3RXKA

Crystal structure of trypsin complexed with methyl 4-amino-1-methyl-pyrrolidine-2-carboxylate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxkA02
1P01A 1H9LB 1ETTH 3ODDA 1O34A 1TYNA 1UMAH 2FS9A 2ZU1A 1EXFA 3STJA 3ZVEA 1HBTH 4XBBA 5CMXH 3PMJA 5EW1H 1ZPCA 3LT3A 5FCRA 4DJZB 1MKWH 4X1NU 1TNKA 1YCPM 3OU0A 5F6MA 4FUEA 3ZZAA 4THNH 2DE8A 2D26C 4FU7A 1IQNA 4X6MA 3SJIA 4X6PA 4J2YB 2FTLE 1AY6H 2ALVA 3H7OA 3RMMH 3TLOA 1GI9B 1JOUB 1VGCC 1C1QA 5E0HA 1P06A 2PLXA 2WUBA 2OCVB 5LPEA 3RLYH 2HGTH 1BIOA 1O0DH 5C1UA 2O9QA 2BLVA 1FIZA 4AOQA 1VGCB 5B6OA 2XRCA 1O36A 5T6DA 4Q2KA 1NM6A 1CSOE 2CF8H 4ABAA 4CRCA 3T27A 5I25A 2JH5D 1P05A 3TJNA 1O2UA 4UD9H 1GHVH 1Y5AT 4LZ1H 2QXIA 3D65E 1VZQH 2YNBA 1B5GH 1CE5A 2GDEH 2ZPQA 2GT8A 4AB8A 1FI8A 4WMFA 1TGSZ 2ODPA 3BG4C 3PTNA 2XTTB 1MTWA 5T6FA 1SLUB 1PPZA 2R0LA 2VIDA 2ODYB 1LHFH 1AMHA 2CN0H 1SBWA 1THPB 4ABHA 3M7UA 3SGQE 4TY6A 1TBRH 3MNBA 4UDWH 3TPIZ 1S0RA 3SU3A 1A3BH 1CA8B 2V3OH 3GY2A 1JWTA 3SZNA 1ZOMA 1YGCH 1CGJE 3M7TA 3ZVGA 3SV9A 5BPEA 3S0NA 1Q3XA 4J1YA 1QY6A 3GCTG 1IHTH 2EC9H 3E3TA 2BDHA 1FJSA 1C5MD 3ZZBA 3UWIA 2OC8A 5FCKA 3K9XB 4AYYB 1TA2A 1RJXB 1O3OA 1TX6A 2W7UA 4XDEA 4ZXXH 3V12A 4FUJA 2NU0E 3ATLA 5EQRA 3P70B 3H5CB 7GCHG 4CH8B 1F2SE 2BD7A 2BOKA 2WPLS 2JKHA 1N6XA 3EAJA 8GCHG 1O3DA 1K1PA 2FTMA 3GY4A 1A1RA 5IYTA 3PROA 3E8LA 3RXUA 4B73A 1ANCA 2P93A 3GDSA 1O5BB 8KME2 3A80A 4CBNA 5FBIA 2H9HA 1FV9A 1TNGA 2ANMH 1PYTD 1EASA 1SI5H 1QL7A 1FN8A 1GJAB 4JZFH 4NA7A 2ZHWH 1AFQC 4BXSA 5GPIB 3EA9A 1RS0A 2AERH 1AWHB 3SJ9A 4E7NA 4Y10E 1GJ6A 1EPTA 4R8TB 4SGBE 3U9AH 1A0LA 4D8NA 1HDTH 4H4FA 2ZQ2A 4I7YH 1AZ8A 2FMJA 3ZVBA 2CJIA 1Y3VA 4D76A 1KDQA 1EJAA 1BJVA 5FPYA 2A32A 2VVCA 1YLCA 3L33A 2FZZA 2J38A 5EGMA 1C2IA 3U1IB 5EW2H 3KN2A 3LJJA 1KLTA 1AB9C 1UCYH 2UWLA 3QTVH 4ABGA 2ZTXA 2A7HA 4FUBA 2AGEX 1CHOG 3SUFA 1JMOH 1WTGH 2FPZA 1TE0A 1W10U 2TGTA 3FZZA 1EUFA 1Z8GA 4YOIA 1BTUA 3KQBA 2Y81A 3A7XA 2TGAA 2ZHDA 1GJ5H 4YT6H 4I8JA 1XX9A 1EQ9A 2OINA 2UUKB 1ESTA 1V2UT 2WPKS 1RTKA 2AS9A 2HALA 1GJDB 1NRNH 1S83A 1UK4A 5DP4A 1XVOA 1ZMNA 1ZRKA 3BSQA 1C4U2 2Y5GA 5CHAC 1AVGH 5LH8A 2AGIX 4JCNA 5DGJA 1VITF 1O3EA 4X1PU 1YCPK 3QDZB 3K65B 1GI7B 3RM2H 4BAMB 1SGDE 1EZUC 2ZCHP 1UO6A 1HCGA 3U1JB 2Y5FA 1AD8H 5CHAB 2BX3A 1G3CA 1OYTH 2R9PA 4TPYA 5FPTA 4YZUA 2TGPZ 2ANYA 4NSVA 4X2YA 1E34B 1QL9A 3A88A 3T29A 1H1BA 3RXPA 3DD2H 1LVYA 3STIA 2ULLA 2FOAA 1F0UA 4B2AA 2GD4B 1GDQA 1RIWB 3SQEE 3FP7E 4GHTA 1SGYE 1E36B 3RXTA 3C1KA 3OSYA 4H6TA 5AF9H 1J14A 2BD2A 2IN2A 6GCHF 1FXYA 1C2EA 2BVRH 4K1TA 5FPSA 1C5PA 2P8OB 4O3TA 4I8LA 3FZDA 3RXHA 5GIBA 5EXMA 4X8VH 1DY8A 2SNVA 1EAXA 1TBZH 1UVSH 3LH3A 2FS8A 5C5NA 1VR1H 2BZ6H 2QXHA 1UJ1A 1PFXC 1TB6H 1LO6A 2H9TH 3R3GB 1GG6B 3LGVA 4Q7XA 1C1RA 3B8JA 1NS3A 3ITIA 3A84A 3TJVA 3M37A 1E37B 2VWNA 1P2QA 1O3PB 2A4OA 4K8BA 1T8OA 3RLWH 2DUCA 1B0EA 1LCYA 3KQCA 4XFQA 2R3UA 1GBEA 5TJXA 1EKBB 1TGNA 1NT1A 2A5IA 4E7RG 4WMEA 4UFEH 2CGAA 3M5MA 3VXEH 1BTXA 1VCPA 1K28D 1O3KA 3A89A 2JETB 3DFLA 1UTQA 1LDTT 1E0FD 3E91A 4K5ZA 1XM1A 5FAHA 1SMFE 3ZZ6A 1ZSKA 1TOMH 3F9FA 1C5OH 3R0FA 2F9NA 1JBUH 1DVAH 2G51A 2QF0A 2G55A 1WU1A 1BUIA 1O3AA 3UFAA 3PMBB 5JB9S 2GCHG 1YLDA 1W12U 3UY9A 1EB2A 1SGFA 1TWXB 3GYLB 4TY7A 3Q76A 3U8OH 4IN1A 1O31A 3A85A 1RGQA 2W3KA 2O8WA 2YNAA 2ZDVH 1V2KT 2F91A 2F9PA 1V2OT 3A7WA 1C5YB 1KXBA 1SVPA 5A0AE 1C1WH 2BQ7B 1N6YA 2QXGA 5J4QA 1DSUA 1Z6EA 2FOGA 4ZROA 2H1UA 1GMDF 4YESB 2FXRA 2FP7B 2VIVA 1OWKA 3VEQB 1HNEE 4WH6A 5I46H 1AN1E 2ZA5A 1P02A 1IQLA 1TABE 3V0XA 2NU2E 2P3FH 1SFQB 3A8AA 1EAIA 1EP5A 3LU9B 3URCA 1AE8H 3QUMP 1CT4E 3ZV9A 3VB5A 4DURA 2Q6DA 4MNYA 3CS7A 2FOHA 1O2MA 3LGYA 1LHEH 1O2XA 2R2WU 2Y7XA 3BTME 4JYTA 3RU4T 3ZVDA 4ABEA 1Z8JB 3KIDU 1ESAA 2I6QA 4X8SH 3SNBA 1PQAA 3IITA 1HXEH 5GCHG 2Y5HA 1WOFA 4GPGA 1T8LA 1MQ5A 2SGQE 3Q3YA 1XUGA 1IOEA 3URDA 1DM4B 3ZV8A 3E0NB 1UTNA 1SQAA 1OWHA 3ELAH 1OPHB 2G5NA 3HATH 3ATWA 1UK3A 3P17H 3BEFB 3M61U 3GDVA 2FO9A 5HYOA 4IBLH 3SU6A 5A8YA 1GHBF 3MHWU 1ZPZA 1C1MA 1TMUH 4RKOB 5HMAA 4NCYA 1ZMJA 2FLRH 4BTUB 1WQSA 4GHQA 2J4IA 4Y0ZE 3RXIA 2BDYA 1DUEA 3MNSA 3EA8A 3HK6B 1P09A 2OLGA 1LHDH 1Q2WA 2RA3A 1CVWH 5EPNA 3PWBA 1QA0A 4CR9A 3GY8A 4IN2A 2PKAA 1Y3WA 1O2RA 1QBOA 3RXEA 3ZZ7A 2ANKH 1C9TA 1YPEH 1C1VH 1MTUA 1QTFA 2CHAB 2A4RA 7GCHF 1WUNH 4DVAU 2ZHFH 1NRQH 1MTNC 8GCHF 2O8UA 3ZYDA 6LPRA 3CP7A 2GMTC 4JZIA 2A7JA 1TGBA 1E35B 3GICB 3VB7A 1TRMA 3QX5H 1DWDH 4Y79A 3MU0A 4BANB 4F4OC 1FY8E 1YPLH 4Y6DA 1PYTC 1TNIA 3MO9A 3O8DA 1ZPBA 5A8ZA 2BLQA 5DO4H 4VGCC 1BMNH 2ZDMA 3BTKE 2VWLA 4OGXA 4B2CA 2WV5A 3FANA 1GHXH 3NK8A 2B7DH 1OOKB 2HWLB 4BTIB 3AVZA 3NZIA 2W7SA 1GMCG 3LDXH 1O2YA 4NZLA 3FAOA 1KXCA 4AYVB 1C2MA 4VGCB 5L2ZH 2FYRA 4BAOB 3D62A 3RU4E 2OD3B 1Z8IB 2D1JA 1HB0B 2NWNA 1YF4A 2G81E 2XBVA 3M3SA 1AKSB 1ZSJA 4X8UH 4GLYA 1WBGB 4H42U 5FX6A 1C2FA 7ESTE 2BVSH 1ESBA 2W26A 5DP5A 1G37A 3UR6A 4AG2A 2ZDLA 3SW2B 5A09A 1HAGE 3M5NA 1H9HE 1C5ZB 4OS7A 4ZKOU 1P8VC 2BLWA 3D49H 2FI4E 4ABIA 2ZPRA 1A46H 1GCTB 4X0WU 2NU4E 4ZXYH 1MCTA 4I32A 4YOGA 4TPIZ 1BBRK 1SQOA 2A45B 2BY6X 2SGPE 3UWJH 2AYWA 4D9RA 1C2GA 1HUTH 4U01A 1C5LH 1Z1IA 2ZFTA 