1GI6A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi6A02
3SQEE 4GCHG 1V2TT 3GCTG 1GBDA 1ZRKA 4JYVH 4UD9H 2ZDMA 1DX5M 1C2MA 4YLQH 2AYWA 3TK6A 1MUEB 1GI0A 1P05A 3TNSA 1BTHH 2DE8A 1GDUA 2FYQA 1YLCA 4TYDA 3ZV9A 4MPVA 4K2YA 4X8VH 3QO6A 1Q31A 1OYQA 1AB9B 3UTUH 3QX5H 1YPKH 2WUBA 1A3EH 5GPIB 1FY5A 1JMOH 3RMNH 1OWHA 1WUNH 2Q6FA 1KXDA 1HIAA 4YOGA 1EASA 3SNDA 1SSXA 3LGUA 2BDHA 2G4TA 4OGXA 7GCHF 1WSSH 1PPGE 2VIVA 1F0SA 3SI4H 1F0TA 2Y5HA 4BXSA 4LXBH 4OS7A 4ZROA 3SU6A 4DIHH 1BHXB 3S9BA 1PQ5A 3RXUA 1F5KU 3URCA 2R2WU 3RXQA 1K1NA 1QJ7B 3F9HA 2FPZA 4UFFH 2EI6A 1BBRH 2OD3B 2FX4A 1P9UA 4IC5A 3ZZBA 2PV9B 1TQ7B 1NRNH 2SGDE 1TPOA 1GDNA 3K65B 2XRCA 1EUFA 2B5TB 2ZTZA 3M3TA 1DXWA 2ZGCA 1QQ4A 1HXFH 1MTSA 1FMGA 1XXDA 5FX5A 1HLTH 1ARBA 2XBXA 3F6UH 1SVPA 1C9PA 1TRYA 3ATLA 3VFEA 3U8RH 1W3CA 4AFSA 5C2ZA 3ODDA 3LC5A 2WPJS 1MH0A 3UQOA 2VIWA 4K1TA 3RXCA 2DE9A 1UK3A 1BMAA 3UOPA 1F2SE 2SGQE 3QDZB 3RM0H 3RM2H 1EATA 4H42U 1ORFA 2PTCE 4X2XA 4ABJA 5FX6A 2Y7ZA 5JBAS 1OXGA 2ALPA 1SPJA 4UFEH 3RXTA 1UTJA 5EQRA 2TGPZ 5L2YH 1TGSZ 2A32A 1GI5A 1Y3YA 2HNTF 1EAIA 3KGPA 5SGAE 1GDQA 1L1JA 5A0AE 3LGVA 2Q6GA 1FPCH 2VGCB 2BYAX 4CHAC 5LPRA 1P09A 3ATMA 3FANA 4MLFB 1GMCF 3MNXA 8GCHF 5JBTA 1INCA 3QTOH 1VJ9U 2RG3A 1C1QA 1A0LA 2BLWA 1Y8TA 2XBVA 4HTCH 4JK5A 1GL1A 1LPGB 1QB6A 3K9XB 5HM2A 1EB2A 1DWEH 1IAUA 5EPYA 1EZXC 1BRUP 3RXIA 2BY8X 2VVUA 1S83A 5T6FA 1CE5A 2J38A 2W3IA 3MFJA 1HUTH 3BIUH 1G2MA 3KQEA 2ZU3A 4AORA 1S81A 2ZU5A 5C1YA 3HGNA 4YO9A 4CRBA 3TGJE 1LKAA 4WMDA 4BTTB 4XDEA 5E0HA 3TJVA 1NESE 4FUEA 3PMBB 4NIYA 3M35A 1SC8U 2PW8H 3ITIA 2AGEX 1T32A 2PGQB 3A81A 3NPSA 2H2ZA 1GJBB 2FOEA 1HAVA 3VPKA 5IDKA 3OSYA 1LQEA 2YOLA 1HPGA 1P2QA 2ALVA 4K8YA 5J4QA 3F9GA 1J8AA 3B23B 3UFAA 1QRWA 2W5EA 2ZO3H 1BZXE 3GCNA 