3RXKA

Crystal structure of trypsin complexed with methyl 4-amino-1-methyl-pyrrolidine-2-carboxylate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxkA02
1GHVH 2OD3B 3EA9A 1OWIA 3VB4A 3GISB 1CA8B 1RTKA 3QN7A 4YT6H 5E0GA 3AW1A 4Y6DA 1QL8A 1SGEE 2ZTZA 3QUMP 1G36A 1ZGVA 1GHYH 1TBRH 2G5NA 3OSYA 4TY6A 1GJ6A 1V2WT 5J4SA 2F91A 2ULLA 2ANYA 2AS9A 4F49A 2BDYA 4B1TA 1L2EA 4NA8A 1NRNH 3QLPH 1K1OA 1H1BA 1DSUA 3GY4A 1TALA 4XE4A 1GCTC 2WPLS 5FPYA 3HGPA 1O34A 5DP3A 3QTOH 1YPHC 4K1SA 1LQEA 1DXWA 1X7AC 4ISHH 2AMDA 3MTYA 5DKMA 3VB6A 4D7FA 1C2FA 1GJ9B 5SGAE 2GTBA 1O3NA 1BRAA 1HLTH 3CS0A 1P11E 1AFEH 1SGDE 1O2YA 4Y11E 1JXPA 1LMWB 1TONA 3UR9A 3RM0H 1B5GH 2GZ9A 3LONA 3D23A 3GCTF 4WH6A 1PYTC 3ZZBA 3QK1A 3CS7A 3MU0A 1AVXA 3BIVH 1TOMH 2BD5A 3AVZA 1UCYE 3TJUA 1SSXA 1O2ZA 1O5CB 1HCGA 1QJ1B 3RXCA 3TGIE 2PWXA 1ZMNA 1J9CH 3ATLA 1LHEH 2PFEA 4Y0ZE 3S7KB 5HYOA 1BHXB 3LJJA 3DD2H 3UR6A 1LVBA 2P94A 3SO3A 1FAXA 4X1RU 1NFYA 1HNEE 5HM2A 2SGDE 3SGQE 1AB9C 4GSOA 2W3KA 1P9SA 1UJ1A 2C4FH 5LGOA 2V3OH 3HK6B 1THSH 3F9EA 2GV6A 3A86A 1MKWH 2Q6GA 1KXBA 1FDPA 1IQIA 2Z3CA 3ATIA 1N6YA 2D26C 3GY5A 5L2ZH 1GL1A 1J16A 1CVWH 1QRXA 2ZP0H 1BCUH 1K2I1 4Y7AA 1TRYA 3B23B 1BTPA 1GBTA 3TNSA 2OP9A 3STIA 1NRPH 4A6LA 1C2GA 1C2EA 1UTNA 2C8YB 1JBUH 1SLWB 3QX5H 4GHTA 3MO6A 5GXPA 2RA0A 3GCHC 1JWTA 1O2QA 1TPOA 4Q7ZA 1A0JA 2STBE 3RXTA 5K0HA 1P01A 1GI9B 5DP6A 1P10A 5C67A 1RD3B 1SVPA 1DPOA 3TK6A 5EU8A 1S85A 4FVBA 3FFGA 2PUQH 1ZSJA 2PSYA 5EGMA 4O97A 1UHBA 2BY5X 1A1RA 2BVSH 4D8NA 3MU1A 1RGQA 1A0HB 1SGPE 3G01A 2P16A 1C2HA 2SFAA 1Y8TA 2RA3A 3FZZA 2VVCA 1O37A 1Y59T 2FS9A 3C27B 2A4OA 2B5TB 1UVSH 2XWBI 1O2TA 4IW4E 1ABIH 2ZHWH 1AD8H 1QA7A 1QR3E 3MU4A 2ZTXA 1Z1JA 2FOFA 1AVWA 3SU0A 1BTXA 1S5SA 5DP4A 2P3TB 2BDAA 1L1JA 1NESE 5DJ7A 3UWIA 1IQJA 1Y3YA 4KGAA 4XBDA 1SGFG 2WUCA 1FJSA 1EZUC 3FAOA 5E0JA 1KXEA 1GGDB 3SU1A 4WMDA 4YOGA 1FI8A 5ESTE 1QQ4A 2QF0A 2DE9A 4ZXYH 2BLVA 3ZZ3A 1QB9A 3UQVA 1W0ZU 1ZLRA 3V13A 4CRAA 1GJ8B 1C5VA 5T6FA 1QBVH 1D4PB 3RLYH 1C5ZB 2ZCKP 3FP7E 1QRWA 3SU3A 1O39A 1J17T 3U8RH 3LGTA 5FAHA 1DUAA 1W0YH 4AGKA 1PYTD 3MNCA 4NFFA 2SGEE 1GI8B 4A92A 1MBMA 1PPHE 3LGIA 3DA9B 1H9HE 3BTFE 3HATH 4NWKA 3OYPA 1MD8A 1BA8B 1TNHA 2BQWB 4D7GA 5A0BA 5JYIA 2B7DH 1NC6A 3Q3XA 3RXLA 4BAQB 4K8BA 3NWUA 3PO1B 1C1NA 1YYY1 3LPRA 3TJOA 3BV9B 3ZZCA 1FQ3A 1AUTC 2WPJS 2PR3A 7LPRA 1T4UH 4IGDA 4Z6AH 3M3TA 1A4WH 3UOPA 1O0DH 3VGCB 3RU4D 1E38B 1WSSH 3MU5A 2Q1JA 1GG6C 3GCNA 3NK8A 5EQRA 1ZPCA 3FP8E 2J95A 1AHTH 3UOUA 1ZJDA 3HKJB 4CRCA 1INCA 2BD2A 2AGEX 3JZ2B 3RXDA 1KXDA 1LPKB 1HAHH 1O2WA 2W5EA 2ZPSA 1FN8A 1SQTA 1A3EH 3A7TA 2VH0A 1HJAB 1YPHE 1AQ7A 2OTVA 4JYUH 4NG9H 1FNIA 1O5FH 1GBLA 1DT2A 2R0KA 5EQSA 3HK3B 3UNSA 1O30A 2NU2E 2ZU2A 1IQMA 1SHYA 1LHGH 1K1LA 2ZFPH 4GHQA 4X8SH 4ZHMU 1UO6A 3NZIA 2XTTB 1GDUA 1C5UA 1CA0C 3ZZDA 2Z9JA 1S6HA 8GCHF 1TPSA 1Q31A 1ZTJA 1KTTB 1N8OB 1SG8B 1K22H 1O3JA 4UE7H 1NRQH 3QO6A 3SHAH 1LO6A 4JZEH 2OXSA 1GI6A 2LPRA 1W11U 2VGCB 2J34A 2V3HH 1VCPA 1O2IA 2UWOA 1DWCH 1C1OA 1C1SA 1DICA 1IQLA 3H7OA 4NGAH 3RMNH 3TITA 2SNVA 3AW0A 2GD4B 2BOHB 3O8DA 1V2UT 3SV2H 3EAJA 1WV7H 3SU5A 2PV9B 4AZ2B 3BF6H 2A2XH 1MTSA 4MNVA 4ZAEA 3SQEE 2GVFA 1OWJA 2GX4A 3P92A 1MCTA 1Y3VA 4CR9A 4VGCB 4CRBA 5A0AE 2J9NA 3E1XB 1C5NH 1OYQA 1Y3XA 2YNAA 3A81A 4H42U 1CT0E 1GHWH 1TAWA 3SV6A 1CHOF 2H6MA 2BHGA 2KAIB 2Y82A 3BG4B 5GCHG 2XCNA 1G32B 4JZ1A 3ZVFA 2ZFRH 5AFZH 1D6RA 3RXIA 4CH2B 4IMQA 3SUDA 1FIZA 4ZKSU 2BD3A 3ZZ5A 1DE7H 3SUFA 2HVXA 2CF8H 2EI6A 2XCFA 4ISIH 3DFJA 1G30B 3U8OH 1YM0A 2F9BH 1PPZA 1DSTA 1P2MA 2ZC9H 1AVGH 3A8DA 2FP7B 3IG6B 1N6XA 2XBWA 1BMNH 4GLYA 1WUNH 4TPYA 5FX5A 3F9FA 4HI3A 3GYMA 3M5NA 2O8TA 2ZWLH 2YNBA 1VJAU 3GDVA 1AI8H 1IOEA 3NUMA 2GCTC 3A84A 2ZNKH 1ANDA 2BZ6H 5EPNA 3VXFH 2CGAA 5DPAA 2G4TA 5HGGA 3F9GA 4K2YA 1GI0A 3A8CA 2FS8A 1O3MA 4DW2U 2ZU4A 1O5DH 1ZTKA 1PPCE 1GMHF 1O2VA 5G4BA 1RRKA 1TWXB 3EYDA 4CR5A 1BZXE 2AEIH 2DE8A 2P59A 4B2AA 1GHBF 3F6UH 5JBTA 1BMLA 3SNAA 1YLDA 1C5PA 3P70B 3VEQB 2ZQ1A 1KXFA 1OS8A 2ANKH 4K69A 2WV5A 2P93A 1XKBC 2FI3E 2FM2A 3BIUH 1EB1H 1HAYB 1HIAA 4DJZB 1XMNB 2ZDMA 3Q76A 4CREA 4IC6A 5IYTA 4GPGA 1HAVB 5A09A 2ZDNA 1UCYK 2BQ6B 2OUAA 1JMOH 3S9CA 2QAAA 5JB9S 1GJDB 3UTUH 1WYKA 2XYAA 3PLKA 5ABWA 3Q77A 1EPTB 2BD8A 1AUJA 1CGHA 2TGPZ 1BTWA 4MPUA 1ZJKA 1EKBB 2PKSC 2GCHG 2G00A 1IQHA 4AYVB 3AAVA 4OGXA 2NU4E 2A4RA 1QURH 2NU0E 3DT0H 1QQUA 5DP7A 1EPTC 1C5TA 1DS2E 1Z8IB 1O3AA 1O3DA 1F92A 4A7IB 1O31A 2QF3A 4DVAU 1H9LB 1CBWC 1WBGB 5E8EH 2VVVA 4D76A 1GBDA 3O8RA 2FOEA 2H1UA 2VIQA 1G3DA 2R0LA 2ZHQH 1W7GH 2WUBA 1GVLA 3TGJE 3V7TA 2QC2A 2A5IA 2FTLE 5FX6A 1S6FA 1BB0B 1IQKA 3RXRA 4ISLA 4ZKNU 1QTFA 2SGPE 1OOKB 1G9IE 2AIPA 4NSYA 3VB3A 1K1MA 4SGBE 2A5AA 2FODA 1T8OA 3BTKE 1O2LA 3PTNA 1F0TA 3QGNB 1T32A 4RSPA 1F0RA 4YESB 2BYAX 3R3GB 3LDXH 4E7NA 3KHVA 3SU6A 3BTEE 3KNXA 4Y7BA 3SQHE 4ABDA 2JH5D 2C93B 3EGKH 2W7UA 2QXJA 1DXPA 2JETB 2QN5T 1ELBA 1Y3UA 5EQQA 5TCCA 4E7RG 2G52A 1BHXF 4Y79A 3IWMA 5FHTA 2BLQA 1EZSC 6ESTA 1P9UA 1GI7B 1XVMA 4DCDA 3RC4A 4I31A 3MNXA 1BRUP 4ABHA 4O3TA 3RC6A 1A61H 1P2IA 2FIRH 3QGJA 4K5ZA 4AFUA 4O9VA 1ANEA 