3TIUA

Crystal structure of sars coronavirus main protease complexed with an alpha,beta-unsaturated ethyl ester inhibitor sg82
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords SARS coronavirus main protease
publication title Crystal structures of SARS-Cov main protease complexed with a series of peptidic unsaturated esters
rcsb
source organism Sars coronavirus
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3tiuA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tiuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tiuA02
1O3LA 3GCHC 1CT2E 2GP9B 1TNIA 4MQAA 2AMPA 1VJAU 2FM2A 3OSYA 2Y7XA 2FWWA 3BEFB 4UEHH 2XBVA 3SNCA 1F0UA 5T3HA 2ZPRA 3UPEA 1CA8B 1EAUA 2BD3A 2BDBA 2ZFSA 1RTFB 2ZHFH 2AH4X 1PQ8A 4D76A 5LH8A 2F9NA 3SGQE 1MCVA 2M5TA 3SGBE 1TFXA 1YCPH 2GV6A 3ZVAA 1IQHA 1K2I1 1O39A 2F83A 4IBLH 4JZIA 1YCPM 1SQAA 4KGAA 2Z94A 4AORA 2HOBA 4WMFA 1GVKB 4Y7BA 1WV7H 4K8YA 2P3UB 3FZDA 3KCGH 1AKSB 6GCHF 1NO9H 1G3EA 3GYMA 1D3TB 1OX1A 1YPJH 3CS7A 3ENSB 3PMBB 4FUDA 1V2MT 4ISNA 2QN5T 2G5NA 1GJ9B 4YT7H 4OGYA 1VCQA 4X8VH 1SOTA 3MU8A 1MTWA 1GVLA 1VJ9U 4YZUA 2XCNA 1EPTB 2PLXA 3K65B 1NN6A 1S82A 4IMZA 2BY5X 1BTUA 1SLVB 3PLPA 1IQFA 3K6ZA 2O8LA 4NIVA 1MKXH 4K60A 2EI6A 1CU1A 1SLWB 1C2GA 2OCVB 3PMAB 4Q7ZA 1O3FA 4RSPA 1BTYA 3SHAH 1QQUA 4I7YH 4X1NU 1CA0B 2STAE 3HKIB 1NRNH 3RXUA 2VGCB 1C1SA 1QURH 3U98H 2G81E 4ESTE 4Q80A 1ZR0A 2ODYB 2ZQ2A 1C5YB 1W3CA 1UTPA 2ZNKH 3BN9A 3EE0B 3OU0A 4CRGA 5FAHA 1MKWH 1DXPA 2HPQH 2FESH 2AGEX 5DP6A 5ABWA 1NU7B 1GHWH 1RFNA 3Q76A 1C5PA 2W5EA 3GY7A 5C3NA 4XFQA 1GG6C 1OP8A 2A7JA 1JRSA 4Q7XA 1MMJN 1O2HA 1P9SA 1EAWA 4K3JA 1QR3E 1V2TT 1IHSH 1JXPA 5F6MA 1O5EH 1ETTH 5C1UA 4AYYB 3NWUA 3MU0A 4K1EA 1DUAA 1Z1JA 1YPEH 2ZCHP 3GDSA 3SNAA 2XBYA 3W95A 1OYQA 3M5NA 3PWBA 4GAWA 3LH1A 3A82A 6CHAB 1A5HA 1OXGA 2QXJA 3A7TA 4A6LA 1ETSH 2UUYA 3A85A 1T8LA 1LCYA 4Z0KA 5EXMA 1EAXA 1CQQA 2A7HA 1D3QB 4B75A 2ZGBH 4YOGA 1CHOF 1W0YH 4GCHG 2AGGX 1G3CA 1GVZA 3IG6B 4XBBA 5DK1A 3KL6A 1P02A 1AFQC 1GI6A 1TGTA 5EG4A 4WXVA 1DPOA 1P2OA 1BITA 1QRWA 1KXAA 3SJIA 2IN2A 1NFXA 1UVPA 2RCEA 3PLBA 2AGIX 1LHDH 1KDQA 1L2EA 1SFIA 1GBKA 3ATLA 4Y0YE 1EP5A 1LVBA 1E35B 4IC6A 1TONA 3A8AA 3PO1C 4AGKA 1H1BA 2G51A 2JH6D 5DP8A 3UOPA 2CMYA 1A5GH 1HJ8A 5DKMA 1B0EA 4GPGA 3V3MA 1ELFA 4A1VA 2BLOA 5AVDA 5ESTE 2C4FH 3ZZAA 2XBXA 1A5IA 3EQ0H 3SJ8A 2GCTC 2IOTA 1SFQB 1O5GH 1UO6A 1MCTA 3BSQA 2BM2A 1SGDE 2C8ZB 3E0NB 3RXQA 5A8ZA 1S6FA 1UTLM 3V0XA 2FO9A 1V2RT 3GOVB 1T8OA 2ZTYA 2ZEBA 2SFAA 1AO5A 4J2YB 1G37A 1O3JA 1WUNH 3I29A 5EQQA 4O03A 2Y5HA 3RUOA 3HGPA 1P2MA 3AAVA 1YLDA 2FOBA 2PGBB 1HAZB 1ESAA 1LPKB 3ZZ3A 1GI9B 4NG9H 1TGSZ 3A80A 3ZZ6A 3RXAA 3RXPA 1UMAH 1MAXA 4IN2A 3MNSA 1PQ5A 1V6DA 3F68H 3RC5A 1WU1A 2HRVA 1E0FD 1ZRBA 4YOJA 3UWJH 2WPJS 1AKSA 1G36A 4Y76A 1ANBA 3TNTA 1QBVH 1PPFE 3URDA 1EZSC 1ELGA 1QA0A 3BTTE 3ATKA 1UJ1A 4WJG2 4U01A 5CE1A 1HAYB 3MOCA 4E05H 1LPZB 1MZDA 1O2MA 1W12U 3ZV9A 3RC4A 1FJSA 1O2NA 1PQAA 1UTOA 1SR5C 4A7IB 1B5GH 2DUCA 1EPTA 3A7ZA 3EA8A 1SB1H 3RXGA 3QZRA 2FI3E 3OTJE 4ASHA 2BOHB 5FCKA 1QIXB 2P16A 1FY3A 1A1RA 2FIRH 1GDUA 2H1UA 4BTIB 2Z9JA 3A84A 2SGDE 4FU9A 1TOMH 2UUJB 1IAUA 4GHTA 2SGFE 1O35A 3B8JA 1AIXH 3RXHA 4K1TA 3ZVDA 1GI3A 1Q2WA 2BVRH 1AVXA 1SGTA 1FAKH 1XMNB 4X1PU 1L4DA 2WPHS 4BTUB 2BX3A 1D4PB 2H5CA 4KELA 2GT7A 3VB5A 3TPIZ 1C5MD 3BTDE 4CRDA 6GCHG 4TWYA 5TCCA 5GIBA 3HK3B 2R0KA 2FOHA 1GJ7B 2OBOA 4MDSA 1AZ8A 1YKTA 2CF8H 1A2CH 2GKVE 2H9EH 2H9HA 3EA9A 5T6DA 1GBCA 2NU2E 4Y8ZA 5FPTA 4YM9A 5GCHF 3T28A 3UR6A 3DFLA 5DPAA 1UHBA 4NIYA 1ESTA 4RKJB 1ELAA 5TJXA 1A3BH 1NFWA 1YLCA 3HPTB 1MD8A 1GHXH 1CBWC 1FN8A 5LPFA 2FMJA 3PLKA 3TJOA 4WMDA 1HIAB 1MH0A 3TJVA 2R3YA 2FLRH 2AMDA 1PPGE 4Y10E 1TQ7B 1GBJA 4FUEA 2VIQA 1ZJDA 5AHGH 1QBOA 1GI1A 1TOCB 3ZZ7A 1BRAA 1BRUP 3A8CA 1QJ6B 2K1QA 3BTWE 4DOQA 1LHEH 1G9IE 1VITH 2GCTB 1ZHPA 2O8WA 4TPIZ 4I8LA 4QT8C 5FCRA 3UQOA 1AB9C 5EU8A 3LH3A 1C5XB 1NZQH 3S0NA 4UE7H 2AIPA 1GBDA 2XRCA 2OC0A 1KYNA 1WQVH 2FXRA 2QA9E 4LOYH 3NZIA 3TH2H 3SV9A 1ZYOA 1JWTA 4FVBA 2C3SA 5DP5A 3U1JB 2VH0A 1TNJA 2XBWA 3LGVA 1PPZA 1L1NA 1LKAA 3EYDA 1IQNA 2VVVA 1IQIA 3SV7A 2OC1A 5L2YH 1Y59T 1ACBE 1NTPA 2P3TB 3E8LA 1YYY1 1LVOA 2GD4B 4XBDA 2F91A 5AF9H 1CGHA 1HJAB 1GPZA 3DA9B 4WWYA 1V2ST 1X7AC 3R3GB 4LZ1H 2VU8E 4OS7A 3KEEA 3RM0H 1IQEA 1CHOG 1W13U 1AFEH 2QGRA 1MQ6A 3A8DA 3I78A 2Z9LA 2ANWA 1XM1A 1G2MA 2XTTB 3VB3A 5J4SA 2J9NA 2W7UA 1C2KA 3RMLH 1V2LT 2R3UA 4FUFA 1SVPA 1FY8E 2BLQA 1EJAA 4YLUA 1BTZA 1TNKA 1NC6A 3H7TA 3MO6A 3C27B 2J94A 4HFPB 3E0PB 2A5KA 2ZHWH 3RC6A 1GHYH 3M7TA 2QYIA 3WY8A 2EI8A 2Z7FE 4AGJA 1K1MA 1BBRH 5GJ4B 4UFFH 1DOJA 2PKSB 3SHCH 2RDLA 1AVWA 5A09A 1EASA 3UFAA 1EATA 1KXBA 2ILNA 2C8WB 1WAYB 1ELDE 1EKBB 4TY6A 6LPRA 3MU4A 3SQHE 2ZDKA 1AY6H 1PYTD 3A7XA 3UNQA 1A3EH 1O2YA 1BTWA 1A0LA 9LPRA 1NROH 4RN6A 2ZTZA 3SNBA 1C1OA 5K7RA 1YC0A 3LKWA 2UWOA 2W3KA 1C5ZB 5F8XA 1EJMA 3RMMH 2ULLA 1MBMA 1P06A 1T31A 3PWCA 1BMMH 2PKAA 1CBWB 1W8BH 1KY9A 2BY6X 3FFGA 1GJAB 4X1RU 1V2KT 1D3PB 2A5AA 1YPHE 1EPTC 1UCYK 3A7YA 1TIOA 2C8XB 4JYUH 1ZPCA 2PSXA 3P95A 2ZA5A 2J2UA 3STJA 1H9LB 2FOCA 5F8TA 1EZXC 1TQ0B 1HIAA 1HAGE 2FI4E 2SNVA 