3A86A 4ABGA 1O3GA 1BHXF 1AY6H 2VVCA 1GBHA 2ZECA 3DHKH 2UWOA 1G3EA 5F03A 4DW2U 2IOTA 2EI7A 1FDPA 2Z3DA 5JBCS 1Q2WA 3MHWU 3H7OA 3P8NA 5HGGA 4OS4A 1C1PA 1FXYA 5E2PA 1P12E 2F9VA 2A45B 3T25A 1LQDB 1GBMA 3ZZ7A 1JXPA 3ZVAA 3Q3XA 1IQJA 2R2MB 1J16A 2FDAA 4B2BA 1TONA 1OOKB 2VINA 1S0RA 1FIZA 1CO7E 1P0SH 1LHEH 2TIOA 1PQ7A 1F0UA 1HAIH 2IJOB 4ZH8A 1KTTB 3ZVFA 1MTNC 2OXSA 2IN2A 2ZTXA 1YP9A 1BTUA 2VIPA 1W11U 4HFPB 4A5TS 5LPFA 4YOIA 1EZQA 3QN7A 1QR3E 3GDUA 3LGWA 4BNRA 4YOJA 1LPKB 5E0GA 5EPNA 1GI8B 1GI4A 4U32A 3ZZAA 1ANBA 1OS8A 1QB1A 1C5WB 3BG4C 1GBJA 3DD2H 1AE8H 1RGQA 3SV6A 4O97A 1WV7H 1NU7B 1D3DB 1QL7A 3SUGA 3DFJA 3E0NB 1VGCC 2BQWB 4FU8A 5DP4A 4DGJA 3SNAA 1MD7A 1CHOG 1D4PB 4OS2A 2PSXA 1O2YA 1T4VH 3GDVA 1K1IA 1GHAF 1CA0B 1O35A 1SBWA 2Z9IA 2XC5A 2HNTE 1S5SA 4MG3A 2TBSA 3T5FH 1YPHC 1UTPA 4Y7AA 1UK4A 3BTDE 1SLVB 5CHAC 1A0HB 1P10A 1C5LH 4IBLH 3RP2A 1TBZH 1BOQA 1LHGH 2FIRH 1VITH 1GBBA 1LVBA 2ODQA 3EDXB 2H1UA 2ZIQH 1YPMH 4AYYB 2G4UA 2Y82A 5DP6A 2TGDA 1CHOF 2A2QH 3RU4E 1A2CH 1C2EA 3EGKH 3P6ZB 4ZUHA 3RC6A 4A1TA 3ATIA 2UUKB 2ANWA 5A8YA 3AAVA 1EXFA 1DY9A 2ZHQH 4BAHB 2BLVA 1HAHH 1NFYA 4Y8ZA 5JPMH 1HCGA 2FI3E 1MU6B 3E91A 1D9IA 1NRSH 1BITA 1PJPA 1C9TA 5FXLA 1SGFA 1OX1A 1H9LB 2OUAA 3VB7A 1IHSH 1GI6A 4K1EA 3PMAB 1MZDA 2V6NA 1C2HA 3BTWE 4AB9A 3SW2B 4AG2A 3TNTA 1KSNA 4I8JA 3LGTA 4K1SA 2AIPA 4Y6DA 1FN6A 1FJSA 4RN6A 2Y80A 1O3AA 1YCPM 1MKXH 2GT7A 1Y3VA 4GUXA 4I8LA 4SGAE 1K22H 3M61U 3A8AA 1SR5C 2BD7A 1V2VT 4IC6A 1Y5AT 4R0IA 1UJ1A 2P3FH 2PHBA 1E37B 2UUJB 3SUFA 4A1VA 1O38A 2FTMA 4ABEA 2H9TH 1P2OA 1ELCA 3GY6A 1KIGH 1O2OA 1TNHA 1TGTA 2K1QA 2ULLA 3A89A 1IHTH 3BTHE 2FWWA 1AFEH 2J94A 1OP0A 2HPQH 5ESBA 1QURH 3SU2A 3SUEA 1DE7H 1XX9A 4Q2KA 3GCOA 2BDBA 4UONA 4BAOB 4CH2B 1G3BA 1O2GH 1XUKA 