3RXUA 2A7CA 4PROA 1GJBB 1MTNC 4OS2A 1GBAA 3KCGH 1DX5M 5T6GA 2H9HA 3RM2H 5I25A 4BTUB 3BN9A 1C4U2 2Y7ZA 1RTLA 1GI2A 2EC9H 1QB1A 3SOSA 3E3TA 5GPIB 2D8WA 7GCHG 2BLWA 4JZIA 3BTHE 3S9BA 4GCHF 1Q3XA 1BJVA 3MYWA 3NKKA 1HAOH 2I6QA 1L0ZA 2BX4A 2VNTA 3OY6U 3KN2A 2J2UA 1PJPA 4AYYB 4B76A 2A4QA 1UTQA 3HGNA 2ZHEH 3RXMA 1O36A 2HALA 4X2WA 4YM9A 3FANA 3B8JA 3N7OA 3ATWA 1MD7A 3RXFA 2NU3E 3GDUA 5T6DA 1A46H 4HFPB 1T8MA 1ZSKA 3TVJB 1O3OA 1V2NT 1QJ7B 4NIYA 1LKAA 2PKAB 2UUFB 1ZHMA 4FUHA 1BRCE 4MPVA 2FZZA 1PFXC 3VB5A 2CV3A 2FX4A 1UTLM 1GCTB 1OKXA 4E05H 1K9OE 2BZAA 3VPKA 1MU6B 1HDTH 1NS3A 1K1NA 1SGCA 4MPWA 3GCTG 2VU8E 2PTNA 1ELVA 1MTVA 3RMLH 3MI4A 3RXGA 2ZZUH 1U6QA 1VCWA 1BDAA 4TY7A 3FVFB 1FZZA 2IPHA 4B2CA 2H5CA 4BAMB 2Z6BD 2QXGA 2VIVA 2IJOB 4Y8ZA 1ETRH 1TB6H 2ZFTA 4SGAE 5A8XA 1Z1IA 1TIOA 1J14A 1GMDF 1V2MT 4JZDH 5L2YH 1AFQC 4CH8B 1TABE 1JRSA 2R3YA 4J1YA 1HAXB 4LK4A 4U32A 1YPLH 1O2KA 3ELAH 2XBYA 1NRSH 1BTZA 1KY9A 3MOCA 1OSSA 2ZDKA 3I78A 1XUHA 3K6YA 1TGCA 5DO4H 5AHGH 3SJ8A 1Z6EA 2ZPQA 1P3CA 2VIPA 2WPKS 3E90B 1YLCA 1HPGA 1UTJA 3D49H 1NROH 2Z3EA 1LPGB 4X2YA 1YPMH 4FUCA 5FPTA 3SJKA 2EI8A 1AB9B 2FOHA 2Z9KA 2PSXA 1GI1A 1BQYA 1NU7B 3D62A 3K65B 4CRFA 2PW8H 4A1XA 2BY9X 2GP9B 4TWYA 1MMJN 5ETXA 2V35A 2JH6D 2XC5A 5DK1A 1TQ0B 2FESH 2FXRA 3RC5A 4FXGH 2D2DA 3UFAA 1WQVH 4I8JA 3URDA 2Y6TA 3SI4H 3BTME 1O2SA 1O38A 1AE8H 3TNTA 3KQCA 3LGVA 2FOAA 4OS4A 5I46H 3O8CA 3BTGE 1AE5A 3GCHB 3SHCH 1TRNA 1Y5UT 1NTPA 1O2HA 4UEHH 2H9EH 5F8ZA 1QIXB 1GPZA 1F5KU 3BEIB 2ANWA 5DP8A 5CMXH 1WCZA 2Y5HA 3T5FH 3PYHA 5LPEA 2OC7A 2QYIA 2AH4X 1A5HA 3E0NB 1QB6A 2G4UA 3L6PA 3TU7H 1ORFA 5C1UA 2R9PA 3SI3H 1E36B 1TMBH 1EAUA 1D9IA 1O3FA 1FY4A 2O8MA 4MVNA 3PMHB 2XXLA 1DY9A 1HB0B 3K9XB 2B0FA 3TGKE 1VZQH 1FPHH 1PQAA 5B6OA 1F0UA 5CE1A 3A7ZA 4BXWA 3KF2A 1C5QA 1OP8A 2BTCE 3QDZB 4ISOA 1NT1A 1G3BA 1XVOA 1GBFA 3T29A 4ZUHA 1MBQA 2ZPRA 1FY5A 1RFNA 4I32A 4X1SU 4XBCA 2WPHS 1C5SA 1XXFA 1O3KA 4DIHH 2FI5E 4Y76A 2BVXH 1F2SE 1Z7KA 1YF4A 3Q3YA 4D9RA 1D3DB 1ZZZA 3BTQE 1QBOA 3ESTA 1C2JA 2F9VA 1SGFA 3SNDA 1TA2A 4WH8A 1W12U 3SNBA 1IHTH 1WOFA 5EODA 2ZU1A 2VWOA 3MO3A 2OQUA 1DWBH 1YCPK 3A8AA 1C1QA 4X2VA 1KLTA 2C8WB 2BB4A 3SGAE 2GT8A 4O3UA 1HAVA 2J38A 3PTBA 2F9UA 2ESTE 3A87A 1GDNA 1TNIA 1RS0A 1ZOMA 1BBRH 2FTMA 1YGCH 1A5GH 4LOYH 5E2PA 1DITH 1ELCA 3A7YA 1F0SA 4UFDH 2H2ZA 1TRMA 1VJ9U 5E2OA 5HM9A 3KGPA 1CGIE 4LZ4B 4JYVH 2AMQA 1AO5A 4CBNA 3FZDA 1DDJA 1PPEE 4LXBH 3P8OA 3TJVA 3T26A 4BAKB 1WAYB 2UUJB 1YPKH 5DG6A 3P6ZB 1ELDE 1C1MA 3DHKH 2NWNA 3A80A 5H4IB 2UWLA 1C9TA 1GG6B 2Z7FE 4U2WA 1GL0E 1C5MD 3TK9A 3MH6A 3ZVBA 4U01A 4MLFB 1NY22 3SV9A 3PMBB 4I8LA 1TA6A 5JBBS 1SI5H 8GCHG 4IC5A 1MAXA 1EJMA 2BXUH 1MCVA 1FLEE 1NFWA 1A3BH 2HNTE 4I8GA 1C5YB 3M7TA 3CP7A 4I8HA 5FXLA 2QXIA 1W14U 1ESBA 1A2CH 1VITF 4Q2KA 3A83A 1ACBE 2GDEH 2WPMS 1O35A 2GT7A 2GMTC 1FY8E 3O8BA 3PLPA 4UFEH 1LHDH 3UPEA 2FLRH 3ATKA 1CA0B 3EA8A 2ZDVH 4AORA 2XC0A 4NIWA 2F83A 4B75A 2A7JA 2VINA 1G2LA 3ZVAA 3RXJA 1UTKA 1AU8A 2LNCA 5EW1H 3LC5A 2XWAA 2ASUB 2ZA5A 5A8YA 5C5OA 1XX9A 2Y81A 1WTHD 1P12E 1EATA 1UTMA 3T2NA 6GCHG 1J15A 4MG3A 1T4VH 1TMTH 1GMCF 1DWEH 1VR1H 1GJ5H 2ZQ2A 3BEFB 3SJOA 5C3NA 4ABGA 9ESTA 1K21H 2PHBA 1V2LT 3Q3KA 4X8TH 5AVDA 2ZHDA 4DOQA 1CE5A 2C8ZB 4Y10E 4A1TA 3K6ZA 3GY6A 1UCYH 2ZDAH 2Q6FA 1SGNE 1DFPA 2O8WA 1SMFE 2XBVA 3TK5A 2CMYA 4JZFH 1T8NA 1E35B 1ELTA 3GICB 2C90B 1Z8RA 1O2RA 1TBQH 1SPJA 2SGQE 4FUEA 1GVKB 3GDSA 1QL9A 1C1RA 2ODYB 1O2UA 5FBIA 4ZXXH 2VWNA 1V2QT 1FN6A 4DG4A 1D3PB 2Z9IA 5BRRE 3P8FA 4BAHB 1NU9A 2G51A 3MH4A 1T31A 3MO9A 4A5TS 1SFIA 5C1XA 1EP6A 3OX7U 4INLA 1SC8U 1ETTH 3E0PB 1ELEE 1C5WB 1SQOA 2ODQA 1VCQA 1TPAE 4UDWH 1WTGH 4JCNA 1GHBG 1GJ7B 4K3JA 1S84A 4FUBA 1EQ9A 2GCTB 1GI3A 1UVTH 4RKOB 1XKAC 1C2DA 4FUGA 2A31A 1ELAA 1A5IA 5DP5A 1OWHA 3T25A 1BUIA 1P0SH 2FWWA 5CHAC 2SNWA 3A85A 1NZQH 2H9TH 1AIXH 2BX3A 5HXFA 3F9HA 4X8UH 1P05A 3GYLB 1C5LH 5AF9H 1UHBB 2R2MB 2ZFQH 1ARCA 1JIMA 1GJAB 8KME2 5BPEA 2VIOA 3UWJH 2R3UA 4CHAC 1TNJA 4IN1A 1GVZA 1FONA 1GHAF 2HNTF 2OINA 4FUDA 4WXIA 1QGFA 4CRDA 3KIDU 3ZVCA 2QIQA 3F1SB 2GZ8A 1SLXB 3SN8A 4BOHA 1Z8GA 1GHZA 3I29A 2F9OA 2AMPA 5C1YA 3B9FH 1Z6JH 2R2WU 1SFQB 2HPPH 1TGSZ 2GDDA 1CQQA 1SHHB 1L1NA 3M5OA 2PKSB 2Y80A 1EXFA 2OQ5A 4XBBA 4X8VH 4Q7YA 1D3QB 1YBWA 2BLOA 4AFSA 2P3FH 4FU8A 3RMOH 2BVRH 1O3GA 1NFXA 1EZQA 1TBZH 3QZRA 1O2OA 1FV9A 2VWLA 2VWMA 4AFZA 1H9IE 1OPHB 1RTFB 2A32A 1CBWB 1F7ZA 1V2OT 1Q2WA 3LC3A 4XDEA 1A7SA 4OS7A 3SV8A 2SGFE 1SOZA 4KTUA 4UD9H 1E37B 1SQAA 1XUJA 4K8YA 1VGCC 3S0NA 2FOBA 1O3PB 3HPTB 1NM6A 2WYGA 2GGVB 1FMGA 4AOQA 3F68H 1P2OA 1S0RA 1QBNA 2ZGBH 3LH1A 3GY8A 2ZGXH 4X1PU 2W3IA 1GBBA 4R0IA 3QTVH 2CHAC 1GDQA 2ODPA 3MHWU 3H5CB 5F8XA 3RLWH 3RXOA 3E8LA 1QY6A 1ZPBA 1MZAA 1O33A 4D9QA 2BY8X 1ANCA 1TGTA 2W26A 3QZQA 2FO9A 3M61U 1C1WH 3K2UA 4X6OA 4ABEA 1MZDA 1GCDA 3AASA 1UVOA 4DT7B 3M3SA 3L33A 5FPSA 3KQDA 1GBIA 3H7TA 1PPBH 3RXBA 2Y5FA 3ZZ6A 1ELGA 1LDTT 4YLQH 3RXHA 1GI5A 1C1VH 2WINI 5LPFA 1DANH 1DVAH 2F3CE 1KIGH 2CF9H 2EI7A 2K1QA 4ZH8A 1OYTH 2BDHA 2THFB 4TPIZ 1CSOE 2ZI2H 3U69H 5C2ZA 1KLIH 1KXAA 1ZMLA 1P03A 2UUKB 