3RXKA

Crystal structure of trypsin complexed with methyl 4-amino-1-methyl-pyrrolidine-2-carboxylate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxkA02
5GCHG 1LVYA 3PROA 1MTVA 3RUOA 1THSH 1FZZA 1OP8A 1T31A 1FPCH 1MAYA 1GJ4H 3P8NA 3SV7A 4WMDA 2OC0A 1QJ7B 2BDBA 1IQNA 1EB1H 2G81E 3A84A 2BHGA 1C1PA 1RD3B 3CS7A 1RIWC 2O8LA 1FJSA 1XUGA 2TRMA 1O31A 1CGJE 1A4WH 1K2I1 4LK4A 2K1QA 3FVFB 2P3UB 4ZUHA 2J9NA 1O37A 2F3CE 1XM1A 5FX5A 1GDUA 1O3MA 3RXGA 3RXBA 1HXFH 4NSVA 2ZF0H 4OS4A 4ZKNU 2A5AA 1GI3A 1O3BA 3SUGA 4ZKRU 2OC8A 3SUFA 1ZRBA 3PLPA 1YGCH 3M7QA 2VH0A 2ZHWH 1GDQA 5I46H 1EJNA 1MCTA 4Y7BA 3RXTA 2ZFTA 1LTOA 1C5WB 5JBBS 1DSUA 2R2WU 2Z9JA 1A46H 1VCPA 1MKXK 5FBIA 1BCUH 1LVMA 1NY22 3RXOA 1SI5H 4CH8B 1YC0A 3QZQA 1FUJA 3GCHB 6CHAB 1O2LA 2BDCA 5AVDA 1GBJA 4MLFB 3T2NA 1GHXH 2Z6BD 3FP6E 1P57B 4WWYA 5AHGH 1G9IE 5TCAA 2G8TA 1T4UH 1DWCH 1P2QA 2QIQA 5E2OA 2ZQ1A 1CGHA 1S6HA 3GYMA 1K21H 1Y3WA 3TITA 3LONA 3A83A 2GDEH 1DWBH 3RDZA 4UFEH 4ABIA 4X6MA 1C2IA 2Z9IA 5JBAS 4XDEA 1KLIH 1PYTD 2B0FA 2ZI2H 3BSQA 1B7XB 1PQ8A 1GI7B 2PKSC 4D76A 2FM2A 1EOLA 1P2IA 1E34B 2J92A 1VCQA 2CN0H 3AW1A 2BXUH 1B0EA 3RXPA 3SNCA 1QL8A 1BT7A 2KAIA 4R0IA 1O2JA 1HIAA 2BLWA 4ESTE 4CREA 2ZO3H 1V2MT 3A87A 1TX6A 2XWAA 5ABWA 4RN6A 1QURH 3F6UH 1TBQH 1SLWB 2ZFPH 1ZMNA 4KTUA 5DP7A 1ID5H 3ITIA 2RCEA 1Z1IA 2WYGA 1KSNA 5A8XA 3RU4T 4CBOA 1EATA 1GVZA 1NRPH 1ESAA 1NFXA 4CRGA 1O30A 3RC5A 4BXWA 1LKAA 3D62A 1Q3XA 1J16A 4Y76A 2PTCE 3V0XA 1TGSZ 3S9BA 3RXMA 3SGBE 1RTKA 1SL3A 4B2CA 1P2KA 3Q76A 2WPMS 3SNEA 1FY8E 1S5SA 3RC6A 4RKOB 1ZPZA 3NXPA 4ZXXH 4THNH 1QGFA 1GHBF 1P3CA 2FO9A 1ZSJA 1YP9A 3SJOA 3S7HB 2WPJS 7GCHG 2C8YB 1NZQH 1FI8A 1A0HB 2PUXB 1SGRE 1O32A 2O8UA 5E0HA 1J15A 3KNXA 4F4OC 1O5EH 5FPYA 3STIA 1LPGB 3RU4D 5C5OA 3ZV8A 4X1NU 1O5BB 4UD9H 1TPSA 2ZA5A 4X2XA 1RIWB 1DM4B 2BDHA 4NIWA 3MO9A 5E0GA 1GBKA 4LZ1H 5TJXA 2V6NA 4IN2A 1DSTA 4KELA 3PLKA 1BITA 1JOUB 5HM2A 1GGDC 3F9GA 1MUEB 5C3NA 5F6MA 4JYUH 2JH5D 4NCYA 4K1SA 2D1JA 1V6DA 1X7AC 1TMBH 1SGFA 1YPKH 2XBXA 1G3CA 1S0RA 3BTEE 1BTXA 1GBMA 2ZGBH 1HIAB 1MTWA 4K5ZA 2AMPA 5EXLA 2D8WA 3P17H 2R2MB 3KF2A 1CQQA 3ODFA 1PPZA 4TWWA 2HALA 2RG3A 1C2DA 2Y82A 3T29A 1GI8B 5EPNA 1ANDA 1W11U 3RXQA 2BB4A 4IW4E 1MKWH 4Y7AA 1V2RT 4GCHG 5AF9H 4Q7YA 3BTHE 1EAIA 4X8UH 3LH1A 3LGUA 3EA7A 3VXFH 5IDKA 3RXDA 3O8RA 3HGNA 1O3JA 1YLDA 4OGYA 2AMDA 3MFJA 2CXVA 1QR3E 4JCNA 4AB9A 4AYYB 2UUFB 4GHTA 1Z8IB 4ABGA 2PW8H 5GPIB 4WH6A 3NZIA 1FY1A 4I32A 1P02A 3EE0B 4UE7H 3U8OH 1SPJA 3BEUA 3LT3A 4BAQB 1XKAC 2PGQB 1PPFE 1QRWA 2NWNA 4FVBA 2BD8A 1ESTA 3RU4E 3UWJH 1IAUA 5F8XA 3VB7A 1BRBE 1S81A 1SGIB 4MNWA 4YO9A 3SORA 2Q1JA 3EQ0H 2FEQH 1UTMA 2FI3E 3QZRA 3MOCA 3HK3B 1SFQB 3MU8A 1EP5A 2PKSB 2WV4A 2XCFA 1SLUB 3MH5A 7ESTE 3UNRA 3OY6U 4BXSA 1G3DA 4DVAU 1S82A 4QT8C 5EPYA 5JB8S 4AORA 1SB1H 3MWIU 2G00A 1P9UA 3RXIA 1Y8TA 1GMCF 1AU8A 3LPRA 1FMGA 2W3IA 3ZZAA 1ELVA 1DLKB 1EAXA 1OWJA 3QX5H 5JBCS 4OGXA 1O3PB 4AG1A 1YCPM 2YNBA 1QB9A 2XTTB 1MTUA 1EZQA 3TJVA 1S85A 4XFQA 1KDQB 3LGIA 3MMGA 4TPYA 1DT2A 4BAHB 1C9TA 4MPWA 1ZHPA 2CHAC 2DE8A 1AI8H 1W13U 2ZGCA 1UTOA 4GPGA 3JZ2B 3PYHA 4ZKSU 4WY3A 3BTQE 2P3FH 1HAIH 1O2WA 1Y59T 2PWXA 1ZYOA 2RA3A 3GY2A 1YPLH 3A7TA 2EI7A 2STAE 4RKJB 5A8YA 3PWBA 1JIMA 4Q2KA 4X1QU 1SLXB 1T32A 5DP9A 1KXAA 2HNTF 1BJUA 3SW2B 3EA8A 1WTGH 1YF4A 2A5KA 3A80A 1MAXA 1SQOA 3ZZDA 1QHRB 3UWIA 1UTPA 5JYIA 2WPKS 1T8NA 1C2JA 2FI5E 4BANB 1OXGA 4U01A 1BMNH 2A7HA 2O8WA 1GBHA 1UHBB 5C2ZA 4GUXA 2Y81A 2ASUB 1GGDB 1C5XB 4GLYA 2B9LA 3MH4A 5DJ7A 5HGGA 3KHVA 3RXLA 1OP2A 2SFAA 1O3EA 3LC3A 4ZHAA 1UVPA 1QJ6B 1GJ9B 2GV7A 4IMQA 1FN8A 1VITG 1Z6EA 1F5RA 3UQOA 1Z8JB 3GY6A 1TOCB 3LGWA 2FS8A 3RXSA 1WAYB 4CRDA 1CA0C 2P95A 1MU8B 1LMWB 2ANMH 4D9QA 1TOMH 1O5GH 1TRYA 3B8JA 2RDLA 3BN9A 1Q31A 3M5NA 4O3TA 4X0WU 2JH6D 3VPKA 1C5YB 1ZTLA 3SV9A 2FOFA 3P8OA 2AGIX 1NS3A 3AW0A 4A1TA 3D65E 2FPZA 2FOHA 1W0ZU 3ZVEA 2HPPH 1C5UA 1GMDG 1O3OA 1EJMA 1VITH 2R0KA 4ISIH 2ZDNA 1VGCC 3TU7H 3FP7E 3E1XB 2BTCE 4WXIA 2ANYA 1DWEH 3HKIB 4ABEA 3GICB 4M7GA 5L30H 1MTNC 4X8SH 4X2YA 1KYNA 2FX6A 3SQEE 3A8CA 1K1OA 1XMNB 1E0FD 1HV7A 2P93A 4JYTA 1NRQH 1MD8A 3ZZ6A 1C2LA 1Z7KA 1ELBA 1EPTC 1SSXA 2A45B 4Y79A 1JWTA 2ALVA 4K1EA 2SNWA 3E90B 3LKWA 1YM0A 1NROH 1TX8A 1GVLA 3S9CA 1JIRA 3ZYEA 3MU1A 1FQ3A 1L0ZA 2PTNA 1T8OA 3P95A 3E16B 2F9VA 2J38A 3BTFE 1V2VT 3ZZCA 1EP6A 5T6FA 3NUMA 1DPOA 3BG4C 1ARBA 1L1NA 2XYAA 2FX4A 1GBBA 4NGAH 1W3CA 1BDAA 5FXLA 2FOCA 2QY0B 3U8TH 3ESTA 2FMJA 1TNJA 1ESBA 2VIDA 2VWLA 2VGCC 4IGDA 1HGTH 1TLDA 2H9EH 2QGRA 3SO3A 4I33A 3ZZ3A 8KME2 1QA7A 2GVFA 2FOAA 4I8HA 3TJNA 1LHEH 2AMQA 8LPRA 4FUEA 2OQUA 1QQUA 4UEHH 1TQ7B 1NN6A 1SOTA 4AGJA 2BXTH 2VIPA 1CHOF 1ELEE 3TK9A 1H8IH 3M5OA 2BQ7B 2CHAB 4FUFA 1PJPA 2J95A 1O2UA 3AVZA 1BTYA 1QB6A 1KXCA 3BIUH 3SHAH 1Y3VA 1IHTH 2A0QB 2BZ6H 1SGPE 2EI6A 1BTPA 4DT7B 2BX3A 2ZFQH 1QL7A 1C2MA 1D3PB 5JB9S 3LOXA 2PKAB 2YOLA 3UOPA 3SOSA 3JZ1B 4NZQA 2ZEBA 1M9UA 1BMLA 1DS2E 1YPMH 1Q2WA 3H7TA 3ATMA 1NRSH 2H9TH 3MH6A 2AYWA 1EX3A 4GHQA 2OP9A 1Y3YA 1XUIA 2QA9E 2XCNA 1HAPH 1UCYH 1NRRH 2QF3A 2WUCA 1MBMA 3MU0A 1CT4E 4IBLH 2AFQB 