1C1TA 2D2DA 1O3JA 1OX1A 1OKXA 1HLTH 1LHGH 3IWMA 3P8GA 1T4UH 2VIPA 3TGIE 1GMHF 4Z6AH 1C5QA 1PPFE 3A7VA 1GBDA 2OBOA 1HJAB 3MH6A 2ZFPH 2Z9KA 3ZZCA 3RXJA 4B71A 1FQ3A 3S7KB 3WY8A 2QA9E 1YP9A 1MZAA 4GVUA 1W2KH 3PLBA 1L2EA 2IPHA 1J15A 2Y82A 5TCCA 2TGDA 4NIWA 2G5VA 5GWZA 1TPOA 5ABWA 2LPRA 2XCNA 3PYHA 1GVKB 5JB8S 1C1NA 3JZ1B 2FOBA 3UR9A 1HPGA 2ZFFH 1GDUA 2ZU5A 3QTOH 5T3HA 1A2CH 4CRDA 1ARBA 2G8TA 3MNCA 3SQHE 1NESE 2ZGCA 3TGKE 2EEKA 3RUOA 3SU1A 2GV6A 1QJ7B 1TAWA 1O5AB 1V3XA 4LOYH 4CRGA 4U30A 3SU0A 3Q3KA 2A5AA 2Q1JA 1XUHA 3LJOA 3TU7H 4B1TA 1ZR0A 1DLEA 1C1SA 1HAOH 1Y8TA 2A7CA 1ANEA 5LGOA 2A31A 5FXLA 1TGCA 2FI5E 5PTPA 4WXIA 1MH0A 1K1NA 3BTQE 1CQQA 3A7ZA 4DCDA 3TVJB 3BTGE 1SPJA 3ATMA 4DIIH 2GZ8A 2XCFA 1EZQA 1BDAA 1QURH 3E16B 4XBCA 1SOZA 1EPTB 1S6FA 3UNSA 2C8XB 4KELA 2HNTE 3TH3H 4ZAEA 1HXFH 5HGGA 4DY7B 3UTUH 1O2JA 3SNEA 4ZKRU 1IQIA 2VNTA 1CGIE 1NY22 1W13U 1V6DA 2GCTB 1LVBA 4CHAC 1GWAA 3ZYEA 1Q31A 1LKAA 3UNQA 1T7CA 3DFJA 1BTZA 3MH5A 4OS1A 1BBRE 1INCA 4YLUA 3MU1A 5EG4A 4CHAB 3F68H 1GI3A 4CRAA 3OY6U 3GCHC 1ZGVA 1AO5A 5C2ZA 4I33A 2ODQA 3PM3A 1F7ZA 1SGTA 3S9BA 1P11E 3MTYA 3VB3A 3Q3XA 2Z9GA 3GCHB 3DUXH 1DY9A 3P8FA 1SOTA 1AGJA 4A92A 3RMNH 5GXPA 5A8XA 1BTPA 1O3BA 1Z8RA 4LK4A 1P2NA 1UTOA 2STAE 3ZVCA 1QJ1B 3TNSA 1LVMA 2SGDE 2B9LA 1GL0E 2TPIZ 5E2PA 3VGCB 1G3EA 3QO6A 3W95A 5FHTA 2C3SA 1Y59T 3EQ0H 4MDSA 5GCHF 1UK2A 1ELBA 4YLQH 3RXLA 3HK3B 2F9VA 2O8MA 1WCZA 2UUJB 3T25A 1SHHB 3QK1A 1CO7E 3TITA 2BDBA 5LPRA 3A7TA 4ZHAA 3Q00A 5IDKA 5JBCS 1A5IA 1TIOA 2FX6A 1MBQA 2QV1A 3RMLH 4ISIH 1Z1JA 1DDJA 3VPKA 2ZDAH 2JH0D 3PLPA 3UQOA 2R2MB 1D4PB 2ANWA 1SSXA 1DXWA 1KXDA 3HKJB 1O2VA 2SGEE 5AFYH 2F9BH 2BD9A 3TK6A 4IMQA 3UOUA 1BRCE 4FUIA 2ZCLP 2ZEBA 3I77A 1O2NA 1P04A 1AIXH 1ZHRA 1GVZA 2BDGA 1GL1A 1C1OA 2F9UA 2BVXH 1ARCA 3IG6B 4AORA 1H8DH 1V2ST 2ALPA 3A8CA 3JZ2B 3DHKH 4X1QU 1RRKA 2Y7ZA 2BY8X 1DT2A 3HGPA 3TGJE 1HFDA 2QCYA 4XE4A 1W7XH 4D7FA 3FP6E 1G32B 4GCHG 1N1LA 4JK6A 4KTCA 1O2ZA 4HFPB 1RXPA 5BRRE 4ZHMU 2XWBI 1RIWC 3MO6A 4HGCA 1HRTH 2H5DA 1SGNE 5ESTE 4Y11E 1K21H 1T31A 3QGJA 5A0BA 3BV9B 2PUXB 3T28A 2ZU4A 3E6PH 2A0QB 2GZ7A 2P8OC 3D23A 1FZZA 1TNJA 1ELCA 2TBSA 2VJ1A 3SGBE 2BY5X 2STBE 1TONA 1H8IH 2XC4A 5HXFA 4R0IA 2BD4A 2OUAA 2QGRA 2FWWA 3BTFE 4YOJA 1GG6C 5K7RA 1HAHH 1NPMA 1EX3A 1TLDA 4NZQA 5E8EH 1C5UA 4IS5A 3SUDA 4Q7YA 2ZHEH 5ESBA 1A4WH 4FUDA 4MNXA 4UONA 1TX7A 1ID5H 1S81A 1ELFA 2SNWA 1O30A 4INKA 1D6WA 4BAHB 1GBIA 2FDAA 2XW9A 1L1GA 3A81A 2Q6GA 5JBBS 1YBWA 4FUHA 1YM0A 1UTJA 1C1UH 1P2JA 2JETC 1SGCA 3SHAH 1HAPH 1A61H 1J8AA 4A7IB 4RN6A 3LGWA 3RC5A 5C1YA 5C1XA 1KXEA 1QFKH 3NXPA 3ZZDA 1ETSH 4NA8A 1FNIA 5EPYA 2CMYA 3M3TA 4OGYA 2XC0A 1CBWC 2XYAA 4MPVA 1P9UA 1GJBB 1WTHD 1L4ZA 4OS4A 4NSYA 1HJ8A 1UTMA 5EOKA 2UUFB 1ZJKA 3A86A 4ZHLU 1M9UA 4MG3A 2FOCA 2FOEA 2PTCE 1BQYA 4WVPE 1BTYA 1CBWB 3KNXA 1QRXA 1YC0A 3E1XB 4HZHA 3AW0A 1NRRH 1ELAA 1YCPH 2WUCA 3GCNA 5HM9A 1AUTC 4OS6A 4TYDA 1YPKH 3PWCA 2J94A 1ANDA 4MNWA 1MKXK 3UREA 4JK5A 4BOHA 1DE7H 2Z3EA 5L30H 4AFSA 1C2JA 3LIWA 2PKAB 3MI4A 1SGFG 1YPJH 2AH4X 1O2OA 3AAVA 3BTDE 2A4GA 2BY9X 2BYAX 2ZECA 1IQGA 1UVUH 2OC1A 1HIAA 1P2IA 2VIOA 2RCEA 3SNDA 1EP6A 3BEIB 1EOJA 3TK5A 2VWOA 1V2PT 3U8RH 3P92A 4SGAE 4AGKA 3SJOA 3GDUA 3SV7A 2Z9JA 1V2TT 3OX7U 3RXQA 1NFUA 4K8YA 4NA9H 3KL6A 4X1SU 2WPMS 1CA0B 1OWJA 2OQ5A 1O3CA 4X8TH 8ESTE 3O8CA 1AFEH 4NWLA 3SU5A 4AN7A 4ISNA 9LPRA 2VIWA 3SUGA 2H5CA 2H6MA 1TRYA 1XMNB 1EATA 4ZUHA 1DSTA 1LQEA 1NU9A 1FPHH 1DWBH 1YPMH 1XUKA 1AQ7A 2HPQH 1OP0A 2H9EH 1RTLA 1FY5A 4NFEA 2TRMA 1K1OA 4DT7B 4AFZA 1AVXA 3EDXB 1TOCB 1N8OB 1F0SA 1QA7A 4K69A 3HKIB 1XVMA 1HAZB 3I29A 2XBXA 3NPSA 1B0FA 1W0YH 3P8OA 5DPAA 1DS2E 3FP8E 4UFFH 2P3UB 1BRBE 2WPJS 4Y0YE 2BD5A 4M7GA 2C4FH 3F1SB 4U32A 3ZVFA 5DKMA 3S69A 2VU8E 1F5RA 1HAVB 1VCQA 2ZFRH 2A4QA 1V2VT 2NU3E 4A1TA 3GCTF 1BRAA 2CHAC 2TIOA 4LXBH 1JRSA 2ZTYA 4GSOA 2XNIA 1OWDA 3RXSA 1K1LA 3BIVH 3AASA 1C5NH 4WMDA 5DP6A 3HGNA 3GYMA 2SGAA 3PMAB 3FFGA 5DP7A 3EA7A 1O5EH 3KQEA 5JYIA 1PPHE 1C5RA 1O3NA 2R0KA 3K6YA 3V13A 1QB1A 3ZZ9A 1DXPA 2K1QA 2GDDA 3PV4A 1C9PA 3O8RA 3SO3A 4B2BA 3VFEA 4IMZA 1ELDE 2QN5T 2D8WA 1ZMLA 3RU4D 2BQWB 3RXBA 2PWXA 1P0SH 4DW2U 3M36A 4AX9H 1ELTA 1SB1H 1AHTH 1S82A 3MWIU 1O37A 1RD3B 4X2WA 3RXOA 1QBNA 3BEUA 2J2UA 1EOLA 3GOVB 1QB6A 4K3JA 1P2OA 3KF2A 1BHXB 2B0FA 1VITG 2P94A 2ZDNA 4Y76A 2FOMB 2Z3DA 3Q77A 1GI1A 3PO1B 1C2DA 1DUAA 1XUFA 5HM2A 1ABIH 2BM2A 2W5EA 4Y8YA 1TA6A 3BF6H 1A0HB 1AE5A 1AVWA 2AMPA 1FPCH 2BY7X 1D9IA 2AMQA 4I31A 4UFGH 2ASUB 3LC5A 1MKWK 3F6UH 2Y80A 3LKWA 2FOFA 5TCAA 3OY5U 4JZEH 3ATIA 2EA3A 1FN6A 3EYDA 4JZ1A 1ZHPA 1V2MT 2G52A 2HPPH 3ZZ5A 1K1MA 3W94A 2ZHQH 1GCTC 1ZHMA 1O2QA 3SORA 1RFNA 1O2TA 1ZYOA 4A5TS 2NU1E 3F9EA 1CHOF 2VH0A 3LONA 3M5OA 3MNXA 2V35A 3LGUA 3MOCA 2ZFQH 1PPGE 2A5KA 2Z6BD 2ZNKH 1UVOA 2RA0A 1L4DA 1NO9H 5CE1A 2AIQA 2ZIQH 1XUJA 2XWAA 1A5HA 1CU1A 1ZGIA 3NUMA 3OTJE 1QRZA 3MU4A 2KAIA 1D3TB 1GBLA 1KTTB 2VINA 5FX5A 4INHA 1IQEA 2GZ9A 1CT0E 4ASHA 1NC6A 4NWKA 1ZRBA 3P95A 1DANH 1O2LA 1KXFA 1NN6A 3EGKH 4WWYA 1GBKA 4BXWA 2PSYA 4IC6A 1HJAC 3K6ZA 2F3CE 3RDZA 1QBVH 2ZCKP 