2GCHG 4M7GA 1EPTC 1RIWC 3UR6A 1PPBH 1HYLA 1UHBA 5FBEA 1NRQH 7KMEH 1YKTA 2TPIZ 4K5ZA 4QT8C 3D62A 1UVTH 3HKIB 1LTOA 3KNXA 3PMHB 2O8UA 1AIXH 1O3NA 4TPYA 1T8OA 1P01A 1SGPE 3E3TA 1WQSA 1IQLA 1EP5A 1TABE 1SGYE 1HRTH 3M5NA 5DP8A 2BTCE 1NRRH 5LH8A 3TITA 3NUMA 1TAWA 1N1LA 2H5CA 3STIA 2ZC9H 5GXPA 4CBNA 1O37A 1OWEA 1ZSJA 4FVDA 4IMZA 2P94A 4DIIH 4WWYA 4WJG2 5L2ZH 1GJ9B 3TK9A 1DVAH 3F68H 1AUTC 1UVSH 1G30B 1HJ8A 3T29A 2W7UA 1JIMA 1DICA 2A5KA 4OS6A 3IWMA 2H6MA 2FP7B 1JRTA 1ELAA 5AVDA 2CMYA 1CU1A 4FU7A 3BTTE 3RXAA 1IQKA 3VEQB 5L30H 2ZKSA 1AE5A 1RXPA 1XVMA 1L4DA 3UNRA 4ZKOU 4DVAU 5CE1A 1BBRE 3MI4A 2BY5X 1QHRB 1ABJH 4BAMB 1BTYA 3VB4A 1NT1A 1DSTA 2TRMA 2C8XB 1GL0E 1WU1A 4HI3A 4I8HA 6CHAB 4MTBA 4BAKB 2C4FH 1CGHA 1TPAE 2FMJA 3CENA 2XNIA 5EGMA 1O0DH 1W0YH 3M3VA 3MWIU 5JYIA 1FPHH 4X6MA 1THRH 1QRZA 3RXDA 2FEQH 4X2VA 1O5BB 1EJNA 2ZF0H 5EXLA 1TMBH 1PPFE 4YLUA 4WXVA 2FM2A 4O9VA 3E6PH 3L33A 5LPEA 1O3HA 1DFPA 1EPTA 4YESB 2QA9E 1ETTH 3GY3A 1B5GH 1BJVA 5DP9A 1ESBA 2ZTYA 1SL3A 4NGAH 3ZVEA 1L1NA 1XUGA 3PM3A 2CJIA 2XWBI 1KXFA 1KYNA 1O2KA 2C8YB 1FZZA 3RXEA 4U2WA 1J14A 4I7YH 1A5GH 2ZGBH 3RXFA 4SGBE 2GDDA 1MQ5A 1Y3UA 1C2GA 3S9CA 1CBWB 4LZ4B 3FZDA 1CA8B 1G3CA 1TNGA 5FCRA 1AU8A 1XUJA 1A1RA 4Y71A 1H4WA 5GCHF 1BRAA 3MNCA 3BTKE 1TNIA 1DLKB 2F9NA 1EJMA 1TQ0B 4IGDA 1AO5A 8GCHG 3A80A 1AVXA 4AGJA 3VB3A 1ZHMA 2OINA 1OKXA 1QBOA 1Y59T 3A7WA 1AFQB 1C2KA 4K3JA 1FLEE 3SN8A 3A8BA 1ELGA 1NZQH 2ZHEH 1UVOA 1DS2E 1KLJH 2P95A 2YNAA 3UUZA 1W13U 2BD2A 4FUBA 3E90B 4NSVA 3TU7H 4CRGA 2NU3E 1RFNA 2QXJA 5EXMA 6LPRA 2R9PA 1P9SA 1HAZB 4WY3A 2Q6DA 5GCHG 1P2NA 1AZZA 1J17T 4B76A 3KN2A 3SHCH 3RLWH 4H4FA 1C5UA 4ZAEA 4NSYA 2QCYA 3OTJE 1ZJKA 4IN2A 2ZGHA 2V3OH 4DOQA 3EYDA 2BD4A 3PO1C 1SGTA 1RTKA 4INHA 4UFDH 2ZCLP 3Q00A 