA 2VVCA 3M5OA 1O2RA 4UD9H 4YLUA 3BTWE 4D8NA 8GCHF 3LC5A 2YNBA 2OLGA 2QIQA 3ZZ9A 3LKWA 1MCVA 1O37A 1V2OT 2H9EH 1F92A 3GY6A 5FXLA 2A31A 1L1JA 1GI7B 2UUKB 1TPOA 3SI4H 3RXRA 2VWNA 4NWLA 1QQUA 1BRAA 1N6XA 2VGCB 1O5CB 3PYHA 2DE9A 3A7XA 1WV7H 2FS8A 1YBWA 1DPOA 3A7YA 3A8CA 4UONA 3GICB 3SJIA 3TJUA 1CVWH 1O3EA 2GCHG 4CBNA 4Y0ZE 3TNTA 1QRWA 4X8TH 3SQHE 5C1XA 3MYWA 3K2UA 5EW2H 4BAMB 3HGNA 1Z8RA 2ZI2H 1NU7B 1MQ5A 4B76A 3TPIZ 1EOJA 2A2QH 1T8MA 1C2KA 1O38A 2ODQA 1EX3A 3QLPH 1KSNA 3L33A 1DLKB 4FUBA 5HM9A 2ZQ1A 1CHOG 1P9SA 2A5IA 2ZPSA 1JMOH 5J4SA 4WF8A 3P8GA 1J14A 4FXGH 1SLXB 4O97A 2HNTF 1YLCA 1LKBA 5JPMH 3DFLA 3A88A 2ZNKH 1DVAH 2NU0E 2A32A 2B0FA 1O5GH 4KP0A 2W3IA 4NZLA 2Q6DA 4DJZB 3MO3A 3PROA 3BG4B 2AGGX 1HXFH 2ZFQH 1V3XA 3MH4A 2V3HH 2ANYA 2VWMA 4NA8A 1CBWC 1PQ7A 3ZZ6A 2XRCA 4NFFA 2OXSA 3BSQA 1GBTA 4UFGH 4RKOB 1SGQE 1S0QA 2EA3A 2FOEA 2OINA 1GJ9B 1MH0A 4B71A 1C1NA 1BBRK 2G52A 4WWYA 1GCTB 3T2NA 3I77A 2FDAA 1HAGE 1BJVA 2FI3E 1GMDG 2NWNA 2BQ6B 3P8NA 3VB4A 4GUXA 1VCWA 1QTFA 1SQOA 2J38A 1TRMA 2BZ6H 3KN2A 3S7KB 1V6DA 3U69H 3NZIA 2DE8A 4BAQB 1VCPA 3KEEA 1XVMA 1IOEA 1UCYH 1HCGA 4Y8YA 1EOLA 1O3HA 1L1GA 1W0ZU 2QV1A 2A4GA 3ITIA 2GV7A 1MKWH 4AFSA 4WXVA 1ELGA 2OCVB 1FDPA 4OS1A 2HALA 1O34A 1AWHB 1O2IA 2Y5HA 3E8LA 1FV9A 1LVMA 1RTLA 2ASUB 2B8OH 1NM6A 3A83A 3QZRA 4TWYA 3BG8A 1O35A 3MO9A 1BTHH 2XC5A 2ZU4A 3M5NA 5DP9A 2ZGJA 2BY8X 2C3SA 1EZXC 3PB1E 3TH3H 3GCNA 6GCHF 1MUEB 1TMBH 1E0FD 3MU4A 1ELCA 3MWIU 3BTHE 3PWCA 1SSXA 1DUAA 1UJ1A 2AIQA 4MPWA 3D23A 3ATIA 1RS0A 1HDTH 2ZPQA 1IQIA 1C1RA 4E7NA 2WPKS 4HI3A 1QRXA 3ZVFA 3SOSA 2R0LA 3RXJA 1VGCC 1HAZB 1FY5A 3MH7A 1OWDA 4AFZA 2RG3A 1EXFA 1DANH 3P17H 2AH4X 3SU3A 1FAXA 1HAPH 1O2WA 5H4IB 3M5LA 4CRDA 2FOBA 1EAXA 2V3OH 4HFPB 2PKAA 4H42U 2HOBA 3TK6A 2BDAA 1SQTA 2FOHA 1KLJH 4WH6A 1LQDB 5T6DA 3FZZA 1T8LA 3RXPA 3UUZA 4XSKU 1HAYB 1ZMNA 3RXKA 3Q00A 1LHDH 1F5RA 1UTPA 2VNTA 2Z9JA 4HGCA 1QY6A 1FQ3A 4DGJA 3RXEA 1HYLA 4IMQA 2ZDMA 3ZZDA 1GJ4H 3SV9A 1PPEE 1AVWA 1SGPE 1PPFE 1EZSC 3GCTG 1OX1A 