5JDUB 3RLYH 1T8LA 1TWXB 1LQDB 3ZZ4A 4BTIB 1SGTA 3LGVA 2UWPA 4JYVH 1BTWA 2HRVA 3MU4A 4AFSA 1TBZH 3A8BA 2C4FH 4E7RG 4KP0A 1ARCA 1UTQA 1CA0B 3GDUA 5ETXA 4CRAA 8GCHG 4AGKA 1P04A 1IQFA 3A86A 6GCHG 2ZHDA 3QN7A 3RXJA 3FP8E 1BA8B 5CHAC 3A7VA 1THRH 3QDZB 4JK6A 2A4QA 2ZU3A 4OS5A 1GI1A 3UPEA 2A2QH 1VGCB 4X2WA 4Y10E 3ZZBA 3QK1A 2BVXH 2GX4A 3OYPA 1TE0A 1MTNB 3MO3A 5T3HA 1QIXB 2VWMA 1TIOA 2TBSA 4XBCA 2OC7A 5E2PA 2BY9X 1EPTB 2BX4A 1UVSH 1N1LA 2LNCA 2I6QA 2CGAA 3D49H 2R9PA 3GCTG 1GBLA 4AN7A 4JMYA 3H5CB 1T7CA 2F9OA 1E37B 4FVDA 4K60A 3S69A 1D3DB 2AEIH 4NWLA 1NFYA 2A4GA 2CF8H 2Q6FA 1V3XA 2BDYA 3E0PB 1OWIA 1EASA 2BLQA 1FXYA 1MZDA 1P01A 2WYJA 3BG4B 2ZDMA 1CT2E 3ZVGA 1LHFH 2H9HA 4A5TS 1BHXF 1XVMA 2AGGX 2ZTYA 4CHAB 1G37A 1RGQA 2ULLA 3UY9A 1BOQA 1S6FA 1XVOA 4U30A 4NA9H 4D8NA 3GY5A 1C5TA 1P2MA 2FESH 5DP6A 3K9XB 2Y7XA 2VGCB 4ABDA 4I8KA 4ZMAH 2ZU5A 1OPHB 1SLVB 5A2MH 2THFB 1ZSLA 2ZHEH 2ODQA 1C5VA 4DJZB 2A1DB 2O8TA 3AAVA 3BTDE 1DE7H 4O9VA 1UO6A 1TNGA 2BY6X 3FZZA 1AFQC 5BPEA 5TCCA 4H6SB 3T25A 1C4U2 4MNXA 5ESTE 5LPFA 3PTNA 5FCKA 3LU9B 2ZCKP 5EODA 4YT6H 1C9PA 5EQSA 1ZHMA 3EAJA 2HPQH 1UTKA 2GGVB 4ZH8A 1SGNE 2XNIA 1S84A 1PQ7A 4H4FA 2QN5T 3GCNA 1K22H 4I8GA 4MPVA 3T62A 1GBFA 1O3GA 4DW2U 3Q3YA 1OKXA 2Y5FA 1SR5C 5C20A 2OXSA 1QTFA 2ZQ2A 3K6YA 1T8MA 2GCHF 1UK2A 2VJ1A 1HYLA 1G2MA 4WJG2 5T6GA 1FIZA 1DDJA 3UTUH 1MCVA 2Z94A 3SGAE 1WCZA 4H42U 1BRCE 3NWUA 4MPUA 2HOBA 3KQCA 3V3MA 3TPIZ 5GDSH 4FUJA 1DXPA 2QV1A 3A8DA 3QWCH 3PWCA 1HAVB 3TH4H 3V7TA 2QCYA 3ZVDA 4ABHA 3A82A 4YLUA 1WUNH 1P2JA 4J2YB 4Q7ZA 2FZZA 1IHSH 5J4SA 5HYOA 1FY3A 1ZGVA 1HCGA 1YBWA 5C1UA 5DK1A 1L4ZA 1DANH 3S7KB 1W7XH 2NU2E 4PROA 1V2OT 3HPTB 3BV9B 1Y5UT 3B23B 4OS7A 5FX6A 3KEEA 1ETSH 2P59A 1AY6H 3BTGE 1O5DH 1TMUH 1TX7A 1FONA 5CHAB 2BZAA 2ZU2A 4I8LA 1DICA 3S9AA 1C5QA 1AUJA 4BNRA 2JH0D 1BJVA 1EJAA 3AASA 4MG3A 4HGCA 4XE4A 4CBNA 2Z9KA 1IQLA 1JBUH 3UR6A 1NFWA 3UFAA 1ZOMA 2FXRA 2GKVE 3D23A 1SFIA 1HAYB 1IOEA 1Z71A 3FANA 5C1YA 1C1UH 4ZROA 3SBKA 1YCPH 1TNIA 1BBRK 2BD5A 4D7FA 1LHCH 1O5AB 3DUXH 2BOHB 4UONA 1ZJKA 1G3EA 1O3CA 2W5EA 3BEIB 5EQQA 4ABBA 1EZXC 5F03A 4YZUA 3PMJA 3I78A 1FPHH 2STBE 1GJ8B 2GMTC 1A0JA 1V2WT 2QAAA 4OS1A 4OS2A 3BG8A 1FDPA 3EGKH 3BTWE 1OWKA 3N7OA 2IN2A 3SUEA 1C2KA 2OLGA 1C5PA 1AO5A 1GG6C 2OD3B 2AS9A 5EOKA 1LKBA 1AVWA 1V2KT 2VVUA 1ELFA 2H1UA 3SJ8A 3VFEA 4DG4A 1DWDH 4D7GA 4MVNA 3M37A 3B9FH 4X6PA 1HJAC 2FOGA 4FU8A 1ZRKA 1GMHF 1GHZA 1EXFA 1OWHA 1KDQA 5GCHF 1TGTA 1LO6A 1SHYA 1C4V2 3A81A 5BRRE 4BAOB 3TGIE 1W7GH 1AFQB 1EKBB 3I29A 2W26A 1EAWA 1ZTKA 1HAGE 4E06H 3BEFB 4WF8A 2ZP0H 2J2UA 1CSOE 1C1MA 1E38B 1O2IA 1O3AA 3HKJB 1TABE 3ODDA 5DP8A 3RMMH 1HLTH 1JXPA 3BTTE 3M7UA 1YPJH 1GI6A 1AB9B 5FAHA 2TGDA 2PSXA 4K69A 4MTBA 3O8DA 1K9OE 1SOZA 1AKSB 1DLEA 1C1VH 3TH3H 3RXFA 1N6YA 5DGJA 3KCGH 1C5SA 3RXKA 1GBTA 3VGCC 3GY3A 2XWBI 4Y8YA 1INCA 1MZAA 3A8AA 2UWLA 3NPSA 1UCYE 1GL1A 2G52A 3V13A 1TNLA 2Q6DA 1UHBA 4JZFH 5J4QA 2C3SA 3ATKA 1SGYE 1LHDH 3QGJA 3DFLA 1C1NA 3LJOA 2WPIS 1G2LA 4XBBA 4E05H 2H6MA 3A7YA 3M61U 4DIHH 3L3TA 1V2JT 4VGCC 1PPGE 1ELAA 1O2QA 3UNSA 4BTUB 5A0BA 1GJ5H 1AUTC 2F9PA 3U98H 1NU7B 2ZGXH 2A31A 4BTTB 2P16A 1KLJH 3SHCH 2F9UA 1WOFA 4RSPA 5C1XA 2NU3E 1GHAG 3CP7A 3SV2H 3MO6A 2TGAA 4ISNA 1MKXH 2OTVA 1U6QA 1AWHB 1GJ7B 3VEQB 1QRZA 1SMFE 2G5NA 4AYVB 1SBWA 2Y80A 1HNEE 2C90B 4IN1A 1UVTH 5H4IB 3OSYA 4B73A 3TNSA 4LOYH 1A2CH 4Y8XA 1P03A 1ZSKA 3U9AH 1CHGA 4X1RU 2O8MA 4JZEH 4NFFA 3QGNB 4YOIA 3ELAH 1GVKB 5DP3A 5CMXH 3DA9B 1E35B 1GJ6A 1AZ8A 1UTLM 1A5IA 4H6TA 2ZNKH 1KTTB 3ZVCA 1DXWA 3BF6H 1T4VH 1WQVH 3V12A 1OYQA 3Q00A 1YLCA 4IMZA 2ZC9H 1F7ZA 3T5FH 1TPAE 3GISB 2C8ZB 2GMTB 1RJXB 2VVVA 3AAUA 3U8RH 2VWOA 1Z8RA 4J1YA 1NO9H 4U2WA 5A09A 1YPHC 4SGBE 1NT1A 1PPCE 3UR9A 4KGAA 3K6ZA 6LPRA 2F9BH 2OUAA 2V3OH 1EZUC 1GG6B 4D9RA 4AOQA 1QB1A 1J17T 1GHWH 1OX1A 3SQHE 2CV3A 1GBEA 1F0RA 1YPGH 1GBDA 1TFXA 2EI8A 1KLTA 4WVPE 1HJAB 3PLBA 2BY5X 2PUQH 4FUGA 7GCHF 3MTYA 5GXPA 1LPZB 1KXFA 1O3FA 3U69H 1LVOA 1WSSH 1QNJA 4TWYA 3KGPA 4NG9H 3VB6A 1D3TB 5DP5A 2ILNA 1GJCB 1L2EA 1UTNA 3ENSB 2BD9A 5DKMA 3SNAA 4IC5A 4X8VH 1VR1H 1P12E 1QRXA 2FOMB 5AFYH 3SU4A 2BQ6B 4JZ1A 3SV8A 1W0YH 5PTPA 3GCOA 1ZMJA 2PR3A 4CRBA 5HM9A 2PKAA 2W7SA 1H9IE 3Q77A 1OS8A 2GP9B 2ZFFH 3M5LA 4A7IB 2ZDKA 5GWZA 1TPPA 3W94A 1FY5A 1SGCA 1G30B 1FY4A 4LZ4B 2NU1E 4KTSA 3RMLH 3VGCB 1ZGIA 3PB1E 1P2OA 4INKA 4Q7XA 1RXPA 1Z6JH 2G4TA 1PPHE 3UQVA 1HJ8A 1ETTH 6ESTA 3TNTA 2ZDLA 2OCVB 5DO4H 4DOQA 1O0DH 3SNBA 4ABJA 4ASHA 3VB3A 2BY7X 2Y6TA 2ZCLP 3L6PA 1K1NA 2GV6A 2WPHS 1O3NA 5HXFA 3A85A 2SGAA 4GCHF 1Z8GA 9ESTA 1C5NH 1PPBH 4A1VA 2JKHA 1HFDA 4JZIA 4CHAC 1P2NA 4VGCB 3RMOH 2QXIA 3SU3A 4MDSA 1CVWH 2PSYA 4ZXYH 4I8JA 3DFJA 3SU5A 1SVPA 1GI5A 1XUKA 1KXEA 1D9IA 1V2LT 3MH7A 3P92A 1QBNA 3NK8A 2BLOA 3QLPH 1V2ST 1HB0B 1MD7A 1O3HA 5G4BA 2ALPA 1LDTT 3IITA 5EXNA 1SG8B 2P8OC 1ELDE 2VIVA 1D3QB 3GDSA 1N6XA 1AN1E 4B75A 1QJ1B 1HUTH 3ZVBA 1GHVH 2C93B 1D4PB 4FU7A 1KTSB 1BQYA 1HAXB 1GI9B 3E0NB 3OY5U 3VB4A 3MNXA 1NM6A 3U1IB 3F9EA 1AGJA 1O34A 1XXDA 1EPTA 2Q6GA 2A32A 2M5TA 5B6OA 2ZWLH 3PV4A 2TPIZ 1C2GA 2SNVA 