4Q80A 3RP2A 1SQTA 1JIMA 3RM0H 1TMTH 4KTSA 1GBAA 1S0QA 2Z9IA 1MMJN 2QAAA 1QNJA 1P3CA 2AFQB 1OP2A 1P2KA 2GGVB 1SGQE 2Q6FA 1CGHA 2BXTH 4Y8ZA 1ZTLA 3V7TA 5C3NA 3QLPH 1GCDA 2CXVA 4MLFB 3RC6A 4PROA 1SG8B 1GBCA 1NZQH 1L1NA 1FONA 1MCVA 4NG9H 3M7QA 2GV7A 4MNVA 1K1JA 1WSSH 1ACBE 5F8XA 1SGIB 3EE0B 1EJMA 1MTSA 2AIPA 2PV9B 3C27B 3N7OA 1XKBC 4U2WA 3RMOH 5G4BA 3SBKA 4ABBA 1Y5UT 3SI3H 3QZQA 4ISOA 4BTTB 3SOSA 1KTSB 2QC2A 4CH2B 2ZF0H 5DJ7A 1S85A 1UTPA 3BIUH 4X6NA 1GBHA 6CHAC 1F0RA 1FLEE 1MD7A 1O2SA 3BTWE 1VITH 1K22H 1EB1H 1GMDG 3MMGA 3B23B 1PQ7A 2Z94A 4K1EA 2Z7FE 2V0BA 1FDPA 2BD3A 2PKSC 5E2OA 3CS0A 1MQ6A 6CHAB 1W8BH 2THFB 1KXAA 2P3TB 1PQ8A 2BXUH 3ZZ8A 1EPTC 5JPMH 2ZPSA 4HI3A 2PW8H 4ZKNU 1AKSA 1AZZA 3VXFH 2Z3CA 3PLKA 1T8NA 1NRPH 1EAWA 4CRFA 4AB9A 1HJ9A 1RTFB 3SJKA 4CRBA 4BAQB 2PKSB 2C93B 3UUZA 1V2RT 3OYPA 2GCTC 1L1JA 3HPTB 1TRNA 3I78A 3GY6A 4BAKB 1GHZA 1BZXE 1MAXA 3BTEE 4JYVH 4O9VA 3ZVAA 4DG4A 2B5TB 1SLWB 4H6SB 1GPZA 4YTAA 1KDQB 1BBRH 1T32A 3UPEA 5AHGH 2BD8A 1IAUA 1GI5A 2PR3A 2G4TA 4CREA 4MQAA 5C5OA 3M35A 2GX4A 1QR3E 1PPEE 2BOHB 4A6LA 1V2JT 3LH1A 2GCHF 5GDSH 3E90B 2HLCA 2F83A 1UHBA 2DE9A 1SGRE 4RKJB 1ZJDA 1NU7B 3U69H 1YYY1 1O3GA 1QQUA 1C2LA 3LC3A 1V2NT 4OS2A 1F5LA 1U6QA 2QY0B 3NCLA 4MTBA 1EZXC 1UCYK 4I8GA 3RXGA 4B75A 1GHBG 3ODFA 1F92A 5E0JA 3BG4B 1GHAG 1G2MA 1F5KU 4Z0KA 2XXLA 3PTBA 3TNTA 2UWPA 3B9FH 4XOJA 1T4VH 1MTVA 5L2YH 3A87A 2Z9LA 1H9IE 1O2PA 2HOBA 4X2VA 3VGCC 1OYQA 1BA8B 1MZDA 1FAXA 4XBDA 1GVLA 3SGAE 1IQKA 1G3BA 1O38A 4NIVA 1A0JA 1EZSC 1HAIH 3ZZ4A 3SV6A 2WPIS 1NFXA 1C5VA 3GY3A 5LPFA 2EI6A 3AW1A 5F8TA 1QL8A 5JBAS 2O8TA 3RXKA 1O5GH 3SNAA 5F03A 1Y3UA 4HTCH 1C4V2 1S6HA 1YPHC 1LKBA 4TWWA 2O8LA 1BOQA 3SU2A 3BN9A 1J17T 1LPKB 2J9NA 3L3TA 2VB0A 1PJPA 2PTNA 2V3HH 3MO3A 1KY9A 2VGCC 4B76A 3KEEA 4YT7H 5AFZH 1O5DH 2GKVE 1TQ7B 2VWMA 2SFAA 3P8NA 1E38B 1OSSA 1ELEE 4X1RU 8LPRA 4B74A 1UTLM 4A1VA 5DP8A 2WYGA 1O35A 3TH4H 1OS8A 2RG3A 4ABFA 2V6NA 2VGCB 2QYIA 1GGDC 1C2KA 3QZRA 2P59A 1TMBH 2SGFE 1JIRA 1QRWA 3V3MA 1X7AC 1IQHA 3T26A 2OC0A 4NIYA 2OQUA 4K2YA 1A5GH 1C5TA 1G2LA 2JH6D 1AFQB 4E05H 5J4SA 5EXNA 1FY1A 1QQ4A 4ESTE 1HYLA 1GI6A 1OWIA 1GGDB 5EQQA 3MYWA 3SUEA 1NFWA 1GHYH 3SU4A 4DOQA 1SFIA 1VJ9U 1GI0A 2AMDA 2C8YB 2BDAA 1J16A 4D7GA 3S7HB 5F8ZA 3VB4A 3FVFB 2PUQH 1GBTA 1UVTH 2WV4A 4I8HA 4WXVA 3SJ8A 1IHSH 4FVBA 4KP0A 1UVPA 6ESTA 1AB9B 1JRTA 1TGTA 1O2WA 2PGQB 4KKDA 4LZ4B 1AI8H 2ZZUH 1GJ8B 2ZO3H 3GISB 2FIRH 1UCYE 1P2MA 1BCUH 3PB1E 1LPZB 4K1SA 4GUXA 2BZAA 1GBMA 4NIXA 2BDIA 1MAYA 3M3VA 3BTHE 4FU9A 3S9CA 1VCWA 2CV3A 1GI8B 5JBTA 1O32A 1OP8A 2A2XH 4CR5A 1V2LT 1GMHG 3GCOA 1P03A 1THSH 4XSKU 2BQ6B 2J95A 1GMCF 2BLOA 2HNTF 1LQDB 1O33A 1W11U 1D6RA 1IQMA 3RC4A 2J34A 1BRUP 1DITH 3T62A 3MFJA 1YPGH 1CHGA 1S5SA 3KQDA 2ZGHA 4FUFA 3SV2H 3BTTE 1O3LA 3QWCH 1ORFA 3RXMA 1HIAB 2ZGBH 1KIGH 3TK9A 4JYUH 2OBQA 1KSNA 4BNRA 2BMGB 3VB6A 1ETRH 2ZDKA 5EQSA 2J92A 4CBOA 3NWUA 5DG6A 4OS5A 3MU8A 2XBYA 1KLIH 1SGEE 4TWYA 3RXRA 4KTUA 2WYJA 4MPXA 2FX4A 1PQ5A 3RXDA 1GJ4H 1XXDA 1P3EA 2A2QH 1GBJA 3UOPA 1C2HA 1TNHA 4DGJA 2ZI2H 1Z71A 5DP3A 2FLBH 4IC5A 3DA9B 1Z6JH 1LHCH 4E06H 4AG1A 1NTPA 1DLKB 1ELVA 4ZKSU 4F49A 4ISHH 2GP9B 1GJ9B 1NROH 2HVXA 1A3EH 3CENA 1Z7KA 7KMEH 1FAKH 2C90B 1VJAU 1GBBA 3MH4A 3UQVA 1DWCH 1MBMA 1QCPA 5DK1A 1G36A 3UIRA 4D9QA 1C1PA 1G3DA 2G00A 1CT2E 1O2GH 1F0TA 3H7TA 2GTBA 2A1DB 2BB4A 2WINI 1XUIA 1IQFA 1TPPA 1TBQH 4ZMAH 1XXFA 4DIHH 1OWEA 1O3FA 3BG8A 3A82A 1KYNA 2Y6TA 1W3CA 3TIUA 5C67A 1IQJA 4Y7BA 1SL3A 1WV7H 4UFDH 2FI3E 1LPGB 2XBWA 2BTCE 1P12E 3TJUA 5DP9A 2GVFA 4Y8XA 1D3PB 1GBFA 1QGFA 1O5CB 2UWOA 1ZLRA 1ANBA 1O2KA 1A7SA 1OXGA 2BDCA 1ZSLA 2LNCA 1HV7A 1BHXF 3GY5A 1XKAC 2HNTC 5T6GA 3TH2H 1CA0C 4X2XA 3LPRA 2P16A 1Y5BT 2F9OA 1O2HA 2QIQA 1QJ6B 4Q7ZA 2IOTA 1TPSA 2QF3A 2FESH 4FVDA 4ABJA 2GT7A 2XC5A 1BT7A 1MU8B 1TPAE 9ESTA 2P95A 4AFUA 1KLJH 1K2I1 2VVUA 5FBEA 2FYQA 1GJ7B 3A83A 4QT8C 1G9IE 1WAYB 1FY4A 2AGGX 1N8OC 3SV8A 1H4WA 1DPOA 1O2IA 1THRH 2OP9A 1YKTA 2ZGJA 4MPWA 2PGBB 2HRVA 3TJOA 1GJCB 2M5TA 2ZP0H 1C5XB 2BX4A 1V2QT 3A8BA 2RDLA 4O03A 4AZ2B 1TQ0B 1DWEH 3T2NA 1D3QB 1ZTJA 3PMHB 2ZG0H 2ZU2A 3F9GA 4JZDH 1BB0B 1FMGA 1W14U 2ZKSA 5GJ4B 1Y3YA 3LGIA 3ATKA 5EXLA 3U98H 2W3IA 1WYKA 1T8MA 1W0ZU 1WQVH 1TFXA 4FXGH 2EI8A 2WPHS 4UEHH 3P6ZB 5E0GA 4WH8A 3S9AA 5A0CA 1AU8A 1LVOA 4GAWA 1ZZZA 1GHAF 2R3YA 2ZC9H 3GY7A 4K60A 1QIXB 2KAIB 2PHBA 1G30B 1MKXH 1DICA 1D3DB 1QHRB 4KGAA 3ESTA 2ZFSA 2AEIH 4MPUA 3KGPA 1GI2A 4UE7H 4MVNA 5H4IB 1TALA 1YPHE 3A7YA 1GI4A 1P10A 1B7XB 2FM2A 3A8DA 5K0HA 1DOJA 2VIQA 2G4UA 1P9SA 1W7GH 1EJNA 5EODA 1NRSH 4AFQA 4NGAH 3SI4H 4A1XA 1ZTKA 2ILNA 3DT0H 5A2MH 2OTVA 1TNLA 2ZU3A 1P57B 2ESTE 2FODA 3KHVA 3PO1C 4ZH8A 4FU8A 3QGNB 1V2WT 4O97A 4IW4E 2PSXA 2C8WB 3KCGH 1O3HA 3T5FH 4ISLA 1FY3A 1HGTH 1BITA 2VH6A 1LTOA 4AGJA 3UNRA 2BHGA 1HAYB 3LGTA 1AUJA 1BMLA 1DX5M 1MUEB 1J9CH 1L0ZA 1BJUA 1BMMH 1MTNB 1TX8A 5SGAE 1C5SA 1SHYA 3MU5A 1K9OE 2GMTB 1O3MA 5L6NH 1SR5C 4O3UA 1ELGA 2ZQ1A 7LPRA 2B8OH 1BMAA 4IGDA 3LOXA 1MU6B 3QN7A 1UTKA 4Y71A 1HAXB 3SN8A 1BTWA 4X6OA 1K1IA 2OC7A 1PPBH 2ZWLH 5AVDA 6GCHG 1JXPA 1FIWA 1S84A 1NFYA 2FEQH 2PFEA 4ABDA 1LMWB 2YOLA 2OXSA 2EI7A 1SLVB 1ABJH 3ENSB 5ETXA 1O39A 3AAUA 4INLA 3RXVA 1C4Y2 3MH7A 4YM9A 4Y7AA 1EAUA 1Y3XA 1MD8A 3ZZ3A 3RXAA 5JDUB 1HAVA 3G01A 1DFPA 2I6SA 4WY3A 2ZTZA 3L6PA 4FUCA 3RXFA 3F9HA 1AWFH 2QXJA 3E0PB 4GCHF 3RXCA 3NKKA 3SNCA 1GDNA 1PPCE 4JMYA 1SGPE 2H2ZA 1SLXB 2IJOB 3SHCH 2VVVA 1UHBB 1BTHH 4RSPA 1GHWH 2C8ZB 4I8KA 4YO9A 3M5LA 4WF8A 5EU8A 3O8BA 3U8TH 2UUYA 2ZGXH 3K2UA 5C20A 4NFFA 1FUJA 4WJG2 4FUGA 1SC8U 2CF9H 1O3IA 1QB9A 1O5FH 1C5WB