3TGJE 3OY6U 2RA3A 2AIQA 1HAXB 1QGFA 1TRYA 4BAKB 1NT1A 4YO9A 1ZMNA 1HNEE 2XWBI 3EGKH 5C20A 4MTBA 2J92A 3Q77A 4XBCA 4I8GA 2PTCE 2VGCC 2VJ1A 1HXFH 1VR1H 2VIPA 4AFSA 2PHBA 4NWLA 1C5NH 4MLFB 4ZHLU 2BMGB 1O36A 1ZTLA 3ATIA 2O9QA 2J4IA 2ESTE 2ZC9H 3O8CA 4ZAEA 4R0IA 3S7KB 1XUIA 1THSH 4BXWA 1AE5A 3L6PA 3B23B 1Z6JH 3H5CB 1O33A 2HWLB 5GCHG 3S9AA 1P9UA 1WSSH 1GHBF 5G4BA 4CBOA 1OP2A 2D1JA 1QL7A 2VIDA 2V3OH 4UONA 1YM0A 1O3HA 2ZGHA 3MI4A 4VGCB 3EDXB 2D8WA 3LGYA 1ZSJA 1H8IH 1YPGH 6CHAC 4ABIA 1E38B 2J38A 1EXFA 1T8NA 3NKKA 2R2WU 5HXFA 2A7CA 5JBTA 3M3VA 3KIDU 3FVFB 1TB6H 2ZU4A 3EAJA 4RKOB 1GI4A 1GMCF 1AGJA 2XW9A 1O2GH 1J17T 2OP9A 1GWAA 1LTOA 1KTTB 3MNBA 1AWHB 4U30A 1UVOA 1FN6A 4MNYA 2XYAA 1TMUH 3P8NA 3L33A 4I32A 3B9FH 4H42U 1GGDB 1SGFA 1ZZZA 1QJ1B 2TGDA 4A1XA 2A0QB 2EEKA 3RXDA 2NU0E 2F9OA 2XCFA 4Y11E 1LHFH 3UUZA 1PPBH 2QAAA 4E7RG 1P03A 1O2RA 5CHAB 4BTTB 1O3OA 1OWEA 2PSYA 1ZSLA 5TCAA 1IQJA 5K0HA 1Y5UT 1RXPA 6ESTA 1HGTH 1ANCA 5EGMA 1SSXA 3ELAH 2FODA 4X2YA 1S0QA 1IHTH 2FOGA 1NU9A 1F0RA 1BQYA 5DG6A 1GJ8B 3SU2A 4UDWH 1FY1A 2Z3DA 1WQSA 3DD2H 4BNRA 1HB0B 4WH8A 2P3FH 5E8EH 1LQEA 1S85A 3UNRA 1V2VT 4BAHB 1S0RA 2IPHA 2Y7ZA 2ZI2H 3W94A 1AUJA 1TNHA 1GJ5H 3SI4H 1ZTKA 4Y7AA 2FYQA 4DVAU 3ITIA 1YF4A 2TRMA 2RA0A 1O34A 3RXCA 1PQ7A 1W0ZU 1P0SH 4B2CA 2LPRA 1C1VH 2ZCLP 4CRFA 3LDXH 4CH2B 2BQ7B 2ZHQH 3AAUA 1GCTC 1BJUA 2I6SA 4Q2KA 1RTLA 3HK6B 4FUBA 1W7XH 5DJ7A 1HAHH 1KLTA 1DLEA 4MNXA 2G4UA 3SO3A 4XE4A 4Z6AH 5E2OA 2I6QA 1HYLA 2ZDVH 4ISLA 2ZDMA 2DE9A 1QJ7B 4FUGA 2VNTA 1ZHRA 5A0AE 1AI8H 5BRRE 2BDCA 3VGCB 1HAPH 4DURA 1C2EA 3ODFA 5GXPA 5B6OA 1TYNA 3RU4T 3Q3YA 2BD2A 5JPMH 1D6RA 1UHBB 1ANDA 3CS0A 3HATH 3M35A 4D7FA 2A4GA 4ABJA 2A5IA 1EB1H 2OC8A 1O3CA 1HCGA 1MAYA 1UCYE 2G55A 2BZAA 1MU8B 4WMEA 1FZZA 1T7CA 5JYIA 2ZFQH 3TVJB 2FS8A 1HDTH 1UTNA 4ZXYH 4H6SB 2JETC 5EW2H 1BTXA 1Y5BT 4ABGA 1ETRH 1ZSKA 1NS3A 2ZECA 1O2TA 4JMYA 5EQRA 3SV2H 1QRXA 2G00A 1L4ZA 1XKBC 2QXGA 3RLYH 3F9HA 1O2KA 2V0BA 1N6XA 3V13A 1W2KH 2OBQA 1FLEE 5DGJA 3H7OA 1TWXB 3OY5U 1C1QA 1P2QA 3ZYEA 2BDHA 1W14U 1FXYA 1MZAA 3A88A 1DFPA 4TYDA 3STIA 3GDVA 3L3TA 3BTHE 2FLBH 4OS5A 5FX5A 1IQLA 2VIOA 1EUFA 3G01A 2Y5GA 4ZKOU 3VPKA 4MPVA 3A7WA 4CRBA 4FUCA 4NCYA 3T5FH 1LVYA 2BY8X 4KTCA 4WXIA 1TBZH 1ZMLA 1FPCH 1GHBG 3HGNA 1HAOH 2ZDNA 3GY4A 3MH6A 4GLYA 3QZQA 4Y71A 2CGAA 1SLUB 4DT7B 4CHAB 3ODDA 2OC7A 2ZZUH 1N8OB 1C1PA 1HJAC 2W26A 3E6PH 1YP9A 1O3MA 1FMGA 3SBKA 3FZZA 3RXSA 4X1SU 1AMHA 4SGAE 2CN0H 3AVZA 1GMCG 1Y8TA 1BRCE 4U2WA 1J9CH 1LQDB 3RP2A 1DANH 1ZMJA 5JB9S 4X0WU 2XC5A 3E91A 4ABAA 5A8YA 3V7TA 2SGEE 1FUJA 2Y82A 2G52A 1ZLRA 1Y3XA 1JIRA 1FONA 2GX4A 3JZ2B 3SQEE 1G2LA 4B74A 3LJOA 1GCTB 3OX7U 1TNGA 1UTMA 4CR9A 3EBNA 1O5FH 3RM2H 3KHVA 2FOEA 3IWMA 3BTFE 1C5VA 5C2ZA 2AS9A 4NFEA 1A0JA 2B7DH 1WTGH 2BD4A 1XUJA 2PKSC 3A8BA 2FYRA 4ABFA 1EOLA 1UVTH 1YPKH 1C2DA 1NY22 1C5OH 1CGJE 4Y8XA 2OUAA 3SUDA 3VB6A 1TLDA 2HGTH 2Z6BD 2ZDAH 1ELTA 1F5LA 3SV6A 2HLCA 2UWLA 3RXIA 3SZNA 4YOIA 3ZVEA 1BMNH 2BTCE 2FP7B 1PPEE 1SPJA 3U8RH 3QLPH 1LMWB 1O30A 2PKAB 2ZCKP 1ELCA 1WBGB 3BG8A 3KN2A 2ZGCA 1LPGB 4Y0ZE 3ZVFA 1P8VC 3M7UA 4BANB 1XVOA 3GCTF 5T6FA 3D65E 4LK4A 1YGCH 3ZZ8A 5JBBS 1ELEE 1GHAF 3UWIA 1GMHF 1V2QT 3K2UA 1TRMA 4R8TB 2JETB 3LIWA 3D23A 1KXDA 1QHRB 1P3EA 2F9VA 2VWMA 1RS0A 1EAIA 1GMDF 1OOKB 4BAOB 2STBE 2THFB 4J1YA 5DO4H 1FI8A 3GY2A 1SGFG 1IQGA 1DSUA 2XC0A 1GBIA 4UFDH 3RMOH 2LIZA 1P3CA 5FXLA 2A4RA 3LGWA 4AG2A 3KQCA 1O2QA 4O97A 2BLWA 1MTNB 1O2ZA 4GUXA 1QB9A 1EOJA 1XX9A 2OTVA 1QL8A 2BDGA 3TK9A 3VB7A 3ZZ4A 1TX6A 1GJDB 2QF3A 2QIQA 2BB4A 1ORFA 3KF2A 1SOZA 1C9PA 3F1SB 2WUBA 1O2VA 1HAVB 2AMQA 5A2MH 3ATMA 1BT7A 1EB2A 3BTKE 3MHWU 3RMNH 5C67A 1T8MA 3BEUA 4NGAH 3SUFA 1Y3VA 1BCUH 5H4IB 1BZXE 1FAXA 1KLIH 2JH5D 3QTVH 4ISHH 1GBAA 3NXPA 1BMLA 5BPEA 5GDSH 1UK3A 1Q31A 1AQ7A 4INLA 2BDAA 3Q3KA 3QTOH 5EPYA 1GHZA 4I8KA 1A61H 1O0DH 4YTAA 4X8SH 3T25A 1C2FA 2O8UA 1K1NA 3AW0A 1T4VH 1OS8A 2C8YB 5HGGA 3SV8A 4I31A 4VGCC 1DICA 1GJCB 4MVNA 1PYTC 1V3XA 2TPIZ 2PR3A 1QB1A 4I33A 1Z8RA 1IQKA 2PFEA 1WYKA 2HNTC 2P93A 1ZHMA 1P05A 4CRAA 1ZTJA 4NSYA 4DGJA 4WY3A 1MD7A 2OINA 2VIVA 3SU0A 4OS2A 3QGJA 3TGIE 1RIWB 1CT4E 4YLQH 5DP9A 4KP0A 3GYLB 4A92A 1DVAH 3ZZDA 3QN7A 2VB0A 4D8NA 3SNEA 1OWJA 5C1YA 3MMGA 1ZRKA 2SNWA 5DP4A 4AB9A 3D49H 1GGDC 4AB8A 2HALA 1UVUH 2WYGA 4JK5A 3LT3A 1NFUA 5JBAS 5GWZA 2NWNA 4NWKA 1MBQA 1QNJA 5AFYH 1P57B 2ZTXA 3NUMA 2P59A 1BTPA 1O32A 2QY0B 1MKXK 4ZHMU 5F8ZA 3FANA 5J4QA 3MH5A 2FOMB 3LC5A 3RXOA 4K8BA 5CHAC 3VFEA 1GCDA 1GDNA 2ZGJA 4ABEA 1DDJA 1OPHB 3P8FA 4MPWA 1WTHD 2CV3A 2UWPA 3GICB 4INKA 2VWNA 1TRNA 5I46H 4CREA 2FOAA 9ESTA 2GZ8A 3RDZA 1KLJH 2JH0D 1A46H 4DY7B 3S9BA 2PV9B 4MNVA 1MKWK 2UUFB 1C1WH 1HUTH 2WPKS 3QDZB 2EA3A 1RD3B 1K21H 1LKBA 2V35A 3QGNB 4NA9H 2ZU5A 4XSKU 4UFGH 1K1PA 1N1LA 4ABBA 1SBWA 3U8TH 1RGQA 2Y80A 1MTVA 1DT2A 1C5QA 2WV5A 4XOJA 2ZQ1A 1CO7E 2R9PA 5EPNA 1G30B 1F92A 1C1TA 3QO6A 4MNWA 1GL0E 1BIOA 1VGCC 1T32A 1K9OE 3E16B 4UFEH 2YNBA 1T4UH 1G32B 2ANMH 1VZQH 3FP6E 2Q1JA 2BQWB 5JB8S 1D6WA 3SUEA 4Q7YA 2P8OB 1SHYA 1YPLH 3NPSA 3O8BA 4FU7A 2P95A 1RTKA 3A7VA 1EZQA 1MTSA 1UTJA 3RXLA 4O9VA 1TAWA 2FEQH 4IN1A 