4DIIH 1BMAA 1UMAH 3O8BA 3FZDA 1TPOA 2ZG0H 1FLEE 1TB6H 4HFPB 3W95A 1WTHD 5EG4A 1HPGA 1VJ9U 1S83A 3H7OA 2GT8A 1F0UA 1HAOH 1J8AA 1GCTC 1HAZB 1AQ7A 1H4WA 4KTCA 1Y3UA 5EU8A 2TIOA 4INLA 3G01A 2FI4E 2VH6A 2EEKA 4R8TB 3P70B 2XBWA 2BOKA 5FCRA 1O5CB 1ORFA 3T26A 1AFEH 3E6PH 1C1RA 2O9QA 4FUDA 4WH8A 2DUCA 4HTCH 5EGMA 4JK5A 1SGEE 3EYDA 2CF9H 4AZ2B 1VZQH 2VIWA 1GHBG 1TYNA 2ZU1A 1ZR0A 4U32A 2VU8E 1MQ5A 1YPHE 2J34A 3RMNH 1FN6A 1BIOA 1LVBA 1O2OA 1VJAU 1ANBA 1N8OC 2J94A 4K2YA 2ODYB 2WV5A 5L2ZH 3SU0A 3T27A 4Y71A 3FAOA 3SV6A 2PV9B 4UFFH 3ZZ8A 4X1SU 1GI4A 1KIGH 1H1BA 1IQHA 1MKWK 1D6WA 1K1IA 1MU6B 3KQBA 4TPIZ 1Y3XA 2B8OH 3SU2A 1A61H 1F0SA 2FTMA 3K2UA 3T28A 4WXVA 1QCPA 2ODPA 2Z9LA 2C8WB 2IPHA 4FUIA 1A1RA 3S0NA 1AWFH 4Z0KA 1A7SA 3UOUA 3ZV9A 2ZGJA 1WQSA 1QBOA 5JPMH 4NA8A 4YLQH 2SGDE 3DT0H 2BY8X 3QO6A 5DPAA 1BUIA 1VITF 3RXEA 1FIWA 1HBTH 2AERH 1GBIA 1PYTC 4FUHA 3VB5A 4MQAA 1O2ZA 1F5KU 3MNSA 8ESTE 3A7ZA 1GBAA 2H5DA 1HAVA 3EDXB 1DY8A 3O8CA 1ACBE 2G5VA 2ZTXA 3LGTA 4FU9A 3GDVA 2PFEA 4Y6DA 2BQWB 1QL9A 2BM2A 1GJAB 5LPRA 3M3TA 1P09A 3BTKE 2VIOA 1CBWC 1O2GH 1GMDF 1ELCA 1LCYA 4ZAEA 1A0LA 2JETC 3KL6A 5EXMA 4HZHA 1C1TA 1W8BH 1W2KH 4IC6A 1O3DA 1H8DH 1BTUA 3MU5A 3SJKA 1C5LH 3RXAA 2P8OB 1P9SA 3EA9A 3E91A 3GY7A 3R0FA 1NESE 1NU9A 3LJJA 1AMHA 1P0SH 1RTLA 3FFGA 2QC2A 4GSOA 5E8EH 1MMJN 2J4IA 1DUAA 5K0HA 1BRAA 1TALA 3SN8A 3UNQA 3GYLB 1PPEE 1RFNA 3GY4A 3VXEH 1AB9C 2G51A 1JRTA 1V2PT 1GMCG 1TQ0B 3WY8A 4B2AA 4DCDA 2ZGHA 1P05A 2ZPRA 4HI3A 4XBDA 1Y5BT 2QF0A 1LQEA 5A0AE 2H5CA 5LPEA 1TRMA 4YOJA 3HGPA 4CH2B 3M3VA 1TGBA 1ZZZA 1GCTB 1D6RA 1AVXA 1TBRH 2XBYA 1TRNA 1P10A 2BDAA 3RXHA 2VB0A 5IYTA 7KMEH 3TVJB 4XSKU 2V35A 3E3TA 2FWWA 3QTOH 3SU1A 5EW2H 2FODA 3TK6A 1PQAA 1K1JA 2XW9A 1KY9A 5L2YH 3PM3A 2QXJA 2SGPE 4DGJA 2A5IA 3HATH 2SGFE 4Y11E 1PFXC 1OSSA 1MBQA 2ZIQH 2FYRA 1N8OB 3HK6B 3OU0A 1V2QT 4GAWA 3TGKE 4GVUA 5I25A 1KXDA 2EC9H 3M5MA 4AFQA 3TGJE 4XOJA 3M7TA 3SJIA 3SZNA 3MHWU 2OBOA 2F83A 3UREA 1SC8U 1FNIA 3SU6A 1DFPA 1TNHA 7LPRA 1C2HA 1VCWA 3K65B 4KKDA 4TY6A 1B0FA 2WUBA 5DP4A 2P3TB 4DY7B 1P8VC 5F8ZA 5F8TA 1AKSA 1GI0A 5ESBA 1BHXB 3BTME 1BB0B 5FHTA 2ZHQH 1O2KA 4K1TA 1BZXE 1IQKA 2EA3A 1IQGA 1BBRE 2OC1A 5C5NA 1IQJA 1GWAA 3TLOA 2HWLB 2ESTE 1AD8H 4ISHH 1IQMA 1QFKH 8GCHF 4NIYA 4ISOA 2NU0E 6GCHF 1GJBB 1O2XA 1F5LA 1CBWB 1C5RA 2R3UA 4X6NA 2BMGB 2ZECA 3MNCA 4F49A 3SUDA 1BTZA 1CA8B 2UUKB 1ANCA 1K1LA 5AFZH 4AX9H 1O2VA 2JETB 3M36A 5CE1A 9LPRA 1P3EA 2UUYA 1FV9A 5A8ZA 3SI3H 4FXGH 4JZDH 1XUHA 2KAIB 3F68H 3R3GB 4CRFA 2GDDA 1BRUP 3KIDU 1W10U 3BIVH 2TGPZ 2Z7FE 3GCTF 2BD4A 3CENA 1TGNA 3P8GA 1Z1JA 4CR5A 2GZ7A 1EQ9A 1L4DA 1SGDE 1TNKA 3SJ9A 1GI2A 1NC6A 1O2PA 4B76A 1AVGH 2ZU4A 3OX7U 2XRCA 1UVOA 3F9HA 1ZPBA 5FPSA 4NZLA 1F0TA 1UTJA 1DY9A 4LXBH 1TA6A 2GZ8A 1V2UT 2B5TB 2ZPQA 1O33A 1DUEA 1O36A 1P06A 4INHA 1YPEH 3LC5A 2G55A 1CO7E 2OBQA 3RXUA 1GJDB 2BD3A 4NIXA 1NTPA 1G32B 1BMMH 3ZZ7A 3A7XA 1AHTH 2CJIA 1CHOG 2R0LA 1W14U 5EW1H 2HVXA 2QYIA 3UIRA 1EB2A 2PHBA 1A5GH 4ZHMU 2Z3EA 4K3JA 2C8XB 4X2VA 1UCYK 4ABAA 1KXBA 4X1PU 4SGAE 4FUCA 3PO1C 4K8YA 3URDA 5A0CA 1HDTH 1F2SE 2GTBA 3RXVA 2BVSH 3ZVAA 4NFEA 3ZZ5A 4O3UA 4NA7A 1O2MA 4Y8ZA 3RC4A 1RRKA 3TJUA 5GIBA 1EZSC 2A4OA 4UFDH 1CE5A 1OWDA 2DE9A 2HGTH 1HJ9A 2B7DH 2V3HH 1O38A 4MNVA 1LPKB 2ZDVH 3C1KA 2HNTC 5DG6A 1C2FA 4O03A 2XC4A 4WMFA 2A7JA 3TK5A 4TY7A 1C5ZB 1V2TT 2D2DA 4AFZA 3NCLA 2IOTA 3CS0A 2OQ5A 1FAXA 1MQ6A 3RXRA 1BTHH 1J9CH 1J14A 4X8TH 3ZVFA 1TGCA 3RM0H 2P94A 1L1JA 1G36A 2NU4E 2Z3CA 1SQTA 4I7YH 2F9NA 1MTSA 3NKKA 4MPXA 2BDIA 1Y5AT 3L33A 1QA0A 1XX9A 1HXEH 2SGQE 3SGQE 2OINA 1QY6A 2FLBH 2D26C 3TIUA 1ETRH 2IJOB 4DURA 3A88A 5LH8A 1GBCA 3A7WA 4YM9A 4MNYA 3RM2H 1C2EA 4CRCA 1C1SA 3ATLA 1W12U 1SQAA 4NIVA 5EQRA 5C67A 2FLRH 1C1WH 4I31A 2BD2A 2BD7A 1IQIA 3TH2H 1F92A 1TMTH 4BOHA 1L1GA 1ABJH 1UJ1A 2FS9A 2I6SA 2W3KA 2ZDAH 2GCTC 1XXFA 3GY8A 3KN2A 4ABFA 3PTBA 1ELTA 3P6ZB 1ABIH 1YKTA 4B1TA 4NWKA 3MI4A 1O2HA 1UK4A 3KQEA 1PQ5A 2PLXA 2PGBB 1ELGA 2VWNA 2XC0A 1WBGB 1S0QA 3Q3XA 2VIQA 1O2RA 1NRNH 4UDWH 2A7CA 3ATWA 1HAHH 1YYY1 2XXLA 3IG6B 4ZHLU 4K8BA 2FDAA 1AE5A 1JRSA 2Z9GA 3RXCA 4A6LA 4Z6AH 3ZYDA 5E0JA 1HRTH 1LHGH 2VINA 2HLCA 1BBRH 1CU1A 4AB8A 2BDGA 1ZPCA 1ZLRA 5LGOA 1FAKH 1B5GH 1XUFA 1ZMLA 1OP0A 3RP2A 2H2ZA 2UWOA 2LPRA 4B2BA 2ZFSA 4X6OA 1NFUA 2ZZUH 3STJA 3F9FA 1O2NA 4YOGA 2FP7B 2BYAX 4A92A 2ZKSA 3PO1B 1ANEA 1O3KA 1ZTJA 1XKBC 1EUFA 1P11E 1ZHRA 2TGTA 1RTFB 4YESB 1QQ4A 2ZTZA 2GT7A 1DVAH 4YTAA 1EOJA 3SNDA 1O2SA 3UUZA 2ZFRH 3MNBA 4ISLA 2GCHG 4Y0YE 1IQEA 1WYKA 3E8LA 1OYTH 2FIRH 3IWMA 4BAMB 2VVCA 1AE8H 4AFUA 1GHYH 1TA2A 4NSYA 1C5OH 1TAWA 1E36B 2ANWA 2HNTE 1O3IA 2AGEX 3QTVH 1O39A 4E7NA 1JMOH 2WINI 1GDNA 3ATIA 2XBVA 1OOKB 3P8FA 4B74A 4ZKOU 3GOVB 5L6NH 4IS5A 2RA0A 3PMBB 1CGIE 2AIPA 3GCHC 2V0BA 5SGAE 3Q3KA 2UUJB 6CHAC 3PMAB 1C5MD 2QXGA 5FBEA 2ANKH 1ZJDA 1A3EH 3LGYA 4FUBA 2FOEA 1QBVH 3A89A 2Y7ZA 1YCPK 1O35A 4WMEA 3I77A 4OS6A 2F91A 2YNAA 2CMYA 1WU1A 2ZHFH 2GD4B 2G4UA 1DOJA 1UK3A 3DHKH 1AIXH 3F1SB 4UFGH 3SI4H 1SHHB 1DX5M 3QUMP 2AIQA 1GHAF 1OWEA 1XUJA 4Q80A 1C1OA 2WPLS 1K1PA 4O97A 3ZZ9A 2ZCHP 4B71A 1EAUA 3MYWA 3DD2H 3TJOA 1V2NT 3LH3A 2A2XH 1O3LA 2FTLE 2FYQA 1SGFG 1GPZA 1K1MA 2AH4X 5FPTA 3PMHB 4Y0ZE 1SGQE 2GZ9A 1A5HA 3LIWA 1RS0A 1AZZA 1UVUH 2R3YA 4A1XA 1C4Y2 3URCA 3OTJE 1THPB 1TONA 5JBTA 1CT0E 2BLVA 5K7RA 5T6DA 2GCTB 3M35A 1GL0E 1K28D 1DITH 5GJ4B 1H9HE 1O2TA 4CR9A 5HMAA 3RLWH 3M3SA 3C27B 4BAKB 1GCDA 4YT7H 3U1JB 1NPMA 2Y5GA 4AG2A 1WV7H 1G3BA 2A4RA 2W7UA 3LDXH 2QXHA 1A3BH 1MH0A 4TYDA 2ZPSA 2SGEE 2XC5A 2FOBA 2BVRH 3KQDA 2Z3DA 1O5FH 1C1QA 2VNTA 1GMHG 1O2YA 1H9LB 2Y5HA