1MTNB 3UQOA 4ZKOU 3ITIA 1ZRKA 1G37A 3NCLA 3MWIU 6LPRA 2EEKA 1E34B 1JIRA 3M5MA 4ABIA 4B71A 1OP0A 1EX3A 3M35A 5L6NH 2BD7A 4BTIB 2V6NA 3PWCA 3UNQA 2HWLB 1BTHH 1DLKB 1MKXK 1H8DH 4FUIA 2VIWA 2AYWA 4WF8A 2P95A 2HPQH 1TNKA 2BM2A 2ZDLA 2SGAA 3UIRA 1Y5AT 4H6SB 1E0FD 1ESTA 4WWYA 3EE0B 2ZGCA 1UVUH 1O5BB 2G5VA 3ZZ7A 1NRRH 2TBSA 3PWBA 1ZRBA 1O3BA 2A2QH 1EB2A 2W7SA 3RXPA 1OWKA 4NZQA 1FUJA 2AGGX 4UFFH 1TOCB 4Y0YE 2JH0D 1KYNA 4TWWA 1HXEH 2BY7X 1EAIA 3M7QA 4GAWA 3LGYA 4AX9H 4INHA 2TGAA 3U98H 2GV7A 1K1JA 4ASHA 4BTTB 5DP9A 1BBRE 2XRCA 2TGTA 7KMEH 5TCAA 6CHAC 2ANMH 4DURA 5ESBA 2P8OC 1WU1A 1SR5C 4MNXA 4XOJA 2PUXB 5EXNA 3UNRA 2YOLA 5GJ4B 3TIUA 1O2MA 1J8AA 1YCPM 3VB7A 3JZ1B 2HNTC 4GVUA 2BY6X 3MNBA 1P8VC 3RXKA 4ZKRU 4BXSA 1EJAA 2TPIZ 4WMFA 1RIWC 2WYJA 1L4DA 5FCRA 3A89A 1MUEB 2PTCE 1IQGA 3P95A 5E0HA 4J2YB 1AFQB 3ZZ9A 1EUFA 1XUGA 1XUIA 3RUOA 1M9UA 3QWCH 3U1JB 1TX6A 4H6TA 1AN1E 7GCHF 2H5DA 4IS5A 3T28A 3R0FA 4YLUA 2A7HA 4FUFA 2GKVE 3GY2A 3TLOA 3A82A 4U30A 1TGBA 1BRBE 1V2VT 1ZHPA 2CJIA 3LT3A 1HJ8A 3ODDA 5K7RA 3IITA 3UUZA 2VJ1A 4BNRA 1P02A 1ZMJA 2ZKSA 3HKIB 2Y7XA 2JKHA 3LH3A 4KP0A 3S9AA 3I77A 5PTPA 3PMJA 3L3TA 2Z9GA 1AGJA 3RXQA 1HIAB 1GBEA 2A5KA 2Y5GA 2J4IA 1HGTH 1Z8JB 7ESTE 1CT4E 1QL7A 1O2JA 1TNGA 4LZ1H 3E6PH 2O8LA 5A0CA 4K60A 4X1QU 1C2MA 1GHXH 3RXVA 4RKJB 1XXDA 3SU2A 1YCPH 1TE0A 2I6SA 4ABAA 1C1PA 2OBQA 3V0XA 4AG2A 4WXVA 3SJ9A 1BMMH 1B7XB 1C2IA 2BD4A 2CN0H 2QY0B 1NFUA 1S82A 5EW2H 3TJNA 1KTSB 1UTOA 3RXSA 2DUCA 1THRH 2FX6A 2QV1A 3ENSB 1MH0A 1C4Y2 2A45B 4NWLA 3OU0A 2FOCA 4I7YH 1C5OH 4FUJA 5EPYA 1UTPA 2NU1E 1P2JA 4ZHLU 3GY3A 1C1TA 4NA9H 2KAIA 3UREA 1GBMA 2RCEA 4MQAA 2WV4A 4HZHA 3A7VA 4ZHAA 4ZROA 2ZGJA 3MFJA 3ODFA 2A1DB 1GBJA 1B0FA 2Q6DA 2AERH 1EASA 1V2TT 2C8XB 5A2MH 4MNWA 1N1LA 1V3XA 3NXPA 1C2KA 1AY6H 1LCYA 2ILNA 2RG3A 3MNSA 1H8IH 1MU8B 3M37A 1O5AB 1V2KT 1PQ5A 5EOKA 3ZYEA 2B9LA 4OGYA 4GUXA 5J4QA 1KLJH 3DUXH 3TH2H 2F9PA 4UONA 3RP2A 1YPJH 4TYDA 5F8TA 2FYQA 3T62A 4B73A 2BDBA 2PGQB 3BSQA 4JK6A 1BMAA 5C5NA 1SLVB 1CO7E 3V3MA 1FXYA 3P17H 3KEEA 4ESTE 3URCA 4JK5A 4AG1A 2ZU3A 1SGQE 3MH7A 3A8BA 2FDAA 3STJA 1LQDB 1AMHA 3GY7A 4HGCA 8LPRA 3OY5U 2HLCA 2O9QA 2TGDA 3S69A 4JMYA 1ZGIA 4JYTA 2VB0A 3AAUA 1OWEA 1O3LA 3M7UA 2F9NA 2M5TA 4ABFA 1P09A 2O8UA 4AB9A 2J92A 1L4ZA 3RDZA 4MTBA 1LPZB 1IAUA 1XM1A 5A8ZA 4XSKU 1HUTH 1AZ8A 1ZHRA 1ZYOA 2Z3DA 4NA7A 1HBTH 1QA0A 1AKSB 1P2QA 1HXFH 1VITG 2RDLA 1EPTA 1O2XA 3M5LA 1KDQB 5FCKA 2J94A 1KSNA 1IQNA 2D1JA 3RXAA 1BTUA 2FPZA 2STAE 1GGDC 5IDKA 1T7CA 1Y5BT 2TIOA 4O03A 4AGJA 2UWPA 3LGWA 1CHGA 1YPGH 3A88A 1QFKH 1BJUA 1MKWK 1P06A 5C20A 1F5RA 1EP5A 1CU1A 1TMUH 4H4FA 3DFLA 4R8TB 4AFQA 4UFGH 3ZZ8A 2BD9A 1Z71A 2G55A 2GMTB 4NIXA 3ZV9A 1GBKA 3SORA 2ZFSA 2PLXA 1V2PT 3CENA 1NO9H 5LH8A 4YTAA 3SUGA 3A7WA 1DUEA 4YOJA 1GMCG 1PQ8A 1O3CA 3SNEA 2PGBB 1GJCB 2OCVB 1ARBA 1DOJA 4K1EA 1DY8A 3PO1C 4B2BA 1ZTLA 4Y71A 5JBAS 5LPRA 3U9AH 1SGIB 1LVYA 1C9PA 5JPMH 5TJXA 1B0EA 3VGCC 1FAKH 1V2JT 1O3HA 3W95A 1HAPH 3E91A 1P04A 2BOKA 1C2LA 1GWAA 4OS1A 4QT8C 4YO9A 2FLBH 4HTCH 1DLEA 3D65E 1HFDA 1CHOG 1EJNA 2HGTH 1QJ6B 2FOMB 3Q00A 1TGNA 5DGJA 2IOTA 3TPIZ 4ABBA 1TPPA 4ISNA 1G2MA 1TNLA 3LOXA 2Z9LA 1HJAC 2FMJA 1C1UH 1C5XB 3EA7A 5HMAA 2AGIX 1YKTA 1RJXB 4A1VA 1O3EA 4Y8XA 3SU4A 5EG4A 2C3SA 3LKWA 3LGUA 1ABJH 3PM3A 1SBWA 3SV7A 4NCYA 1SGTA 1N8OC 2ZTYA 3ATMA 2BDCA 3ZZAA 1W13U 4Y8YA 1C4V2 4NFEA 5JBCS 1GBCA 1K1IA 1BBRK 1PPFE 3KQEA 3VFEA 1BT7A 2VGCC 2Z94A 5T3HA 1GI4A 1VITH 1AWHB 2XNIA 3SBKA 1NPMA 1ETSH 1GMHG 1HYLA 2XBXA 4FU7A 1W7XH 4X6MA 2ZIQH 2ZG0H 4MDSA 3MMGA 4K1TA 3EDXB 1GHAG 5CHAB 1EOLA 1EZXC 3RU4E 1HRTH 3ZYDA 1TLDA 1LKBA 5GWZA 2GZ7A 6GCHF 2IN2A 3E16B 4FU9A 2PKAA 1CT2E 2BQ7B 1HAIH 4VGCC 2ZU5A 4Z0KA 4BANB 3PB1E 3LIWA 3TH3H 1JOUB 4CHAB 2AFQB 3BG4C 2BDGA 2OC1A 1S81A 3M3VA 1HV7A 1UK2A 1TYNA 1O3IA 1TFXA 2B8OH 4NIVA 1AWFH 2XC4A 3LU9B 3WY8A 4KTCA 1F5LA 1GJ4H 2FI4E 1EAWA 1W2KH 2CXVA 3OTJE 1OWDA 3KL6A 1MTWA 3SUEA 2AIQA 3MU8A 1MAYA 5JB8S 2ALPA 5GCHF 4CBOA 2G8TA 3ZVEA 5FBEA 1UMAH 3ZVDA 4F4OC 2ZFFH 1LVMA 1ZR0A 5EXMA 1FY3A 1MTUA 2V0BA 4NZLA 4X1NU 3SZNA 3P8GA 3PMAB 1S0QA 4YT7H 4X6PA 5JDUB 2QXHA 1K28D 1MQ6A 1W3CA 5AFYH 2OBOA 4RN6A 4XFQA 2OC0A 1MKXH 1ID5H 1WQSA 2BXTH 2OC8A 1ZPZA 4CRGA 2ZEBA 1AZZA 1BTYA 1G3CA 9LPRA 1VGCB 1OX1A 4I8KA 1BOQA 2A0QB 3ZVGA 1TX8A 1NN6A 1ANBA 1UK3A 4B74A 3U8TH 3C1KA 1XUKA 8ESTE 1BITA 1LTOA 2CHAB 3PLBA 1SLUB 1Y3WA 2ZO3H 3LJOA 1SL3A 2P3UB 1O5GH 2ZGHA 3PV4A 4YOIA 4BAOB 3A7XA 5EXLA 3FP6E 3BTTE 1ZSLA 3TH4H 3KQBA 1T8LA 3S7HB 1ELFA 3RXEA 1D3TB 4Q80A 4THNH 3GOVB 4IBLH 1O32A 2VH6A 1CGJE 3VXEH 4DY7B 2HOBA 1O2PA 4I33A 2FYRA 1LHFH 1V2RT 1BIOA 1EAXA 1QCPA 1O2NA 1A0LA 4WMEA 4FVDA 4KELA 4M7GA 1P2KA 1OP2A 1FY1A 4MPXA 4AB8A 1SGRE 1K1PA 4OS6A 3M36A 1SB1H 4WY3A 2ZECA 1QNJA 4DGJA 2VIDA 2BMGB 3RMMH 3PROA 1YP9A 1OXGA 1GBHA 4ABJA 1EOJA 2GCHF 1RXPA 1L1GA 1H4WA 2HRVA 2QGRA 1LVOA 2EA3A 2OLGA 3W94A 3MH5A 4E06H 1W8BH 4GCHG 1O5EH 2UUYA 4X6NA 1HAZB 3EQ0H 1THPB 4Q7XA 2BDIA 1UK4A 1HAGE 3BG8A 4IN2A 3UY9A 1UVPA 5L30H 4MNYA 1LHCH 5F03A 1DWDH 1HJ9A 2VVUA 1FPCH 5GIBA 1TQ7B 1QRZA 1G3EA 5GDSH 4ZMAH 3U1IB 2JETC 4WVPE 1ESAA 1IHSH 4NSVA 4WJG2 1IQEA 1SGYE 1FIWA 1C5RA 1QHRB 1SOTA 1W10U 1TX7A 4X0WU 1P2NA 1JRTA 1XUFA 4DIIH 2QA9E 2QCYA 1MQ5A 2ALVA 6CHAB 3BEUA 3ZV8A 3SNCA 2ZCHP 1PQ7A 1V6DA 2P8OB 4INKA 1YC0A 2FEQH 3SGBE 2WPIS 3ZZ4A 1PPGE 1YPEH 1AKSA 2XW9A 1KXCA 4IMZA 2FOGA 1GMDG 3SW2B 1IQFA 2TRMA 1KDQA 3BTWE 1V2ST 4YZUA 1D6WA 1RIWB 2ZCLP 3SJIA 3RU4T 2G81E 2ZHFH 1P57B 3V12A 4KTSA 3GCOA 4X2XA 5F6MA 2A4GA 3T27A 1P3EA 4AN7A 1S83A 4OS5A 3BTDE 2ZF0H 1DM4B 3NPSA 3P8NA 4KKDA 1O2GH