2CHAC 2ZKSA 4FXGH 4ZKSU 3RU4E 5FX6A 4GCHF 5LPRA 1OP0A 3DT0H 1O2SA 2QC2A 2C90B 3M3SA 2B5TB 3Q3XA 1HFDA 2FS9A 1V2JT 1GBBA 7LPRA 2NU1E 2ZFPH 1BB0B 1P2IA 2P94A 3O8DA 1DLKB 4TY7A 2XNIA 2CF9H 4X6PA 2QV1A 3TU7H 4B76A 4JZEH 1AZZA 1HAVA 1SHHB 4BXSA 3VGCC 4X1QU 5FPSA 1TMBH 1BHXB 4FVDA 1BDAA 7ESTE 3GCTG 4X2XA 1KXEA 5E0JA 1ABJH 2FZZA 2ZF0H 1GHAG 2ZFFH 1GMHG 1XXDA 2C93B 3LU9B 1S84A 3MYWA 4ZUHA 3UR9A 5PTPA 1CGIE 1TE0A 3QUMP 1NFYA 1AD8H 2YOLA 2Z3EA 1INCA 3U9AH 4INHA 5EXLA 3LONA 1GMDG 1H9HE 4FUJA 1DY8A 1O5CB 2IJOB 2FI5E 3VB4A 1DWBH 2TIOA 2O8MA 1W7GH 3T62A 4AX9H 1Y3YA 3M3TA 2XXLA 2BVSH 2ZHEH 3C1KA 4MG3A 5E2PA 5A8XA 4JYTA 1XUKA 2VVCA 3MU5A 1NRRH 1F5KU 1KXFA 1Z8GA 2ODQA 1Y5AT 2BOKA 1K22H 1UTKA 3BEIB 5A0CA 5HM9A 1JOUB 1P12E 2ALPA 3BTQE 3TJNA 4YESB 1Z6EA 3VXEH 4DCDA 1C5SA 3MO3A 5C5NA 1TGNA 2VWLA 5GPIB 3BTGE 4DG4A 1GBHA 3BIUH 2TGTA 5LGOA 3BG4B 1QTFA 1P2KA 1UK4A 5ETXA 2OQ5A 2ZFRH 2EI7A 3KNXA 4KTUA 2FX6A 4MPUA 1GDQA 2GT8A 1C2IA 2GTBA 3U8OH 4B71A 1DE7H 2R0LA 1V2WT 1MU6B 2ANKH 4BAQB 3SW2B 5SGAE 4CHAC 1Q3XA 1L0ZA 1CT0E 1GL1A 1TA2A 4H6TA 4H4FA 2SGAA 1N8OC 1FDPA 4K69A 3SN8A 1DITH 2VH6A 1C2LA 1FNIA 1VGCB 8GCHF 3GY5A 5DP7A 1O3PB 1AUTC 1C4V2 1SGNE 1TMTH 1SL3A 1EZUC 2BD9A 4JZDH 1UTQA 1C2HA 2PUXB 3M37A 4CRCA 2GGVB 3SU1A 3ZVCA 2BD7A 3PB1E 1O5BB 4BOHA 1XVMA 3RXRA 1O38A 3TIUA 2CXVA 2A1DB 3ZVBA 2BZ6H 2PTNA 2CHAB 4B73A 3S7HB 5HMAA 4X6MA 2B8OH 1M9UA 5E0GA 1ZOMA 3M5MA 2BLVA 2BYAX 3UNSA 1FV9A 4JZ1A 1P01A 4B1TA 2B0FA 4ZKNU 1OWIA 2F9UA 3TJUA 3M61U 1GJ4H 5C5OA 1WCZA 1P2NA 4X8UH 3F9GA 1PPHE 1O31A 1Z71A 1V2OT 4DIIH 2CJIA 1SGPE 2W3IA 4GVUA 3LJJA 4Y6DA 4NA7A 1ABIH 3CP7A 3ZV8A 1KSNA 1DXWA 3UQVA 1ZPBA 3FP8E 3K6YA 3TH4H 1UK2A 3K9XB 4WH6A 3NK8A 3SOSA 3UTUH 4IMQA 4NFFA 2AEIH 2VINA 1TALA 2A2XH 1TPPA 1K1JA 1TX8A 4F49A 3GISB 3MU1A 4NZQA 4FUIA 1AWFH 3P92A 1TX7A 1V2UT 2Q6FA 1O3DA 1AHTH 3KGPA 3ZZ5A 2F9PA 3KQDA 3TH3H 3VXFH 3QWCH 2Z9KA 4AFUA 3T2NA 3ZZ9A 3TK6A 1Z7KA 1QBNA 4K5ZA 1EP6A 4FUHA 2ANYA 5L2ZH 3SUGA 1C5RA 3JZ1B 3V12A 3DFJA 8ESTE 1DM4B 2KAIA 1UCYH 1S83A 4OGXA 2TGPZ 3ZVGA 1SGEE 4ZH8A 2Z9GA 2FX4A 1XUFA 3BIVH 1TBRH 2FOFA 3GCOA 2GDEH 1QFKH 1ARCA 1EQ9A 4I8JA 1IQMA 3ESTA 1HAIH 5F03A 1A4WH 4DJZB 1PFXC 2A45B 4AYVB 1BMAA 1MTNC 1ZGVA 1GJ6A 3GCHB 2Y6TA 2SGQE 5JDUB 2BHGA 1O3GA 4D9RA 1CVWH 2D26C 1DY9A 2AYWA 1VITF 2NU4E 1IOEA 3SU3A 1NRSH 1Z1IA 3SNDA 1F2SE 1BBRK 2VIWA 1G3DA 1TA6A 3RXMA 1SI5H 1ZJKA 2D2DA 1EJNA 2ZP0H 1E34B 1AE8H 3MH4A 1BJVA 1GI8B 1HXEH 3F9EA 1TNLA 1K1IA 1OWHA 2A4OA 5FBIA 4AFZA 3DUXH 1MQ5A 3M7QA 1C1UH 4X2VA 1YBWA 2ZPQA 2ZU2A 3LGIA 1NRPH 4KKDA 1BHXF 1A7SA 4LXBH 3T27A 2UUKB 2WPLS 1G3BA 2ZIQH 1SMFE 1VCWA 5E0HA 4SGBE 5JBCS 7GCHF 3RXBA 2VVUA 2HNTF 1RRKA 4ISOA 1C5UA 2BXTH 3MTYA 5CMXH 7KMEH 1ESBA 4IS5A 1FQ3A 3KQEA 1C4Y2 1THPB 4TPYA 5IDKA 2BD8A 4B2AA 3SU5A 4GSOA 1BRBE 1L1JA 1O3KA 4CH8B 1J8AA 5C1XA 1C1MA 2Q6DA 1RIWC 3MNXA 3MNCA 4ZHAA 2YNAA 1DWCH 1V2NT 3AASA 2ZGXH 1NM6A 2O8TA 5DP3A 1GI0A 1J16A 1HJ9A 1SGRE 3VEQB 1DS2E 2AERH 1QA7A 4A5TS 1HPGA 2Q6GA 3LPRA 4OS1A 2FPZA 1A0HB 2ZU1A 2TBSA 4ZXXH 1D3DB 1GBMA 5HYOA 1L1GA 3SI3H 1CSOE 2F9BH 1GBTA 3M5LA 1O2XA 1UVSH 2GV7A 2WYJA 1LO6A 3MWIU 3MO9A 4KTSA 2WINI 1GHVH 3A89A 1WOFA 2PUQH 3A83A 1E36B 2G4TA 1O5AB 2GMTC 3FAOA 1XXFA 3GY6A 2BVXH 1GG6B 1GI2A 2OLGA 3AW1A 4AG1A 1TPSA 3U69H 4F4OC 4IC5A 3RXVA 1B0FA 8GCHG 1C9TA 1V2PT 1VCPA 3A87A 3TGKE 1PPCE 2BQ6B 1JRTA 1ANEA 3SU4A 1FY4A 1QQ4A 1Z8IB 5IYTA 3A81A 4E06H 4HGCA 4B2BA 3TNSA 4LZ4B 8LPRA 4U32A 2Y5FA 3LGUA 2OXSA 2BDYA 1QL9A 3UIRA 4X6NA 3CENA 4BAMB 2JKHA 1AVGH 4IGDA 1YPMH 1AFQB 1J14A 1O2JA 3A86A 3PTNA 2P8OC 5EW1H 1P2JA 4TWWA 2BY7X 1XUHA 3KQBA 3P17H 2A2QH 5EOKA 1JIMA 1OYTH 1SGQE 1J15A 2K7XA 1TABE 1XKAC 1DWDH 1XUGA 1FIZA 3QK1A 4HZHA 1KTSB 1LDTT 3PO1B 1P09A 2BXUH 5AFZH 1TBQH 2GCHF 3S69A 1GBLA 4GHQA 1ELVA 2Z3CA 1C1NA 3NCLA 2H9TH 1OWKA 1O5DH 2HPPH 2F3CE 4I8HA 1O3AA 1RJXB 1TPAE 4UD9H 3ZZCA 2A31A 2G5VA 2QXIA 3MH7A 2ZPSA 1SC8U 1Y3WA 5LPEA 1QRZA 2QF0A 3RXFA 4AOQA 1YCPK 2VWOA 2B9LA 1O3BA 2H5DA 1LVMA 1CE5A 1ELBA 2G8TA 3SGAE 4CR5A 4Y8YA 4HTCH 4NSVA 5FPYA 3GY8A 1BA8B 1K1LA 4ZKRU 2AFQB 3SORA 2HNTE 2ALVA 2TGAA 1O2UA 5EODA 4IW4E 4ABDA 3RXTA 2PGQB 1NESE 3LGTA 2H6MA 2QXHA 3QX5H 4HI3A 3P6ZB 1FY5A 2OD3B 1FPHH 3OYPA 4D9QA 4FU8A 1BUIA 2Z9IA 4O3TA 1H8DH 2GDDA 4X8TH 2GZ7A 2ZDLA 1H9IE 3P8OA 1THRH 3BV9B 1Y3UA 1O3NA 3MFJA 1BOQA 1TGBA 1GI5A 1TPOA 1BBRE 2J95A 3F6UH 5EQSA 1FIWA 2A4QA 1VITG 1F0SA 4JYVH 3PYHA 3GDUA 1MUEB 2WV4A 3BTME 1ID5H 1AU8A 1MTUA 3SJ9A 2PW8H 4ABHA 1HBTH 4THNH 3EA7A 1DSTA 3F9FA 1O2PA 1KIGH 1OWDA 2OQUA 2ZU3A 2LNCA 2GVFA 3LC3A 2GZ9A 4Y79A 3ZYDA 1O3EA 2GMTB 3BG4C 1P10A 1QCPA 1D9IA 2ZFTA 5I25A 2J34A 1TGCA 4O3UA 1C1RA 4K2YA 1O2IA 3E1XB 1C5WB 1GBEA 1LHGH 1GJBB 4NIXA 4NZLA 4NIWA 3N7OA 3O8RA 1S81A 4OS4A 2WPIS 1HLTH 2BY9X 1F7ZA 3GCNA 4ZROA 1K1OA 3P70B 4AFQA 7GCHG 2HVXA 1SLXB 2RG3A 4AN7A 4ISIH 1NRQH 3TITA 3P8GA 4JZFH 3IITA 1JBUH 3PM3A 1C5TA 4M7GA 3TLOA 3PTBA 2SGPE 2ZO3H 1SGYE 5ESBA 1O2WA 1F0TA 1P04A 4XDEA 2Y81A 3Q00A 5L30H 2FDAA 3TK5A 3LOXA 3E90B 4A1TA 1H4WA 4WF8A 3RXJA 4DIHH 2FTLE 1ZGIA 3I77A 3RXEA 4OS6A 2PWXA 1NPMA 1B7XB 4D7GA 1SG8B 4CBNA 2A32A 