chains in the Genus database with same CATH superfamily
5GCHG 4B6FA 1LVYA 3PROA 1MTVA 3RUOA 1THSH 1FZZA 1OP8A 1T31A 1FPCH 1MAYA 1GJ4H 3P8NA 3SV7A 4WMDA 2OC0A 1QJ7B 2W6JD 2BDBA 1IQNA 1EB1H 2G81E 3A84A 2BHGA 1C1PA 1RD3B 3CS7A 1RIWC 2O8LA 1FJSA 1XUGA 2TRMA 1O31A 1CGJE 1A4WH 1K2I1 4F48B 4LK4A 2K1QA 3FVFB 2P3UB 4ZUHA 2J9NA 1O37A 2F3CE 1XM1A 5FX5A 1GDUA 1O3MA 4FETA 3RXGA 3RXBA 1HXFH 4NSVA 2ZF0H 4OS4A 4ZKNU 2A5AA 1GI3A 1O3BA 3SUGA 4ZKRU 2OC8A 3SUFA 1ZRBA 3PLPA 3ZIAD 1YGCH 3M7QA 2VH0A 2ZHWH 1GDQA 5I46H 1EJNA 1MCTA 4Y7BA 3RXTA 2ZFTA 1LTOA 2GJGA 1C5WB 5JBBS 1DSUA 2R2WU 2Z9JA 1A46H 1VCPA 1MKXK 5FBIA 1BCUH 1LVMA 1NY22 3RXOA 5HKKD 1SI5H 4CH8B 1YC0A 3QZQA 1FUJA 3GCHB 6CHAB 1O2LA 2BDCA 5AVDA 1GBJA 4MLFB 3T2NA 1GHXH 2Z6BD 3FP6E 1P57B 4WWYA 5AHGH 1G9IE 5TCAA 2WHXA 5C17A 2G8TA 1T4UH 1DWCH 1P2QA 2QIQA 5E2OA 2ZQ1A 1CGHA 1S6HA 3GYMA 1K21H 1Y3WA 3TITA 3LONA 3A83A 2GDEH 1DWBH 3RDZA 4UFEH 4ABIA 4X6MA 1C2IA 2Z9IA 5JBAS 4XDEA 1KLIH 1KMHB 1PYTD 2B0FA 2ZI2H 3BSQA 1B7XB 1PQ8A 1GI7B 2PKSC 4D76A 2FM2A 5FL7D 1EOLA 1P2IA 1E34B 2J92A 1VCQA 2CN0H 3AW1A 2BXUH 1B0EA 3RXPA 3SNCA 1QL8A 1BT7A 2KAIA 4R0IA 1O2JA 2F4LA 1HIAA 2BLWA 4ESTE 2YMSB 4CREA 2ZO3H 2M2AA 1V2MT 3A87A 1TX6A 2XWAA 5ABWA 4RN6A 1QURH 3F6UH 1TBQH 1SLWB 2ZFPH 1ZMNA 4KTUA 5DP7A 1ID5H 3ITIA 2RCEA 1Z1IA 2WYGA 1KSNA 1EFRD 5A8XA 3RU4T 4CBOA 1EATA 1GVZA 1NRPH 1ESAA 1NFXA 4CRGA 1O30A 3RC5A 2J98A 4BXWA 1LKAA 3D62A 1Q3XA 1J16A 4Y76A 3PRBA 2PTCE 3V0XA 1TGSZ 3S9BA 3RXMA 3SGBE 5F53A 1RTKA 1SL3A 4B2CA 1P2KA 3Q76A 2WPMS 3SNEA 1FY8E 1S5SA 3RC6A 4RKOB 1ZPZA 3NXPA 4ZXXH 2KCOA 4THNH 1QGFA 1GHBF 1P3CA 2FO9A 1ZSJA 1YP9A 3SJOA 3S7HB 2WPJS 7GCHG 2C8YB 1NZQH 1FI8A 1A0HB 2PUXB 1SGRE 1O32A 2O8UA 3F3BA 5E0HA 1J15A 5EJ1A 3KNXA 4F4OC 1O5EH 5FPYA 3PV5A 1LPGB 3STIA 3RU4D 5C5OA 3ZV8A 4X1NU 1O5BB 4UD9H 1TPSA 2ZA5A 4X2XA 1RIWB 1DM4B 2BDHA 4NIWA 3MO9A 5E0GA 1GBKA 3GS9A 4LZ1H 5TJXA 2V6NA 4IN2A 1DSTA 4KELA 3PLKA 1BITA 1JOUB 5HM2A 1GGDC 3F9GA 1MUEB 2WV9A 5C3NA 5F6MA 4JYUH 2JH5D 4NCYA 4K1SA 2D1JA 1V6DA 1X7AC 1TMBH 1SGFA 1YPKH 2XBXA 1G3CA 1S0RA 3BTEE 1BTXA 1GBMA 2ZGBH 1HIAB 1MTWA 4K5ZA 2AMPA 5EXLA 2D8WA 3P17H 2R2MB 3KF2A 1CQQA 3ODFA 1PPZA 4TWWA 2HALA 2RG3A 1C2DA 2Y82A 3T29A 1GI8B 5EPNA 1ANDA 1W11U 3RXQA 2BB4A 4IW4E 1MKWH 4Y7AA 1V2RT 4GCHG 5AF9H 4Q7YA 2JIZD 3BTHE 3DSGA 1EAIA 4X8UH 3LH1A 3LGUA 3EA7A 3VXFH 5IDKA 3RXDA 3O8RA 3HGNA 3H09A 1O3JA 1YLDA 4OGYA 2AMDA 3MFJA 2CXVA 1QR3E 4JCNA 4AB9A 4AYYB 2KX4A 2UUFB 4GHTA 1Z8IB 4ABGA 2PW8H 5GPIB 4WH6A 3SYJA 3NZIA 1FY1A 3VG8A 4ASUD 4I32A 1P02A 3EE0B 4UE7H 3U8OH 1SPJA 3BEUA 3LT3A 4BAQB 1XKAC 2PGQB 1PPFE 1QRWA 2K8IA 2NWNA 4FVBA 1W0KD 4ZCNA 2BD8A 1ESTA 3RU4E 3UWJH 1IAUA 5F8XA 3VB7A 1BRBE 1S81A 1SGIB 4MNWA 4YO9A 3SORA 2Q1JA 3EQ0H 2FEQH 1UTMA 2FI3E 3QZRA 3MOCA 3HK3B 1SFQB 3MU8A 1EP5A 2PKSB 2WV4A 2XCFA 1SLUB 3MH5A 7ESTE 3UNRA 3OY6U 4BXSA 1G3DA 4DVAU 1S82A 4QT8C 5EPYA 5JB8S 4AORA 1SB1H 5EJLA 3MWIU 2G00A 1P9UA 3RXIA 1Y8TA 1GMCF 1AU8A 3LPRA 1FMGA 2W3IA 3ZZAA 1ELVA 1DLKB 1EAXA 1OWJA 3QX5H 5JBCS 4OGXA 1O3PB 4AG1A 1YCPM 2YNBA 1QB9A 2XTTB 1MTUA 1EZQA 3UB0A 3TJVA 1S85A 4XFQA 1KDQB 3LGIA 3MMGA 4TPYA 1DT2A 4BAHB 1C9TA 4MPWA 1ZHPA 2CHAC 2DE8A 1AI8H 1W13U 2ZGCA 1UTOA 4GPGA 3JZ2B 3PYHA 4ZKSU 2IJD1 4WY3A 3BTQE 2P3FH 1HAIH 1O2WA 1Y59T 2PWXA 1ZYOA 2RA3A 3GY2A 4OM9A 1YPLH 3A7TA 2EI7A 2STAE 4RKJB 5A8YA 3PWBA 1JIMA 4Q2KA 4X1QU 1SLXB 1T32A 5DP9A 1KXAA 2HNTF 1BJUA 3SW2B 3EA8A 1WTGH 1YF4A 2A5KA 3A80A 1MAXA 1SQOA 3ZZDA 1QHRB 3UWIA 1UTPA 5JYIA 3FO8D 2WPKS 1T8NA 1C2JA 2FI5E 3F0PA 4BANB 1OXGA 4U01A 1BMNH 2A7HA 2O8WA 1GBHA 5EIYA 4Q63A 5C94A 1UHBB 5C2ZA 4GUXA 2Y81A 2ASUB 1GGDB 1C5XB 4GLYA 2B9LA 3MH4A 5DJ7A 5HGGA 3KHVA 3RXLA 1OP2A 2SFAA 1O3EA 3LC3A 4ZHAA 1UVPA 1QJ6B 1GJ9B 2GV7A 4IMQA 1FN8A 1VITG 1Z6EA 1F5RA 3UQOA 1Z8JB 3GY6A 1TOCB 3LGWA 2FS8A 3RXSA 1WAYB 4CRDA 1CA0C 2P95A 1MU8B 1LMWB 2ANMH 4D9QA 1TOMH 1O5GH 1TRYA 3B8JA 2RDLA 3BN9A 1Q31A 3M5NA 4O3TA 4X0WU 1YWUA 2JH6D 3VPKA 1C5YB 1ZTLA 3SV9A 2FOFA 3P8OA 2AGIX 1NS3A 3AW0A 4A1TA 3D65E 2FPZA 2FOHA 1W0ZU 3ZVEA 2HPPH 1C5UA 1GMDG 1O3OA 1EJMA 1VITH 2R0KA 4ISIH 2ZDNA 1VGCC 3TU7H 3FP7E 3E1XB 2BTCE 4WXIA 2ANYA 1DWEH 3HKIB 4ABEA 3GICB 4M7GA 5L30H 1MTNC 4X8SH 4X2YA 1KYNA 2FX6A 3SQEE 3A8CA 1K1OA 1XMNB 1E0FD 1HV7A 2P93A 4JYTA 1NRQH 3OTPA 1MD8A 3ZZ6A 1C2LA 1Z7KA 1ELBA 4RT0A 1EPTC 1SSXA 2A45B 4Y79A 1JWTA 2ALVA 4K1EA 2SNWA 3E90B 3LKWA 1YM0A 3U28C 1NROH 1TX8A 1GVLA 3S9CA 1JIRA 3ZYEA 3MU1A 1FQ3A 1L0ZA 2PTNA 1T8OA 1E1RD 3P95A 3E16B 2F9VA 3KQ5A 2J38A 3BTFE 1V2VT 3ZZCA 1EP6A 5T6FA 3NUMA 1DPOA 