1SLWB 2VH0A 1RIWB 1T7CA 4X1RU 5C1UA 3ZZ4A 1BJUA 1CGJE 4JZFH 1TOMH 8ESTE 2FXRA 3RU4T 3BEUA 1O3MA 1C1NA 2BLOA 4YTAA 1TMTH 3SNCA 5EOKA 2ZFRH 1O3DA 1SQTA 4NFEA 5C5OA 2Y5GA 4B73A 1GJ8B 3BG8A 2RCEA 1ZTLA 3RXMA 2QC2A 3JZ2B 4CRDA 2XW9A 2OC7A 4GVUA 1IOEA 1C4Y2 1MTVA 4MPXA 5C5NA 1O2ZA 1S82A 3GISB 1FAKH 2FOMB 1ABIH 1ZGVA 1QNJA 1RD3B 1HXEH 1L2EA 1MKWK 1C1OA 4FVBA 3MH6A 3GY8A 1GMDF 2VWNA 2H9HA 4TWWA 1ZLRA 1P8VC 2NU2E 2ZP0H 4VGCC 4B75A 1O5DH 3M5LA 3TGIE 1KDQA 2WUCA 4FUFA 2ZDKA 3D65E 3Q3YA 1BTPA 3RXJA 2WPKS 2ZPRA 3U8TH 1AKSB 4XBBA 2Z9LA 1GHAG 1TRNA 2A1DB 3UNQA 4ASHA 1HAXB 1CBWC 2UWLA 2ZQ1A 2FOAA 2I6QA 1QCPA 3U8OH 5DK1A 2BX4A 8KME2 5DO4H 2BZ6H 1SGQE 1ZPCA 2F9UA 1SLUB 3B8JA 1NRPH 2QXGA 1GJ7B 4YT7H 1K9OE 5F8ZA 1NTPA 3MH5A 3BG4B 3RXGA 3ZZ6A 1WQVH 1EOLA 4K60A 3E1XB 3Q77A 3NKKA 5T3HA 1SGRE 3WY8A 4LZ1H 3ATKA 4MDSA 3EAJA 1H8DH 1NC6A 4BAQB 3SV2H 4AFZA 1C1WH 1MQ6A 2SGPE 1SGEE 1Z71A 3TH4H 3LGYA 4X6NA 3EA8A 3UWJH 5HXFA 3D23A 2C93B 4Y0ZE 5FPTA 1FY1A 3MU1A 3S69A 2AMQA 4GPGA 1QRXA 2XTTB 8LPRA 3M5MA 2ZHFH 2FS9A 2GZ9A 2ESTE 2OLGA 1UTMA 1J9CH 4E7NA 1C5TA 1PFXC 1HJAB 1C5YB 4JZIA 1H9HE 3SZNA 1MTNB 1BMLA 1VR1H 2GP9B 5I25A 1YCPH 1V2MT 1B0EA 2OQUA 2NU4E 1DPOA 4ZHLU 5A0CA 2RA3A 1GVZA 1C2JA 3GOVB 5DP3A 4CREA 1A5IA 5DPAA 1VITF 1C5SA 1RRKA 3I77A 2G51A 4Q7ZA 3ZVBA 1O2WA 2CHAB 4IMQA 3PTNA 4I32A 3PROA 3URDA 3IITA 4U30A 2PLXA 1GMHG 1HB0B 3UOUA 1W7XH 2CGAA 1S84A 4AYVB 1LVMA 2C90B 1IQGA 1UMAH 2TGTA 2LNCA 1HAOH 1XVOA 2BD9A 2Z3EA 3E8LA 2HALA 2A4RA 2BB4A 4AX9H 2G00A 2R0LA 3SGAE 1GBAA 1GGDB 2ZU1A 2BQ7B 2GV7A 4AFQA 1O2SA 3O8BA 2ZFQH 1MCTA 5CHAB 1P02A 1ELEE 1OPHB 2ZFSA 1VITG 1ZZZA 2P93A 3ZVGA 1GPZA 1ZHPA 3BSQA 1JRSA 2VIDA 2BQ6B 1NO9H 2F83A 2Z9JA 1C2LA 2SGAA 1N8OC 4XBDA 4XSKU 5FBIA 1JBUH 5F8TA 