4K1SA 1YPHC 2BD5A 3HKJB 1F5RA 1KXCA 1SGCA 3PMHB 3BTEE 2NU3E 4E7NA 3BF6H 1N6YA 2ASUB 1Z8JB 4DW2U 3T29A 1JMOH 1O2LA 3PMJA 1AB9B 2R2MB 1CA0C 1GBFA 1LHCH 1C2JA 1S6HA 3R0FA 3SJKA 2BX4A 3PV4A 3M36A 3RXKA 4MPXA 3RLWH 4YT6H 1C5LH 3FP7E 4X6OA 1SQTA 4ZMAH 2FTMA 1S5SA 1W11U 3M5OA 2W7SA 2H2ZA 4WVPE 3UOUA 3U1IB 1HRTH 1SQOA 1O37A 3ZZBA 3D62A 1E37B 1O3IA 1AN1E 1HV7A 8KME2 1C4U2 3T26A 3PROA 2KAIB 4JK6A 4NA8A 1W10U 4X2WA 1DWEH 5A0BA 2V3HH 4AZ2B 3ATWA 2ODPA 2BDIA 1EX3A 1C2MA 3URCA 1DUEA 1SGIB 1PJPA 3UY9A 1QB6A 2EC9H 1ARBA 2XC4A 5FBEA 3DHKH 3E3TA 1ZPZA 5FHTA 2V6NA 1OKXA 2ZHDA 5HM2A 1QY6A 1GI7B 1P11E 2WPMS 3SJOA 1KDQB 1U6QA 1DX5M 5T6GA 5L6NH 3S9CA 1BTHH 1K28D 5EXNA 1OSSA 4PROA 1CHGA 2GCHG 2ZWLH 2WUCA 3UREA 2DE8A 3RU4D 2QCYA 3GY3A 2ZG0H 4JCNA 3SU6A 2XWAA 1O2OA
chains in the Genus database with same CATH superfamily
1O3LA 3GCHC 1CT2E 2GP9B 1TNIA 4MQAA 2AMPA 1VJAU 2FM2A 3OSYA 2Y7XA 2FWWA 3BEFB 4UEHH 2XBVA 3SNCA 1F0UA 5T3HA 2ZPRA 3UPEA 1CA8B 1EAUA 2BD3A 2BDBA 2ZFSA 1RTFB 2ZHFH 2AH4X 1PQ8A 4D76A 5LH8A 2F9NA 3SGQE 1MCVA 2M5TA 3SGBE 1TFXA 1YCPH 2GV6A 4I86A 3ZVAA 1IQHA 1K2I1 1O39A 2F83A 4IBLH 4JZIA 1YCPM 1SQAA 4KGAA 2Z94A 4AORA 2HOBA 4WMFA 3F2HA 1GVKB 4Y7BA 1WV7H 4K8YA 2P3UB 3FZDA 3KCGH 1AKSB 6GCHF 1NO9H 1G3EA 3GYMA 1D3TB 1OX1A 1YPJH 3CS7A 3ENSB 3PMBB 4FUDA 1V2MT 4ISNA 2QN5T 2G5NA 1GJ9B 4YT7H 4OGYA 1VCQA 4X8VH 1SOTA 5GNDA 3MU8A 1MTWA 1GVLA 1VJ9U 4YZUA 2XCNA 1EPTB 2PLXA 3K65B 4FOUC 1NN6A 1S82A 4IMZA 2BY5X 1BTUA 1SLVB 3PLPA 1IQFA 3K6ZA 2O8LA 4NIVA 1MKXH 4K60A 2EI6A 1CU1A 1SLWB 1C2GA 2OCVB 3PMAB 4Q7ZA 1O3FA 4RSPA 1BTYA 3SHAH 1QQUA 4I7YH 4X1NU 1CA0B 2STAE 3HKIB 1NRNH 3RXUA 2VGCB 1C1SA 1QURH 3U98H 2G81E 4ESTE 4Q80A 1ZR0A 2ODYB 2ZQ2A 1C5YB 1W3CA 1UTPA 2ZNKH 3BN9A 3EE0B 3OU0A 4CRGA 5FAHA 1MKWH 1DXPA 2HPQH 2FESH 2AGEX 5DP6A 5ABWA 1NU7B 1GHWH 1RFNA 3Q76A 1C5PA 2W5EA 3GY7A 5C3NA 4XFQA 1GG6C 1OP8A 3H09A 2A7JA 1JRSA 4Q7XA 1MMJN 1O2HA 1P9SA 3U28C 1EAWA 4K3JA 1QR3E 1V2TT 1IHSH 1JXPA 5F6MA 1O5EH 2PP6A 1ETTH 5C1UA 4AYYB 3NWUA 3MU0A 4K1EA 1DUAA 1Z1JA 1YPEH 2ZCHP 3GDSA 3SNAA 2XBYA 3W95A 1OYQA 3M5NA 3PWBA 4GAWA 3LH1A 3A82A 6CHAB 1A5HA 1OXGA 2QXJA 3A7TA 4A6LA 1ETSH 2UUYA 3A85A 1T8LA 1LCYA 4Z0KA 5EXMA 1EAXA 1CQQA 2A7HA 5EJ1A 1D3QB 4B75A 2ZGBH 4YOGA 1CHOF 1W0YH 4GCHG 2AGGX 1G3CA 1GVZA 3IG6B 4XBBA 5DK1A 3KL6A 1P02A 1AFQC 1GI6A 1TGTA 5EG4A 4WXVA 1DPOA 1P2OA 1BITA 1QRWA 1KXAA 5KEDA 3SJIA 2IN2A 1NFXA 1UVPA 2RCEA 3PLBA 2AGIX 1LHDH 1KDQA 1L2EA 1SFIA 4P00A 1GBKA 3ATLA 4Y0YE 1EP5A 1LVBA 1E35B 4IC6A 1TONA 3A8AA 3PO1C 4AGKA 1H1BA 2G51A 2JH6D 5DP8A 3UOPA 2CMYA 1EFRD 1A5GH 1HJ8A 5DKMA 1B0EA 4GPGA 3V3MA 1ELFA 4A1VA 2BLOA 5AVDA 5ESTE 2C4FH 3ZZAA 2XBXA 1A5IA 3EQ0H 3SJ8A 2GCTC 2IOTA 1SFQB 1O5GH 1UO6A 1MCTA 3BSQA 5EJZA 2BM2A 1SGDE 2C8ZB 3E0NB 3RXQA 5A8ZA 1S6FA 1UTLM 3V0XA 2FO9A 1V2RT 3GOVB 1T8OA 2ZTYA 2ZEBA 2SFAA 1AO5A 4J2YB 1G37A 1O3JA 1WUNH 3I29A 5EQQA 4O03A 2Y5HA 3RUOA 3HGPA 3VG8A 1P2MA 3AAVA 1YLDA 2FOBA 2PGBB 1HAZB 1ESAA 1LPKB 3ZZ3A 1GI9B 4NG9H 1TGSZ 3A80A 3ZZ6A 3RXAA 3RXPA 1UMAH 1MAXA 4IN2A 3MNSA 1PQ5A 1V6DA 3F68H 3RC5A 1WU1A 2HRVA 1E0FD 1ZRBA 4YOJA 3UWJH 2WPJS 1AKSA 1G36A 4Y76A 1ANBA 2JIZD 3TNTA 1QBVH 1PPFE 3URDA 1EZSC 1ELGA 1QA0A 3BTTE 3ATKA 1UJ1A 4WJG2 4U01A 5CE1A 1HAYB 3MOCA 4E05H 1LPZB 1MZDA 1O2MA 1W12U 3ZV9A 3RC4A 1FJSA 1O2NA 1PQAA 1UTOA 1SR5C 4A7IB 5CDFE 1B5GH 2DUCA 1EPTA 3A7ZA 3EA8A 1SB1H 3RXGA 3QZRA 2FI3E 3OTJE 4ASHA 2BOHB 5FCKA 1QIXB 2P16A 1FY3A 1A1RA 2FIRH 1GDUA 2H1UA 4BTIB 2Z9JA 3A84A 2SGDE 4FU9A 1TOMH 2UUJB 1IAUA 4GHTA 5F53A 2SGFE 1O35A 3B8JA 1K0HA 1AIXH 3RXHA 4K1TA 3ZVDA 1GI3A 1Q2WA 2BVRH 1AVXA 1SGTA 1FAKH 1XMNB 4X1PU 1L4DA 2WPHS 4BTUB 2BX3A 1D4PB 2H5CA 4KELA 2GT7A 3VB5A 3TPIZ 1C5MD 3BTDE 4CRDA 6GCHG 4TWYA 5TCCA 5GIBA 3HK3B 1W0KD 2R0KA 2FOHA 1GJ7B 2OBOA 4MDSA 1AZ8A 1YKTA 2CF8H 1A2CH 2GKVE 2H9EH 2H9HA 3EA9A 5T6DA 2VBCA 1GBCA 2NU2E 4Y8ZA 5FPTA 4YM9A 5GCHF 3T28A 3UR6A 3DFLA 5DPAA 1UHBA 4NIYA 4RT0A 1ESTA 4RKJB 1ELAA 5TJXA 1A3BH 1NFWA 1YLCA 3HPTB 3SZEA 1MD8A 1GHXH 1CBWC 1FN8A 5LPFA 2FMJA 3PLKA 3TJOA 4WMDA 1HIAB 1MH0A 3TJVA 2R3YA 2FLRH 2AMDA 1PPGE 4Y10E 1TQ7B 1GBJA 4FUEA 2VIQA 1ZJDA 5AHGH 1QBOA 1GI1A 1TOCB 4M9FA 1BRAA 3ZZ7A 1BRUP 3A8CA 1QJ6B 2K1QA 3BTWE 4DOQA 1LHEH 1G9IE 1VITH 2GCTB 1ZHPA 2O8WA 4TPIZ 4I8LA 4QT8C 5FCRA 3UQOA 1AB9C 5EU8A 3LH3A 1C5XB 1NZQH 3S0NA 4UE7H 2AIPA 1GBDA 2XRCA 2OC0A 1KYNA 1WQVH 2FXRA 2QA9E 3DCLA 4LOYH 3NZIA 3TH2H 3SV9A 1ZYOA 1JWTA 1YWUA 4FVBA 2C3SA 2XOKD 5DP5A 2J98B 3U1JB 2VH0A 2HLDD 2JDID 1TNJA 2XBWA 3LGVA 1PPZA 1L1NA 1LKAA 3EYDA 1IQNA 2VVVA 1IQIA 3SV7A 2OC1A 5L2YH 1Y59T 1ACBE 1NTPA 2P3TB 3E8LA 1YYY1 1LVOA 2GD4B 4XBDA 2F91A 5AF9H 1CGHA 1HJAB 1GPZA 3DA9B 4WWYA 1V2ST 1X7AC 3R3GB 4LZ1H 2VU8E 4OS7A 3KEEA 3RM0H 1IQEA 1CHOG 1W13U 1AFEH 2HVYB 2QGRA 1MQ6A 3A8DA 3I78A 2Z9LA 2ANWA 1XM1A 1G2MA 1WDIA 2XTTB 3VB3A 5J4SA 2J9NA 2W7UA 1C2KA 3RMLH 1V2LT 2R3UA 4FUFA 1SVPA 1FY8E 2BLQA 1EJAA 4YLUA 1BTZA 1TNKA 1NC6A 3H7TA 3MO6A 3C27B 2J94A 4HFPB 3E0PB 2A5KA 2ZHWH 5C0TA 3RC6A 1GHYH 3M7TA 2QYIA 3WY8A 2EI8A 2Z7FE 3AK5A 4AGJA 1K1MA 1BBRH 5GJ4B 4UFFH 1DOJA 2PKSB 3SHCH 2RDLA 2WSSD 1AVWA 5A09A 