3BG4C 1ARBA 1L1NA 2XYAA 2FX4A 1GBBA 4NGAH 1W3CA 3FN8A 1BDAA 5FXLA 2FOCA 2QY0B 3U8TH 3ESTA 2FMJA 1TNJA 1ESBA 2VIDA 2VWLA 2VGCC 4IGDA 1HGTH 1TLDA 2H9EH 2QGRA 3SO3A 4I33A 3ZZ3A 8KME2 1QA7A 2GVFA 2FOAA 4I8HA 3TJNA 1LHEH 2AMQA 8LPRA 4FUEA 2OQUA 1QQUA 4UEHH 1TQ7B 1NN6A 2LP6A 1SOTA 4AGJA 2BXTH 2VIPA 1CHOF 1ELEE 3TK9A 1H8IH 3M5OA 5C0TA 2BQ7B 2CHAB 4FUFA 1PJPA 2J95A 1O2UA 3AVZA 1BTYA 1BMFD 1KXCA 1QB6A 3BIUH 3SHAH 1Y3VA 1IHTH 2A0QB 2BZ6H 1SGPE 2EI6A 1BTPA 4DT7B 2BX3A 2ZFQH 1QL7A 1C2MA 1D3PB 5JB9S 3LOXA 2PKAB 2YOLA 3UOPA 3SOSA 3JZ1B 4NZQA 2ZEBA 1M9UA 1BMLA 1DS2E 1YLNA 1YPMH 1Q2WA 3H7TA 3ATMA 1NRSH 2H9TH 3MH6A 2AYWA 1EX3A 4RI0A 4GHQA 2OP9A 1Y3YA 1XUIA 2QA9E 2XCNA 1HAPH 1UCYH 1NRRH 2QF3A 2WUCA 1MBMA 3MU0A 1CT4E 4IBLH 2AFQB 5JDUB 3RLYH 1T8LA 1TWXB 1LQDB 3ZZ4A 4BTIB 1SGTA 3LGVA 2UWPA 4JYVH 1BTWA 2HRVA 3MU4A 4AFSA 1TBZH 3A8BA 2C4FH 4E7RG 4KP0A 1ARCA 1UTQA 1CA0B 5T1VA 3GDUA 5ETXA 4CRAA 8GCHG 4AGKA 1P04A 1IQFA 3A86A 6GCHG 2ZHDA 3QN7A 3RXJA 3FP8E 1BA8B 4B6EA 5CHAC 3A7VA 1THRH 3QDZB 4JK6A 2A4QA 2ZU3A 2JJ1D 4OS5A 1GI1A 3UPEA 2A2QH 1VGCB 4X2WA 4Y10E 2XOKD 3ZZBA 3QK1A 2BVXH 2GX4A 3OYPA 1TE0A 1MTNB 3MO3A 2AHME 5T3HA 1QIXB 2VWMA 1TIOA 2TBSA 4XBCA 2OC7A 5E2PA 5DN6D 2BY9X 1EPTB 2BX4A 1UVSH 1N1LA 2LNCA 2I6QA 2CGAA 3D49H 2R9PA 3GCTG 1GBLA 4AN7A 4JMYA 3H5CB 1T7CA 2F9OA 1E37B 4FVDA 4K60A 3S69A 1D3DB 2AEIH 4NWLA 1NFYA 2A4GA 2CF8H 2Q6FA 1V3XA 2BDYA 3E0PB 1OWIA 1EASA 2BLQA 1FXYA 5C0UA 1MZDA 1P01A 2WYJA 3BG4B 2ZDMA 1CT2E 3ZVGA 1LHFH 2H9HA 4A5TS 1BHXF 1XVMA 2AGGX 2ZTYA 4CHAB 1G37A 1RGQA 2ULLA 3UY9A 1BOQA 1S6FA 1XVOA 4U30A 4NA9H 4D8NA 3GY5A 1C5TA 1P2MA 2FESH 5DP6A 3K9XB 2Y7XA 2VGCB 4ABDA 4I8KA 4ZMAH 2ZU5A 1OPHB 1SLVB 5A2MH 2THFB 1ZSLA 2ZHEH 2ODQA 1C5VA 4DJZB 2A1DB 2O8TA 3AAVA 3BTDE 1DE7H 2YMSD 4O9VA 1UO6A 1TNGA 2BY6X 3FZZA 1AFQC 5BPEA 5TCCA 4H6SB 3T25A 1C4U2 4MNXA 5ESTE 5LPFA 3PTNA 4DT4A 3LU9B 5FCKA 2ZCKP 5EODA 4YT6H 1C9PA 5EQSA 1ZHMA 3EAJA 2HPQH 1UTKA 3MQKC 2GGVB 4ZH8A 1SGNE 2XNIA 1S84A 1PQ7A 4H4FA 2QN5T 3GCNA 1K22H 4I8GA 4MPVA 3T62A 1GBFA 1O3GA 4DW2U 3Q3YA 1OKXA 2Y5FA 1SR5C 5C20A 2OXSA 1QTFA 2ZQ2A 3K6YA 1T8MA 2GCHF 1UK2A 2VJ1A 1HYLA 1G2MA 4WJG2 5T6GA 1FIZA 1DDJA 3UTUH 1MCVA 2Z94A 3SGAE 1WCZA 4H42U 1BRCE 3NWUA 4MPUA 2HOBA 3KQCA 3V3MA 3TPIZ 5GDSH 4FUJA 1DXPA 2QV1A 3A8DA 3QWCH 3PWCA 1HAVB 3TH4H 3V7TA 2QCYA 3ZVDA 4ABHA 3A82A 4YLUA 1WUNH 1P2JA 4J2YB 4Q7ZA 2FZZA 1IHSH 3F2HA 5J4SA 2JJ2D 5HYOA 1FY3A 1ZGVA 1HCGA 1YBWA 5C1UA 5DK1A 1L4ZA 1DANH 3S7KB 1W7XH 2NU2E 4PROA 1V2OT 3HPTB 3BV9B 2KCPA 1Y5UT 3B23B 4OS7A 5FX6A 3KEEA 1ETSH 2P59A 1AY6H 3BTGE 1O5DH 1TMUH 1TX7A 1FONA 5CHAB 2BZAA 2ZU2A 4I8LA 1DICA 3S9AA 1C5QA 1AUJA 4BNRA 2JH0D 2KZ4A 1BJVA 1EJAA 3AASA 4MG3A 4HGCA 1WXRA 1E1QD 2V7QD 4XE4A 2WSSD 1IQLA 2Z9KA 4CBNA 1JBUH 3UR6A 1NFWA 3UFAA 1ZOMA 2FXRA 2GKVE 3D23A 1SFIA 1HAYB 1IOEA 1Z71A 3FANA 3N7DA 5C1YA 1C1UH 4XD7D 4ZROA 3SBKA 1YCPH 1TNIA 1BBRK 2BD5A 4D7FA 1LHCH 1O5AB 3DUXH 2BOHB 4UONA 1ZJKA 1G3EA 1O3CA 2W5EA 3BEIB 5EQQA 4ABBA 1EZXC 5F03A 4YZUA 3PMJA 3I78A 1FPHH 2STBE 1GJ8B 2GMTC 1A0JA 1SKYE 1V2WT 2QAAA 4OS1A 4OS2A 3BG8A 1FDPA 3EGKH 3BTWE 1OWKA 3N7OA 2IN2A 3SUEA 1C2KA 2L6OA 2OLGA 1C5PA 1AO5A 1GG6C 2OD3B 2AS9A 5EOKA 1LKBA 1AVWA 1V2KT 2VVUA 1ELFA 2H1UA 3SJ8A 3VFEA 5HIZA 4DG4A 1DWDH 4D7GA 4MVNA 3M37A 3B9FH 4X6PA 1HJAC 2FOGA 4FU8A 1ZRKA 1GMHF 1GHZA 1EXFA 1OWHA 1KDQA 5CHBA 5GCHF 1TGTA 1LO6A 1SHYA 1C4V2 3A81A 5BRRE 4BAOB 3TGIE 1W7GH 1AFQB 1EKBB 3I29A 2W26A 1EAWA 1ZTKA 1HAGE 4E06H 3BEFB 4WF8A 3W1EA 2KCYA 2ZP0H 2J5UA 2J2UA 1CSOE 4RT1A 1C1MA 1E38B 1O2IA 1O3AA 3HKJB 1TABE 3ODDA 5DP8A 3RMMH 1HLTH 1JXPA 2WPDD 3BTTE 3M7UA 1QZ8A 1YPJH 1GI6A 1AB9B 5FAHA 2TGDA 2PSXA 4K69A 4MTBA 3O8DA 1K9OE 1SOZA 1AKSB 1DLEA 1C1VH 3TH3H 4XRNA 3RXFA 1N6YA 5DGJA 3KCGH 1C5SA 3RXKA 1GBTA 3VGCC 3GY3A 4TT3D 3N99A 2XWBI 4Y8YA 1INCA 1MZAA 3A8AA 2UWLA 2KFWA 3NPSA 1UCYE 1GL1A 2G52A 3V13A 1TNLA 2Q6DA 1UHBA 4JZFH 5J4QA 2C3SA 3ATKA 1SGYE 1LHDH 3QGJA 2W6ID 3DFLA 2PP6A 1C1NA 3LJOA 2WPIS 1G2LA 4XBBA 4E05H 2H6MA 3A7YA 3M61U 4DIHH 3OE7D 3L3TA 4I86A 1V2JT 4VGCC 1PPGE 1ELAA 1O2QA 3UNSA 4BTUB 2QE7D 5A0BA 1GJ5H 1AUTC 2F9PA 3U98H 2CK3D 1NU7B 2ZGXH 2A31A 4BTTB 2P16A 1KLJH 3SHCH 2F9UA 1WOFA 4RSPA 5C1XA 2NU3E 1GHAG 3CP7A 3SV2H 3MO6A 2TGAA 4ISNA 1MKXH 2OTVA 1U6QA 1AWHB 1GJ7B 3VEQB 1QRZA 1SMFE 2G5NA 4AYVB 1SBWA 2Y80A 1HNEE 2C90B 4IN1A 1UVTH 5H4IB 1NBME 3OSYA 4B73A 3TNSA 4LOYH 1A2CH 4Y8XA 1P03A 1ZSKA 5EJZA 3U9AH 1CHGA 4X1RU 2O8MA 4JZEH 4NFFA 3QGNB 4YOIA 3ELAH 1GVKB 5DP3A 5CMXH 3DA9B 1E35B 1GJ6A 1AZ8A 1UTLM 1A5IA 4H6TA 1YY3A 2ZNKH 1KTTB 3ZVCA 1DXWA 3BF6H 1T4VH 1WQVH 3V12A 1OYQA 3Q00A 1YLCA 4IMZA 2ZC9H 1F7ZA 3T5FH 1TPAE 3GISB 2C8ZB 2GMTB 1RJXB 2VVVA 2WZQA 3AAUA 2VWOA 3U8RH 1Z8RA 3DSPA 4J1YA 1NO9H 4U2WA 5A09A 1YPHC 4SGBE 1NT1A 1PPCE 3UR9A 4KGAA 3K6ZA 6LPRA 2F9BH 2OUAA 2V3OH 1EZUC 1GG6B 4D9RA 4AOQA 1QB1A 1J17T 1GHWH 1OX1A 3SQHE 2CV3A 1GBEA 1F0RA 1YPGH 1GBDA 1TFXA 2EI8A 1KLTA 4WVPE 1HJAB 3PLBA 2BY5X 2PUQH 4FUGA 3WWBA 7GCHF 3MTYA 4Z1MD 5GXPA 1WDIA 1LPZB 1KXFA 1O3FA 3U69H 1LVOA 1WSSH 1QNJA 4TWYA 3KGPA 3F0OA 