4J1YA 1NPMA 2AS9A 2QIQA 3LOXA 2Z94A 1C1SA 1O2MA 1O2JA 3UNSA 3KHVA 4KTCA 2G8TA 3SO3A 3VXFH 1P3CA 3AAUA 3I29A 4UFGH 4CR9A 3ZV8A 1C5OH 1LVYA 3RLYH 4ZXXH 1GI3A 2WV4A 1O36A 4NIXA 5EQSA 1UTQA 1TMUH 2XXLA 1XXFA 1O3JA 1GMHF 3MMGA 4ZXYH 3ESTA 2QF0A 2ZGXH 3UREA 2ZFFH 2FYRA 1RS0A 1AN1E 1OWKA 3U1JB 1U6QA 1GBLA 4B71A 1ZR0A 1SGDE 2ASUB 3VGCB 1SHYA 1HGTH 3QGJA 3OX7U 3STJA 4LK4A 1SOTA 2HNTC 4KTSA 3N7OA 5EU8A 3W94A 1W10U 5BPEA 4MNYA 1DDJA 2V35A 3T27A 3RXRA 2ZDLA 5E0JA 2CF9H 1ESTA 3SU1A 3PO1B 3M7TA 2VIOA 3A85A 1AMHA 1KLTA 3O8CA 1UTNA 1GBKA 2AIQA 2SGEE 1SFQB 2BD5A 3D49H 1XM1A 3ZVCA 3A7ZA 2G5VA 4DCDA 4NIWA 1ZMLA 2A4GA 3LONA 1K1LA 1P11E 2BDYA 5FHTA 4A1XA 1EAUA 2BD3A 5ABWA 2B9LA 1KXCA 1FI8A 4JZDH 3ZZ9A 3QWCH 3E0PB 3M36A 2ZWLH 4JYTA 1MD8A 2O8TA 2XBWA 2AMDA 4A6LA 2FOBA 1TALA 3C1KA 1O3EA 1TNJA 2G55A 3DA9B 3DUXH 1CQQA 5AFYH 1PPHE 3VGCC 1HAYB 2FI4E 4MNWA 3PTBA 1HAVB 1UO6A 1B0FA 4FXGH 1V2KT 4X2WA 1Z8JB 2J34A 2PKAA 1NY22 3MO9A 1J15A 2ZQ2A 2AERH 3FZZA 3LJJA 3T2NA 4IS5A 1E34B 3MU8A 4D7GA 1XKAC 2XWAA 3TK5A 3T26A 2GZ8A 3QLPH 1TNKA 2AGGX 4INKA 4NA7A 1A3BH 4WVPE 5DP7A 1AGJA 3BF6H 3F1SB 5E2OA 1K2I1 3ELAH 4OS1A 1FIWA 3O8RA 1SGNE 2KAIB 1K1JA 2JETC 1O2QA 2AEIH 2G5NA 1G32B 2J9NA 1FY4A 3CP7A 2FLRH 1GI1A 3UR9A 1GHYH 1SGIB 3AW0A 5A8XA 1ZPZA 3K6ZA 2YNBA 1V2WT 1ESAA 2TGAA 1E38B 1PYTD 4Y8YA 1S6HA 1BDAA 1PQAA 1A61H 1P06A 1AD8H 1TE0A 4ZMAH 1GG6C 1O3CA 3RDZA 1WYKA 1K1PA 1FQ3A 1NROH 3U98H 3F9FA 4BOHA 1TOCB 1UTOA 2UUYA 2A7HA 3SV9A 1Y3WA 2FOHA 2ZPQA 4U01A 4K8BA 2FODA 4ABAA 1AKSA 4JK6A 1V2NT 1F92A 1EPTB 3A7TA 2OC1A 3PMJA 4CRCA 3ZZ8A 1M9UA 1O5FH 3P8OA 4D8NA 1O2RA 3LKWA 3MNBA 3RXHA 1TX8A 3NXPA 3SU5A 2LPRA 1DT2A 3MO3A 1GBEA 1O3KA 3LT3A 1OWDA 3BTFE 3ENSB 4Y8XA 1E0FD 4X8TH 2J95A 1GVKB 2O8WA 2AH4X 