1EASA 3UFAA 1EATA 1KXBA 2ILNA 2C8WB 1WAYB 1ELDE 1EKBB 4TY6A 4Z1MD 4XRNA 6LPRA 3MU4A 2WPDD 3SQHE 2ZDKA 1AY6H 1PYTD 3A7XA 3DSGA 3UNQA 1A3EH 1O2YA 1BTWA 1A0LA 9LPRA 1MABB 1NROH 4RN6A 2ZTZA 3SNBA 1C1OA 2QF4A 5K7RA 1YC0A 3ZIAD 3LKWA 2UWOA 2W3KA 1C5ZB 5F8XA 1EJMA 3RMMH 2ULLA 1MBMA 1P06A 1T31A 3PWCA 1BMMH 2PKAA 1CBWB 1W8BH 1KY9A 2BY6X 3FFGA 1GJAB 4X1RU 3FO8D 1V2KT 1D3PB 2A5AA 1YPHE 1EPTC 1UCYK 3A7YA 1TIOA 2C8XB 4JYUH 1ZPCA 2PSXA 3P95A 5DN6D 2ZA5A 5EIYA 2J2UA 3STJA 1H9LB 2FOCA 5F8TA 1EZXC 1TQ0B 1HIAA 1HAGE 2FI4E 2SNVA 3TGJE 3OY6U 2RA3A 2AIQA 1HAXB 1QGFA 1TRYA 4BAKB 1NT1A 4YO9A 1ZMNA 1HNEE 2XWBI 3EGKH 5C20A 4MTBA 2J92A 3Q77A 4XBCA 4I8GA 2PTCE 2VGCC 2VJ1A 1HXFH 1VR1H 2VIPA 4AFSA 2PHBA 4NWLA 1C5NH 4MLFB 4ZHLU 2BMGB 1O36A 1ZTLA 3ATIA 2JJ2D 2O9QA 2J4IA 2J97A 2ESTE 2ZC9H 3O8CA 3WW7A 4ZAEA 4R0IA 3S7KB 1XUIA 1THSH 4BXWA 1AE5A 3L6PA 3B23B 1Z6JH 3H5CB 1O33A 2HWLB 5GCHG 2J98A 3S9AA 5HIYA 1P9UA 1WSSH 1GHBF 5G4BA 4CBOA 1OP2A 2D1JA 1QL7A 2VIDA 2V3OH 4UONA 1YM0A 1O3HA 2ZGHA 3MI4A 4VGCB 3EDXB 2D8WA 3LGYA 1ZSJA 1H8IH 1YPGH 6CHAC 4ABIA 1E38B 2J38A 1EXFA 1T8NA 3NKKA 2R2WU 5HXFA 2A7CA 5JBTA 3M3VA 3KIDU 3FVFB 1TB6H 2ZU4A 3EAJA 4RKOB 1GI4A 1GMCF 1AGJA 2XW9A 3OEED 1O2GH 1J17T 2OP9A 1GWAA 1LTOA 1KTTB 1NBME 3MNBA 1AWHB 4U30A 1UVOA 1FN6A 4MNYA 2XYAA 1TMUH 3P8NA 3L33A 4I32A 3B9FH 4H42U 1GGDB 1SGFA 1ZZZA 1QJ1B 2TGDA 3KQ5A 4A1XA 2A0QB 2EEKA 3RXDA 2NU0E 2F9OA 2XCFA 4Y11E 1LHFH 3UUZA 1PPBH 2QAAA 4E7RG 1P03A 4RT1A 1O2RA 5CHAB 4BTTB 1O3OA 1OWEA 2PSYA 1ZSLA 5TCAA 1IQJA 5K0HA 1Y5UT 1RXPA 6ESTA 2EQNA 1HGTH 1ANCA 5EGMA 1SSXA 3ELAH 2F43B 2FODA 4X2YA 2K8IA 1S0QA 1IHTH 2FOGA 1NU9A 1F0RA 1BQYA 5DG6A 1GJ8B 3SU2A 4UDWH 1FY1A 2Z3DA 3KYFA 1WQSA 2KX4A 3DD2H 4BNRA 1HB0B 4WH8A 2P3FH 5E8EH 1LQEA 1S85A 3UNRA 1V2VT 4BAHB 1S0RA 2IPHA 2KCPA 2Y7ZA 2ZI2H 3W94A 1AUJA 1TNHA 1GJ5H 3SI4H 3FOAA 1ZTKA 4Y7AA 2WZQA 2FYQA 4DVAU 3ITIA 1YF4A 2TRMA 2RA0A 1O34A 3RXCA 1PQ7A 1W0ZU 4OM9A 1P0SH 4B2CA 4DT4A 2LPRA 1C1VH 2ZCLP 4CRFA 3LDXH 4CH2B 2BQ7B 2ZHQH 1QZ8A 3AAUA 1GCTC 1BJUA 2I6SA 4Q2KA 1RTLA 3HK6B 4FUBA 1W7XH 5DJ7A 1HAHH 1KLTA 1DLEA 4MNXA 2G4UA 3SO3A 4XE4A 3N7DA 4Z6AH 5E2OA 2I6QA 1HYLA 2ZDVH 4ISLA 2L6OA 2ZDMA 2DE9A 1QJ7B 4FUGA 2VNTA 1ZHRA 5A0AE 1AI8H 5BRRE 2BDCA 3VGCB 1HAPH 4DURA 1C2EA 3ODFA 3OEHD 5GXPA 2LELA 5B6OA 1TYNA 3RU4T 3Q3YA 2BD2A 5JPMH 1D6RA 1UHBB 1ANDA 3CS0A 3HATH 3M35A 4D7FA 2A4GA 4ABJA 2A5IA 1EB1H 2OC8A 1O3CA 1HCGA 1MAYA 1UCYE 2G55A 2BZAA 1MU8B 4WMEA 2J5UA 1FZZA 1T7CA 5EJLA 5JYIA 2ZFQH 3TVJB 2FS8A 1HDTH 4B6EA 1UTNA 4ZXYH 4H6SB 2JETC 5EW2H 5HKKD 1BTXA 1Y5BT 4ABGA 1ETRH 1ZSKA 1NS3A 2ZECA 1O2TA 4HG6A 4JMYA 2JJ1D 3F2GA 5EQRA 3SV2H 1QRXA 2G00A 1L4ZA 1XKBC 2QXGA 2K0QA 3F9HA 1O2KA 2V0BA 3RLYH 1N6XA 3V13A 1W2KH 5DSFA 2OBQA 1FLEE 5DGJA 3H7OA 1TWXB 3OY5U 1C1QA 1P2QA 1COWD 3ZYEA 2YMSD 2BDHA 1W14U 1FXYA 1MZAA 1H8HD 3A88A 1DFPA 4TYDA 3STIA 3GDVA 3L3TA 3BTHE 2FLBH 2AHME 4OS5A 5FX5A 1IQLA 2VIOA 1EUFA 3G01A 2Y5GA 4TT3D 4ZKOU 3VPKA 4MPVA 3A7WA 4CRBA 4FUCA 4NCYA 3T5FH 1LVYA 2BY8X 4KTCA 4WXIA 1TBZH 3CNRA 1ZMLA 1FPCH 1GHBG 3HGNA 1HAOH 2ZDNA 3GY4A 3MH6A 4GLYA 3QZQA 4Y71A 2CGAA 1SLUB 4DT7B 4CHAB 3ODDA 2OC7A 2ZZUH 1N8OB 1C1PA 1HJAC 2W26A 3E6PH 1YP9A 4AC9A 1O3MA 1FMGA 3SBKA 3FZZA 3RXSA 4X1SU 1AMHA 4SGAE 2CN0H 3AVZA 4ASUD 1GMCG 4XD7D 1Y8TA 1BRCE 4U2WA 1J9CH 4B6FA 1LQDB 3RP2A 1DANH 1ZMJA 5JB9S 4X0WU 2XC5A 3E91A 4ABAA 5A8YA 3V7TA 2SGEE 1FUJA 2Y82A 2G52A 1ZLRA 1Y3XA 1JIRA 1FONA 2GX4A 3JZ2B 3SQEE 4F48B 1G2LA 4B74A 3LJOA 1GCTB 2KCYA 3OX7U 1TNGA 1UTMA 4CR9A 3EBNA 1O5FH 3RM2H 3KHVA 2FOEA 3IWMA 3BTFE 1C5VA 5C2ZA 3EE7A 2AS9A 4NFEA 1A0JA 2B7DH 1WTGH 2BD4A 2KM0A 1XUJA 2PKSC 1VKYA 3A8BA 2FYRA 2YMSB 2V3MA 4ABFA 3MQKC 1EOLA 1UVTH 1YPKH 1C2DA 1NY22 1C5OH 1CGJE 4Y8XA 2OUAA 3SUDA 3VB6A 1TLDA 2HGTH 2Z6BD 2ZDAH 1ELTA 1F5LA 3SV6A 2HLCA 2UWLA 3RXIA 3SZNA 4YOIA 3ZVEA 1BMNH 2BTCE 2FP7B 1PPEE 1SPJA 3U8RH 3QLPH 1LMWB 1O30A 2PKAB 2ZCKP 1ELCA 1WBGB 3BG8A 3KN2A 2ZGCA 1LPGB 4Y0ZE 3ZVFA 1P8VC 3M7UA 4BANB 1XVOA 3GCTF 5T6FA 3D65E 4LK4A 1YGCH 3ZZ8A 5JBBS 1ELEE 1GHAF 3UWIA 1GMHF 1V2QT 3K2UA 1TRMA 4R8TB 2JETB 3LIWA 1E79D 3D23A 1KXDA 1QHRB 1P3EA 2F9VA 2VWMA 4F55A 1RS0A 1EAIA 1GMDF 1OOKB 4BAOB 2STBE 2THFB 4J1YA 5DO4H 1FI8A 2KCAA 3GY2A 1SGFG 1IQGA 1DSUA 2XC0A 1GBIA 4UFDH 3RMOH 2LIZA 1P3CA 5FXLA 2A4RA 3LGWA 4AG2A 3KQCA 1O2QA 4O97A 2BLWA 1MTNB 1O2ZA 4GUXA 1QB9A 1EOJA 1XX9A 2OTVA 1QL8A 2BDGA 3TK9A 3VB7A 3ZZ4A 1TX6A 1GJDB 2QF3A 2QIQA 2BB4A 1ORFA 3KF2A 1SOZA 1C9PA 3F1SB 2WUBA 1O2VA 1HAVB 2AMQA 5A2MH 3ATMA 1BT7A 1EB2A 3BTKE 5C94A 3MHWU 3RMNH 5C67A 1T8MA 3BEUA 4NGAH 3SUFA 1Y3VA 1BCUH 5H4IB 1BZXE 1FAXA 1KLIH 2JH5D 3QTVH 4ISHH 1GBAA 3NXPA 1BMLA 5BPEA 5GDSH 1UK3A 1Q31A 1AQ7A 4INLA 2BDAA 3Q3KA 3QTOH 5EPYA 1GHZA 4I8KA 1A61H 1O0DH 4YTAA 4X8SH 3T25A 1C2FA 2O8UA 1K1NA 3AW0A 1T4VH 1OS8A 2C8YB 5HGGA 3SV8A 4I31A 4VGCC 1DICA 1GJCB 4MVNA 1PYTC 1V3XA 2TPIZ 2PR3A 1QB1A 4I33A 1Z8RA 1IQKA 2PFEA 1WYKA 2HNTC 2P93A 1ZHMA 1P05A 4CRAA 1ZTJA 4NSYA 4DGJA 4WY3A 1MD7A 2OINA 2VIVA 3DSOA 1YY3A 3SU0A 2V7QD 4OS2A 3QGJA 3TGIE 1RIWB 1CT4E 4YLQH 5DP9A 4KP0A 4ACBA 3GYLB 4A92A 1DVAH 3ZZDA 3QN7A 2VB0A 