chains in the Genus database with same CATH superfamily
1GHVH 2OD3B 3EA9A 3DSPA 3FO8D 1OWIA 3VB4A 3GISB 1CA8B 1RTKA 3QN7A 4YT6H 5E0GA 3AW1A 4Y6DA 1QL8A 1SGEE 2ZTZA 3QUMP 1G36A 1ZGVA 1GHYH 1TBRH 2G5NA 3OSYA 4TY6A 1GJ6A 1OHHD 2HLDD 1V2WT 5J4SA 2F91A 2ULLA 2ANYA 2AS9A 4F49A 2BDYA 4B1TA 1L2EA 4NA8A 1NRNH 3QLPH 1K1OA 1H1BA 1DSUA 3GY4A 1TALA 4XE4A 1GCTC 2WPLS 5FPYA 3HGPA 1O34A 5DP3A 3QTOH 1YPHC 4K1SA 2W6JD 1LQEA 1DXWA 1X7AC 4ISHH 2AMDA 3MTYA 5DKMA 3VB6A 4D7FA 1C2FA 1GJ9B 5SGAE 2GTBA 1O3NA 1BRAA 1HLTH 3CS0A 1P11E 1AFEH 1SGDE 1O2YA 4Y11E 4ASUD 1JXPA 1LMWB 1TONA 3UR9A 3RM0H 1B5GH 2GZ9A 3LONA 3D23A 3GCTF 4WH6A 1PYTC 3ZZBA 3QK1A 3CS7A 3MU0A 3F0PA 1AVXA 3BIVH 1TOMH 2BD5A 3AVZA 5C0TA 1UCYE 3TJUA 1SSXA 1O2ZA 1O5CB 1HCGA 1QJ1B 3RXCA 3TGIE 2W6ID 2PWXA 1ZMNA 1J9CH 3ATLA 1LHEH 2PFEA 4Y0ZE 2KR7A 3S7KB 5HYOA 1BHXB 3LJJA 3DD2H 3UR6A 1LVBA 2P94A 3SO3A 1FAXA 4X1RU 1NFYA 1HNEE 5HM2A 2EQNA 2SGDE 3SGQE 1AB9C 4GSOA 2W3KA 1P9SA 1UJ1A 2C4FH 5LGOA 2V3OH 3HK6B 1THSH 3F9EA 2GV6A 3A86A 1MKWH 2Q6GA 1KXBA 3ZIAD 1FDPA 1IQIA 2Z3CA 3ATIA 1N6YA 2D26C 3GY5A 4AC9A 1GL1A 5L2ZH 1J16A 1CVWH 1QRXA 2ZP0H 1EFRD 1BCUH 1K2I1 4Y7AA 1TRYA 3B23B 1BTPA 1GBTA 2IJD1 3TNSA 2OP9A 3STIA 1NRPH 3F2HA 4A6LA 1C2GA 1C2EA 1UTNA 2C8YB 1JBUH 2QE7D 1SLWB 3QX5H 4GHTA 3MO6A 5GXPA 2RA0A 3GCHC 1JWTA 1O2QA 1TPOA 4Q7ZA 1A0JA 2STBE 3RXTA 5K0HA 1P01A 1GI9B 5DP6A 1P10A 5C67A 1RD3B 1SVPA 1DPOA 3TK6A 5EU8A 1S85A 4FVBA 3FFGA 2PUQH 1ZSJA 2PSYA 5EGMA 4O97A 1UHBA 2BY5X 1A1RA 2BVSH 4D8NA 3MU1A 1RGQA 3OTPA 1A0HB 1SGPE 3G01A 2P16A 1C2HA 2SFAA 1Y8TA 2KZ4A 2RA3A 3FZZA 2VVCA 1O37A 1Y59T 2FS9A 3C27B 2A4OA 2B5TB 5FL7D 1UVSH 2XWBI 1O2TA 4IW4E 1ABIH 2ZHWH 1AD8H 1QA7A 1QR3E 3MU4A 2ZTXA 1Z1JA 2FOFA 1AVWA 3SU0A 1UW7A 1BTXA 1S5SA 5DP4A 2P3TB 2BDAA 1L1JA 1NESE 5DJ7A 3UWIA 1IQJA 1Y3YA 4KGAA 4XBDA 1SGFG 2WUCA 1FJSA 1EZUC 3FAOA 5E0JA 1KXEA 1GGDB 3SU1A 4WMDA 4YOGA 1FI8A 5ESTE 1QQ4A 2QF0A 2DE9A 4ZXYH 2BLVA 3ZZ3A 1QB9A 3UQVA 1W0ZU 1ZLRA 3V13A 4CRAA 1GJ8B 1C5VA 5T6FA 1QBVH 1D4PB 3RLYH 1C5ZB 2ZCKP 3FP7E 1QRWA 3SU3A 1O39A 1J17T 3U8RH 3LGTA 5FAHA 1DUAA 1W0YH 4AGKA 1PYTD 3MNCA 4NFFA 2SGEE 1GI8B 4A92A 1MBMA 1PPHE 3LGIA 3DA9B 1H9HE 3BTFE 3HATH 4NWKA 3OYPA 5GNDA 1MD8A 1BA8B 1TNHA 2BQWB 3EE7A 4D7GA 5A0BA 5JYIA 2B7DH 1NC6A 3Q3XA 3RXLA 4BAQB 4K8BA 3NWUA 3PO1B 1C1NA 1YYY1 3LPRA 3TJOA 3BV9B 3ZZCA 1FQ3A 1AUTC 2WPJS 2PR3A 7LPRA 1T4UH 1W0KD 4IGDA 4Z6AH 3M3TA 1A4WH 3UOPA 1O0DH 3VGCB 3RU4D 1E38B 1WSSH 3MU5A 2Q1JA 3DSGA 1GG6C 3GCNA 1FX0B 3NK8A 5EQRA 1ZPCA 3FP8E 2J95A 1AHTH 3UOUA 1ZJDA 3HKJB 4CRCA 1QZ8A 1INCA 2BD2A 2AGEX 3JZ2B 3RXDA 1KXDA 1LPKB 4F48B 1HAHH 1O2WA 2W5EA 2ZPSA 1FN8A 1SQTA 1A3EH 3A7TA 2VH0A 1HJAB 1YPHE 1AQ7A 2OTVA 4JYUH 4NG9H 1FNIA 1O5FH 1GBLA 1DT2A 2R0KA 5EQSA 3HK3B 3UNSA 4DT4A 1O30A 2NU2E 2ZU2A 5IK2D 1IQMA 1SHYA 1LHGH 1K1LA 2ZFPH 4GHQA 4X8SH 4ZHMU 1UO6A 3NZIA 2XTTB 1GDUA 1C5UA 1CA0C 3ZZDA 2Z9JA 1S6HA 8GCHF 1TPSA 1Q31A 1ZTJA 1KTTB 1N8OB 1SG8B 1K22H 1O3JA 4UE7H 3FN8A 1NRQH 3QO6A 5HIZA 3SHAH 1LO6A 4JZEH 2OXSA 1GI6A 2LPRA 1W11U 3PV5A 2VGCB 2J34A 2V3HH 1VCPA 1O2IA 2UWOA 1DWCH 1C1OA 1C1SA 1DICA 1IQLA 3H7OA 4NGAH 3RMNH 3TITA 2SNVA 3AW0A 2GD4B 3N7DA 2BOHB 3O8DA 1V2UT 3SV2H 3EAJA 1WV7H 3SU5A 2PV9B 4AZ2B 3BF6H 2A2XH 1MTSA 4MNVA 4ZAEA 3SQEE 2GVFA 1OWJA 2GX4A 3P92A 5EJ1A 1MCTA 1Y3VA 1H8ED 1E1QD 4CR9A 4VGCB 4CRBA 5A0AE 2J9NA 3E1XB 1C5NH 1OYQA 1Y3XA 2YNAA 3A81A 4H42U 1CT0E 1GHWH 1TAWA 3SV6A 1CHOF 2H6MA 2BHGA 2KAIB 2Y82A 3BG4B 5GCHG 2XCNA 1G32B 4JZ1A 3ZVFA 2ZFRH 5AFZH 1D6RA 3RXIA 4CH2B 4IMQA 3OEHD 3SUDA 1FIZA 4ZKSU 2BD3A 3ZZ5A 1DE7H 3SUFA 2HVXA 2CF8H 2EI6A 2XCFA 4ISIH 3DFJA 1G30B 3U8OH 1YM0A 2F9BH 1PPZA 1DSTA 1P2MA 2ZC9H 1AVGH 3A8DA 2FP7B 3IG6B 1N6XA 3WW7A 2XBWA 1BMNH 4GLYA 1WUNH 4TPYA 5FX5A 3F9FA 4HI3A 3GYMA 3M5NA 2V7QD 2O8TA 2PP6A 2ZWLH 2GJGA 2YNBA 1VJAU 3GDVA 1AI8H 1IOEA 3NUMA 2GCTC 3A84A 2ZNKH 1ANDA 2KCAA 2BZ6H 5EPNA 3VXFH 2CGAA 5DPAA 2G4TA 5HGGA 3F9GA 4K2YA 1GI0A 3A8CA 2FS8A 1O3MA 3KYFA 4DW2U 2ZU4A 1O5DH 1ZTKA 1PPCE 1GMHF 1O2VA 5G4BA 1RRKA 1TWXB 3EYDA 2J98B 4CR5A 1BZXE 2AEIH 2DE8A 2P59A 4B2AA 1GHBF 3F6UH 5JBTA 1BMLA 3SNAA 1NBMD 1YLDA 1C5PA 3P70B 3VEQB 2ZQ1A 1KXFA 1OS8A 2ANKH 4K69A 2WV5A 2P93A 1XKBC 2FI3E 2FM2A 3BIUH 1EB1H 1HAYB 1HIAA 4DJZB 1XMNB 2ZDMA 3H09A 3Q76A 4CREA 4IC6A 5IYTA 4GPGA 1HAVB 5A09A 2ZDNA 1UCYK 2BQ6B 2KCYA 2OUAA 1JMOH 3S9CA 2QAAA 5JB9S 1GJDB 3UTUH 1WYKA 2XYAA 3PLKA 5ABWA 2WSSD 3Q77A 1EPTB 2BD8A 1AUJA 1CGHA 2TGPZ 1BTWA 4MPUA 1ZJKA 1EKBB 2PKSC 2GCHG 2G00A 1IQHA 4AYVB 3AAVA 4OGXA 2NU4E 2A4RA 1QURH 2NU0E 3DT0H 