1VCPA 5EW1H 2EA3A 2VNTA 1DITH 1SMFE 2FOFA 2ZPSA 3PLBA 3L6PA 4RKOB 2BM2A 1DOJA 2EI8A 2STAE 3LPRA 3MU5A 3L3TA 1QA0A 3PWBA 4ISOA 4FUJA 3RMOH 1YM0A 3U9AH 1A0JA 3A83A 1VZQH 3TH3H 2QXIA 2BDCA 1YPJH 3ATWA 2HRVA 5IYTA 1ID5H 4GHQA 3K2UA 1K28D 4H6SB 4IN1A 2P59A 3TIUA 4B2AA 2B0FA 3BEFB 1N8OB 1TA6A 5EQQA 1HJ9A 1O3OA 1MAYA 1BTXA 3VXEH 5A2MH 1FAXA 2D1JA 5JB9S 2AMPA 1C1TA 2D8WA 1P03A 1V2JT 1DXPA 2XCNA 4UEHH 2AFQB 2A5AA 2PGBB 1AZ8A 2QXHA 1LMWB 4D9RA 2V0BA 1SI5H 1O39A 1UTLM 1IQHA 4O03A 3KQDA 1D6RA 1C5MD 1Z1JA 2G52A 4Q7XA 4WXIA 1V2UT 1P2IA 1F5RA 2ZG0H 1ZRBA 2GVFA 1O32A 3GY5A 3V7TA 2WPMS 1CT2E 4ISNA 3SJKA 1O2HA 2BVRH 2C3SA 1CVWH 3QK1A 4CBOA 2FO9A 4CH8B 4FUHA 3P92A 1O3BA 2OBQA 1VCQA 4DG4A 1BUIA 1TX6A 1HDTH 4GAWA 4Y79A 1AVGH 3BTGE 1C5QA 3MYWA 3SORA 4ZHMU 1SB1H 1C5RA 1K21H 2Z7FE 1OWIA 3UQVA 1ZGIA 1CHGA 1DWCH 2PFEA 1GMDG 1W14U 5C3NA 3MOCA 4ZKSU 3TJOA 4XE4A 4AZ2B 1GJ6A 3RC5A 4HZHA 2DUCA 3S7HB 2GGVB 7ESTE 1MCVA 1DANH 1ELVA 1V2QT 1QBNA 4A7IB 5K0HA 4GSOA 4NWKA 4X1SU 2AGIX 3A84A 3HATH 2C8ZB 4X8SH 1GHXH 2GV6A 1DLEA 1P3EA 1HBTH 1GJ5H 2PTNA 2GCTC 4HGCA 3SU4A 3C27B 3NZIA 1ZSLA 3PYHA 3E16B 1CA0C 1EQ9A 1MBQA 3HKJB 1C1UH 5LGOA 1XUFA 1D3QB 1YBWA 1W8BH 4I31A 2Y6TA 1O5CB 4ZKNU 4GHTA 3ZVDA 1P2KA 1O5AB 1H1BA 2J92A 4NFFA 1NN6A 4WH8A 1UVPA 5T6DA 1O31A 3B9FH 2FTLE 1BQYA 2J2UA 2FLBH 2PUXB 2A7JA 3CS7A 2ZFTA 1F5LA 3FP7E 4VGCB 2P8OB 1PPZA 3TGKE 1GHZA 3NK8A 1AWFH 1JIRA 1FV9A 2GCTB 1SOZA 2A4QA 2BVXH 1A7SA 1T8NA 1EB1H 3A8CA 3CS0A 3U69H 4ABBA 1F7ZA 4JYUH 3BTQE 2HOBA 3FAOA 4Q7YA 1GWAA 4AG1A 2J4IA 5DJ7A 1A4WH 2JETB 2Z9KA 1BT7A 2OC0A 5EW2H 3M3SA 2ZDVH 3RXOA 1ZTJA 1GJCB 1DM4B 1EAWA 1ELFA 1YPGH 2Y5FA 4Q80A 1BMMH 1OYTH 1S6FA 2JH0D 3RXVA 4D76A 1BRBE 1ANCA 4Y10E 4LOYH 5L6NH 1KY9A 1IQIA 4AB8A 2BVSH 1C1RA 