4D8NA 3SNEA 1OWJA 5C1YA 3MMGA 1H8ED 1ZRKA 2SNWA 5DP4A 4AB9A 3D49H 1GGDC 4AB8A 2HALA 1UVUH 2WYGA 4JK5A 3LT3A 1NFUA 5JBAS 5GWZA 2NWNA 4NWKA 1MBQA 1QNJA 5AFYH 1P57B 2ZTXA 3NUMA 2P59A 1SKYE 1BTPA 1O32A 2QY0B 1MKXK 4ZHMU 5F8ZA 3FANA 5J4QA 3MH5A 2FOMB 3LC5A 3RXOA 4K8BA 5CHAC 3VFEA 1GCDA 1GDNA 2ZGJA 2RDEA 4ABEA 1DDJA 1YLNA 1OPHB 3P8FA 4MPWA 1WTHD 2CV3A 2UWPA 3GICB 4INKA 2VWNA 1TRNA 5I46H 4CREA 2FOAA 9ESTA 2GZ8A 3RDZA 3KYGA 1KLJH 2JH0D 1A46H 4DY7B 3S9BA 2PV9B 4MNVA 1MKWK 2UUFB 1C1WH 1HUTH 2WPKS 3QDZB 2EA3A 1RD3B 1K21H 1LKBA 2V35A 3QGNB 4NA9H 2ZU5A 4XSKU 4UFGH 1K1PA 1N1LA 4ABBA 1SBWA 3U8TH 1RGQA 2Y80A 1MTVA 1DT2A 1C5QA 2WV5A 4XOJA 2ZQ1A 1CO7E 2R9PA 5EPNA 5IK2D 1G30B 1F92A 1C1TA 3QO6A 4MNWA 1GL0E 2LP6A 1BIOA 1VGCC 1T32A 1K9OE 3E16B 4UFEH 2YNBA 1T4UH 1G32B 2ANMH 1VZQH 3FP6E 2Q1JA 2BQWB 5JB8S 1D6WA 3SUEA 4Q7YA 2P8OB 1SHYA 1YPLH 3NPSA 3O8BA 4FU7A 2P95A 1RTKA 3A7VA 3OFND 1EZQA 1MTSA 1UTJA 3RXLA 4O9VA 1TAWA 2FEQH 3GS9A 3OAAD 4IN1A 2CHAC 2ZKSA 4FXGH 4ZKSU 3RU4E 5FX6A 4GCHF 5LPRA 1OP0A 3DT0H 1O2SA 5C17A 2QC2A 2C90B 3M3SA 2B5TB 3Q3XA 1HFDA 2FS9A 1V2JT 1GBBA 7LPRA 2NU1E 2ZFPH 1BB0B 1P2IA 2P94A 3O8DA 1DLKB 4TY7A 2XNIA 5KECA 2CF9H 2IPQX 2W6ID 4X6PA 2QV1A 3TU7H 4B76A 4JZEH 1W0JD 2OK5A 1AZZA 1HAVA 1SHHB 4BXSA 3VGCC 4X1QU 5FPSA 1TMBH 1BHXB 4FVDA 1BDAA 3F0OA 3GCTG 4X2XA 1KXEA 5E0JA 7ESTE 1ABJH 2FZZA 2ZF0H 1GHAG 2ZFFH 1GMHG 1XXDA 2C93B 3LU9B 1S84A 3MYWA 4ZUHA 3UR9A 5PTPA 1CGIE 1TE0A 3QUMP 3SYJA 1NFYA 1AD8H 2YOLA 2Z3EA 1INCA 3U9AH 4INHA 5EXLA 3LONA 1GMDG 1BMFD 1H9HE 4FUJA 1DY8A 1O5CB 2IJOB 2FI5E 3VB4A 1DWBH 2TIOA 2O8MA 1W7GH 3T62A 3F3BA 4AX9H 1Y3YA 3M3TA 2XXLA 2BVSH 2ZHEH 3C1KA 4MG3A 5E2PA 5A8XA 4JYTA 1XUKA 2VVCA 3MU5A 1NRRH 1F5KU 1KXFA 1Z8GA 2ODQA 1Y5AT 2BOKA 1K22H 1UTKA 3BEIB 5A0CA 5HM9A 1JOUB 1P12E 2ALPA 3BTQE 3TJNA 4YESB 1Z6EA 3VXEH 4DCDA 1C5SA 3MO3A 4Q4LA 5C5NA 1TGNA 2VWLA 5GPIB 3BTGE 4DG4A 5CHBA 1GBHA 3BIUH 2TGTA 5LGOA 3BG4B 1QTFA 1P2KA 1UK4A 5ETXA 2OQ5A 2ZFRH 2EI7A 3OE7D 3F2FA 3KNXA 4KTUA 2FX6A 4MPUA 1GDQA 2GT8A 1C2IA 2GTBA 3U8OH 4B71A 1DE7H 2R0LA 1V2WT 1MU6B 2ANKH 4BAQB 3SW2B 3N7EA 5SGAE 4CHAC 1Q3XA 1L0ZA 1CT0E 1GL1A 1TA2A 4H6TA 4H4FA 2SGAA 1N8OC 1FDPA 4K69A 3SN8A 1DITH 1E1RD 2VH6A 1C2LA 1FNIA 1VGCB 8GCHF 3GY5A 5DP7A 1O3PB 1AUTC 1C4V2 1SGNE 1TMTH 1SL3A 2WV9A 1EZUC 2BD9A 4JZDH 1UTQA 1C2HA 2PUXB 3M37A 4CRCA 2GGVB 3SU1A 3ZVCA 2BD7A 3F0PA 3PB1E 1O5BB 4BOHA 1XVMA 3RXRA 1O38A 3TIUA 2CXVA 2A1DB 3ZVBA 1NBMD 2BZ6H 2PTNA 3UAIC 2CHAB 4B73A 3S7HB 5HMAA 4X6MA 2B8OH 1M9UA 5E0GA 1KMHB 1ZOMA 3M5MA 2BLVA 2BYAX 3UNSA 1FV9A 4JZ1A 1P01A 4B1TA 2B0FA 4ZKNU 1OWIA 2F9UA 3TJUA 3M61U 1GJ4H 5C5OA 1WCZA 1P2NA 4X8UH 3F9GA 1PPHE 1O31A 1Z71A 1V2OT 4DIIH 2CJIA 1SGPE 2YMSC 2W3IA 4GVUA 3LJJA 4Y6DA 4NA7A 1ABIH 3CP7A 3ZV8A 1KSNA 1DXWA 3UQVA 1ZPBA 3FP8E 3K6YA 3TH4H 1UK2A 3K9XB 4WH6A 3NK8A 3SOSA 3UTUH 4IMQA 4NFFA 2AEIH 2VINA 1TALA 2A2XH 1TPPA 1K1JA 1TX8A 4F49A 3GISB 3MU1A 4NZQA 4FUIA 1AWFH 3P92A 1TX7A 1V2UT 2Q6FA 1O3DA 2CK3D 1AHTH 3KGPA 3ZZ5A 2F9PA 2QE7D 3KQDA 3TH3H 3VXFH 3QWCH 2Z9KA 4AFUA 3T2NA 2KR7A 3TK6A 1Z7KA 3ZZ9A 1QBNA 4K5ZA 1EP6A 4FUHA 2ANYA 5L2ZH 2KFWA 3PRDA 1C5RA 3JZ1B 3SUGA 3V12A 2W6JD 3DFJA 8ESTE 1DM4B 2KAIA 1UCYH 1S83A 4OGXA 2TGPZ 3ZVGA 1SGEE 4ZH8A 2Z9GA 2FX4A 1XUFA 3BIVH 1TBRH 2FOFA 3GCOA 2GDEH 3W1EA 1QFKH 1ARCA 3UB0A 1EQ9A 4I8JA 1IQMA 3ESTA 1HAIH 5F03A 1A4WH 4DJZB 1PFXC 2A45B 4AYVB 3FN8A 1BMAA 4RI0A 5FL7D 1MTNC 1ZGVA 5HIZA 1GJ6A 3GCHB 2Y6TA 2SGQE 3DSPA 5JDUB 2BHGA 1O3GA 4D9RA 1CVWH 2D26C 1DY9A 2AYWA 1VITF 2NU4E 1IOEA 3SU3A 1NRSH 1Z1IA 3SNDA 1F2SE 1BBRK 2VIWA 1G3DA 1TA6A 3RXMA 1SI5H 1ZJKA 2D2DA 1EJNA 2ZP0H 1E34B 1AE8H 3MH4A 3PV2A 1BJVA 1GI8B 1HXEH 3F9EA 1TNLA 1K1IA 4P02A 1OWHA 2A4OA 5FBIA 4AFZA 3DUXH 1MQ5A 3M7QA 1C1UH 4X2VA 1YBWA 2ZPQA 2ZU2A 3LGIA 1NRPH 4ACAA 4KKDA 1BHXF 1A7SA 4LXBH 3T27A 2UUKB 3WWBA 2WPLS 1G3BA 2ZIQH 1SMFE 2QF5A 1VCWA 5E0HA 4SGBE 5JBCS 7GCHF 3RXBA 2VVUA 2HNTF 1RRKA 4ISOA 1C5UA 2BXTH 3MTYA 5CMXH 7KMEH 1ESBA 4IS5A 1FQ3A 3KQEA 1C4Y2 1THPB 4TPYA 5IDKA 2BD8A 4B2AA 3SU5A 4GSOA 1BRBE 1L1JA 1O3KA 4CH8B 1J8AA 5C1XA 1C1MA 2Q6DA 1RIWC 3MNXA 3MNCA 4ZHAA 2YNAA 1DWCH 1V2NT 3AASA 2ZGXH 1NM6A 2O8TA 5DP3A 1GI0A 1J16A 1HJ9A 1SGRE 3VEQB 1DS2E 2AERH 1QA7A 4YXWD 4A5TS 1HPGA 2Q6GA 3LPRA 4OS1A 2FPZA 1A0HB 2ZU1A 2TBSA 4ZXXH 1D3DB 1GBMA 5HYOA 1L1GA 3SI3H 1CSOE 2F9BH 1GBTA 3M5LA 1O2XA 1UVSH 2GV7A 2WYJA 1LO6A 3MWIU 3MO9A 4KTSA 2WINI 1GHVH 3A89A 1WOFA 2PUQH 3A83A 1E36B 2G4TA 1O5AB 2GMTC 3FAOA 1XXFA 3GY6A 2BVXH 1GG6B 1GI2A 2OLGA 3AW1A 4AG1A 1TPSA 3FKSD 3U69H 4F4OC 4IC5A 3RXVA 1B0FA 4TSFD 8GCHG 1C9TA 1V2PT 1VCPA 3A87A 3TGKE 1PPCE 2BQ6B 1JRTA 1ANEA 3SU4A 1FY4A 1QQ4A 1Z8IB 5IYTA 3A81A 4E06H 4HGCA 4B2BA 3TNSA 4LZ4B 8LPRA 4U32A 2Y5FA 3LGUA 2OXSA 2BDYA 1QL9A 3UIRA 4X6NA 3CENA 4BAMB 2JKHA 1AVGH 4IGDA 1YPMH 1AFQB 1J14A 1O2JA 3A86A 3PTNA 2P8OC 5EW1H 1P2JA 4TWWA 2BY7X 1XUHA 3KQBA 3P17H 2A2QH 5EOKA 4ZCNA 1JIMA 3PRBA 1OYTH 1SGQE 1J15A 2K7XA 1TABE 1XKAC 1DWDH 1XUGA 1FIZA 3PV5A 3QK1A 4HZHA 5KGOA 2KCOA 1KTSB 1LDTT 3PO1B 1P09A 2BXUH 5AFZH 1TBQH 2GCHF 3S69A 1GBLA 4GHQA 1ELVA 2Z3CA 1C1NA 3NCLA 2H9TH 1OWKA 