2Q6GA 2ZQ2A 4CH2B 5C20A 1OWIA 2ZFSA 4JCNA 1SC8U 1JOUB 3TIUA 1TB6H 1PQ8A 4B74A 1P2OA 4LZ4B 1CT2E 5JB9S 2FOFA 1GCDA 1GBHA 2NU1E 3VB5A 1TALA 3MU8A 4IC5A 3U98H 2P16A 1MBMA 4Y8ZA 1HLTH 3PO1B 1GBKA 1XUIA 4ZROA 5ETXA 1O3KA 3KIDU 5GJ4B 1YYY1 4K5ZA 1VR1H 4GVUA 1W2KH 2JH6D 3MNBA 1T7CA 1CA0B 1DE7H 4TWWA 1SMFE 1TA2A 1TGSZ 1UTJA 1Y3XA 5DO4H 1GDQA 2FESH 4MPVA 1S6FA 1QCPA 7GCHG 1S6HA 1MTSA 4GAWA 3P95A 5T6FA 3W94A 3RXVA 1TNIA 1AZZA 1P02A 1GHVH 2GVFA 5F6MA 2W5EA 1BHXF 2QXHA 3O8RA 1PQ5A 1ZTKA 3EAJA 3OYPA 1BBRE 5A0BA 1XUFA 3B9FH 3IITA 1CGHA 2TRMA 1C5QA 4TPYA 1W3CA 4XBCA 2P8OC 4DURA 1S0RA 2BY9X 2ZCKP 2BD4A 1T8OA 1TNHA 1LHEH 1ARCA 3UQVA 1FY8E 3H7OA 1CHGA 1GI8B 2QN5T 4J2YB 4ZHAA 2P3TB 1RTFB 2VIPA 4D76A 9ESTA 1P2KA 1GHYH 1AVXA 2JH0D 3K9XB 4WVPE 2ZF0H 5FX6A 2FOMB 1EATA 2HNTE 3D65E 4CR9A 1JIMA 1Y5AT 3ESTA 1F0UA 3GCOA 4UFDH 1IQGA 5C1UA 3ZZCA 3MH5A 4ZH8A 3M3TA 1T31A 5C5OA 4FU9A 3F68H 1KLIH 3QGNB 1THPB 4AFUA 4SGBE 3DA9B 1HIAA 1QBOA 2EI8A 2D26C 4FUCA 1ZHRA 3URDA 1NY22 4A7IB 3H7TA 2ZU5A 4I8JA 3SUEA 3ZYDA 1F5KU 1O3BA 3A8DA 2XBXA 1O2NA 1NS3A 3UPEA 1ABIH 1WSSH 3MNCA 3TITA 1NN6A 2R3YA 2Z3EA 1S84A 1LVBA 3O8DA 1S5SA 4WH8A 1AU8A 1HJ9A 4ABHA 1UTOA 3MNSA 4AYVB 1O30A 1AB9B 1IQKA 1W14U 2ZHQH 3GDSA 4R8TB 1EJNA 3D49H 2XC0A 4NGAH 3NKKA 2WPHS 1O2QA 3LJJA 2PKSC 1SQAA 2BDYA 4LOYH 1FIZA 1Q31A 3TGJE 1LTOA 1NFYA 4FU7A 5HGGA 1P2IA 5GCHF 2O8LA 2VVUA 1SLVB 4LXBH 1HAVA 2WYJA 2BVRH 3GCHB 3TK5A 4Y6DA 2OBQA 1EP6A 1GL1A 2VB0A 5DJ7A 4AGKA 1Y8TA 3AAUA 1A1RA 1VJ9U 1DFPA 5L2ZH 4IW4E 2BLOA 3TJNA 3P8FA 4MNXA 1CE5A 4YO9A 3ATWA 1TMUH 1EASA 1QJ6B 1QFKH 1ZOMA 1C5OH 3ZVEA 1GBDA 2TGPZ 4ISLA 1V2ST 2PTCE 1YC0A 1O2OA 1UVSH 2GGVB 4INLA 1EAWA 1P03A 1FN6A 4A1VA 1ZSKA 1GMHG 1GI0A 2IJOB 1FONA 2XWAA 3NWUA 3PTNA 4H6TA 8GCHG 1P3EA 5E0GA 3OSYA 1KXCA 4WMFA 4J1YA 1K1IA 1SOZA 3A7VA 3U8OH 1GI2A 3SHAH 3SU6A 1JRSA 1TRYA 1OWHA 2A0QB 4K1EA 1BTZA 1Z8JB 4IMZA 3E91A 3ZVDA 4BXSA 1YPLH 3HPTB 1ZJKA 3A89A 4NWKA 4X2WA 2BDCA 3LJOA 3RXHA 4A1XA 1YPHC 4U32A 4ZHMU 1P01A 1GJDB 