chains in the Genus database with same CATH superfamily
1P01A 1H9LB 1ETTH 3ODDA 1O34A 1TYNA 1UMAH 2FS9A 2ZU1A 1EXFA 3STJA 3ZVEA 4ACAA 1HBTH 4XBBA 5CMXH 3PMJA 5EW1H 1ZPCA 3LT3A 5FCRA 4DJZB 4TT3D 5KEDA 1MKWH 4X1NU 1TNKA 1YCPM 3OU0A 5F6MA 4FUEA 3ZZAA 4THNH 2DE8A 2D26C 4FU7A 1IQNA 4X6MA 3SJIA 4X6PA 4J2YB 2FTLE 1AY6H 2ALVA 3H7OA 3RMMH 3TLOA 1GI9B 1JOUB 1VGCC 1C1QA 5E0HA 1P06A 2PLXA 2WUBA 2OCVB 5LPEA 3RLYH 2HGTH 1BIOA 1O0DH 5C1UA 2O9QA 2BLVA 1FIZA 4AOQA 1VGCB 5B6OA 2XRCA 1O36A 5T6DA 4Q2KA 1NM6A 1CSOE 2CF8H 4ABAA 4CRCA 3T27A 2LP6A 2JH5D 5I25A 1P05A 3TJNA 1O2UA 4UD9H 1GHVH 1Y5AT 4LZ1H 2QXIA 3D65E 1VZQH 2YNBA 1B5GH 1CE5A 2GDEH 2ZPQA 2GT8A 4AB8A 1E1QD 1FI8A 4WMFA 1TGSZ 2ODPA 3BG4C 3PTNA 2IJD1 2XTTB 1MTWA 5T6FA 2EY4C 1SLUB 1PPZA 2R0LA 2VIDA 2ODYB 1LHFH 1AMHA 2CN0H 1SBWA 1THPB 4ABHA 3M7UA 3SGQE 4TY6A 1TBRH 3MNBA 4UDWH 3TPIZ 1S0RA 3SU3A 1A3BH 1CA8B 2V3OH 3NRLA 3GY2A 1JWTA 3SZNA 1ZOMA 1YGCH 1CGJE 3M7TA 3ZVGA 3SV9A 5BPEA 3OFND 3S0NA 1Q3XA 4J1YA 1QY6A 2KCOA 1WDIA 3GCTG 1IHTH 2EC9H 3E3TA 2BDHA 1FJSA 1C5MD 3ZZBA 2F43B 3UWIA 2OC8A 5FCKA 3K9XB 4AYYB 1TA2A 1RJXB 1O3OA 1TX6A 2W7UA 4XDEA 4ZXXH 3V12A 4FUJA 2NU0E 3ATLA 5HIZA 5EQRA 3P70B 3H5CB 7GCHG 4CH8B 1F2SE 2BD7A 2BOKA 2WPLS 2JKHA 1N6XA 3EAJA 8GCHG 1O3DA 1K1PA 2FTMA 3GY4A 1A1RA 2V7QD 3F0OA 5IYTA 3PROA 5GNDA 3E8LA 3RXUA 4B73A 1ANCA 2P93A 1E79D 3GDSA 1O5BB 8KME2 3A80A 4CBNA 5FBIA 2H9HA 1FV9A 1TNGA 2ANMH 1PYTD 1EASA 1SI5H 3KYFA 1QL7A 1FN8A 1GJAB 4JZFH 4NA7A 2ZHWH 1AFQC 4BXSA 5GPIB 3EA9A 1RS0A 2AERH 1AWHB 3SJ9A 4E7NA 4Y10E 1GJ6A 1EPTA 4R8TB 4SGBE 3U9AH 1A0LA 3FN8A 4D8NA 1HDTH 3FOAA 2ZQ2A 4H4FA 1AZ8A 2FMJA 3ZVBA 2CJIA 1Y3VA 4I7YH 4D76A 1KDQA 1EJAA 1BJVA 5FPYA 2A32A 2VVCA 1YLCA 3L33A 2FZZA 2J38A 5EGMA 1C2IA 3U1IB 5EW2H 3KN2A 3LJJA 1KLTA 3MQKC 1AB9C 3PV5A 1UCYH 2UWLA 3QTVH 4ABGA 2ZTXA 2A7HA 4FUBA 2AGEX 1CHOG 4Q63A 3SUFA 1JMOH 1NBMD 1WTGH 2FPZA 1TE0A 1W10U 2TGTA 3SZEA 3FZZA 1EUFA 1Z8GA 4YOIA 1BTUA 3KQBA 2GJGA 2Y81A 3A7XA 2TGAA 2ZHDA 1GJ5H 4YT6H 4I8JA 1XX9A 1EQ9A 2OINA 2UUKB 1ESTA 1V2UT 2WPKS 1RTKA 2AS9A 2HALA 1GJDB 1NRNH 1S83A 1UK4A 5DP4A 1XVOA 1ZMNA 1ZRKA 3BSQA 1C4U2 2Y5GA 5CHAC 1AVGH 5LH8A 2AGIX 4JCNA 5DGJA 1VITF 1O3EA 4X1PU 3W1EA 1YCPK 3QDZB 3K65B 1GI7B 3RM2H 4BAMB 1SGDE 1EZUC 2ZCHP 1UO6A 1HCGA 3U1JB 2Y5FA 1AD8H 5CHAB 2BX3A 1G3CA 1OYTH 2R9PA 4TPYA 5FPTA 4YZUA 2TGPZ 2ANYA 4NSVA 4X2YA 1E34B 1QL9A 3A88A 3T29A 1H1BA 3RXPA 3DD2H 1LVYA 3STIA 2ULLA 2FOAA 1F0UA 4B2AA 2GD4B 1GDQA 1RIWB 3SQEE 3FP7E 4GHTA 1SGYE 1E36B 3RXTA 3C1KA 3OSYA 4H6TA 5AF9H 1J14A 2BD2A 2IN2A 6GCHF 1FXYA 1C2EA 2BVRH 4K1TA 5FPSA 1C5PA 2P8OB 4O3TA 2IPQX 4I8LA 3FZDA 3RXHA 5GIBA 5EXMA 4X8VH 1K0HA 1DY8A 2SNVA 1EAXA 1TBZH 1UVSH 3LH3A 2FS8A 5C5NA 1VR1H 2BZ6H 2QXHA 1UJ1A 1PFXC 1TB6H 1LO6A 2H9TH 3R3GB 1GG6B 3LGVA 4Q7XA 1C1RA 3B8JA 1NS3A 3ITIA 3A84A 3TJVA 3U28C 3M37A 1E37B 2VWNA 1P2QA 1O3PB 2A4OA 4K8BA 1T8OA 3RLWH 2DUCA 1B0EA 1LCYA 3KQCA 4XFQA 2R3UA 1GBEA 5TJXA 3PRBA 1EKBB 1TGNA 1NT1A 2A5IA 4E7RG 4WMEA 4UFEH 2CGAA 3M5MA 3VXEH 1BTXA 1VCPA 1K28D 1O3KA 3A89A 2JETB 3DFLA 1UTQA 1LDTT 2EQNA 1E0FD 3E91A 4K5ZA 4B6EA 1XM1A 5FAHA 1SMFE 3ZZ6A 1ZSKA 1TOMH 3F9FA 1C5OH 3R0FA 2F9NA 1JBUH 1DVAH 2G51A 2QF0A 2G55A 1WU1A 1BUIA 1O3AA 3UFAA 3PMBB 5JB9S 2GCHG 1YLDA 1W12U 3UY9A 1EB2A 1SGFA 1TWXB 3GYLB 4TY7A 3Q76A 3U8OH 4IN1A 5HKKD 3F2FA 1O31A 3A85A 1RGQA 2W3KA 2O8WA 2YNAA 2ZDVH 1V2KT 2F91A 2F9PA 1V2OT 5EJ1A 3A7WA 1C5YB 1KXBA 1SVPA 5A0AE 1C1WH 4YXWD 2BQ7B 1N6YA 2QXGA 5J4QA 1DSUA 1Z6EA 3OTPA 2FOGA 4ZROA 2H1UA 1GMDF 4OM9A 4YESB 2FXRA 2FP7B 2VIVA 3AK5A 1OWKA 3VEQB 1HNEE 2F4LA 4WH6A 5I46H 1AN1E 2ZA5A 3N7DA 1P02A 1IQLA 1TABE 3V0XA 3WWBA 2NU2E 2P3FH 1SFQB 3A8AA 1EAIA 1EP5A 3LU9B 3URCA 1AE8H 2QF5A 3QUMP 1CT4E 3ZV9A 3VB5A 4DURA 2Q6DA 4MNYA 3CS7A 2FOHA 1O2MA 3LGYA 2W6JD 1LHEH 1O2XA 2R2WU 2Y7XA 3BTME 4JYTA 3RU4T 3ZVDA 4ABEA 1Z8JB 3KIDU 1ESAA 2I6QA 4X8SH 3SNBA 1PQAA 3IITA 1HXEH 5GCHG 4DT4A 2Y5HA 1WOFA 4GPGA 1T8LA 1MQ5A 2SGQE 3Q3YA 1XUGA 1IOEA 3URDA 1DM4B 3ZV8A 3E0NB 1UTNA 1SQAA 1OWHA 3ELAH 1OPHB 2G5NA 3HATH 3ATWA 1UK3A 3P17H 3BEFB 3M61U 3GDVA 2FO9A 5HYOA 4IBLH 3SU6A 5A8YA 1GHBF 3MHWU 1ZPZA 1C1MA 1TMUH 4RKOB 5HMAA 5B6LA 4NCYA 1ZMJA 2FLRH 4BTUB 1WQSA 4GHQA 2J4IA 4Y0ZE 3RXIA 2BDYA 1DUEA 3MNSA 3EA8A 3HK6B 1P09A 2OLGA 1LHDH 1Q2WA 2RA3A 1CVWH 5EPNA 2WHXA 3PWBA 1QA0A 4CR9A 3GY8A 4IN2A 2PKAA 1Y3WA 1O2RA 1QBOA 3RXEA 3ZZ7A 2ANKH 1C9TA 1YPEH 1C1VH 1MTUA 1QTFA 2CHAB 4B6FA 1W0JD 2A4RA 7GCHF 3VG8A 1WUNH 4DVAU 2ZHFH 1NRQH 1MTNC 8GCHF 2O8UA 3ZYDA 6LPRA 2AHME 3CP7A 2GMTC 4JZIA 2A7JA 