1QQUA 5DP7A 1EPTC 1C5TA 1DS2E 1Z8IB 1O3AA 1O3DA 1F92A 4A7IB 1O31A 2QF3A 4DVAU 1H9LB 2L74A 1CBWC 1WBGB 5E8EH 2VVVA 4D76A 1GBDA 3O8RA 2FOEA 2H1UA 2VIQA 1G3DA 2R0LA 3KQ5A 2ZHQH 1W7GH 2WUBA 1GVLA 3TGJE 3V7TA 2QC2A 2A5IA 2FTLE 5FX6A 1S6FA 1BB0B 1IQKA 3RXRA 4ISLA 4ZKNU 1QTFA 2SGPE 1OOKB 1G9IE 2AIPA 5CDFE 4NSYA 3VB3A 1K1MA 4SGBE 2A5AA 2FODA 1T8OA 3BTKE 1O2LA 3PTNA 1F0TA 3QGNB 1T32A 4RSPA 1F0RA 1KMHB 2BYAX 3R3GB 4YESB 3LDXH 4E7NA 3KHVA 3SU6A 3BTEE 1COWD 3KNXA 4Y7BA 3SQHE 3OFND 4ABDA 2JH5D 2C93B 2JDID 3EGKH 2W7UA 2QXJA 1DXPA 2JETB 2QN5T 3OAAD 1ELBA 1Y3UA 5EQQA 5TCCA 4E7RG 2VBCA 2G52A 1BHXF 4Y79A 3IWMA 5FHTA 2BLQA 1EZSC 6ESTA 1P9UA 1GI7B 1XVMA 4DCDA 3RC4A 4I31A 3MNXA 1BRUP 4ABHA 5EJLA 4O3TA 3RC6A 1A61H 1P2IA 2FIRH 3QGJA 4K5ZA 4AFUA 4O9VA 1ANEA 3RXUA 2A7CA 4PROA 1YLNA 1GJBB 1MTNC 4OS2A 1GBAA 3KCGH 1DX5M 5T6GA 2H9HA 3RM2H 5I25A 4BTUB 3BN9A 1C4U2 2M2AA 2Y7ZA 1RTLA 1GI2A 2EC9H 1QB1A 3SOSA 3E3TA 5GPIB 2D8WA 7GCHG 2BLWA 4JZIA 3BTHE 3S9BA 4GCHF 1Q3XA 1BJVA 3MYWA 3NKKA 1HAOH 2I6QA 1L0ZA 2BX4A 2VNTA 3OY6U 3KN2A 2J2UA 1PJPA 4AYYB 4B76A 2A4QA 1UTQA 3HGNA 2ZHEH 3RXMA 1O36A 2HALA 4X2WA 4YM9A 3FANA 2YMSC 3B8JA 3N7OA 3ATWA 1MD7A 3RXFA 2NU3E 3GDUA 5T6DA 1A46H 4HFPB 1T8MA 1ZSKA 3TVJB 1O3OA 1V2NT 1QJ7B 4NIYA 1LKAA 2PKAB 2UUFB 1ZHMA 4FUHA 1BRCE 4MPVA 2FZZA 1PFXC 3VB5A 2CV3A 2FX4A 1UTLM 1GCTB 1OKXA 4E05H 1K9OE 2BZAA 3VPKA 1MU6B 1HDTH 1NS3A 1K1NA 1SGCA 4MPWA 3GCTG 2VU8E 2PTNA 1ELVA 1MTVA 3RMLH 3MI4A 3RXGA 2ZZUH 1U6QA 1VCWA 1BDAA 4TY7A 3FVFB 1FZZA 2IPHA 4B2CA 2H5CA 4BAMB 2Z6BD 2QXGA 2VIVA 2IJOB 4Y8ZA 1ETRH 1TB6H 2ZFTA 4SGAE 5A8XA 1Z1IA 1TIOA 1J14A 1GMDF 1V2MT 4JZDH 5L2YH 1AFQC 4CH8B 1TABE 1JRSA 2R3YA 4J1YA 1HAXB 4LK4A 1K0HA 4U32A 1YPLH 5T1VA 1O2KA 3ELAH 2XBYA 1NRSH 1BTZA 1KY9A 3MOCA 1OSSA 2ZDKA 3I78A 1XUHA 3K6YA 1TGCA 5DO4H 5AHGH 3SJ8A 1Z6EA 2ZPQA 1P3CA 2VIPA 2WPKS 3E90B 1YLCA 1SQRA 1HPGA 1UTJA 3D49H 1NROH 2Z3EA 1LPGB 2V3MA 1YPMH 4FUCA 4X2YA 5FPTA 3SJKA 2EI8A 1AB9B 2FOHA 2Z9KA 2PSXA 1GI1A 1BQYA 1NU7B 3D62A 3K65B 4CRFA 2PW8H 4A1XA 2BY9X 2GP9B 4TWYA 1MMJN 2WV9A 5ETXA 5F53A 2V35A 2JH6D 2XC5A 5DK1A 1TQ0B 2FESH 2FXRA 3RC5A 4FXGH 3NRLA 2D2DA 3UFAA 1WQVH 4I8JA 3URDA 2Y6TA 2J97A 3SI4H 3BTME 1O2SA 1O38A 1AE8H 3TNTA 3KQCA 3LGVA 2FOAA 4OS4A 5I46H 3O8CA 3BTGE 1AE5A 3GCHB 3SHCH 1TRNA 1Y5UT 1NTPA 1O2HA 4UEHH 2H9EH 5F8ZA 1QIXB 1GPZA 1F5KU 3BEIB 2ANWA 5DP8A 5CMXH 1WCZA 3FKSD 2Y5HA 3T5FH 3PYHA 5LPEA 2OC7A 2QYIA 2AH4X 1A5HA 2YMSD 1QB6A 2G4UA 3E0NB 3L6PA 1ORFA 3TU7H 5C1UA 2R9PA 3SI3H 1E36B 1TMBH 1EAUA 1D9IA 1O3FA 3F3BA 1FY4A 2O8MA 4MVNA 3PMHB 2XXLA 1DY9A 1HB0B 3K9XB 2B0FA 3TGKE 1VZQH 1FPHH 1PQAA 5B6OA 1F0UA 5CE1A 4P02A 3A7ZA 4BXWA 3KF2A 1C5QA 1OP8A 2BTCE 3QDZB 4ISOA 1NT1A 1G3BA 1XVOA 1GBFA 3T29A 4ZUHA 1MBQA 2ZPRA 1FY5A 1RFNA 4I32A 4X1SU 4XBCA 2WPHS 1C5SA 5EIYA 1XXFA 1O3KA 4DIHH 2HVYB 2FI5E 4Y76A 2BVXH 1F2SE 1Z7KA 1YF4A 3Q3YA 4D9RA 1D3DB 3OEED 1ZZZA 3BTQE 1QBOA 3ESTA 1C2JA 2F9VA 1SGFA 3SNDA 1TA2A 3SZEA 4WH8A 1W12U 3SNBA 1IHTH 1WOFA 5EODA 2ZU1A 2VWOA 3MO3A 2OQUA 1DWBH 1YCPK 3A8AA 1C1QA 3SYJA 4X2VA 1KLTA 2C8WB 2BB4A 3SGAE 2GT8A 4O3UA 1HAVA 2J38A 3PTBA 2F9UA 2ESTE 3A87A 1GDNA 1TNIA 1RS0A 1ZOMA 1BBRH 2FTMA 1YGCH 1A5GH 4LOYH 5E2PA 3PV2A 1DITH 1ELCA 3A7YA 1F0SA 4UFDH 2H2ZA 1TRMA 1VJ9U 5E2OA 5HM9A 3KGPA 1CGIE 4LZ4B 4JYVH 2AMQA 1AO5A 4CBNA 3FZDA 1DDJA 1PPEE 4LXBH 3P8OA 3TJVA 3T26A 4BAKB 5DSFA 1WAYB 2UUJB 1YPKH 5DG6A 3P6ZB 1ELDE 1C1MA 3DHKH 2NWNA 3A80A 5H4IB 2UWLA 1C9TA 1GG6B 2Z7FE 4U2WA 1GL0E 1C5MD 3TK9A 3MH6A 3ZVBA 4U01A 4MLFB 1NY22 3SV9A 3PMBB 4I8LA 1TA6A 5JBBS 1SI5H 8GCHG 4IC5A 1MAXA 1EJMA 2BXUH 1MCVA 1FLEE 1NFWA 1A3BH 2HNTE 4I8GA 1C5YB 3M7TA 3CP7A 4I8HA 5FXLA 2QXIA 1W14U 3WWFA 1ESBA 1A2CH 1VITF 4Q2KA 3A83A 1ACBE 2GDEH 2WPMS 1O35A 2GT7A 2GMTC 1FY8E 3O8BA 3PLPA 4UFEH 1LHDH 3UPEA 2FLRH 3ATKA 1CA0B 3EA8A 2ZDVH 4AORA 2XC0A 4NIWA 2F83A 4B75A 2A7JA 4OM9A 2VINA 1G2LA 3ZVAA 3RXJA 1UTKA 1AU8A 2LNCA 5EW1H 3U28C 3LC5A 2XWAA 2ASUB 2ZA5A 5A8YA 5C5OA 1XX9A 2Y81A 1WTHD 1P12E 4P00A 1EATA 1H8HD 1UTMA 3T2NA 6GCHG 1J15A 4MG3A 1T4VH 1TMTH 1GMCF 1DWEH 1VR1H 1GJ5H 2ZQ2A 3BEFB 3SJOA 5C3NA 4HG6A 4ABGA 9ESTA 1K21H 2PHBA 1V2LT 3Q3KA 4X8TH 5AVDA 2ZHDA 4DOQA 1CE5A 2C8ZB 4Y10E 4A1TA 4Z1MD 3K6ZA 3GY6A 1UCYH 2ZDAH 2Q6FA 1SGNE 1DFPA 2O8WA 1SMFE 2XBVA 3TK5A 2CMYA 4JZFH 1T8NA 1E35B 1ELTA 3GICB 2C90B 1Z8RA 1O2RA 1TBQH 1SPJA 2SGQE 4FUEA 1GVKB 3GDSA 1QL9A 1C1RA 2ODYB 1O2UA 5FBIA 4ZXXH 2VWNA 1V2QT 1FN6A 4DG4A 1D3PB 2Z9IA 5BRRE 3P8FA 4BAHB 1NU9A 2G51A 3MH4A 1T31A 3MO9A 5KGOA 4A5TS 1SFIA 5C1XA 1EP6A 3OX7U 4INLA 1SC8U 1ETTH 3E0PB 1ELEE 1C5WB 1SQOA 2ODQA 1VCQA 1TPAE 4UDWH 1WTGH 4JCNA 1GHBG 1GJ7B 4K3JA 1S84A 4FUBA 2QF5A 5HIYA 1EQ9A 2GCTB 1GI3A 5B6LA 1UVTH 4RKOB 1XKAC 1C2DA 4FUGA 2A31A 1ELAA 1A5IA 5DP5A 1OWHA 3T25A 3PRDA 1BUIA 1P0SH 2FWWA 5CHAC 2SNWA 3A85A 3MQKC 1NZQH 2H9TH 1AIXH 2BX3A 5HXFA 4Q63A 3F9HA 4X8UH 1P05A 3GYLB 1C5LH 5AF9H 1UHBB 2R2MB 2ZFQH 1ARCA 1JIMA 1GJAB 3PRBA 8KME2 5BPEA 2VIOA 3UWJH 2R3UA 4CHAC 1TNJA 4IN1A 1GVZA 1FONA 1GHAF 2HNTF 2OINA 4FUDA 4WXIA 1QGFA 4CRDA 3KIDU 3ZVCA 