4NG9H 3KYGA 1D3TB 3VB6A 5DP5A 2ILNA 1GJCB 5KEDA 1L2EA 1UTNA 3ENSB 2BD9A 5DKMA 3SNAA 4IC5A 4X8VH 1UW7A 1VR1H 1P12E 1QRXA 2FOMB 5AFYH 3SU4A 2BQ6B 4JZ1A 3SV8A 1W0YH 5PTPA 3GCOA 1ZMJA 2PR3A 2RDEA 4CRBA 5HM9A 2PKAA 2W7SA 1H9IE 3Q77A 1OS8A 2GP9B 2ZFFH 3M5LA 4A7IB 2ZDKA 5GWZA 1TPPA 3W94A 1FY5A 3EE7A 1SGCA 1G30B 5GNDA 1FY4A 4LZ4B 2NU1E 4KTSA 3RMLH 3VGCB 1ZGIA 5CDFE 3PB1E 1P2OA 4INKA 4Q7XA 1RXPA 1Z6JH 2G4TA 1PPHE 3UQVA 1HJ8A 1ETTH 6ESTA 3TNTA 2ZDLA 2OCVB 5DO4H 4DOQA 1O0DH 3SNBA 4ABJA 4ASHA 3VB3A 2BY7X 2Y6TA 2ZCLP 3L6PA 1K1NA 2GV6A 2WPHS 1O3NA 5HXFA 3A85A 2SGAA 4GCHF 1Z8GA 9ESTA 1C5NH 1PPBH 3F2GA 4A1VA 2JKHA 1HFDA 4JZIA 4CHAC 1P2NA 4VGCB 3RMOH 2QXIA 3SU3A 4MDSA 1CVWH 2PSYA 4ZXYH 4I8JA 3DFJA 3SU5A 1SVPA 1GI5A 1XUKA 1KXEA 1D9IA 1V2LT 3MH7A 3P92A 1QBNA 3NK8A 2HVYB 2BLOA 3QLPH 1V2ST 1HB0B 1MD7A 1O3HA 5G4BA 2ALPA 1LDTT 3IITA 5EXNA 1SG8B 2P8OC 1ELDE 2VIVA 1D3QB 3GDSA 1N6XA 1AN1E 4B75A 1QJ1B 1HUTH 3ZVBA 1GHVH 2C93B 1D4PB 4FU7A 1KTSB 1BQYA 1HAXB 1GI9B 3E0NB 3OY5U 3PV2A 3VB4A 3MNXA 1NM6A 3U1IB 2J97A 3F9EA 1AGJA 1O34A 1XXDA 1EPTA 2Q6GA 2A32A 2M5TA 5B6OA 2ZWLH 3PV4A 2TPIZ 1C2GA 2SNVA 4DIIH 1BMAA 1UMAH 3O8BA 3AK5A 3FZDA 1TPOA 2ZG0H 1FLEE 1TB6H 4HFPB 2IPQX 3W95A 1WTHD 5EG4A 1HPGA 1VJ9U 1S83A 3H7OA 2GT8A 1F0UA 1HAOH 1J8AA 1GCTC 1HAZB 1AQ7A 1H4WA 4KTCA 1Y3UA 5EU8A 2TIOA 1W0JD 4INLA 3G01A 2FI4E 2VH6A 2EEKA 4R8TB 3P70B 2XBWA 2BOKA 5FCRA 1O5CB 1ORFA 3T26A 1AFEH 3E6PH 1C1RA 2O9QA 4FUDA 4WH8A 2DUCA 4HTCH 5EGMA 4JK5A 1SGEE 3EYDA 2CF9H 1COWD 4AZ2B 1VZQH 2VIWA 1GHBG 1TYNA 4M9FA 2ZU1A 1ZR0A 4U32A 2VU8E 1MQ5A 1YPHE 2J34A 3RMNH 1FN6A 1BIOA 1LVBA 1O2OA 3WWFA 1VJAU 1ANBA 1N8OC 2J94A 4K2YA 2ODYB 2WV5A 5L2ZH 3SU0A 3T27A 4Y71A 3FAOA 4P02A 3SV6A 2PV9B 3KYFA 4UFFH 3ZZ8A 4X1SU 1GI4A 1KIGH 1H1BA 1IQHA 1MKWK 1D6WA 1K1IA 1MU6B 3KQBA 4TPIZ 1Y3XA 2B8OH 3SU2A 1A61H 1F0SA 2FTMA 3K2UA 3T28A 2EY4C 4WXVA 1QCPA 2ODPA 2Z9LA 2C8WB 2IPHA 4FUIA 1A1RA 3S0NA 1SQRA 1AWFH 4Z0KA 1A7SA 3UOUA 3ZV9A 3NRLA 2ZGJA 1WQSA 1QBOA 5JPMH 4NA8A 4YLQH 5IK2D 2SGDE 3DT0H 2BY8X 3QO6A 5DPAA 1BUIA 1VITF 3RXEA 1FIWA 1HBTH 2AERH 1GBIA 1PYTC 4FUHA 3VB5A 4MQAA 1O2ZA 1F5KU 3MNSA 8ESTE 3A7ZA 1GBAA 2H5DA 1HAVA 3EDXB 1DY8A 3O8CA 1ACBE 2G5VA 2ZTXA 3LGTA 4FU9A 3GDVA 2PFEA 4Y6DA 2BQWB 1QL9A 2BM2A 1GJAB 5LPRA 1FX0B 3M3TA 1P09A 3BTKE 2VIOA 1CBWC 1O2GH 1GMDF 1ELCA 1LCYA 4ZAEA 1A0LA 2JETC 3KL6A 5EXMA 4HZHA 1C1TA 1W8BH 1W2KH 4IC6A 4ACAA 1O3DA 1H8DH 1BTUA 3MU5A 3SJKA 1C5LH 3RXAA 2P8OB 1P9SA 3F2FA 3EA9A 3E91A 3GY7A 3R0FA 1NESE 1NU9A 3LJJA 1AMHA 1P0SH 1RTLA 3FFGA 3FOAA 2QC2A 4GSOA 5E8EH 1MMJN 2J4IA 1DUAA 5K0HA 1BRAA 1TALA 2XNDD 3SN8A 3UNQA 3GYLB 1PPEE 1RFNA 3GY4A 3VXEH 1AB9C 2G51A 1JRTA 1V2PT 1GMCG 1TQ0B 3WY8A 4B2AA 4DCDA 2ZGHA 1P05A 2K0QA 2ZPRA 4HI3A 2RFKC 2EQNA 4XBDA 1Y5BT 2QF0A 1LQEA 5A0AE 2H5CA 5LPEA 1TRMA 4YOJA 3HGPA 4CH2B 3M3VA 1TGBA 1ZZZA 1GCTB 1D6RA 1AVXA 1TBRH 2XBYA 1TRNA 1OHHD 1P10A 2BDAA 3RXHA 2VB0A 5IYTA 7KMEH 3TVJB 4XSKU 2V35A 3E3TA 2FWWA 3QTOH 3SU1A 5EW2H 2FODA 3TK6A 1H8ED 1PQAA 1K1JA 2XW9A 1KY9A 5L2YH 3PM3A 2QXJA 2SGPE 4DGJA 2A5IA 3HATH 2SGFE 4Y11E 1PFXC 1OSSA 1MBQA 2ZIQH 2FYRA 1N8OB 3HK6B 3OU0A 1V2QT 4GAWA 3TGKE 4GVUA 5I25A 4FOUC 1KXDA 2EC9H 3M5MA 3CNRA 4AFQA 3TGJE 4XOJA 3M7TA 3SJIA 3SZNA 3MHWU 2F83A 2OBOA 3UREA 1SC8U 1FNIA 3SU6A 1DFPA 1TNHA 7LPRA 1C2HA 1VCWA 3K65B 4KKDA 4TY6A 1B0FA 2JDID 2WUBA 5DP4A 2P3TB 4DY7B 1P8VC 5F8ZA 5F8TA 1AKSA 1GI0A 5ESBA 1BHXB 3BTME 1BB0B 5FHTA 2ZHQH 1O2KA 4K1TA 1BZXE 1IQKA 2EA3A 1IQGA 1BBRE 2OC1A 5C5NA 1IQJA 1GWAA 3TLOA 2HWLB 2ESTE 1AD8H 4ISHH 1IQMA 1QFKH 8GCHF 4NIYA 4ISOA 2NU0E 6GCHF 1GJBB 1O2XA 1F5LA 1CBWB 1C5RA 2R3UA 4X6NA 2BMGB 4TSFD 2ZECA 3MNCA 4F49A 3SUDA 1BTZA 1CA8B 2UUKB 1ANCA 1K1LA 5AFZH 4AX9H 1O2VA 2JETB 3M36A 5CE1A 3WW7A 9LPRA 1P3EA 2UUYA 1FV9A 4HG6A 5A8ZA 3SI3H 4FXGH 4JZDH 1XUHA 2KAIB 3F68H 3R3GB 4CRFA 2GDDA 1BRUP 3KIDU 1W10U 3BIVH 2TGPZ 2Z7FE 3GCTF 2BD4A 2L74A 3CENA 1TGNA 3P8GA 1Z1JA 4CR5A 2GZ7A 1EQ9A 1L4DA 1SGDE 1TNKA 3SJ9A 1GI2A 1NC6A 1O2PA 4B76A 1AVGH 2ZU4A 5B6LA 3OX7U 1NBMD 2XRCA 1UVOA 3F9HA 1ZPBA 5FPSA 4NZLA 1F0TA 1UTJA 1DY9A 4LXBH 1TA6A 2GZ8A 1V2UT 2B5TB 2J98B 2ZPQA 1O33A 1DUEA 1O36A 1P06A 4INHA 1YPEH 3LC5A 2G55A 1CO7E 2OBQA 3RXUA 1GJDB 2BD3A 4NIXA 1NTPA 1G32B 2LELA 1BMMH 3ZZ7A 3A7XA 1AHTH 2CJIA 1CHOG 2R0LA 1W14U 5EW1H 2HVXA 2QYIA 3UIRA 1EB2A 2PHBA 1A5GH 5HIYA 4ZHMU 2Z3EA 4K3JA 2C8XB 4X2VA 1UCYK 4ABAA 1KXBA 4X1PU 4SGAE 4FUCA 3PO1C 4K8YA 3URDA 5A0CA 1HDTH 1F2SE 2GTBA 3RXVA 2BVSH 3SZEA 3ZVAA 4NFEA 3ZZ5A 4O3UA 4NA7A 1O2MA 4Y8ZA 3RC4A 1RRKA 3TJUA 5GIBA 1EZSC 2A4OA 4UFDH 1CE5A 1OWDA 2DE9A 2HGTH 4AC9A 1HJ9A 2B7DH 2V3HH 1O38A 4MNVA 1LPKB 2ZDVH 3C1KA 2HNTC 5DG6A 1C2FA 4O03A 2XC4A 5DSFA 4WMFA 2A7JA 3TK5A 4TY7A 1C5ZB 1V2TT 2D2DA 4AFZA 3NCLA 2IOTA 3CS0A 2OQ5A 1FAXA 1MQ6A 3RXRA 1BTHH 1J9CH 1J14A 4X8TH 3ZVFA 1TGCA 3RM0H 2P94A 2KCAA 1L1JA 1G36A 2NU4E 2Z3CA 1SQTA 4I7YH 3OEED 2F9NA 1MTSA 3NKKA 4MPXA 2BDIA 1Y5AT 3L33A 1QA0A 1XX9A 1HXEH 2SGQE 3SGQE 2QF4A 3DSOA 2OINA 1QY6A 2FLBH 2D26C 3FKSD 5KECA 3TIUA 1ETRH 2IJOB 4DURA 3A88A 5LH8A 1GBCA 3A7WA 4YM9A 