1TGBA 1E35B 3GICB 3VB7A 1TRMA 3QX5H 1DWDH 4Y79A 3MU0A 4BANB 3OAAD 4F4OC 1FY8E 1YPLH 4Y6DA 1PYTC 1TNIA 3MO9A 3O8DA 1ZPBA 5A8ZA 2BLQA 5DO4H 4VGCC 1BMNH 2ZDMA 3BTKE 2VWLA 4OGXA 4B2CA 2WV5A 3FANA 1GHXH 3NK8A 2B7DH 1OOKB 2HWLB 4BTIB 3AVZA 3NZIA 2W7SA 1GMCG 3LDXH 1O2YA 4NZLA 3FAOA 1KXCA 4AYVB 1C2MA 4VGCB 5L2ZH 2FYRA 4BAOB 3D62A 3RU4E 2OD3B 1Z8IB 3EE7A 2D1JA 1HB0B 2NWNA 1YF4A 2G81E 2XBVA 3M3SA 5CHBA 1AKSB 3OE7D 1ZSJA 4X8UH 4GLYA 1WBGB 4H42U 5FX6A 1C2FA 7ESTE 2BVSH 1ESBA 2W26A 5DP5A 1G37A 2JJ2D 3UR6A 4AG2A 2ZDLA 3SW2B 5A09A 1HAGE 3M5NA 1H9HE 1C5ZB 4OS7A 4ZKOU 1P8VC 2BLWA 3D49H 2FI4E 4ABIA 2VBCA 2ZPRA 1A46H 1GCTB 4X0WU 2NU4E 4ZXYH 1MCTA 4I32A 1MABB 4YOGA 4TPIZ 1BBRK 1SQOA 2A45B 2BY6X 2J5UA 2SGPE 3UWJH 3DSOA 2AYWA 4D9RA 1C2GA 1HUTH 4U01A 1C5LH 1Z1IA 2ZFTA 1C1TA 2D2DA 4P02A 1O3JA 3KYGA 1OX1A 1OKXA 1HLTH 1LHGH 3IWMA 3P8GA 1T4UH 2VIPA 3TGIE 1GMHF 4Z6AH 1C5QA 1PPFE 2KCAA 3A7VA 1GBDA 2KZ4A 4Q4LA 2OBOA 1HJAB 3MH6A 2ZFPH 5EJZA 2Z9KA 3ZZCA 3RXJA 4B71A 1FQ3A 3S7KB 3WY8A 2QA9E 1YP9A 1MZAA 4GVUA 1W2KH 3PLBA 1L2EA 2IPHA 1J15A 2Y82A 5TCCA 2TGDA 4NIWA 2G5VA 5GWZA 1TPOA 2KCPA 5ABWA 2LPRA 2XCNA 3PYHA 1GVKB 5JB8S 1C1NA 3JZ1B 2FOBA 3UR9A 1HPGA 2ZFFH 1GDUA 2ZU5A 3QTOH 5T3HA 1A2CH 2KCYA 4CRDA 1ARBA 2G8TA 3MNCA 3SQHE 2RFKC 1NESE 2ZGCA 3TGKE 2EEKA 3RUOA 3SU1A 2M2AA 2GV6A 1QJ7B 1TAWA 1O5AB 1V3XA 4LOYH 4CRGA 4U30A 3SU0A 3Q3KA 2A5AA 2Q1JA 1XUHA 3LJOA 3TU7H 4FOUC 4B1TA 1ZR0A 1DLEA 1C1SA 1HAOH 1Y8TA 2A7CA 1ANEA 5LGOA 2A31A 5FXLA 1TGCA 2FI5E 5PTPA 4WXIA 1MH0A 1K1NA 3BTQE 1CQQA 3A7ZA 4DCDA 3TVJB 3BTGE 1SPJA 3ATMA 4DIIH 5DSFA 2GZ8A 2XCFA 1EZQA 1BDAA 1QURH 3E16B 4XBCA 1SOZA 1EPTB 1S6FA 3UNSA 2C8XB 4KELA 2HNTE 3TH3H 4ZAEA 1HXFH 5HGGA 4DY7B 3UTUH 1O2JA 3SNEA 4ZKRU 1IQIA 2VNTA 5FL7D 1CGIE 1NY22 1W13U 1V6DA 2GCTB 1LVBA 4CHAC 1GWAA 3ZYEA 1Q31A 1LKAA 3UNQA 1T7CA 1SQRA 3DFJA 1BTZA 3MH5A 4OS1A 4P00A 1BBRE 1INCA 4YLUA 3UB0A 3MU1A 5EG4A 4CHAB 3F68H 1GI3A 4CRAA 3OY6U 3GCHC 1ZGVA 1AO5A 5C2ZA 4I33A 2XNDD 2ODQA 3PM3A 1F7ZA 1SGTA 3S9BA 5HIYA 1P11E 3MTYA 3VB3A 1EFRD 3Q3XA 2Z9GA 3GCHB 3DUXH 1DY9A 3P8FA 1SOTA 1AGJA 4A92A 3RMNH 5GXPA 5A8XA 1BTPA 1W0KD 3F2HA 1O3BA 1Z8RA 4LK4A 1P2NA 1UTOA 2STAE 3ZVCA 1QJ1B 3TNSA 1LVMA 2SGDE 2B9LA 1GL0E 2TPIZ 5E2PA 3VGCB 1G3EA 3QO6A 3W95A 5FHTA 2C3SA 1Y59T 3EQ0H 4MDSA 5GCHF 1UK2A 3H09A 1ELBA 2JJ1D 4YLQH 3RXLA 3HK3B 2F9VA 2O8MA 1WCZA 2UUJB 3T25A 1SHHB 3QK1A 1CO7E 3TITA 2BDBA 5LPRA 3A7TA 4ZHAA 3Q00A 5IDKA 5JBCS 1A5IA 1TIOA 3PV2A 2FX6A 1MBQA 2J98A 2QV1A 3RMLH 4ISIH 1Z1JA 1DDJA 3VPKA 2ZDAH 2JH0D 3PLPA 3UQOA 2R2MB 1D4PB 2ANWA 1SSXA 1DXWA 1KXDA 3HKJB 1O2VA 2SGEE 5AFYH 2F9BH 2BD9A 3TK6A 1KMHB 4IMQA 3UOUA 1BRCE 4FUIA 2ZCLP 2ZEBA 3I77A 1O2NA 1P04A 1AIXH 1ZHRA 3PRDA 1GVZA 2BDGA 1GL1A 1C1OA 2F9UA 2LELA 2BVXH 1ARCA 3IG6B 4AORA 1H8DH 1V2ST 2ALPA 3A8CA 3JZ2B 3DHKH 4X1QU 1RRKA 3DCLA 2Y7ZA 2BY8X 2XOKD 1DT2A 3HGPA 3TGJE 1HFDA 2QCYA 4XE4A 1W7XH 4D7FA 3FP6E 1G32B 4GCHG 1N1LA 4JK6A 4KTCA 1O2ZA 4HFPB 1RXPA 5BRRE 4ZHMU 2XWBI 1RIWC 3MO6A 4HGCA 1HRTH 2H5DA 1SGNE 5ESTE 4Y11E 1K21H 1T31A 3QGJA 5C0TA 5A0BA 2HLDD 3BV9B 2PUXB 3T28A 2YMSD 1BMFD 2ZU4A 3E6PH 2A0QB 2GZ7A 2P8OC 3D23A 1FZZA 1TNJA 1ELCA 2TBSA 4TSFD 2VJ1A 3SGBE 2BY5X 2STBE 1TONA 1H8IH 2XC4A 5HXFA 4R0IA 2BD4A 2OUAA 2QGRA 2FWWA 3BTFE 4YOJA 1GG6C 1H8ED 5K7RA 1HAHH 1NPMA 1EX3A 1TLDA 4NZQA 5E8EH 1C5UA 4IS5A 3SUDA 4Q7YA 2ZHEH 5ESBA 1A4WH 4FUDA 4MNXA 4UONA 1TX7A 1ID5H 1S81A 1ELFA 2SNWA 1O30A 4INKA 1D6WA 4BAHB 1GBIA 2FDAA 2XW9A 1L1GA 3A81A 2Q6GA 5JBBS 1YBWA 4FUHA 1YM0A 1UTJA 1C1UH 1P2JA 2JETC 1SGCA 3SHAH 1HAPH 1A61H 1J8AA 4A7IB 4RN6A 3LGWA 3RC5A 4FETA 5C1YA 5C1XA 1KXEA 1QFKH 3NXPA 3ZZDA 1ETSH 4NA8A 1FNIA 5EPYA 2CMYA 3M3TA 4OGYA 2XC0A 1CBWC 2XYAA 4MPVA 1P9UA 1GJBB 1WTHD 1L4ZA 4OS4A 4NSYA 1HJ8A 1UTMA 2KX4A 5EOKA 2UUFB 1ZJKA 3A86A 4ZHLU 1M9UA 4MG3A 3ZIAD 2FOCA 2FOEA 2PTCE 1BQYA 4WVPE 1BTYA 1CBWB 3KNXA 1QRXA 1YC0A 3E1XB 4HZHA 3AW0A 1NRRH 1ELAA 1YCPH 3SYJA 2WUCA 3GCNA 5HM9A 1AUTC 4OS6A 4TYDA 1YPKH 3PWCA 4AC9A 2J94A 1ANDA 3UAIC 4MNWA 1MKXK 3UREA 4JK5A 4BOHA 1DE7H 2Z3EA 5L30H 4AFSA 1C2JA 3LIWA 2PKAB 3MI4A 1FX0B 1SGFG 1YPJH 2AH4X 1O2OA 3AAVA 3BTDE 5EJLA 2A4GA 2BY9X 2BYAX 2ZECA 1IQGA 1UVUH 2OC1A 1HIAA 1P2IA 4RT1A 2VIOA 2RCEA 3SNDA 1EP6A 3BEIB 1SKYE 1EOJA 3TK5A 2VWOA 1V2PT 3U8RH 5KGOA 3P92A 4SGAE 4AGKA 3SJOA 3GDUA 3SV7A 2Z9JA 1V2TT 3OX7U 3RXQA 1NFUA 4K8YA 4NA9H 3KL6A 4X1SU 2WPMS 1CA0B 1OWJA 2OQ5A 1O3CA 4X8TH 8ESTE 3O8CA 4F55A 1AFEH 4NWLA 5EIYA 3SU5A 4AN7A 4ISNA 9LPRA 2VIWA 3SUGA 2H5CA 2H6MA 1TRYA 1XMNB 1EATA 4ZUHA 1DSTA 1LQEA 1NU9A 1FPHH 1DWBH 1YPMH 1XUKA 1AQ7A 2HPQH 1OP0A 2H9EH 1RTLA 1FY5A 4NFEA 2TRMA 1K1OA 3WWFA 4DT7B 4AFZA 1AVXA 3EDXB 2K0QA 1TOCB 1N8OB 1F0SA 1QA7A 4K69A 3HKIB 1XVMA 1HAZB 3I29A 2XBXA 3NPSA 1B0FA 1W0YH 3P8OA 5DPAA 1DS2E 3FP8E 3WW7A 4UFFH 2P3UB 1BRBE 2WPJS 4Y0YE 2BD5A 4M7GA 2C4FH 3F1SB 4U32A 3ZVFA 5DKMA 3S69A 2VU8E 1F5RA 1HAVB 1VCQA 1S6LA 2ZFRH 2A4QA 1V2VT 2NU3E 4A1TA 3GCTF 1BRAA 2CHAC 2TIOA 4LXBH 1JRSA 2ZTYA 3OEHD 4GSOA 2XNIA 1OWDA 3RXSA 1K1LA 3BIVH 3AASA 1C5NH 4WMDA 5DP6A 3HGNA 3GYMA 