2QIQA 3F1SB 2GZ8A 1SLXB 3SN8A 4BOHA 1Z8GA 1GHZA 3I29A 2F9OA 2AMPA 5C1YA 3B9FH 1Z6JH 2R2WU 1SFQB 2HPPH 1TGSZ 2GDDA 1CQQA 1SHHB 1L1NA 3M5OA 2PKSB 2Y80A 1EXFA 2OQ5A 4XBBA 4X8VH 4Q7YA 1D3QB 1YBWA 2BLOA 4AFSA 2P3FH 4FU8A 3RMOH 2BVRH 1O3GA 1NFXA 1EZQA 1TBZH 3QZRA 1O2OA 1FV9A 2VWLA 2VWMA 4AFZA 1H9IE 1OPHB 1RTFB 2A32A 1CBWB 1F7ZA 5KEDA 1V2OT 1Q2WA 3LC3A 4XDEA 1A7SA 4OS7A 3SV8A 2SGFE 1SOZA 4KTUA 4UD9H 1E37B 1SQAA 1XUJA 4K8YA 1VGCC 3S0NA 2FOBA 1O3PB 2IPQX 3HPTB 5CHBA 1NM6A 2WYGA 2GGVB 1FMGA 4AOQA 2WZQA 3F68H 1P2OA 1S0RA 1QBNA 2ZGBH 3LH1A 3GY8A 2ZGXH 4X1PU 2W3IA 1GBBA 4R0IA 3QTVH 2CHAC 1GDQA 2ODPA 3MHWU 3H5CB 3F0OA 5F8XA 3RLWH 3RXOA 3E8LA 1QY6A 1ZPBA 1MZAA 1O33A 4D9QA 2BY8X 1ANCA 1TGTA 2W26A 3QZQA 2FO9A 3M61U 2KFWA 1C1WH 3K2UA 4X6OA 4ABEA 1MZDA 1GCDA 3AASA 1UVOA 4DT7B 3M3SA 3L33A 5FPSA 3KQDA 1GBIA 3H7TA 1PPBH 3RXBA 2Y5FA 3ZZ6A 1ELGA 1LDTT 4YLQH 3F2GA 3RXHA 2K0QA 3VG8A 1GI5A 1C1VH 2WINI 5LPFA 1DANH 1DVAH 2F3CE 1KIGH 2CF9H 2EI7A 2K1QA 4ZH8A 1OYTH 2BDHA 2THFB 4TPIZ 1CSOE 2ZI2H 3U69H 5C2ZA 1KLIH 1KXAA 1ZMLA 1P03A 2UUKB 1MTNB 3UQOA 4ZKOU 3ITIA 1ZRKA 1G37A 3NCLA 3MWIU 6LPRA 2EEKA 1E34B 4I86A 1JIRA 3M5MA 3N99A 4ABIA 1OP0A 1EX3A 3M35A 4B71A 2BD7A 4ZCNA 5L6NH 3DSOA 4BTIB 2V6NA 3PWCA 3UNQA 2HWLB 1BTHH 1DLKB 1MKXK 1H8DH 4FUIA 2VIWA 2AYWA 4WF8A 2P95A 2HPQH 1TNKA 2BM2A 2ZDLA 2SGAA 3UIRA 1Y5AT 4H6SB 1E0FD 1ESTA 4WWYA 3EE0B 2ZGCA 1UVUH 1O5BB 2G5VA 3ZZ7A 1NRRH 2TBSA 3PWBA 1ZRBA 4M9FA 1O3BA 2JJ2D 2A2QH 2YMSB 1EB2A 2W7SA 3RXPA 1OWKA 4ACBA 4NZQA 1FUJA 2AGGX 4UFFH 1TOCB 2RDEA 4Y0YE 2JH0D 1KYNA 4TWWA 1HXEH 2BY7X 1EAIA 3M7QA 4GAWA 3LGYA 4AX9H 4INHA 2TGAA 3U98H 2GV7A 1K1JA 4ASHA 4BTTB 5DP9A 1BBRE 2XRCA 2TGTA 7KMEH 5TCAA 5C17A 6CHAC 2ANMH 4DURA 5ESBA 2P8OC 1WU1A 1SR5C 4MNXA 4XOJA 2PUXB 5EXNA 3UNRA 2YOLA 5GJ4B 3TIUA 1O2MA 1J8AA 1YCPM 3VB7A 3JZ1B 2HNTC 4GVUA 2BY6X 3MNBA 1P8VC 3RXKA 4ZKRU 4BXSA 1EJAA 2TPIZ 4WMFA 1RIWC 5HKKD 2WYJA 1L4DA 5FCRA 3GS9A 3A89A 1MUEB 2PTCE 1IQGA 3P95A 5E0HA 4J2YB 1AFQB 3ZZ9A 1EUFA 1XUGA 1XUIA 3RUOA 3UB0A 1M9UA 3QWCH 3U1JB 1TX6A 4H6TA 1AN1E 7GCHF 2H5DA 4IS5A 3T28A 3R0FA 4YLUA 2A7HA 4FUFA 2GKVE 3GY2A 3TLOA 3A82A 4U30A 1TGBA 1BRBE 1V2VT 2EY4C 1ZHPA 2CJIA 3LT3A 1HJ8A 3ODDA 5K7RA 3IITA 3UUZA 2VJ1A 4BNRA 1P02A 1ZMJA 2ZKSA 3HKIB 2Y7XA 2JKHA 3LH3A 4KP0A 3S9AA 3I77A 5PTPA 3PMJA 3L3TA 2Z9GA 1AGJA 2LELA 3RXQA 1HIAB 1GBEA 2A5KA 2Y5GA 2J4IA 1HGTH 1Z8JB 7ESTE 1CT4E 1QL7A 1O2JA 1TNGA 4LZ1H 3E6PH 2O8LA 5A0CA 4K60A 4X1QU 1C2MA 1YY3A 1GHXH 3RXVA 4RKJB 1XXDA 3SU2A 1YCPH 1TE0A 2I6SA 4ABAA 1C1PA 2OBQA 3V0XA 4AG2A 4WXVA 3SJ9A 1BMMH 1B7XB 1C2IA 2BD4A 2CN0H 3F2FA 2QY0B 1NFUA 1S82A 5EW2H 3TJNA 1KTSB 1UTOA 3RXSA 2DUCA 1THRH 2FX6A 2QV1A 3ENSB 1MH0A 1WXRA 1C4Y2 2A45B 4NWLA 3OU0A 2FOCA 4I7YH 1C5OH 4FUJA 5EPYA 1UTPA 2NU1E 1P2JA 4ZHLU 3GY3A 1C1TA 4NA9H 2KAIA 3UREA 1GBMA 2RCEA 4MQAA 2WV4A 4HZHA 3A7VA 4ZHAA 4ZROA 2ZGJA 3MFJA 3ODFA 4FOUC 2A1DB 1GBJA 5C0UA 1W0JD 1B0FA 2Q6DA 2AERH 1EASA 1V2TT 2C8XB 5A2MH 4MNWA 1N1LA 1V3XA 3NXPA 1C2KA 1AY6H 1LCYA 2ILNA 2RG3A 3MNSA 1H8IH 1MU8B 3M37A 1O5AB 1V2KT 1PQ5A 2KX4A 5EOKA 3N7EA 3ZYEA 2B9LA 4OGYA 4GUXA 5J4QA 1KLJH 3DUXH 4XRNA 2F9PA 3TH2H 4UONA 3RP2A 5DN6D 1YPJH 4TYDA 5F8TA 2FYQA 3T62A 4B73A 2BDBA 2PGQB 3BSQA 4JK6A 1BMAA 4Q4LA 5C5NA 1SLVB 2CK3D 1CO7E 3V3MA 1FXYA 3P17H 3KEEA 4ESTE 3URCA 4JK5A 2J98A 4AG1A 2ZU3A 1SGQE 3MH7A 3A8BA 2FDAA 3STJA 1LQDB 1AMHA 3GY7A 4HGCA 8LPRA 3OY5U 2HLCA 2O9QA 2TGDA 3S69A 4JMYA 1ZGIA 4JYTA 2VB0A 3AAUA 1OWEA 1O3LA 3M7UA 2F9NA 2M5TA 4ABFA 1P09A 2O8UA 3AK5A 4AB9A 2J92A 1L4ZA 3RDZA 4MTBA 1LPZB 1IAUA 1XM1A 5A8ZA 4XSKU 1HUTH 1AZ8A 1ZHRA 1ZYOA 2Z3DA 4NA7A 1HBTH 1QA0A 1AKSB 1P2QA 1HXFH 1VITG 2RDLA 1EPTA 1O2XA 3M5LA 4RI0A 1KDQB 5FCKA 2J94A 1KSNA 1IQNA 2D1JA 3RXAA 1BTUA 2FPZA 2STAE 1GGDC 5IDKA 1T7CA 1Y5BT 2TIOA 4O03A 4AGJA 2UWPA 3LGWA 1CHGA 1YPGH 3A88A 1QFKH 1BJUA 1MKWK 1P06A 5C20A 1F5RA 1EP5A 1CU1A 1TMUH 4H4FA 3DFLA 4R8TB 4AFQA 4UFGH 3ZZ8A 2BD9A 1Z71A 2G55A 2GMTB 2F4LA 4NIXA 3ZV9A 1GBKA 3SORA 2ZFSA 2PLXA 1V2PT 3CENA 1NO9H 5LH8A 4YTAA 3SUGA 3A7WA 1DUEA 4YOJA 1GMCG 1PQ8A 1O3CA 3SNEA 2PGBB 1GJCB 2OCVB 1ARBA 3WWBA 1DOJA 4K1EA 1DY8A 3PO1C 4B2BA 1ZTLA 4Y71A 5JBAS 5LPRA 3U9AH 1SGIB 1LVYA 1C9PA 5JPMH 5TJXA 1B0EA 3VGCC 1FAKH 1V2JT 1O3HA 3W95A 1HAPH 1S6LA 3E91A 1P04A 2BOKA 1C2LA 1GWAA 4OS1A 4QT8C 4YO9A 1WDIA 2FLBH 4HTCH 1E79D 1DLEA 3D65E 1HFDA 1CHOG 1EJNA 2HGTH 4RT1A 1QJ6B 2FOMB 3Q00A 1TGNA 5DGJA 2IOTA 3TPIZ 4ABBA 1TPPA 4ISNA 1G2MA 1TNLA 3LOXA 2Z9LA 1HJAC 2FMJA 1C1UH 1C5XB 3EA7A 3KYGA 5HMAA 2AGIX 4TT3D 1YKTA 2LP6A 1RJXB 4YXWD 4A1VA 1O3EA 4Y8XA 3SU4A 5EG4A 2C3SA 3LKWA 3LGUA 1ABJH 3PM3A 1SBWA 3SV7A 4NCYA 1SGTA 1N8OC 2WPDD 2ZTYA 3ATMA 2BDCA 3ZZAA 2RFKC 1W13U 4Y8YA 4XD7D 1C4V2 4NFEA 5JBCS 1GBCA 2JJ1D 1K1IA 1BBRK 1PPFE 3KQEA 3VFEA 1BT7A 2VGCC 2Z94A 5T3HA 1GI4A 1VITH 2J5UA 1AWHB 2XNIA 3SBKA 1NPMA 1ETSH 1GMHG 1HYLA 2XBXA 4FU7A 1W7XH 4X6MA 2ZIQH 2ZG0H 4MDSA 3MMGA 1E1RD 2JIZD 4K1TA 3EDXB 1GHAG 2L6OA 5CHAB 1EOLA 1EZXC 3RU4E 1HRTH 3ZYDA 1TLDA 1LKBA 5GWZA 2GZ7A 2QF4A 6GCHF 2IN2A 3E16B 4FU9A 2PKAA 1CT2E 4TSFD 