4MNYA 3RM2H 2KM0A 1C2EA 4CRCA 1C1SA 3ATLA 1W12U 1SQAA 4NIVA 5EQRA 5C67A 2FLRH 1C1WH 4I31A 2BD2A 3PRDA 2BD7A 1IQIA 1S6LA 3TH2H 1F92A 1TMTH 4BOHA 1L1GA 1ABJH 1UJ1A 2FS9A 2I6SA 2W3KA 2ZDAH 2GCTC 1XXFA 3GY8A 3KN2A 4ABFA 3PTBA 1ELTA 3P6ZB 1ABIH 1YKTA 4B1TA 4NWKA 3MI4A 1O2HA 1UK4A 3KQEA 1PQ5A 2PLXA 2PGBB 1ELGA 2VWNA 2XC0A 1WBGB 1S0QA 3Q3XA 2VIQA 1O2RA 2V3MA 1NRNH 4UDWH 2A7CA 3ATWA 1HAHH 1YYY1 2XXLA 3IG6B 4ZHLU 4K8BA 2FDAA 1AE5A 1JRSA 2Z9GA 3RXCA 4A6LA 4Z6AH 3ZYDA 5E0JA 1HRTH 1LHGH 2VINA 3OAAD 2HLCA 1BBRH 1CU1A 4AB8A 2BDGA 1ZPCA 1ZLRA 5LGOA 1FAKH 1B5GH 1XUFA 1ZMLA 1OP0A 3RP2A 2H2ZA 2UWOA 2LPRA 4B2BA 2HLDD 2ZFSA 4X6OA 1NFUA 2ZZUH 3STJA 3F9FA 1O2NA 4YOGA 2FP7B 2BYAX 4A92A 1MABB 2ZKSA 3PO1B 1ANEA 1O3KA 1ZTJA 1XKBC 1EUFA 1VKYA 1P11E 1ZHRA 2TGTA 1RTFB 4YESB 1QQ4A 2ZTZA 2GT7A 1DVAH 4YTAA 1EOJA 3SNDA 1O2SA 3UUZA 2ZFRH 3MNBA 4ISLA 2GCHG 4Y0YE 1IQEA 1WYKA 3E8LA 1OYTH 2FIRH 5KGOA 3IWMA 4BAMB 2VVCA 3DCLA 2OK5A 1AE8H 4AFUA 1GHYH 1TA2A 4Q4LA 4NSYA 1C5OH 1TAWA 1E36B 2ANWA 2HNTE 1O3IA 2AGEX 3QTVH 1O39A 4E7NA 1JMOH 2WINI 1GDNA 3ATIA 2QF5A 2XBVA 1OOKB 3P8FA 4B74A 4ZKOU 3GOVB 5L6NH 4IS5A 4P00A 2RA0A 3PMBB 1CGIE 2AIPA 3GCHC 2V0BA 5SGAE 3Q3KA 2UUJB 6CHAC 3PMAB 1C5MD 2QXGA 5FBEA 2ANKH 1ZJDA 1A3EH 3LGYA 4FUBA 2FOEA 1QBVH 3A89A 2Y7ZA 1YCPK 1O35A 4WMEA 3I77A 4OS6A 2F91A 2YNAA 2CMYA 1WU1A 2ZHFH 2GD4B 2G4UA 1DOJA 1UK3A 3DHKH 1AIXH 3OFND 3F1SB 4UFGH 3SI4H 1SHHB 1DX5M 3QUMP 4ACBA 2AIQA 1GHAF 1OWEA 1XUJA 4Q80A 4F55A 3UAIC 1C1OA 2WPLS 1K1PA 4O97A 3ZZ9A 2ZCHP 4B71A 1EAUA 3MYWA 3DD2H 3TJOA 1V2NT 3LH3A 2A2XH 1O3LA 2FTLE 1E79D 1H8HD 3OEHD 2FYQA 1SGFG 1GPZA 1K1MA 2AH4X 2VBCA 5FPTA 3PMHB 4Y0ZE 1SGQE 2GZ9A 1A5HA 3LIWA 1RS0A 1AZZA 1UVUH 2R3YA 4A1XA 1C4Y2 3URCA 3OTJE 1THPB 2YMSC 1TONA 5JBTA 1CT0E 2BLVA 5K7RA 5T6DA 2GCTB 3M35A 4YXWD 1GL0E 1K28D 1DITH 5GJ4B 1H9HE 1O2TA 4CR9A 5HMAA 3RLWH 3M3SA 3C27B 4BAKB 1GCDA 4YT7H 3U1JB 1NPMA 2Y5GA 4AG2A 1WV7H 1G3BA 2A4RA 2W7UA 3LDXH 2QXHA 1A3BH 1MH0A 4TYDA 2ZPSA 2KR7A 2SGEE 2XC5A 2FOBA 1K0HA 2BVRH 3KQDA 2Z3DA 1O5FH 1C1QA 2VNTA 3N7EA 2F43B 1GMHG 1O2YA 1H9LB 2Y5HA
chains in the Genus database with same CATH topology
5GCHG 1LVYA 3PROA 1MTVA 3RUOA 1THSH 1FZZA 1OP8A 1T31A 1FPCH 1MAYA 1GJ4H 3P8NA 3SV7A 4WMDA 2OC0A 1QJ7B 2BDBA 1IQNA 1EB1H 2G81E 3A84A 2BHGA 1C1PA 1RD3B 3CS7A 1RIWC 2O8LA 1FJSA 1XUGA 2TRMA 1O31A 1CGJE 1A4WH 1K2I1 4LK4A 2K1QA 3FVFB 2P3UB 4ZUHA 2J9NA 1O37A 2F3CE 1XM1A 5FX5A 1GDUA 1O3MA 3RXGA 3RXBA 1HXFH 4NSVA 2ZF0H 4OS4A 4ZKNU 2A5AA 1GI3A 1O3BA 3SUGA 4ZKRU 2OC8A 3SUFA 1ZRBA 3PLPA 1YGCH 3M7QA 2VH0A 2ZHWH 1GDQA 5I46H 1EJNA 1MCTA 4Y7BA 3RXTA 2ZFTA 1LTOA 1C5WB 5JBBS 1DSUA 2R2WU 2Z9JA 1A46H 1VCPA 1MKXK 5FBIA 1BCUH 1LVMA 1NY22 3RXOA 1SI5H 4CH8B 1YC0A 3QZQA 1FUJA 3GCHB 6CHAB 1O2LA 2BDCA 5AVDA 1GBJA 4MLFB 3T2NA 1GHXH 2Z6BD 3FP6E 1P57B 4WWYA 5AHGH 1G9IE 5TCAA 2G8TA 1T4UH 1DWCH 1P2QA 2QIQA 5E2OA 2ZQ1A 1CGHA 1S6HA 3GYMA 1K21H 1Y3WA 3TITA 3LONA 3A83A 2GDEH 1DWBH 3RDZA 4UFEH 4ABIA 4X6MA 1C2IA 2Z9IA 5JBAS 4XDEA 1KLIH 1PYTD 2B0FA 2ZI2H 3BSQA 1B7XB 1PQ8A 1GI7B 2PKSC 4D76A 2FM2A 1EOLA 1P2IA 1E34B 2J92A 1VCQA 2CN0H 3AW1A 2BXUH 1B0EA 3RXPA 3SNCA 1QL8A 1BT7A 2KAIA 4R0IA 1O2JA 1HIAA 2BLWA 4ESTE 4CREA 2ZO3H 1V2MT 3A87A 1TX6A 2XWAA 5ABWA 4RN6A 1QURH 3F6UH 1TBQH 1SLWB 2ZFPH 1ZMNA 4KTUA 5DP7A 1ID5H 3ITIA 2RCEA 1Z1IA 2WYGA 1KSNA 5A8XA 3RU4T 4CBOA 1EATA 1GVZA 1NRPH 1ESAA 1NFXA 4CRGA 1O30A 3RC5A 4BXWA 1LKAA 3D62A 1Q3XA 1J16A 4Y76A 2PTCE 3V0XA 1TGSZ 3S9BA 3RXMA 3SGBE 1RTKA 1SL3A 4B2CA 1P2KA 3Q76A 2WPMS 3SNEA 1FY8E 1S5SA 3RC6A 4RKOB 1ZPZA 3NXPA 4ZXXH 4THNH 1QGFA 1GHBF 1P3CA 2FO9A 1ZSJA 1YP9A 3SJOA 3S7HB 2WPJS 7GCHG 2C8YB 1NZQH 1FI8A 1A0HB 2PUXB 1SGRE 1O32A 2O8UA 5E0HA 1J15A 3KNXA 4F4OC 1O5EH 5FPYA 3STIA 1LPGB 3RU4D 5C5OA 3ZV8A 4X1NU 1O5BB 4UD9H 1TPSA 2ZA5A 4X2XA 1RIWB 1DM4B 2BDHA 4NIWA 3MO9A 5E0GA 1GBKA 4LZ1H 5TJXA 2V6NA 4IN2A 1DSTA 4KELA 3PLKA 1BITA 1JOUB 5HM2A 1GGDC 3F9GA 1MUEB 5C3NA 5F6MA 4JYUH 2JH5D 4NCYA 4K1SA 2D1JA 1V6DA 1X7AC 1TMBH 1SGFA 1YPKH 2XBXA 1G3CA 1S0RA 3BTEE 1BTXA 1GBMA 2ZGBH 1HIAB 1MTWA 4K5ZA 2AMPA 5EXLA 2D8WA 3P17H 2R2MB 3KF2A 1CQQA 3ODFA 1PPZA 4TWWA 2HALA 2RG3A 1C2DA 2Y82A 3T29A 1GI8B 5EPNA 1ANDA 1W11U 3RXQA 2BB4A 4IW4E 1MKWH 4Y7AA 1V2RT 4GCHG 5AF9H 4Q7YA 3BTHE 1EAIA 4X8UH 3LH1A 3LGUA 3EA7A 3VXFH 5IDKA 3RXDA 3O8RA 3HGNA 1O3JA 1YLDA 4OGYA 2AMDA 3MFJA 2CXVA 1QR3E 4JCNA 4AB9A 4AYYB 2UUFB 4GHTA 1Z8IB 4ABGA 2PW8H 5GPIB 4WH6A 3NZIA 1FY1A 4I32A 1P02A 3EE0B 4UE7H 3U8OH 1SPJA 3BEUA 3LT3A 4BAQB 1XKAC 2PGQB 1PPFE 1QRWA 2NWNA 4FVBA 2BD8A 1ESTA 3RU4E 3UWJH 1IAUA 5F8XA 3VB7A 1BRBE 1S81A 1SGIB 4MNWA 4YO9A 3SORA 2Q1JA 3EQ0H 2FEQH 1UTMA 2FI3E 3QZRA 3MOCA 3HK3B 1SFQB 3MU8A 1EP5A 2PKSB 2WV4A 2XCFA 1SLUB 3MH5A 7ESTE 3UNRA 3OY6U 4BXSA 1G3DA 4DVAU 1S82A 4QT8C 5EPYA 5JB8S 4AORA 1SB1H 3MWIU 2G00A 1P9UA 3RXIA 1Y8TA 1GMCF 1AU8A 3LPRA 1FMGA 2W3IA 3ZZAA 1ELVA 1DLKB 1EAXA 1OWJA 3QX5H 5JBCS 4OGXA 1O3PB 4AG1A 1YCPM 2YNBA 1QB9A 2XTTB 1MTUA 1EZQA 3TJVA 1S85A 4XFQA 1KDQB 3LGIA 3MMGA 4TPYA 1DT2A 4BAHB 1C9TA 4MPWA 1ZHPA 2CHAC 2DE8A 1AI8H 