2SGAA 3PMAB 3FFGA 5DP7A 3EA7A 1O5EH 3KQEA 5JYIA 1PPHE 1C5RA 1O3NA 2R0KA 3K6YA 3V13A 1QB1A 3ZZ9A 1DXPA 2K1QA 2GDDA 3PV4A 1C9PA 3O8RA 3SO3A 4B2BA 3VFEA 4IMZA 1ELDE 2QN5T 2D8WA 1ZMLA 3RU4D 2WV9A 2BQWB 3RXBA 2PWXA 1P0SH 4DW2U 3M36A 4AX9H 1ELTA 1SB1H 1AHTH 1S82A 3MWIU 1O37A 1RD3B 4X2WA 3RXOA 1QBNA 3BEUA 2J2UA 1EOLA 3GOVB 1QB6A 3GS9A 3CNRA 4K3JA 1P2OA 3KF2A 1BHXB 2B0FA 1VITG 2P94A 2ZDNA 2KFWA 4Y76A 2FOMB 2Z3DA 3Q77A 1GI1A 3PO1B 1C2DA 1DUAA 1XUFA 5HM2A 1ABIH 2BM2A 2W5EA 4Y8YA 1TA6A 3BF6H 1A0HB 1AE5A 1AVWA 2AMPA 1FPCH 2BY7X 1D9IA 2AMQA 4I31A 4UFGH 2ASUB 3LC5A 1MKWK 3F6UH 2OK5A 2Y80A 3LKWA 2FOFA 5TCAA 3OY5U 4JZEH 3ATIA 2EA3A 3FO8D 1FN6A 3EYDA 4JZ1A 1ZHPA 2HPPH 1V2MT 2G52A 3ZZ5A 1K1MA 3W94A 2ZHQH 1GCTC 1ZHMA 1O2QA 3SORA 1RFNA 1O2TA 1ZYOA 4A5TS 2NU1E 3F9EA 1CHOF 3OEED 2VH0A 3LONA 3M5OA 3MNXA 2V35A 3LGUA 3MOCA 2ZFQH 1PPGE 2A5KA 2Z6BD 2ZNKH 1UVOA 2RA0A 1L4DA 1NO9H 5CE1A 2AIQA 2ZIQH 1XUJA 2XWAA 1A5HA 1CU1A 1ZGIA 3NUMA 3OTJE 1QRZA 3MU4A 2KAIA 1D3TB 1GBLA 1KTTB 2VINA 5FX5A 4INHA 1IQEA 2GZ9A 1CT0E 4ASHA 1NC6A 4NWKA 1ZRBA 3P95A 5C94A 1DANH 1O2LA 1KXFA 1NN6A 3EGKH 4WWYA 2JIZD 2WZQA 1GBKA 4BXWA 2PSYA 4IC6A 1HJAC 3K6ZA 1COWD 2F3CE 3RDZA 1QBVH 2ZCKP 4Q80A 3RP2A 1SQTA 1JIMA 3RM0H 1TMTH 4KTSA 1GBAA 1S0QA 3F2GA 2Z9IA 1MMJN 2QAAA 1QNJA 1P3CA 2AFQB 1OP2A 1P2KA 2RDEA 2GGVB 1SGQE 2Q6FA 1CGHA 2BXTH 4Y8ZA 1ZTLA 3V7TA 5C3NA 3QLPH 1GCDA 2CXVA 4MLFB 2WSSD 3RC6A 4PROA 1SG8B 1GBCA 1NZQH 1L1NA 1FONA 1MCVA 4NG9H 3M7QA 2GV7A 4MNVA 1K1JA 1WSSH 1ACBE 5F8XA 2YMSB 1SGIB 4HG6A 3EE0B 1EJMA 1MTSA 2AIPA 2PV9B 3C27B 3N7OA 1XKBC 4U2WA 3RMOH 5G4BA 3SBKA 4ABBA 1Y5UT 3SI3H 3QZQA 4ISOA 4BTTB 3SOSA 1KTSB 2QC2A 4CH2B 2ZF0H 5DJ7A 1S85A 1UTPA 3BIUH 4X6NA 1GBHA 6CHAC 1F0RA 1FLEE 1MD7A 1O2SA 3BTWE 1VITH 1K22H 1EB1H 1GMDG 3MMGA 3B23B 1PQ7A 2Z94A 4K1EA 2Z7FE 2V0BA 1FDPA 2BD3A 2PKSC 5E2OA 3CS0A 1MQ6A 6CHAB 1W8BH 2THFB 1KXAA 2P3TB 1PQ8A 2BXUH 3ZZ8A 1EPTC 5JPMH 2ZPSA 4HI3A 2PW8H 4ZKNU 1AKSA 1AZZA 3VXFH 2KR7A 2Z3CA 1T8NA 1NRPH 3PLKA 1EAWA 4CRFA 4AB9A 1HJ9A 1RTFB 3SJKA 4CRBA 4BAQB 2PKSB 2C93B 3UUZA 1V2RT 3OYPA 2GCTC 1L1JA 3HPTB 1TRNA 3I78A 3GY6A 4BAKB 1GHZA 1BZXE 1MAXA 3BTEE 4JYVH 4O9VA 5F53A 3ZVAA 2B5TB 1SLWB 4H6SB 4DG4A 1GPZA 4YTAA 1KDQB 1BBRH 1T32A 3UPEA 5AHGH 2BD8A 1IAUA 1GI5A 2PR3A 2G4TA 4CREA 4MQAA 5C5OA 3M35A 2GX4A 1QR3E 1PPEE 2BOHB 4A6LA 4F48B 1V2JT 2J98B 3LH1A 2GCHF 5GDSH 3E90B 2HLCA 2F83A 1UHBA 2DE9A 1SGRE 4RKJB 1ZJDA 1NU7B 3U69H 1YYY1 2KM0A 1O3GA 1QQUA 1C2LA 3LC3A 1V2NT 3F3BA 4OS2A 1F5LA 1U6QA 2QY0B 3NCLA 1QZ8A 4MTBA 1EZXC 1UCYK 4I8GA 2CK3D 3RXGA 4B75A 1GHBG 3ODFA 1F92A 5E0JA 3BG4B 1GHAG 1G2MA 1F5KU 4Z0KA 2XXLA 3PTBA 3TNTA 2UWPA 3B9FH 4I86A 1T4VH 4XOJA 1MTVA 5L2YH 3A87A 2Z9LA 1H9IE 1O2PA 2HOBA 4X2VA 3VGCC 1OYQA 1BA8B 1MZDA 1FAXA 4XBDA 1GVLA 4XD7D 3SGAE 1IQKA 1G3BA 1O38A 4NIVA 5T1VA 1A0JA 1EZSC 1HAIH 3ZZ4A 3N7EA 3SV6A 2WPIS 1NFXA 1C5VA 3GY3A 5LPFA 2EI6A 3AW1A 5F8TA 1QL8A 5JBAS 2O8TA 3RXKA 1O5GH 3SNAA 5F03A 1Y3UA 4HTCH 1C4V2 1S6HA 1YPHC 1LKBA 4TWWA 2O8LA 1BOQA 3SU2A 3BN9A 1J17T 1LPKB 2J9NA 3L3TA 2VB0A 1PJPA 2PTNA 2V3HH 3MO3A 1KY9A 2VGCC 4B76A 3KEEA 4YT7H 5AFZH 1O5DH 2GKVE 1TQ7B 2VWMA 2SFAA 3P8NA 1E38B 1OSSA 1ELEE 4X1RU 8LPRA 4B74A 1UTLM 4A1VA 5DP8A 2WYGA 1O35A 3TH4H 1OS8A 2RG3A 4ABFA 2V6NA 2VGCB 2L6OA 2QYIA 1GGDC 1C2KA 3QZRA 2P59A 1TMBH 2SGFE 1JIRA 1QRWA 3V3MA 1X7AC 1IQHA 3T26A 2OC0A 4NIYA 2OQUA 4K2YA 3DSGA 1A5GH 1C5TA 1G2LA 2JH6D 1AFQB 4E05H 5J4SA 5EXNA 1FY1A 1QQ4A 4ESTE 1HYLA 1GI6A 1OWIA 1GGDB 5EQQA 3MYWA 3SUEA 1NFWA 1GHYH 5DN6D 3SU4A 4DOQA 1SFIA 1VJ9U 1GI0A 2AMDA 2C8YB 2BDAA 1J16A 4D7GA 3S7HB 5F8ZA 3VB4A 3FVFB 2PUQH 1GBTA 1UVTH 2WV4A 4I8HA 4WXVA 3SJ8A 1IHSH 4FVBA 4KP0A 1UVPA 6ESTA 1AB9B 1JRTA 1TGTA 1O2WA 2PGQB 4KKDA 4LZ4B 1AI8H 2ZZUH 1GJ8B 2ZO3H 5KECA 3GISB 2FIRH 1UCYE 1P2MA 1BCUH 3PB1E 1LPZB 4K1SA 4GUXA 2BZAA 1GBMA 4XRNA 4NIXA 2BDIA 1MAYA 3M3VA 3BTHE 4FU9A 3S9CA 4Z1MD 1VCWA 2CV3A 2K8IA 1GI8B 5JBTA 1O32A 1OP8A 2A2XH 4CR5A 1V2LT 1GMHG 1NBME 1P03A 3GCOA 1THSH 4XSKU 2BQ6B 2J95A 1GMCF 2BLOA 2HNTF 1LQDB 1O33A 1W11U 1D6RA 1IQMA 3RC4A 2J34A 1BRUP 1DITH 3T62A 3MFJA 1YPGH 1CHGA 1S5SA 3KQDA 2ZGHA 4FUFA 3SV2H 3BTTE 1O3LA 3QWCH 1ORFA 3RXMA 1HIAB 2ZGBH 1KIGH 3TK9A 4JYUH 2OBQA 1KSNA 4BNRA 2BMGB 3VB6A 1ETRH 2ZDKA 5EQSA 2J92A 4CBOA 3NWUA 5DG6A 4OS5A 3MU8A 2XBYA 1KLIH 3N99A 1SGEE 3KQ5A 4TWYA 3RXRA 4KTUA 2WYJA 4MPXA 2FX4A 1PQ5A 3RXDA 1GJ4H 1XXDA 1P3EA 2A2QH 1GBJA 3UOPA 1C2HA 1TNHA 3F0PA 4DGJA 2ZI2H 1Z71A 5DP3A 2FLBH 4IC5A 3DA9B 1Z6JH 1LHCH 4E06H 4AG1A 1NTPA 1DLKB 1ELVA 4ZKSU 4F49A 4ISHH 2GP9B 1GJ9B 1NROH 2HVXA 1A3EH 3CENA 1Z7KA 7KMEH 2W6ID 1FAKH 2C90B 1VJAU 1GBBA 3MH4A 3UQVA 1DWCH 1MBMA 1QCPA 5DK1A 1G36A 3UIRA 4D9QA 1C1PA 1G3DA 2G00A 1CT2E 1O2GH 1OHHD 1F0TA 1YLNA 3H7TA 2GTBA 2A1DB 2BB4A 2J97A 2WINI 1XUIA 1IQFA 1TPPA 1TBQH 4ZMAH 1XXFA 4DIHH 1OWEA 2QF4A 1O3FA 3BG8A 3A82A 1KYNA 2Y6TA 1W3CA 3TIUA 5C67A 1IQJA 4Y7BA 1SL3A 1UW7A 1WV7H 4M9FA 4UFDH 2FI3E 1LPGB 2XBWA 2BTCE 1P12E 3TJUA 5DP9A 2GVFA 4Y8XA 1D3PB 1GBFA 1QGFA 1O5CB 2UWOA 1ZLRA 1ANBA 1O2KA 1A7SA 1OXGA 2BDCA 1ZSLA 