1O5DH 2HPPH 2F3CE 4I8HA 1O3AA 1RJXB 1TPAE 4UD9H 5B6LA 3ZZCA 2A31A 2G5VA 2QXIA 3MH7A 2ZPSA 1SC8U 1Y3WA 2XNDD 5LPEA 1QRZA 2QF0A 3RXFA 4AOQA 1YCPK 2VWOA 2B9LA 1O3BA 2H5DA 4FETA 1LVMA 1CE5A 1ELBA 2G8TA 3SGAE 4CR5A 4Y8YA 4HTCH 4NSVA 5FPYA 3GY8A 1BA8B 1K1LA 4ZKRU 2AFQB 3SORA 2HNTE 2ALVA 2TGAA 1O2UA 5EODA 4IW4E 4ABDA 2L74A 2PGQB 3RXTA 1NESE 2RFKC 3LGTA 1UW7A 2H6MA 2QXHA 3QX5H 4HI3A 3P6ZB 1FY5A 2OD3B 1FPHH 3OYPA 4D9QA 4FU8A 1BUIA 3N99A 2Z9IA 2WHXA 4O3TA 1H8DH 2GDDA 4X8TH 2GZ7A 2EY4C 2ZDLA 1H9IE 3P8OA 1THRH 3BV9B 1Y3UA 1O3NA 3MFJA 1BOQA 1TGBA 1GI5A 1TPOA 1BBRE 2J95A 3F6UH 5EQSA 1S6LA 1FIWA 2A4QA 1VITG 1F0SA 4JYVH 3PYHA 3GDUA 1MUEB 2WV4A 3BTME 1ID5H 1AU8A 1MTUA 3SJ9A 2PW8H 4ABHA 1HBTH 4THNH 3EA7A 1DSTA 3F9FA 1O2PA 1KIGH 1OWDA 5T1VA 2OQUA 2ZU3A 2LNCA 2GVFA 3LC3A 2GZ9A 4Y79A 3ZYDA 1O3EA 2GMTB 3BG4C 1P10A 1QCPA 1D9IA 2ZFTA 5I25A 2J34A 1TGCA 4O3UA 1C1RA 4K2YA 1O2IA 3E1XB 1C5WB 1GBEA 1LHGH 3WWFA 1GJBB 2F4LA 4NIXA 4NZLA 4NIWA 3N7OA 3O8RA 3NRLA 1S81A 4OS4A 2WPIS 1HLTH 2BY9X 1SQRA 1F7ZA 3GCNA 4ZROA 1K1OA 3P70B 4AFQA 7GCHG 2HVXA 1SLXB 2RG3A 4AN7A 4ISIH 1NRQH 3TITA 3P8GA 4JZFH 1OHHD 3IITA 1JBUH 2GJGA 1C5TA 3PM3A 4M7GA 3TLOA 3PTBA 2SGPE 2ZO3H 1SGYE 5ESBA 1O2WA 1F0TA 1P04A 4XDEA 2Y81A 3Q00A 2KZ4A 5L30H 2FDAA 3TK5A 3LOXA 3E90B 4A1TA 1H4WA 4WF8A 3RXJA 4DIHH 2FTLE 1ZGIA 2IJD1 3I77A 3RXEA 4OS6A 2PWXA 1NPMA 1B7XB 4D7GA 1SG8B 4CBNA 2A32A 4K1SA 1YPHC 2BD5A 1WXRA 3HKJB 1F5RA 1KXCA 1SGCA 3OTPA 3PMHB 3BTEE 2NU3E 4E7NA 3BF6H 1N6YA 2ASUB 1Z8JB 4DW2U 3T29A 1JMOH 1O2LA 3PMJA 1AB9B 2R2MB 1CA0C 1GBFA 1LHCH 1C2JA 1S6HA 3R0FA 3SJKA 2BX4A 3PV4A 3M36A 3RXKA 1FX0B 4MPXA 3RLWH 4YT6H 1C5LH 3FP7E 4X6OA 1SQTA 4ZMAH 2FTMA 1S5SA 1W11U 3M5OA 2W7SA 2H2ZA 4WVPE 3UOUA 3U1IB 1HRTH 1SQOA 1O37A 3ZZBA 3D62A 1E37B 1O3IA 1AN1E 1HV7A 8KME2 1C4U2 3T26A 3PROA 2KAIB 4JK6A 4NA8A 1W10U 4Q63A 4X2WA 1DWEH 5A0BA 2V3HH 4AZ2B 3ATWA 2ODPA 2BDIA 1EX3A 1C2MA 3URCA 1DUEA 1SGIB 1PJPA 3UY9A 1QB6A 2EC9H 1ARBA 2XC4A 5FBEA 3DHKH 3E3TA 1ZPZA 5FHTA 2V6NA 1E1QD 1OKXA 2ZHDA 5HM2A 1QY6A 1GI7B 1P11E 2WPMS 3SJOA 1KDQB 1U6QA 1DX5M 5T6GA 5L6NH 3S9CA 1BTHH 1K28D 5EXNA 1OSSA 4PROA 1CHGA 2GCHG 2ZWLH 2WUCA 3UREA 2DE8A 3RU4D 2QCYA 2M2AA 3GY3A 2ZG0H 4JCNA 3SU6A 5C0UA 2XWAA 1O2OA
chains in the Genus database with same CATH topology
1O3LA 3GCHC 1CT2E 2GP9B 1TNIA 4MQAA 2AMPA 1VJAU 2FM2A 3OSYA 2Y7XA 2FWWA 3BEFB 4UEHH 2XBVA 3SNCA 1F0UA 5T3HA 2ZPRA 3UPEA 1CA8B 1EAUA 2BD3A 2BDBA 2ZFSA 1RTFB 2ZHFH 2AH4X 1PQ8A 4D76A 5LH8A 2F9NA 3SGQE 1MCVA 2M5TA 3SGBE 1TFXA 1YCPH 2GV6A 3ZVAA 1IQHA 1K2I1 1O39A 2F83A 4IBLH 4JZIA 1YCPM 1SQAA 4KGAA 2Z94A 4AORA 2HOBA 4WMFA 1GVKB 4Y7BA 1WV7H 4K8YA 2P3UB 3FZDA 3KCGH 1AKSB 6GCHF 1NO9H 1G3EA 3GYMA 1D3TB 1OX1A 1YPJH 3CS7A 3ENSB 3PMBB 4FUDA 1V2MT 4ISNA 2QN5T 2G5NA 1GJ9B 4YT7H 4OGYA 1VCQA 4X8VH 1SOTA 3MU8A 1MTWA 1GVLA 1VJ9U 4YZUA 2XCNA 1EPTB 2PLXA 3K65B 1NN6A 1S82A 4IMZA 2BY5X 1BTUA 1SLVB 3PLPA 1IQFA 3K6ZA 2O8LA 4NIVA 1MKXH 4K60A 2EI6A 1CU1A 1SLWB 1C2GA 2OCVB 3PMAB 4Q7ZA 1O3FA 4RSPA 1BTYA 3SHAH 1QQUA 4I7YH 4X1NU 1CA0B 2STAE 3HKIB 1NRNH 3RXUA 2VGCB 1C1SA 1QURH 3U98H 2G81E 4ESTE 4Q80A 1ZR0A 2ODYB 2ZQ2A 1C5YB 1W3CA 1UTPA 2ZNKH 3BN9A 3EE0B 3OU0A 4CRGA 5FAHA 1MKWH 1DXPA 2HPQH 2FESH 2AGEX 5DP6A 5ABWA 1NU7B 1GHWH 1RFNA 3Q76A 1C5PA 2W5EA 3GY7A 5C3NA 4XFQA 1GG6C 1OP8A 2A7JA 1JRSA 4Q7XA 1MMJN 1O2HA 1P9SA 1EAWA 4K3JA 1QR3E 1V2TT 1IHSH 1JXPA 5F6MA 1O5EH 1ETTH 5C1UA 4AYYB 3NWUA 3MU0A 4K1EA 1DUAA 1Z1JA 1YPEH 2ZCHP 3GDSA 3SNAA 2XBYA 3W95A 1OYQA 3M5NA 3PWBA 4GAWA 3LH1A 3A82A 6CHAB 1A5HA 1OXGA 2QXJA 3A7TA 4A6LA 1ETSH 2UUYA 3A85A 1T8LA 1LCYA 4Z0KA 5EXMA 1EAXA 1CQQA 2A7HA 1D3QB 4B75A 2ZGBH 4YOGA 1CHOF 1W0YH 4GCHG 2AGGX 1G3CA 1GVZA 3IG6B 4XBBA 5DK1A 3KL6A 1P02A 1AFQC 1GI6A 1TGTA 5EG4A 4WXVA 1DPOA 1P2OA 1BITA 1QRWA 1KXAA 3SJIA 2IN2A 1NFXA 1UVPA 2RCEA 3PLBA 2AGIX 1LHDH 1KDQA 1L2EA 1SFIA 1GBKA 3ATLA 4Y0YE 1EP5A 1LVBA 1E35B 4IC6A 1TONA 3A8AA 3PO1C 4AGKA 1H1BA 2G51A 2JH6D 5DP8A 3UOPA 2CMYA 1A5GH 1HJ8A 5DKMA 1B0EA 4GPGA 3V3MA 1ELFA 4A1VA 2BLOA 5AVDA 5ESTE 2C4FH 3ZZAA 2XBXA 1A5IA 3EQ0H 3SJ8A 2GCTC 2IOTA 1SFQB 1O5GH 1UO6A 1MCTA 3BSQA 2BM2A 1SGDE 2C8ZB 3E0NB 3RXQA 5A8ZA 1S6FA 1UTLM 3V0XA 2FO9A 1V2RT 3GOVB 1T8OA 2ZTYA 2ZEBA 2SFAA 1AO5A 4J2YB 1G37A 1O3JA 1WUNH 3I29A 5EQQA 4O03A 2Y5HA 3RUOA 3HGPA 1P2MA 3AAVA 1YLDA 2FOBA 2PGBB 1HAZB 1ESAA 1LPKB 3ZZ3A 1GI9B 4NG9H 1TGSZ 3A80A 3ZZ6A 3RXAA 3RXPA 1UMAH 1MAXA 4IN2A 3MNSA 1PQ5A 1V6DA 3F68H 3RC5A 1WU1A 2HRVA 1E0FD 1ZRBA 4YOJA 3UWJH 2WPJS 1AKSA 1G36A 4Y76A 1ANBA 3TNTA 1QBVH 1PPFE 3URDA 1EZSC 1ELGA 1QA0A 3BTTE 3ATKA 1UJ1A 4WJG2 4U01A 5CE1A 1HAYB 3MOCA 4E05H 1LPZB 1MZDA 1O2MA 1W12U 3ZV9A 3RC4A 1FJSA 1O2NA 1PQAA 1UTOA 1SR5C 4A7IB 1B5GH 2DUCA 1EPTA 3A7ZA 3EA8A 1SB1H 3RXGA 3QZRA 2FI3E 3OTJE 4ASHA 2BOHB 5FCKA 1QIXB 2P16A 1FY3A 1A1RA 2FIRH 1GDUA 2H1UA 4BTIB 2Z9JA 3A84A 2SGDE 4FU9A 1TOMH 2UUJB 1IAUA 4GHTA 2SGFE 1O35A 3B8JA 1AIXH 3RXHA 4K1TA 3ZVDA 1GI3A 1Q2WA 2BVRH 1AVXA 1SGTA 1FAKH 1XMNB 4X1PU 1L4DA 2WPHS 4BTUB 2BX3A 1D4PB 2H5CA 4KELA 2GT7A 3VB5A 3TPIZ 1C5MD 3BTDE 4CRDA 6GCHG 4TWYA 5TCCA 5GIBA 3HK3B 2R0KA 2FOHA 