1QURH 2PTNA 5EXNA 1N8OC 3R3GB 1CSOE 1YKTA 3S9BA 3QWCH 1NFXA 4CRAA 3B8JA 3HKIB 5FBIA 1FY4A 1ABJH 2ULLA 2QCYA 3LH1A 1OPHB 1CO7E 3AW1A 2ZTYA 1GBCA 1KTSB 1NZQH 1P9UA 1KTTB 1GI3A 3FP7E 3LGTA 3KL6A 1C4U2 1DOJA 1FLEE 1OYQA 3DD2H 1TNLA 2FTMA 5E2OA 1MTWA 4KKDA 1G3CA 2AYWA 2O8MA 1TBRH 4BANB 4O3TA 1GBBA 5EODA 5DKMA 2SGAA 2QA9E 9LPRA 1C5TA 1BMNH 2RA0A 4Y79A 3V0XA 4NIVA 2ZDLA 1SLUB 4UFEH 2BB4A 1A2CH 1P0SH 1W10U 4ABGA 3FZDA 4X1SU 2BOKA 4AB8A 4OS7A 2GZ7A 4GCHF 2SGFE 2HLCA 5E2PA 1XUGA 2OUAA 3RDZA 1LPKB 3BN9A 4M7GA 1DWCH 1A5GH 2XBWA 3MHWU 2EEKA 3GY3A 4Z6AH 1TPSA 1DT2A 1H8DH 2H2ZA 4NZQA 2OC8A 1XUKA 4FUJA 1O3LA 2QAAA 1Y5BT 2FWWA 1GVKB 1ELDE 3GY7A 1ZZZA 4U30A 1B0FA 4FUFA 1BB0B 2PLXA 5E0JA 1Y3VA 1HNEE 1SPJA 1WOFA 2ZHEH 2GDEH 3ZZ8A 4I8LA 2BDHA 1C1PA 1OXGA 2ZCLP 4X6MA 1VGCB 1V2PT 3STJA 1BOQA 4RSPA 2A4QA 3MFJA 3L3TA 1RFNA 1L1NA 4BTTB 4Y11E 1P10A 3E0NB 2UWLA 3ZVCA 4JMYA 2ZFRH 3RXDA 3GYLB 1VCQA 4X0WU 1ANDA 3MU5A 3S9AA 3MOCA 1ESTA 3I29A 1C5XB 1AB9C 2G5NA 2ZGHA 1BTXA 2ESTE 3RXQA 2P95A 2XXLA 1W13U 1BBRH 3TK9A 4K1TA 1TX6A 4MDSA 3SZNA 1WTGH 4K69A 5AFZH 2OC0A 3ATMA 5C5NA 2GT8A 4Y71A 1CA8B 2BVXH 1EPTB 4DG4A 1C2DA 1G3BA 2O9QA 3GCHC 3RU4D 3SO3A 1GVZA 2GMTB 2G00A 3EQ0H 4ZUHA 4IC6A 2ANWA 2ZDVH 1LHCH 2Q1JA 5EGMA 1O3DA 1A3BH 3SU2A 3T26A 1DX5M 1AMHA 1ZPCA 3RUOA 4ISIH 3PWBA 5IYTA 3UY9A 2A7JA 3T28A 2QY0B 2H5DA 3QUMP 2V6NA 1QHRB 1AHTH 1PPBH 2SGDE 2LPRA 1TA6A 2OQ5A 2FOAA 2OD3B 3PMAB 4Y0YE 3VXEH 3VGCC 4CRGA 2SNWA 3I78A 2QXIA 2F9UA 3RM2H 3EA8A 3UREA 1RXPA 3ELAH 3M7TA 3ZVAA 2J95A 4JYUH 1SI5H 4I8GA 3D62A 3HATH 4GPGA 1SOTA 2YNAA 3QO6A 4GHTA 3TU7H 2W3KA 2SGPE 4AZ2B 1TGTA 5TCCA 5DK1A 1ELBA 1S83A 1TYNA 1J8AA 1ETRH 4B2CA 4FUIA 4ABIA 2P8OB 2KAIB 4WXIA 2ZWLH 1W8BH 4IN1A 3UNQA 3SHCH 4CR5A 1UTMA 2B9LA 1UMAH 2BM2A 1F0TA 1UHBA 1F0SA 2D1JA 3RXAA 3RXTA 1JWTA 1KY9A 1OWEA 3FFGA 1NC6A 4D9QA 2EI6A 1JBUH 1GHAF 1BZXE 1GL0E 2TGTA 2TGAA 1O32A 3IWMA 2H5CA 1EJMA 1C1OA 1IHSH 3ODFA 4O3UA 1RJXB 2VIOA 1BDAA 2AMPA 4I7YH 1C2JA 1E37B 1AKSA 2I6QA 3G01A <