2LNCA 1HV7A 1BHXF 3GY5A 1XKAC 2HNTC 5T6GA 3TH2H 1CA0C 4X2XA 3LPRA 2P16A 1Y5BT 2F9OA 1O2HA 2QIQA 1QJ6B 4Q7ZA 2IOTA 5IK2D 1TPSA 2QF3A 2FESH 4RT0A 4FVDA 1YY3A 4ABJA 2GT7A 2XC5A 1BT7A 1MU8B 1TPAE 9ESTA 2P95A 4AFUA 1KLJH 5C17A 1K2I1 2VVUA 5FBEA 2FYQA 1GJ7B 3A83A 4QT8C 1G9IE 1WAYB 1FY4A 2AGGX 1N8OC 3SV8A 2HVYB 1H4WA 1DPOA 1O2IA 1THRH 2OP9A 1YKTA 1VKYA 2ZGJA 4MPWA 2PGBB 2HRVA 3TJOA 1GJCB 2M5TA 2ZP0H 1C5XB 2BX4A 1V2QT 2WPDD 3A8BA 2RDLA 4O03A 4AZ2B 1TQ0B 1DWEH 3T2NA 1D3QB 1ZTJA 3PMHB 2ZG0H 2ZU2A 1WXRA 3F9GA 4JZDH 1BB0B 1FMGA 1W14U 2ZKSA 5GJ4B 1Y3YA 3LGIA 3ATKA 5EXLA 3U98H 2W3IA 1WYKA 1T8MA 1W0ZU 1WQVH 2V3MA 1TFXA 4FXGH 2EI8A 2WPHS 4RI0A 4UEHH 3P6ZB 5E0GA 4ZCNA 4WH8A 3S9AA 5A0CA 1AU8A 1LVOA 4GAWA 1ZZZA 1GHAF 2R3YA 2ZC9H 3GY7A 4K60A 1QIXB 2KAIB 2PHBA 1G30B 1MKXH 1DICA 1D3DB 1QHRB 4KGAA 3ESTA 2JDID 2ZFSA 2AEIH 4MPUA 3KGPA 1GI2A 2L74A 4UE7H 4MVNA 5CDFE 5H4IB 1TALA 1YPHE 3A7YA 1GI4A 1P10A 1B7XB 2FM2A 3A8DA 5K0HA 1DOJA 2VIQA 2G4UA 1P9SA 1W7GH 1EJNA 5EODA 1NRSH 4AFQA 4NGAH 3SI4H 4A1XA 1ZTKA 2ILNA 3DT0H 5A2MH 1TNLA 2OTVA 2ZU3A 1P57B 2ESTE 2FODA 2QE7D 3KHVA 3PO1C 4ZH8A 4FU8A 3QGNB 1V2WT 5C0UA 4O97A 4IW4E 2PSXA 2C8WB 3KCGH 1O3HA 3T5FH 4ISLA 1FY3A 1HGTH 1BITA 2VH6A 1LTOA 4AGJA 3UNRA 2BHGA 1HAYB 3LGTA 1AUJA 3FKSD 1BMLA 1DX5M 1MUEB 1J9CH 1L0ZA 1BJUA 1BMMH 1MTNB 1TX8A 5SGAE 1C5SA 1SHYA 3MU5A 1K9OE 2GMTB 1O3MA 5L6NH 1SR5C 4O3UA 1ELGA 2ZQ1A 7LPRA 2B8OH 1BMAA 4IGDA 3LOXA 1MU6B 3QN7A 1UTKA 4Y71A 1HAXB 3SN8A 1BTWA 4X6OA 1K1IA 2OC7A 1PPBH 2ZWLH 5AVDA 6GCHG 1JXPA 1FIWA 1S84A 1NFYA 2FEQH 2PFEA 4ABDA 1LMWB 2YOLA 2OXSA 2EI7A 1SLVB 1ABJH 3ENSB 5ETXA 4ACBA 1O39A 2PP6A 3AAUA 4INLA 3RXVA 1C4Y2 3MH7A 4YM9A 4Y7AA 1EAUA 1Y3XA 1YWUA 1MD8A 3ZZ3A 3RXAA 5JDUB 1HAVA 3G01A 1DFPA 2I6SA 4WY3A 1E1RD 2ZTZA 3L6PA 4FUCA 3RXFA 3F9HA 1AWFH 3DSPA 2QXJA 3E0PB 4GCHF 3RXCA 3NKKA 3SNCA 1GDNA 1PPCE 4JMYA 1SGPE 2H2ZA 1SLXB 1H8HD 2IJOB 2VVVA 3SHCH 1UHBB 1BTHH 4RSPA 1GHWH 2C8ZB 4I8KA 4YO9A 3M5LA 4WF8A 2YMSC 5EU8A 3O8BA 3U8TH 2UUYA 2ZGXH 3K2UA 5C20A 4NFFA 1FUJA 4WJG2 4ASUD 4FUGA 1SC8U 2CF9H 1O3IA 1QB9A 1O5FH 1C5WB
chains in the Genus database with same CATH topology
1P01A 1H9LB 1ETTH 3ODDA 1O34A 1TYNA 1UMAH 2FS9A 2ZU1A 1EXFA 3STJA 3ZVEA 1HBTH 4XBBA 5CMXH 3PMJA 5EW1H 1ZPCA 3LT3A 5FCRA 4DJZB 1MKWH 4X1NU 1TNKA 1YCPM 3OU0A 5F6MA 4FUEA 3ZZAA 4THNH 2DE8A 2D26C 4FU7A 1IQNA 4X6MA 3SJIA 4X6PA 4J2YB 2FTLE 1AY6H 2ALVA 3H7OA 3RMMH 3TLOA 1GI9B 1JOUB 1VGCC 1C1QA 5E0HA 1P06A 2PLXA 2WUBA 2OCVB 5LPEA 3RLYH 2HGTH 1BIOA 1O0DH 5C1UA 2O9QA 2BLVA 1FIZA 4AOQA 1VGCB 5B6OA 2XRCA 1O36A 5T6DA 4Q2KA 1NM6A 1CSOE 2CF8H 4ABAA 4CRCA 3T27A 5I25A 2JH5D 1P05A 3TJNA 1O2UA 4UD9H 1GHVH 1Y5AT 4LZ1H 2QXIA 3D65E 1VZQH 2YNBA 1B5GH 1CE5A 2GDEH 2ZPQA 2GT8A 4AB8A 1FI8A 4WMFA 1TGSZ 2ODPA 3BG4C 3PTNA 2XTTB 1MTWA 5T6FA 1SLUB 1PPZA 2R0LA 2VIDA 2ODYB 1LHFH 1AMHA 2CN0H 1SBWA 1THPB 4ABHA 3M7UA 3SGQE 4TY6A 1TBRH 3MNBA 4UDWH 3TPIZ 1S0RA 3SU3A 1A3BH 1CA8B 2V3OH 3GY2A 1JWTA 3SZNA 1ZOMA 1YGCH 1CGJE 3M7TA 3ZVGA 3SV9A 5BPEA 3S0NA 1Q3XA 4J1YA 1QY6A 3GCTG 1IHTH 2EC9H 3E3TA 2BDHA 1FJSA 1C5MD 3ZZBA 3UWIA 2OC8A 5FCKA 3K9XB 4AYYB 1TA2A 1RJXB 1O3OA 1TX6A 2W7UA 4XDEA 4ZXXH 3V12A 4FUJA 2NU0E 3ATLA 5EQRA 3P70B 3H5CB 7GCHG 4CH8B 1F2SE 2BD7A 2BOKA 2WPLS 2JKHA 1N6XA 3EAJA 8GCHG 1O3DA 1K1PA 2FTMA 3GY4A 1A1RA 5IYTA 3PROA 3E8LA 3RXUA 4B73A 1ANCA 2P93A 3GDSA 1O5BB 8KME2 3A80A 4CBNA 5FBIA 2H9HA 1FV9A 1TNGA 2ANMH 1PYTD 1EASA 1SI5H 1QL7A 1FN8A 1GJAB 4JZFH 4NA7A 2ZHWH 1AFQC 4BXSA 5GPIB 3EA9A 1RS0A 2AERH 1AWHB 3SJ9A 4E7NA 4Y10E 1GJ6A 1EPTA 4R8TB 4SGBE 3U9AH 1A0LA 4D8NA 1HDTH 4H4FA 2ZQ2A 4I7YH 1AZ8A 2FMJA 3ZVBA 2CJIA 1Y3VA 4D76A 1KDQA 1EJAA 1BJVA 5FPYA 2A32A 2VVCA 1YLCA 3L33A 2FZZA 2J38A 5EGMA 1C2IA 3U1IB 5EW2H 3KN2A 3LJJA 1KLTA 1AB9C 1UCYH 2UWLA 3QTVH 4ABGA 2ZTXA 2A7HA 4FUBA 2AGEX 1CHOG 3SUFA 1JMOH 1WTGH 2FPZA 1TE0A 1W10U 2TGTA 3FZZA 1EUFA 1Z8GA 4YOIA 1BTUA 3KQBA 2Y81A 3A7XA 2TGAA 2ZHDA 1GJ5H 4YT6H 4I8JA 1XX9A 1EQ9A 2OINA 2UUKB 1ESTA 1V2UT 2WPKS 1RTKA 2AS9A 2HALA 1GJDB 1NRNH 1S83A 1UK4A 5DP4A 1XVOA 1ZMNA 1ZRKA 3BSQA 1C4U2 2Y5GA 5CHAC 1AVGH 5LH8A 2AGIX 4JCNA 5DGJA 1VITF 1O3EA 4X1PU 1YCPK 3QDZB 3K65B 1GI7B 3RM2H 4BAMB 1SGDE 1EZUC 2ZCHP 1UO6A 1HCGA 3U1JB 2Y5FA 1AD8H 5CHAB 2BX3A 1G3CA 1OYTH 2R9PA 4TPYA 5FPTA 4YZUA 2TGPZ 2ANYA 4NSVA 4X2YA 1E34B 1QL9A 3A88A 3T29A 1H1BA 3RXPA 3DD2H 1LVYA 3STIA 2ULLA 2FOAA 1F0UA 4B2AA 2GD4B 1GDQA 1RIWB 3SQEE 3FP7E 4GHTA 1SGYE 1E36B 3RXTA 3C1KA 3OSYA 4H6TA 5AF9H 1J14A 2BD2A 2IN2A 6GCHF 1FXYA 1C2EA 2BVRH 4K1TA 5FPSA 1C5PA 2P8OB 4O3TA 4I8LA 3FZDA 3RXHA 5GIBA 5EXMA 4X8VH 1DY8A 2SNVA 1EAXA 1TBZH 1UVSH 3LH3A 2FS8A 5C5NA 1VR1H 2BZ6H 2QXHA 1UJ1A 1PFXC 1TB6H 1LO6A 2H9TH 3R3GB 1GG6B 3LGVA 4Q7XA 1C1RA 3B8JA 1NS3A 3ITIA 3A84A 3TJVA 3M37A 1E37B 2VWNA 1P2QA 1O3PB 2A4OA 4K8BA 1T8OA 3RLWH 2DUCA 1B0EA 1LCYA 3KQCA 4XFQA 2R3UA 1GBEA 5TJXA 1EKBB 1TGNA 1NT1A 2A5IA 4E7RG 4WMEA 4UFEH 2CGAA 3M5MA 3VXEH 1BTXA 1VCPA 1K28D 1O3KA 3A89A 2JETB 3DFLA 1UTQA 1LDTT 1E0FD 3E91A 4K5ZA 1XM1A 5FAHA 1SMFE 3ZZ6A 1ZSKA 1TOMH 3F9FA 1C5OH 3R0FA 