2BQ7B 1HAIH 4VGCC 2ZU5A 4Z0KA 4BANB 3PB1E 1SKYE 3LIWA 3TH3H 1JOUB 4CHAB 2AFQB 3BG4C 1MABB 1YWUA 2BDGA 2OC1A 1S81A 3M3VA 1HV7A 1UK2A 1TYNA 1O3IA 1TFXA 2B8OH 4NIVA 1AWFH 2XC4A 3LU9B 3WY8A 4KTCA 1F5LA 1GJ4H 2FI4E 1EAWA 1W2KH 2CXVA 3OTJE 1OWDA 3KL6A 1MTWA 3SUEA 2AIQA 3MU8A 1MAYA 5JB8S 2ALPA 2XNDD 5GCHF 2G8TA 4CBOA 3ZVEA 5FBEA 1UMAH 3ZVDA 4FETA 4F4OC 2ZFFH 1LVMA 1ZR0A 5EXMA 1FY3A 1MTUA 2V0BA 4NZLA 4X1NU 3SZNA 3P8GA 3PMAB 1S0QA 4YT7H 4X6PA 5JDUB 2QXHA 1K28D 1MQ6A 1W3CA 5AFYH 2OBOA 4RN6A 2AHME 4XFQA 2OC0A 3DCLA 1MKXH 1ID5H 1WQSA 2BXTH 1ZPZA 2OC8A 4CRGA 2ZEBA 1AZZA 1BTYA 1G3CA 9LPRA 1VGCB 1OX1A 4I8KA 1BOQA 2A0QB 3ZVGA 1TX8A 1NN6A 1ANBA 1UK3A 4B6EA 4B74A 3U8TH 3C1KA 1XUKA 8ESTE 1BITA 1LTOA 2CHAB 3PLBA 1SLUB 2OK5A 1Y3WA 2ZO3H 3LJOA 1SL3A 2P3UB 1O5GH 2ZGHA 3PV4A 4YOIA 4BAOB 3A7XA 5EXLA 3FP6E 3BTTE 1ZSLA 3TH4H 1BMFD 3KQBA 1T8LA 3S7HB 1ELFA 3RXEA 1D3TB 4Q80A 4THNH 3GOVB 4IBLH 1O32A 2VH6A 2KM0A 2KCOA 1CGJE 3VXEH 4DY7B 2HOBA 1O2PA 4I33A 4B6FA 2FYRA 1LHFH 1V2RT 1BIOA 1EAXA 1QCPA 1O2NA 1A0LA 4WMEA 4FVDA 4KELA 4M7GA 1P2KA 1OP2A 1FY1A 4MPXA 4AB8A 1SGRE 1K1PA 4OS6A 3M36A 1SB1H 4WY3A 2ZECA 1QNJA 4DGJA 2VIDA 2BMGB 3RMMH 3PROA 1YP9A 1OXGA 3W1EA 1GBHA 4ABJA 1EOJA 1VKYA 2GCHF 1RXPA 1L1GA 1H4WA 2HRVA 2QGRA 1LVOA 2EA3A 2WHXA 2OLGA 3W94A 3MH5A 4RT0A 4E06H 2KCPA 1W8BH 4GCHG 1O5EH 2F43B 2UUYA 4X6NA 1HAZB 2XOKD 3EQ0H 1THPB 4Q7XA 2BDIA 1NBME 1UK4A 1HAGE 3BG8A 4IN2A 3UY9A 1UVPA 5L30H 3OE7D 4MNYA 1LHCH 5F03A 1DWDH 1HJ9A 2VVUA 1FPCH 5GIBA 1TQ7B 3CNRA 1QRZA 1G3EA 5GDSH 4ZMAH 3U1IB 2JETC 4WVPE 1ESAA 1IHSH 4NSVA 4WJG2 1IQEA 1SGYE 5EJZA 1FIWA 1C5RA 1QHRB 1SOTA 1W10U 1TX7A 4X0WU 1P2NA 1JRTA 1XUFA 4DIIH 5C94A 2QA9E 2QCYA 1MQ5A 2ALVA 6CHAB 3BEUA 3ZV8A 3SNCA 4ACAA 2ZCHP 1PQ7A 1V6DA 2P8OB 4INKA 1YC0A 2FEQH 3SGBE 3UAIC 2WPIS 3ZZ4A 4F55A 1PPGE 1YPEH 1AKSA 2XW9A 1KXCA 4IMZA 5KECA 2FOGA 1GMDG 3SW2B 1IQFA 2TRMA 1KDQA 3BTWE 1V2ST 4YZUA 1D6WA 1RIWB 2ZCLP 3SJIA 3RU4T 2G81E 2ZHFH 1P57B 3V12A 2K8IA 3FOAA 4KTSA 3GCOA 4X2XA 5F6MA 2A4GA 3T27A 1P3EA 4AN7A 1S83A 4OS5A 3BTDE 2ZF0H 1DM4B 3NPSA 3P8NA 4KKDA 1O2GH
chains in the Genus database with same CATH topology
1GHVH 2OD3B 3EA9A 1OWIA 3VB4A 3GISB 1CA8B 1RTKA 3QN7A 4YT6H 5E0GA 3AW1A 4Y6DA 1QL8A 1SGEE 2ZTZA 3QUMP 1G36A 1ZGVA 1GHYH 1TBRH 2G5NA 3OSYA 4TY6A 1GJ6A 1V2WT 5J4SA 2F91A 2ULLA 2ANYA 2AS9A 4F49A 2BDYA 4B1TA 1L2EA 4NA8A 1NRNH 3QLPH 1K1OA 1H1BA 1DSUA 3GY4A 1TALA 4XE4A 1GCTC 2WPLS 5FPYA 3HGPA 1O34A 5DP3A 3QTOH 1YPHC 4K1SA 1LQEA 1DXWA 1X7AC 4ISHH 2AMDA 3MTYA 5DKMA 3VB6A 4D7FA 1C2FA 1GJ9B 5SGAE 2GTBA 1O3NA 1BRAA 1HLTH 3CS0A 1P11E 1AFEH 1SGDE 1O2YA 4Y11E 1JXPA 1LMWB 1TONA 3UR9A 3RM0H 1B5GH 2GZ9A 3LONA 3D23A 3GCTF 4WH6A 1PYTC 3ZZBA 3QK1A 3CS7A 3MU0A 1AVXA 3BIVH 1TOMH 2BD5A 3AVZA 1UCYE 3TJUA 1SSXA 1O2ZA 1O5CB 1HCGA 1QJ1B 3RXCA 3TGIE 2PWXA 1ZMNA 1J9CH 3ATLA 1LHEH 2PFEA 4Y0ZE 3S7KB 5HYOA 1BHXB 3LJJA 3DD2H 3UR6A 1LVBA 2P94A 3SO3A 1FAXA 4X1RU 1NFYA 1HNEE 5HM2A 2SGDE 3SGQE 1AB9C 4GSOA 2W3KA 1P9SA 1UJ1A 2C4FH 5LGOA 2V3OH 3HK6B 1THSH 3F9EA 2GV6A 3A86A 1MKWH 2Q6GA 1KXBA 1FDPA 1IQIA 2Z3CA 3ATIA 1N6YA 2D26C 3GY5A 5L2ZH 1GL1A 1J16A 1CVWH 1QRXA 2ZP0H 1BCUH 1K2I1 4Y7AA 1TRYA 3B23B 1BTPA 1GBTA 3TNSA 2OP9A 3STIA 1NRPH 4A6LA 1C2GA 1C2EA 1UTNA 2C8YB 1JBUH 1SLWB 3QX5H 4GHTA 3MO6A 5GXPA 2RA0A 3GCHC 1JWTA 1O2QA 1TPOA 4Q7ZA 1A0JA 2STBE 3RXTA 5K0HA 1P01A 1GI9B 5DP6A 1P10A 5C67A 1RD3B 1SVPA 1DPOA 3TK6A 5EU8A 1S85A 4FVBA 3FFGA 2PUQH 1ZSJA 2PSYA 5EGMA 4O97A 1UHBA 2BY5X 1A1RA 2BVSH 4D8NA 3MU1A 1RGQA 1A0HB 1SGPE 3G01A 2P16A 1C2HA 2SFAA 1Y8TA 2RA3A 3FZZA 2VVCA 1O37A 1Y59T 2FS9A 3C27B 2A4OA 2B5TB 1UVSH 2XWBI 1O2TA 4IW4E 1ABIH 2ZHWH 1AD8H 1QA7A 1QR3E 3MU4A 2ZTXA 1Z1JA 2FOFA 1AVWA 3SU0A 1BTXA 1S5SA 5DP4A 2P3TB 2BDAA 1L1JA 1NESE 5DJ7A 3UWIA 1IQJA 1Y3YA 4KGAA 4XBDA 1SGFG 2WUCA 1FJSA 1EZUC 3FAOA 5E0JA 1KXEA 1GGDB 3SU1A 4WMDA 4YOGA 1FI8A 5ESTE 1QQ4A 2QF0A 2DE9A 4ZXYH 2BLVA 3ZZ3A 1QB9A 3UQVA 1W0ZU 1ZLRA 3V13A 4CRAA 1GJ8B 1C5VA 5T6FA 1QBVH 1D4PB 3RLYH 1C5ZB 2ZCKP 3FP7E 1QRWA 3SU3A 1O39A 1J17T 3U8RH 3LGTA 5FAHA 1DUAA 1W0YH 4AGKA 1PYTD 3MNCA 4NFFA 2SGEE 1GI8B 4A92A 1MBMA 1PPHE 3LGIA 3DA9B 1H9HE 3BTFE 3HATH 4NWKA 3OYPA 1MD8A 1BA8B 1TNHA 2BQWB 4D7GA 5A0BA 5JYIA 2B7DH 1NC6A 3Q3XA 3RXLA 4BAQB 4K8BA 3NWUA 3PO1B 1C1NA 1YYY1 3LPRA 3TJOA 3BV9B 3ZZCA 1FQ3A 1AUTC 2WPJS 2PR3A 7LPRA 1T4UH 4IGDA 4Z6AH 3M3TA 1A4WH 3UOPA 1O0DH 3VGCB 3RU4D 1E38B 1WSSH 3MU5A 2Q1JA 1GG6C 3GCNA 3NK8A 5EQRA 1ZPCA 3FP8E 2J95A 1AHTH 3UOUA 1ZJDA 3HKJB 4CRCA 1INCA 2BD2A 2AGEX 3JZ2B 3RXDA 1KXDA 1LPKB 1HAHH 1O2WA 2W5EA 2ZPSA 1FN8A 1SQTA 1A3EH 3A7TA 2VH0A 1HJAB 1YPHE 1AQ7A 2OTVA 4JYUH 4NG9H 1FNIA 1O5FH 1GBLA 1DT2A 2R0KA 5EQSA 3HK3B 3UNSA 1O30A 2NU2E 2ZU2A 1IQMA 1SHYA 1LHGH 1K1LA 2ZFPH 4GHQA 4X8SH 4ZHMU 1UO6A 3NZIA 2XTTB 1GDUA 1C5UA 1CA0C 3ZZDA 2Z9JA 1S6HA 8GCHF 1TPSA 1Q31A 1ZTJA 1KTTB 1N8OB 1SG8B 1K22H 1O3JA 4UE7H 1NRQH 3QO6A 3SHAH 1LO6A 4JZEH 2OXSA 1GI6A 2LPRA 1W11U 2VGCB 2J34A 2V3HH 1VCPA 1O2IA 2UWOA 1DWCH 1C1OA 1C1SA 1DICA 1IQLA 3H7OA 4NGAH 3RMNH 3TITA 2SNVA 3AW0A 2GD4B 2BOHB 