1W13U 2ZGCA 1UTOA 4GPGA 3JZ2B 3PYHA 4ZKSU 4WY3A 3BTQE 2P3FH 1HAIH 1O2WA 1Y59T 2PWXA 1ZYOA 2RA3A 3GY2A 1YPLH 3A7TA 2EI7A 2STAE 4RKJB 5A8YA 3PWBA 1JIMA 4Q2KA 4X1QU 1SLXB 1T32A 5DP9A 1KXAA 2HNTF 1BJUA 3SW2B 3EA8A 1WTGH 1YF4A 2A5KA 3A80A 1MAXA 1SQOA 3ZZDA 1QHRB 3UWIA 1UTPA 5JYIA 2WPKS 1T8NA 1C2JA 2FI5E 4BANB 1OXGA 4U01A 1BMNH 2A7HA 2O8WA 1GBHA 1UHBB 5C2ZA 4GUXA 2Y81A 2ASUB 1GGDB 1C5XB 4GLYA 2B9LA 3MH4A 5DJ7A 5HGGA 3KHVA 3RXLA 1OP2A 2SFAA 1O3EA 3LC3A 4ZHAA 1UVPA 1QJ6B 1GJ9B 2GV7A 4IMQA 1FN8A 1VITG 1Z6EA 1F5RA 3UQOA 1Z8JB 3GY6A 1TOCB 3LGWA 2FS8A 3RXSA 1WAYB 4CRDA 1CA0C 2P95A 1MU8B 1LMWB 2ANMH 4D9QA 1TOMH 1O5GH 1TRYA 3B8JA 2RDLA 3BN9A 1Q31A 3M5NA 4O3TA 4X0WU 2JH6D 3VPKA 1C5YB 1ZTLA 3SV9A 2FOFA 3P8OA 2AGIX 1NS3A 3AW0A 4A1TA 3D65E 2FPZA 2FOHA 1W0ZU 3ZVEA 2HPPH 1C5UA 1GMDG 1O3OA 1EJMA 1VITH 2R0KA 4ISIH 2ZDNA 1VGCC 3TU7H 3FP7E 3E1XB 2BTCE 4WXIA 2ANYA 1DWEH 3HKIB 4ABEA 3GICB 4M7GA 5L30H 1MTNC 4X8SH 4X2YA 1KYNA 2FX6A 3SQEE 3A8CA 1K1OA 1XMNB 1E0FD 1HV7A 2P93A 4JYTA 1NRQH 1MD8A 3ZZ6A 1C2LA 1Z7KA 1ELBA 1EPTC 1SSXA 2A45B 4Y79A 1JWTA 2ALVA 4K1EA 2SNWA 3E90B 3LKWA 1YM0A 1NROH 1TX8A 1GVLA 3S9CA 1JIRA 3ZYEA 3MU1A 1FQ3A 1L0ZA 2PTNA 1T8OA 3P95A 3E16B 2F9VA 2J38A 3BTFE 1V2VT 3ZZCA 1EP6A 5T6FA 3NUMA 1DPOA 3BG4C 1ARBA 1L1NA 2XYAA 2FX4A 1GBBA 4NGAH 1W3CA 1BDAA 5FXLA 2FOCA 2QY0B 3U8TH 3ESTA 2FMJA 1TNJA 1ESBA 2VIDA 2VWLA 2VGCC 4IGDA 1HGTH 1TLDA 2H9EH 2QGRA 3SO3A 4I33A 3ZZ3A 8KME2 1QA7A 2GVFA 2FOAA 4I8HA 3TJNA 1LHEH 2AMQA 8LPRA 4FUEA 2OQUA 1QQUA 4UEHH 1TQ7B 1NN6A 1SOTA 4AGJA 2BXTH 2VIPA 1CHOF 1ELEE 3TK9A 1H8IH 3M5OA 2BQ7B 2CHAB 4FUFA 1PJPA 2J95A 1O2UA 3AVZA 1BTYA 1QB6A 1KXCA 3BIUH 3SHAH 1Y3VA 1IHTH 2A0QB 2BZ6H 1SGPE 2EI6A 1BTPA 4DT7B 2BX3A 2ZFQH 1QL7A 1C2MA 1D3PB 5JB9S 3LOXA 2PKAB 2YOLA 3UOPA 3SOSA 3JZ1B 4NZQA 2ZEBA 1M9UA 1BMLA 1DS2E 1YPMH 1Q2WA 3H7TA 3ATMA 1NRSH 2H9TH 3MH6A 2AYWA 1EX3A 4GHQA 2OP9A 1Y3YA 1XUIA 2QA9E 2XCNA 1HAPH 1UCYH 1NRRH 2QF3A 2WUCA 1MBMA 3MU0A 1CT4E 4IBLH 2AFQB 5JDUB 3RLYH 1T8LA 1TWXB 1LQDB 3ZZ4A 4BTIB 1SGTA 3LGVA 2UWPA 4JYVH 1BTWA 2HRVA 3MU4A 4AFSA 1TBZH 3A8BA 2C4FH 4E7RG 4KP0A 1ARCA 1UTQA 1CA0B 3GDUA 5ETXA 4CRAA 8GCHG 4AGKA 1P04A 1IQFA 3A86A 6GCHG 2ZHDA 3QN7A 3RXJA 3FP8E 1BA8B 5CHAC 3A7VA 1THRH 3QDZB 4JK6A 2A4QA 2ZU3A 4OS5A 1GI1A 3UPEA 2A2QH 1VGCB 4X2WA 4Y10E 3ZZBA 3QK1A 2BVXH 2GX4A 3OYPA 1TE0A 1MTNB 3MO3A 5T3HA 1QIXB 2VWMA 1TIOA 2TBSA 4XBCA 2OC7A 5E2PA 2BY9X 1EPTB 2BX4A 1UVSH 1N1LA 2LNCA 2I6QA 2CGAA 3D49H 2R9PA 3GCTG 1GBLA 4AN7A 4JMYA 3H5CB 1T7CA 2F9OA 1E37B 4FVDA 4K60A 3S69A 1D3DB 2AEIH 4NWLA 1NFYA 2A4GA 2CF8H 2Q6FA 1V3XA 2BDYA 3E0PB 1OWIA 1EASA 2BLQA 1FXYA 1MZDA 1P01A 2WYJA 3BG4B 2ZDMA 1CT2E 3ZVGA 1LHFH 2H9HA 4A5TS 1BHXF 1XVMA 2AGGX 2ZTYA 4CHAB 1G37A 1RGQA 2ULLA 3UY9A 1BOQA 1S6FA 1XVOA 4U30A 4NA9H 4D8NA 3GY5A 1C5TA 1P2MA 2FESH 5DP6A 3K9XB 2Y7XA 2VGCB 4ABDA 4I8KA 4ZMAH 2ZU5A 1OPHB 1SLVB 5A2MH 2THFB 1ZSLA 2ZHEH 2ODQA 1C5VA 4DJZB 2A1DB 2O8TA 3AAVA 3BTDE 1DE7H 4O9VA 1UO6A 1TNGA 2BY6X 3FZZA 1AFQC 5BPEA 5TCCA 4H6SB 3T25A 1C4U2 4MNXA 5ESTE 5LPFA 3PTNA 5FCKA 3LU9B 2ZCKP 5EODA 4YT6H 1C9PA 5EQSA 1ZHMA 3EAJA 2HPQH 1UTKA 2GGVB 4ZH8A 1SGNE 2XNIA 1S84A 1PQ7A 4H4FA 2QN5T 3GCNA 1K22H 4I8GA 4MPVA 3T62A 1GBFA 1O3GA 4DW2U 3Q3YA 1OKXA 2Y5FA 1SR5C 5C20A 2OXSA 1QTFA 2ZQ2A 3K6YA 1T8MA 2GCHF 1UK2A 2VJ1A 1HYLA 1G2MA 4WJG2 5T6GA 1FIZA 1DDJA 3UTUH 1MCVA 2Z94A 3SGAE 1WCZA 4H42U 1BRCE 3NWUA 4MPUA 2HOBA 3KQCA 3V3MA 3TPIZ 5GDSH 4FUJA 1DXPA 2QV1A 3A8DA 3QWCH 3PWCA 1HAVB 3TH4H 3V7TA 2QCYA 3ZVDA 4ABHA 3A82A 4YLUA 1WUNH 1P2JA 4J2YB 4Q7ZA 2FZZA 1IHSH 5J4SA 5HYOA 1FY3A 1ZGVA 1HCGA 1YBWA 5C1UA 5DK1A 1L4ZA 1DANH 3S7KB 1W7XH 2NU2E 4PROA 1V2OT 3HPTB 3BV9B 1Y5UT 3B23B 4OS7A 5FX6A 3KEEA 1ETSH 2P59A 1AY6H 3BTGE 1O5DH 1TMUH 1TX7A 1FONA 5CHAB 2BZAA 2ZU2A 4I8LA 1DICA 3S9AA 1C5QA 1AUJA 4BNRA 2JH0D 1BJVA 1EJAA 3AASA 4MG3A 4HGCA 4XE4A 4CBNA 2Z9KA 1IQLA 1JBUH 3UR6A 1NFWA 3UFAA 1ZOMA 2FXRA 2GKVE 3D23A 1SFIA 1HAYB 1IOEA 1Z71A 3FANA 5C1YA 1C1UH 4ZROA 3SBKA 1YCPH 1TNIA 1BBRK 2BD5A 4D7FA 1LHCH 1O5AB 3DUXH 2BOHB 4UONA 1ZJKA 1G3EA 1O3CA 2W5EA 3BEIB 5EQQA 4ABBA 1EZXC 5F03A 4YZUA 3PMJA 3I78A 1FPHH 2STBE 1GJ8B 2GMTC 1A0JA 1V2WT 2QAAA 4OS1A 4OS2A 3BG8A 1FDPA 3EGKH 3BTWE 1OWKA 3N7OA 2IN2A 3SUEA 1C2KA 2OLGA 1C5PA 1AO5A 1GG6C 2OD3B 2AS9A 5EOKA 1LKBA 1AVWA 1V2KT 2VVUA 1ELFA 2H1UA 3SJ8A 3VFEA 4DG4A 1DWDH 4D7GA 4MVNA 3M37A 3B9FH 4X6PA 1HJAC 2FOGA 4FU8A 1ZRKA 1GMHF 1GHZA 1EXFA 1OWHA 1KDQA 5GCHF 1TGTA 1LO6A 1SHYA 1C4V2 3A81A 5BRRE 4BAOB 3TGIE 1W7GH 1AFQB 1EKBB 3I29A 2W26A 1EAWA 1ZTKA 1HAGE 4E06H 3BEFB 4WF8A 2ZP0H 2J2UA 1CSOE 1C1MA 1E38B 1O2IA 1O3AA 3HKJB 1TABE 3ODDA 5DP8A 3RMMH 1HLTH 1JXPA 3BTTE 3M7UA 1YPJH 1GI6A 1AB9B 5FAHA 2TGDA 2PSXA 4K69A 4MTBA 3O8DA 1K9OE 1SOZA 1AKSB 1DLEA 1C1VH 3TH3H 3RXFA 1N6YA 5DGJA 3KCGH 1C5SA 3RXKA 1GBTA 3VGCC 3GY3A 2XWBI 4Y8YA 1INCA 1MZAA 3A8AA 2UWLA 3NPSA 1UCYE 1GL1A 2G52A 3V13A 1TNLA 2Q6DA 1UHBA 4JZFH 5J4QA 2C3SA 3ATKA 1SGYE 1LHDH 3QGJA 3DFLA 1C1NA 3LJOA 2WPIS 1G2LA 4XBBA 4E05H 2H6MA 3A7YA 3M61U 4DIHH 3L3TA 1V2JT 4VGCC 1PPGE 1ELAA