1GJ7B 2OBOA 4MDSA 1AZ8A 1YKTA 2CF8H 1A2CH 2GKVE 2H9EH 2H9HA 3EA9A 5T6DA 1GBCA 2NU2E 4Y8ZA 5FPTA 4YM9A 5GCHF 3T28A 3UR6A 3DFLA 5DPAA 1UHBA 4NIYA 1ESTA 4RKJB 1ELAA 5TJXA 1A3BH 1NFWA 1YLCA 3HPTB 1MD8A 1GHXH 1CBWC 1FN8A 5LPFA 2FMJA 3PLKA 3TJOA 4WMDA 1HIAB 1MH0A 3TJVA 2R3YA 2FLRH 2AMDA 1PPGE 4Y10E 1TQ7B 1GBJA 4FUEA 2VIQA 1ZJDA 5AHGH 1QBOA 1GI1A 1TOCB 3ZZ7A 1BRAA 1BRUP 3A8CA 1QJ6B 2K1QA 3BTWE 4DOQA 1LHEH 1G9IE 1VITH 2GCTB 1ZHPA 2O8WA 4TPIZ 4I8LA 4QT8C 5FCRA 3UQOA 1AB9C 5EU8A 3LH3A 1C5XB 1NZQH 3S0NA 4UE7H 2AIPA 1GBDA 2XRCA 2OC0A 1KYNA 1WQVH 2FXRA 2QA9E 4LOYH 3NZIA 3TH2H 3SV9A 1ZYOA 1JWTA 4FVBA 2C3SA 5DP5A 3U1JB 2VH0A 1TNJA 2XBWA 3LGVA 1PPZA 1L1NA 1LKAA 3EYDA 1IQNA 2VVVA 1IQIA 3SV7A 2OC1A 5L2YH 1Y59T 1ACBE 1NTPA 2P3TB 3E8LA 1YYY1 1LVOA 2GD4B 4XBDA 2F91A 5AF9H 1CGHA 1HJAB 1GPZA 3DA9B 4WWYA 1V2ST 1X7AC 3R3GB 4LZ1H 2VU8E 4OS7A 3KEEA 3RM0H 1IQEA 1CHOG 1W13U 1AFEH 2QGRA 1MQ6A 3A8DA 3I78A 2Z9LA 2ANWA 1XM1A 1G2MA 2XTTB 3VB3A 5J4SA 2J9NA 2W7UA 1C2KA 3RMLH 1V2LT 2R3UA 4FUFA 1SVPA 1FY8E 2BLQA 1EJAA 4YLUA 1BTZA 1TNKA 1NC6A 3H7TA 3MO6A 3C27B 2J94A 4HFPB 3E0PB 2A5KA 2ZHWH 3RC6A 1GHYH 3M7TA 2QYIA 3WY8A 2EI8A 2Z7FE 4AGJA 1K1MA 1BBRH 5GJ4B 4UFFH 1DOJA 2PKSB 3SHCH 2RDLA 1AVWA 5A09A 1EASA 3UFAA 1EATA 1KXBA 2ILNA 2C8WB 1WAYB 1ELDE 1EKBB 4TY6A 6LPRA 3MU4A 3SQHE 2ZDKA 1AY6H 1PYTD 3A7XA 3UNQA 1A3EH 1O2YA 1BTWA 1A0LA 9LPRA 1NROH 4RN6A 2ZTZA 3SNBA 1C1OA 5K7RA 1YC0A 3LKWA 2UWOA 2W3KA 1C5ZB 5F8XA 1EJMA 3RMMH 2ULLA 1MBMA 1P06A 1T31A 3PWCA 1BMMH 2PKAA 1CBWB 1W8BH 1KY9A 2BY6X 3FFGA 1GJAB 4X1RU 1V2KT 1D3PB 2A5AA 1YPHE 1EPTC 1UCYK 3A7YA 1TIOA 2C8XB 4JYUH 1ZPCA 2PSXA 3P95A 2ZA5A 2J2UA 3STJA 1H9LB 2FOCA 5F8TA 1EZXC 1TQ0B 1HIAA 1HAGE 2FI4E 2SNVA 3TGJE 3OY6U 2RA3A 2AIQA 1HAXB 1QGFA 1TRYA 4BAKB 1NT1A 4YO9A 1ZMNA 1HNEE 2XWBI 3EGKH 5C20A 4MTBA 2J92A 3Q77A 4XBCA 4I8GA 2PTCE 2VGCC 2VJ1A 1HXFH 1VR1H 2VIPA 4AFSA 2PHBA 4NWLA 1C5NH 4MLFB 4ZHLU 2BMGB 1O36A 1ZTLA 3ATIA 2O9QA 2J4IA 2ESTE 2ZC9H 3O8CA 4ZAEA 4R0IA 3S7KB 1XUIA 1THSH 4BXWA 1AE5A 3L6PA 3B23B 1Z6JH 3H5CB 1O33A 2HWLB 5GCHG 3S9AA 1P9UA 1WSSH 1GHBF 5G4BA 4CBOA 1OP2A 2D1JA 1QL7A 2VIDA 2V3OH 4UONA 1YM0A 1O3HA 2ZGHA 3MI4A 4VGCB 3EDXB 2D8WA 3LGYA 1ZSJA 1H8IH 1YPGH 6CHAC 4ABIA 1E38B 2J38A 1EXFA 1T8NA 3NKKA 2R2WU 5HXFA 2A7CA 5JBTA 3M3VA 3KIDU 3FVFB 1TB6H 2ZU4A 3EAJA 4RKOB 1GI4A 1GMCF 1AGJA 2XW9A 1O2GH 1J17T 2OP9A 1GWAA 1LTOA 1KTTB 3MNBA 1AWHB 4U30A 1UVOA 1FN6A 4MNYA 2XYAA 1TMUH 3P8NA 3L33A 4I32A 3B9FH 4H42U 1GGDB 1SGFA 1ZZZA 1QJ1B 2TGDA 4A1XA 2A0QB 2EEKA 3RXDA 2NU0E 2F9OA 2XCFA 4Y11E 1LHFH 3UUZA 1PPBH 2QAAA 4E7RG 1P03A 1O2RA 5CHAB 4BTTB 1O3OA 1OWEA 2PSYA 1ZSLA 5TCAA 1IQJA 5K0HA 1Y5UT 1RXPA 6ESTA 1HGTH 1ANCA 5EGMA 1SSXA 3ELAH 2FODA 4X2YA 1S0QA 1IHTH 2FOGA 1NU9A 1F0RA 1BQYA 5DG6A 1GJ8B 3SU2A 4UDWH 1FY1A 2Z3DA 1WQSA 3DD2H 4BNRA 1HB0B 4WH8A 2P3FH 5E8EH 1LQEA 1S85A 3UNRA 1V2VT 4BAHB 1S0RA 2IPHA 2Y7ZA 2ZI2H 3W94A 1AUJA 1TNHA 1GJ5H 3SI4H 1ZTKA 4Y7AA 2FYQA 4DVAU 3ITIA 1YF4A 2TRMA 2RA0A 1O34A 3RXCA 1PQ7A 1W0ZU 1P0SH 4B2CA 2LPRA 1C1VH 2ZCLP 4CRFA 3LDXH 4CH2B 2BQ7B 2ZHQH 3AAUA 1GCTC 1BJUA 2I6SA 4Q2KA 1RTLA 3HK6B 4FUBA 1W7XH 5DJ7A 1HAHH 1KLTA 1DLEA 4MNXA 2G4UA 3SO3A 4XE4A 4Z6AH 5E2OA 2I6QA 1HYLA 2ZDVH 4ISLA 2ZDMA 2DE9A 1QJ7B 4FUGA 2VNTA 1ZHRA 5A0AE 1AI8H 5BRRE 2BDCA 3VGCB 1HAPH 4DURA 1C2EA 3ODFA 5GXPA 5B6OA 1TYNA 3RU4T 3Q3YA 2BD2A 5JPMH 1D6RA 1UHBB 1ANDA 3CS0A 3HATH 3M35A 4D7FA 2A4GA 4ABJA 2A5IA 1EB1H 2OC8A 1O3CA 1HCGA 1MAYA 1UCYE 2G55A 2BZAA 1MU8B 4WMEA 1FZZA 1T7CA 5JYIA 2ZFQH 3TVJB 2FS8A 1HDTH 1UTNA 4ZXYH 4H6SB 2JETC 5EW2H 1BTXA 1Y5BT 4ABGA 1ETRH 1ZSKA 1NS3A 2ZECA 1O2TA 4JMYA 5EQRA 3SV2H 1QRXA 2G00A 1L4ZA 1XKBC 2QXGA 3RLYH 3F9HA 1O2KA 2V0BA 1N6XA 3V13A 1W2KH 2OBQA 1FLEE 5DGJA 3H7OA 1TWXB 3OY5U 1C1QA 1P2QA 3ZYEA 2BDHA 1W14U 1FXYA 1MZAA 3A88A 1DFPA 4TYDA 3STIA 3GDVA 3L3TA 3BTHE 2FLBH 4OS5A 5FX5A 1IQLA 2VIOA 1EUFA 3G01A 2Y5GA 4ZKOU 3VPKA 4MPVA 3A7WA 4CRBA 4FUCA 4NCYA 3T5FH 1LVYA 2BY8X 4KTCA 4WXIA 1TBZH 1ZMLA 1FPCH 1GHBG 3HGNA 1HAOH 2ZDNA 3GY4A 3MH6A 4GLYA 3QZQA 4Y71A 2CGAA 1SLUB 4DT7B 4CHAB 3ODDA 2OC7A 2ZZUH 1N8OB 1C1PA 1HJAC 2W26A 3E6PH 1YP9A 1O3MA 1FMGA 3SBKA 3FZZA 3RXSA 4X1SU 1AMHA 4SGAE 2CN0H 3AVZA 1GMCG 1Y8TA 1BRCE 4U2WA 1J9CH 1LQDB 3RP2A 1DANH 1ZMJA 5JB9S 4X0WU 2XC5A 3E91A 4ABAA 5A8YA 3V7TA 2SGEE 1FUJA 2Y82A 2G52A 1ZLRA 1Y3XA 1JIRA 1FONA 2GX4A 3JZ2B 3SQEE 1G2LA 4B74A 3LJOA 1GCTB 3OX7U 1TNGA 1UTMA 4CR9A 3EBNA 1O5FH 3RM2H 3KHVA 2FOEA 3IWMA 3BTFE 1C5VA 5C2ZA 2AS9A 4NFEA 1A0JA 2B7DH 1WTGH 2BD4A 1XUJA 2PKSC 3A8BA 2FYRA 4ABFA 1EOLA 1UVTH 1YPKH 1C2DA 1NY22 1C5OH 1CGJE 4Y8XA 2OUAA 3SUDA 3VB6A 1TLDA 2HGTH 2Z6BD 2ZDAH 1ELTA 1F5LA 3SV6A 2HLCA 2UWLA 3RXIA 3SZNA 4YOIA 3ZVEA 1BMNH 2BTCE 2FP7B 1PPEE 1SPJA 3U8RH 3QLPH 1LMWB 1O30A 2PKAB 2ZCKP 1ELCA 1WBGB 3BG8A 3KN2A 2ZGCA 1LPGB 4Y0ZE 3ZVFA 1P8VC 3M7UA 4BANB 1XVOA 3GCTF 5T6FA 3D65E 4LK4A 1YGCH 3ZZ8A 5JBBS 1ELEE 1GHAF 3UWIA 1GMHF 1V2QT 3K2UA 1TRMA 4R8TB 2JETB 3LIWA 3D23A 1KXDA 1QHRB 1P3EA 2F9VA 2VWMA 1RS0A 1EAIA 1GMDF 1OOKB 4BAOB 2STBE 2THFB 4J1YA 5DO4H 1FI8A 3GY2A 1SGFG 1IQGA 1DSUA 2XC0A 1GBIA 4UFDH 3RMOH 2LIZA