3O8DA 1V2UT 3SV2H 3EAJA 1WV7H 3SU5A 2PV9B 4AZ2B 3BF6H 2A2XH 1MTSA 4MNVA 4ZAEA 3SQEE 2GVFA 1OWJA 2GX4A 3P92A 1MCTA 1Y3VA 4CR9A 4VGCB 4CRBA 5A0AE 2J9NA 3E1XB 1C5NH 1OYQA 1Y3XA 2YNAA 3A81A 4H42U 1CT0E 1GHWH 1TAWA 3SV6A 1CHOF 2H6MA 2BHGA 2KAIB 2Y82A 3BG4B 5GCHG 2XCNA 1G32B 4JZ1A 3ZVFA 2ZFRH 5AFZH 1D6RA 3RXIA 4CH2B 4IMQA 3SUDA 1FIZA 4ZKSU 2BD3A 3ZZ5A 1DE7H 3SUFA 2HVXA 2CF8H 2EI6A 2XCFA 4ISIH 3DFJA 1G30B 3U8OH 1YM0A 2F9BH 1PPZA 1DSTA 1P2MA 2ZC9H 1AVGH 3A8DA 2FP7B 3IG6B 1N6XA 2XBWA 1BMNH 4GLYA 1WUNH 4TPYA 5FX5A 3F9FA 4HI3A 3GYMA 3M5NA 2O8TA 2ZWLH 2YNBA 1VJAU 3GDVA 1AI8H 1IOEA 3NUMA 2GCTC 3A84A 2ZNKH 1ANDA 2BZ6H 5EPNA 3VXFH 2CGAA 5DPAA 2G4TA 5HGGA 3F9GA 4K2YA 1GI0A 3A8CA 2FS8A 1O3MA 4DW2U 2ZU4A 1O5DH 1ZTKA 1PPCE 1GMHF 1O2VA 5G4BA 1RRKA 1TWXB 3EYDA 4CR5A 1BZXE 2AEIH 2DE8A 2P59A 4B2AA 1GHBF 3F6UH 5JBTA 1BMLA 3SNAA 1YLDA 1C5PA 3P70B 3VEQB 2ZQ1A 1KXFA 1OS8A 2ANKH 4K69A 2WV5A 2P93A 1XKBC 2FI3E 2FM2A 3BIUH 1EB1H 1HAYB 1HIAA 4DJZB 1XMNB 2ZDMA 3Q76A 4CREA 4IC6A 5IYTA 4GPGA 1HAVB 5A09A 2ZDNA 1UCYK 2BQ6B 2OUAA 1JMOH 3S9CA 2QAAA 5JB9S 1GJDB 3UTUH 1WYKA 2XYAA 3PLKA 5ABWA 3Q77A 1EPTB 2BD8A 1AUJA 1CGHA 2TGPZ 1BTWA 4MPUA 1ZJKA 1EKBB 2PKSC 2GCHG 2G00A 1IQHA 4AYVB 3AAVA 4OGXA 2NU4E 2A4RA 1QURH 2NU0E 3DT0H 1QQUA 5DP7A 1EPTC 1C5TA 1DS2E 1Z8IB 1O3AA 1O3DA 1F92A 4A7IB 1O31A 2QF3A 4DVAU 1H9LB 1CBWC 1WBGB 5E8EH 2VVVA 4D76A 1GBDA 3O8RA 2FOEA 2H1UA 2VIQA 1G3DA 2R0LA 2ZHQH 1W7GH 2WUBA 1GVLA 3TGJE 3V7TA 2QC2A 2A5IA 2FTLE 5FX6A 1S6FA 1BB0B 1IQKA 3RXRA 4ISLA 4ZKNU 1QTFA 2SGPE 1OOKB 1G9IE 2AIPA 4NSYA 3VB3A 1K1MA 4SGBE 2A5AA 2FODA 1T8OA 3BTKE 1O2LA 3PTNA 1F0TA 3QGNB 1T32A 4RSPA 1F0RA 4YESB 2BYAX 3R3GB 3LDXH 4E7NA 3KHVA 3SU6A 3BTEE 3KNXA 4Y7BA 3SQHE 4ABDA 2JH5D 2C93B 3EGKH 2W7UA 2QXJA 1DXPA 2JETB 2QN5T 1ELBA 1Y3UA 5EQQA 5TCCA 4E7RG 2G52A 1BHXF 4Y79A 3IWMA 5FHTA 2BLQA 1EZSC 6ESTA 1P9UA 1GI7B 1XVMA 4DCDA 3RC4A 4I31A 3MNXA 1BRUP 4ABHA 4O3TA 3RC6A 1A61H 1P2IA 2FIRH 3QGJA 4K5ZA 4AFUA 4O9VA 1ANEA 3RXUA 2A7CA 4PROA 1GJBB 1MTNC 4OS2A 1GBAA 3KCGH 1DX5M 5T6GA 2H9HA 3RM2H 5I25A 4BTUB 3BN9A 1C4U2 2Y7ZA 1RTLA 1GI2A 2EC9H 1QB1A 3SOSA 3E3TA 5GPIB 2D8WA 7GCHG 2BLWA 4JZIA 3BTHE 3S9BA 4GCHF 1Q3XA 1BJVA 3MYWA 3NKKA 1HAOH 2I6QA 1L0ZA 2BX4A 2VNTA 3OY6U 3KN2A 2J2UA 1PJPA 4AYYB 4B76A 2A4QA 1UTQA 3HGNA 2ZHEH 3RXMA 1O36A 2HALA 4X2WA 4YM9A 3FANA 3B8JA 3N7OA 3ATWA 1MD7A 3RXFA 2NU3E 3GDUA 5T6DA 1A46H 4HFPB 1T8MA 1ZSKA 3TVJB 1O3OA 1V2NT 1QJ7B 4NIYA 1LKAA 2PKAB 2UUFB 1ZHMA 4FUHA 1BRCE 4MPVA 2FZZA 1PFXC 3VB5A 2CV3A 2FX4A 1UTLM 1GCTB 1OKXA 4E05H 1K9OE 2BZAA 3VPKA 1MU6B 1HDTH 1NS3A 1K1NA 1SGCA 4MPWA 3GCTG 2VU8E 2PTNA 1ELVA 1MTVA 3RMLH 3MI4A 3RXGA 2ZZUH 1U6QA 1VCWA 1BDAA 4TY7A 3FVFB 1FZZA 2IPHA 4B2CA 2H5CA 4BAMB 2Z6BD 2QXGA 2VIVA 2IJOB 4Y8ZA 1ETRH 1TB6H 2ZFTA 4SGAE 5A8XA 1Z1IA 1TIOA 1J14A 1GMDF 1V2MT 4JZDH 5L2YH 1AFQC 4CH8B 1TABE 1JRSA 2R3YA 4J1YA 1HAXB 4LK4A 4U32A 1YPLH 1O2KA 3ELAH 2XBYA 1NRSH 1BTZA 1KY9A 3MOCA 1OSSA 2ZDKA 3I78A 1XUHA 3K6YA 1TGCA 5DO4H 5AHGH 3SJ8A 1Z6EA 2ZPQA 1P3CA 2VIPA 2WPKS 3E90B 1YLCA 1HPGA 1UTJA 3D49H 1NROH 2Z3EA 1LPGB 4X2YA 1YPMH 4FUCA 5FPTA 3SJKA 2EI8A 1AB9B 2FOHA 2Z9KA 2PSXA 1GI1A 1BQYA 1NU7B 3D62A 3K65B 4CRFA 2PW8H 4A1XA 2BY9X 2GP9B 4TWYA 1MMJN 5ETXA 2V35A 2JH6D 2XC5A 5DK1A 1TQ0B 2FESH 2FXRA 3RC5A 4FXGH 2D2DA 3UFAA 1WQVH 4I8JA 3URDA 2Y6TA 3SI4H 3BTME 1O2SA 1O38A 1AE8H 3TNTA 3KQCA 3LGVA 2FOAA 4OS4A 5I46H 3O8CA 3BTGE 1AE5A 3GCHB 3SHCH 1TRNA 1Y5UT 1NTPA 1O2HA 4UEHH 2H9EH 5F8ZA 1QIXB 1GPZA 1F5KU 3BEIB 2ANWA 5DP8A 5CMXH 1WCZA 2Y5HA 3T5FH 3PYHA 5LPEA 2OC7A 2QYIA 2AH4X 1A5HA 3E0NB 1QB6A 2G4UA 3L6PA 3TU7H 1ORFA 5C1UA 2R9PA 3SI3H 1E36B 1TMBH 1EAUA 1D9IA 1O3FA 1FY4A 2O8MA 4MVNA 3PMHB 2XXLA 1DY9A 1HB0B 3K9XB 2B0FA 3TGKE 1VZQH 1FPHH 1PQAA 5B6OA 1F0UA 5CE1A 3A7ZA 4BXWA 3KF2A 1C5QA 1OP8A 2BTCE 3QDZB 4ISOA 1NT1A 1G3BA 1XVOA 1GBFA 3T29A 4ZUHA 1MBQA 2ZPRA 1FY5A 1RFNA 4I32A 4X1SU 4XBCA 2WPHS 1C5SA 1XXFA 1O3KA 4DIHH 2FI5E 4Y76A 2BVXH 1F2SE 1Z7KA 1YF4A 3Q3YA 4D9RA 1D3DB 1ZZZA 3BTQE 1QBOA 3ESTA 1C2JA 2F9VA 1SGFA 3SNDA 1TA2A 4WH8A 1W12U 3SNBA 1IHTH 1WOFA 5EODA 2ZU1A 2VWOA 3MO3A 2OQUA 1DWBH 1YCPK 3A8AA 1C1QA 4X2VA 1KLTA 2C8WB 2BB4A 3SGAE 2GT8A 4O3UA 1HAVA 2J38A 3PTBA 2F9UA 2ESTE 3A87A 1GDNA 1TNIA 1RS0A 1ZOMA 1BBRH 2FTMA 1YGCH 1A5GH 4LOYH 5E2PA 1DITH 1ELCA 3A7YA 1F0SA 4UFDH 2H2ZA 1TRMA 1VJ9U 5E2OA 5HM9A 3KGPA 1CGIE 4LZ4B 4JYVH 2AMQA 1AO5A 4CBNA 3FZDA 1DDJA 1PPEE 4LXBH 3P8OA 3TJVA 3T26A 4BAKB 1WAYB 2UUJB 1YPKH 5DG6A 3P6ZB 1ELDE 1C1MA 3DHKH 2NWNA 3A80A 5H4IB 2UWLA 1C9TA 1GG6B 2Z7FE 4U2WA 1GL0E 1C5MD 3TK9A 3MH6A 3ZVBA 4U01A 4MLFB 1NY22 3SV9A 3PMBB 4I8LA 1TA6A 5JBBS 1SI5H 8GCHG 4IC5A 1MAXA 1EJMA 2BXUH 1MCVA 1FLEE 1NFWA 1A3BH 2HNTE 4I8GA 1C5YB 3M7TA 3CP7A 4I8HA 5FXLA 2QXIA 1W14U 1ESBA 1A2CH 1VITF 4Q2KA 3A83A 1ACBE 2GDEH 2WPMS 1O35A 2GT7A 2GMTC 1FY8E 3O8BA 3PLPA 4UFEH 1LHDH 3UPEA 2FLRH 3ATKA 1CA0B 3EA8A 2ZDVH 4AORA 2XC0A 4NIWA 2F83A 4B75A 2A7JA 2VINA 1G2LA 3ZVAA 3RXJA 1UTKA 1AU8A 2LNCA 5EW1H 3LC5A 2XWAA 2ASUB 2ZA5A 5A8YA 5C5OA 1XX9A 2Y81A 1WTHD 1P12E 1EATA 1UTMA