2F9NA 1JBUH 1DVAH 2G51A 2QF0A 2G55A 1WU1A 1BUIA 1O3AA 3UFAA 3PMBB 5JB9S 2GCHG 1YLDA 1W12U 3UY9A 1EB2A 1SGFA 1TWXB 3GYLB 4TY7A 3Q76A 3U8OH 4IN1A 1O31A 3A85A 1RGQA 2W3KA 2O8WA 2YNAA 2ZDVH 1V2KT 2F91A 2F9PA 1V2OT 3A7WA 1C5YB 1KXBA 1SVPA 5A0AE 1C1WH 2BQ7B 1N6YA 2QXGA 5J4QA 1DSUA 1Z6EA 2FOGA 4ZROA 2H1UA 1GMDF 4YESB 2FXRA 2FP7B 2VIVA 1OWKA 3VEQB 1HNEE 4WH6A 5I46H 1AN1E 2ZA5A 1P02A 1IQLA 1TABE 3V0XA 2NU2E 2P3FH 1SFQB 3A8AA 1EAIA 1EP5A 3LU9B 3URCA 1AE8H 3QUMP 1CT4E 3ZV9A 3VB5A 4DURA 2Q6DA 4MNYA 3CS7A 2FOHA 1O2MA 3LGYA 1LHEH 1O2XA 2R2WU 2Y7XA 3BTME 4JYTA 3RU4T 3ZVDA 4ABEA 1Z8JB 3KIDU 1ESAA 2I6QA 4X8SH 3SNBA 1PQAA 3IITA 1HXEH 5GCHG 2Y5HA 1WOFA 4GPGA 1T8LA 1MQ5A 2SGQE 3Q3YA 1XUGA 1IOEA 3URDA 1DM4B 3ZV8A 3E0NB 1UTNA 1SQAA 1OWHA 3ELAH 1OPHB 2G5NA 3HATH 3ATWA 1UK3A 3P17H 3BEFB 3M61U 3GDVA 2FO9A 5HYOA 4IBLH 3SU6A 5A8YA 1GHBF 3MHWU 1ZPZA 1C1MA 1TMUH 4RKOB 5HMAA 4NCYA 1ZMJA 2FLRH 4BTUB 1WQSA 4GHQA 2J4IA 4Y0ZE 3RXIA 2BDYA 1DUEA 3MNSA 3EA8A 3HK6B 1P09A 2OLGA 1LHDH 1Q2WA 2RA3A 1CVWH 5EPNA 3PWBA 1QA0A 4CR9A 3GY8A 4IN2A 2PKAA 1Y3WA 1O2RA 1QBOA 3RXEA 3ZZ7A 2ANKH 1C9TA 1YPEH 1C1VH 1MTUA 1QTFA 2CHAB 2A4RA 7GCHF 1WUNH 4DVAU 2ZHFH 1NRQH 1MTNC 8GCHF 2O8UA 3ZYDA 6LPRA 3CP7A 2GMTC 4JZIA 2A7JA 1TGBA 1E35B 3GICB 3VB7A 1TRMA 3QX5H 1DWDH 4Y79A 3MU0A 4BANB 4F4OC 1FY8E 1YPLH 4Y6DA 1PYTC 1TNIA 3MO9A 3O8DA 1ZPBA 5A8ZA 2BLQA 5DO4H 4VGCC 1BMNH 2ZDMA 3BTKE 2VWLA 4OGXA 4B2CA 2WV5A 3FANA 1GHXH 3NK8A 2B7DH 1OOKB 2HWLB 4BTIB 3AVZA 3NZIA 2W7SA 1GMCG 3LDXH 1O2YA 4NZLA 3FAOA 1KXCA 4AYVB 1C2MA 4VGCB 5L2ZH 2FYRA 4BAOB 3D62A 3RU4E 2OD3B 1Z8IB 2D1JA 1HB0B 2NWNA 1YF4A 2G81E 2XBVA 3M3SA 1AKSB 1ZSJA 4X8UH 4GLYA 1WBGB 4H42U 5FX6A 1C2FA 7ESTE 2BVSH 1ESBA 2W26A 5DP5A 1G37A 3UR6A 4AG2A 2ZDLA 3SW2B 5A09A 1HAGE 3M5NA 1H9HE 1C5ZB 4OS7A 4ZKOU 1P8VC 2BLWA 3D49H 2FI4E 4ABIA 2ZPRA 1A46H 1GCTB 4X0WU 2NU4E 4ZXYH 1MCTA 4I32A 4YOGA 4TPIZ 1BBRK 1SQOA 2A45B 2BY6X 2SGPE 3UWJH 2AYWA 4D9RA 1C2GA 1HUTH 4U01A 1C5LH 1Z1IA 2ZFTA 1C1TA 2D2DA 1O3JA 1OX1A 1OKXA 1HLTH 1LHGH 3IWMA 3P8GA 1T4UH 2VIPA 3TGIE 1GMHF 4Z6AH 1C5QA 1PPFE 3A7VA 1GBDA 2OBOA 1HJAB 3MH6A 2ZFPH 2Z9KA 3ZZCA 3RXJA 4B71A 1FQ3A 3S7KB 3WY8A 2QA9E 1YP9A 1MZAA 4GVUA 1W2KH 3PLBA 1L2EA 2IPHA 1J15A 2Y82A 5TCCA 2TGDA 4NIWA 2G5VA 5GWZA 1TPOA 5ABWA 2LPRA 2XCNA 3PYHA 1GVKB 5JB8S 1C1NA 3JZ1B 2FOBA 3UR9A 1HPGA 2ZFFH 1GDUA 2ZU5A 3QTOH 5T3HA 1A2CH 4CRDA 1ARBA 2G8TA 3MNCA 3SQHE 1NESE 2ZGCA 3TGKE 2EEKA 3RUOA 3SU1A 2GV6A 1QJ7B 1TAWA 1O5AB 1V3XA 4LOYH 4CRGA 4U30A 3SU0A 3Q3KA 2A5AA 2Q1JA 1XUHA 3LJOA 3TU7H 4B1TA 1ZR0A 1DLEA 1C1SA 1HAOH 1Y8TA 2A7CA 1ANEA 5LGOA 2A31A 5FXLA 1TGCA 2FI5E 5PTPA 4WXIA 1MH0A 1K1NA 3BTQE 1CQQA 3A7ZA 4DCDA 3TVJB 3BTGE 1SPJA 3ATMA 4DIIH 2GZ8A 2XCFA 1EZQA 1BDAA 1QURH 3E16B 4XBCA 1SOZA 1EPTB 1S6FA 3UNSA 2C8XB 4KELA 2HNTE 3TH3H 4ZAEA 1HXFH 5HGGA 4DY7B 3UTUH 1O2JA 3SNEA 4ZKRU 1IQIA 2VNTA 1CGIE 1NY22 1W13U 1V6DA 2GCTB 1LVBA 4CHAC 1GWAA 3ZYEA 1Q31A 1LKAA 3UNQA 1T7CA 3DFJA 1BTZA 3MH5A 4OS1A 1BBRE 1INCA 4YLUA 3MU1A 5EG4A 4CHAB 3F68H 1GI3A 4CRAA 3OY6U 3GCHC 1ZGVA 1AO5A 5C2ZA 4I33A 2ODQA 3PM3A 1F7ZA 1SGTA 3S9BA 1P11E 3MTYA 3VB3A 3Q3XA 2Z9GA 3GCHB 3DUXH 1DY9A 3P8FA 1SOTA 1AGJA 4A92A 3RMNH 5GXPA 5A8XA 1BTPA 1O3BA 1Z8RA 4LK4A 1P2NA 1UTOA 2STAE 3ZVCA 1QJ1B 3TNSA 1LVMA 2SGDE 2B9LA 1GL0E 2TPIZ 5E2PA 3VGCB 1G3EA 3QO6A 3W95A 5FHTA 2C3SA 1Y59T 3EQ0H 4MDSA 5GCHF 1UK2A 1ELBA 4YLQH 3RXLA 3HK3B 2F9VA 2O8MA 1WCZA 2UUJB 3T25A 1SHHB 3QK1A 1CO7E 3TITA 2BDBA 5LPRA 3A7TA 4ZHAA 3Q00A 5IDKA 5JBCS 1A5IA 1TIOA 2FX6A 1MBQA 2QV1A 3RMLH 4ISIH 1Z1JA 1DDJA 3VPKA 2ZDAH 2JH0D 3PLPA 3UQOA 2R2MB 1D4PB 2ANWA 1SSXA 1DXWA 1KXDA 3HKJB 1O2VA 2SGEE 5AFYH 2F9BH 2BD9A 3TK6A 4IMQA 3UOUA 1BRCE 4FUIA 2ZCLP 2ZEBA 3I77A 1O2NA 1P04A 1AIXH 1ZHRA 1GVZA 2BDGA 1GL1A 1C1OA 2F9UA 2BVXH 1ARCA 3IG6B 4AORA 1H8DH 1V2ST 2ALPA 3A8CA 3JZ2B 3DHKH 4X1QU 1RRKA 2Y7ZA 2BY8X 1DT2A 3HGPA 3TGJE 1HFDA 2QCYA 4XE4A 1W7XH 4D7FA 3FP6E 1G32B 4GCHG 1N1LA 4JK6A 4KTCA 1O2ZA 4HFPB 1RXPA 5BRRE 4ZHMU 2XWBI 1RIWC 3MO6A 4HGCA 1HRTH 2H5DA 1SGNE 5ESTE 4Y11E 1K21H 1T31A 3QGJA 5A0BA 3BV9B 2PUXB 3T28A 2ZU4A 3E6PH 2A0QB 2GZ7A 2P8OC 3D23A 1FZZA 1TNJA 1ELCA 2TBSA 2VJ1A 3SGBE 2BY5X 2STBE 1TONA 1H8IH 2XC4A 5HXFA 4R0IA 2BD4A 2OUAA 2QGRA 2FWWA 3BTFE 4YOJA 1GG6C 5K7RA 1HAHH 1NPMA 1EX3A 1TLDA 4NZQA 5E8EH 1C5UA 4IS5A 3SUDA 4Q7YA 2ZHEH 5ESBA 1A4WH 4FUDA 4MNXA 4UONA 1TX7A 1ID5H 1S81A 1ELFA 2SNWA 1O30A 4INKA 1D6WA 4BAHB 1GBIA 2FDAA 2XW9A 1L1GA 3A81A 2Q6GA 5JBBS 1YBWA 4FUHA 1YM0A 1UTJA 1C1UH 1P2JA 2JETC 1SGCA 3SHAH 1HAPH 1A61H 1J8AA 4A7IB 4RN6A 3LGWA 3RC5A 5C1YA 5C1XA 1KXEA 1QFKH 3NXPA 3ZZDA 1ETSH 4NA8A 1FNIA 5EPYA 2CMYA 3M3TA 4OGYA 2XC0A 1CBWC 2XYAA 4MPVA 1P9UA 1GJBB 1WTHD 1L4ZA 4OS4A 4NSYA 1HJ8A 1UTMA 5EOKA 2UUFB 1ZJKA 3A86A 4ZHLU 1M9UA 4MG3A 2FOCA 2FOEA 2PTCE 1BQYA 4WVPE 1BTYA 1CBWB 3KNXA 1QRXA 1YC0A 3E1XB 4HZHA 3AW0A 1NRRH 1ELAA 1YCPH 2WUCA 3GCNA 5HM9A 1AUTC 4OS6A 4TYDA 1YPKH 3PWCA 2J94A 1ANDA 4MNWA 1MKXK 3UREA 4JK5A 4BOHA 1DE7H 2Z3EA 5L30H 4AFSA 1C2JA 3LIWA 2PKAB 3MI4A 1SGFG 1YPJH 2AH4X 1O2OA 3AAVA 3BTDE