2F3CE 1AI8H 1IQNA 2ZA5A 5PTPA 3HK3B 3SBKA 4I8GA 1YPLH 2O9QA 1MKXK 2ZU4A 1EAXA 3ZZDA 1CT4E 1QIXB 1EZSC 2ZNKH 1K1MA 5C1XA 2D26C 1O3LA 1NFXA 1V2PT 1YLDA 5ETXA 3P8FA 5DG6A 5HM9A 2ZGJA 1GI9B 2ZFPH 3GCHB 1IQEA 1E35B 2VU8E 2QV1A 2STBE 3GDSA 1HJAC 2CN0H 4BANB 2QYIA 1BMNH 4Y76A 2ZCHP 3T62A 1T4UH 1F0RA 1GHWH 1D6WA 1GHBG 3R3GB 3A88A 3HPTB 4Y11E 3RXSA 1SHHB 1V3XA 1EX3A 1TYNA 2BX3A 1KXBA 1DSUA 3DFLA 4AN7A 5AHGH 3PLKA 5FAHA 1O5GH 1T8MA 4AGKA 2OQ5A 1A46H 1K1OA 4X0WU 3GY4A 3PV4A 1AHTH 3FFGA 1C5PA 4I33A 3V3MA 2VB0A 2VH6A 3SNBA 2SGFE 3TLOA 1YF4A 1QL9A 3Q76A 4XBCA 2P3TB 3LDXH 1LPZB 1E36B 2PR3A 3JZ1B 1LHFH 3S9AA 1W7GH 1GGDC 3MU4A 3KF2A 3MTYA 1TB6H 2XC0A 3Q3KA 3RXKA 4ABIA 1Z8IB 2F91A 4WH6A 1TX7A 1S0QA 3QGNB 1RTFB 1BB0B 3HGPA 1V6DA 3KIDU 4I8KA 2OP9A 4O3TA 3BTEE 1AWHB 2GCHF 4X1QU 1VGCB 1LVOA 1DWDH 5DGJA 1PPEE 1FUJA 2JKHA 2O8LA 1GHVH 5TCCA 2H5DA 4X1NU 3TPIZ 2CHAC 6CHAC 1Z1IA 1C1VH 2BY9X 1V2LT 2JH6D 1KDQB 4ISHH 3SJIA 1GJAB 5DKMA 3GICB 1ANDA 3KQCA 1DY8A 1GCDA 1AQ7A 3NWUA 4NCYA 4TWYA 1ZTKA 1GVLA 3DT0H 4NIVA 4CR5A 2F9BH 4B1TA 1OSSA 3F9EA 2ZEBA 4OS5A 7GCHG 2SNWA 3HK6B 1P04A 1UVUH 3P8GA 1FY8E 1G37A 1P2JA 2WYGA 1TGBA 3TVJB 4CRAA 2BXUH 2VVVA 4FU9A 4NA9H 5GJ4B 1GCTB 3MH4A 3U1IB 1MBMA 4WMEA 1ETSH 1XUIA 2KAIA 3MU0A 2BLQA 4MNVA 3OU0A 2WV5A 1O2VA 2SNVA 2HVXA 3G01A 3SU3A 3ZZCA 1V2RT 4GCHF 1CT0E 5FPYA 1TRMA 1W2KH 3M7QA 2ZZUH 2B7DH 3UIRA 2I6SA 4Y7BA 2BDIA 4FUGA 4ISIH 3RC4A 1L1GA 1GHBF 3P17H 2ZI2H 1O2LA 2G81E 3A82A 1ELTA 1MMJN 3O8DA 2Z6BD 1O30A 4NA8A 2VWOA 2ODPA 1ZOMA 1AFQC 4WF8A 1QFKH 2P16A 4KELA 4MPUA 4NWLA 4NZLA 4TY6A 1TPSA 3VB6A 3A87A 3SOSA 1NFUA 1UHBB 1WOFA 1W0ZU 1H8IH 3AVZA 3SJOA 2CV3A 1O2PA 4KP0A 1PQ8A 5F6MA 1MU8B 3SHAH 3I78A 1C2FA 1OWJA 5FPSA 1X7AC 2ZCKP 1T8LA 3BTME 4ABFA 4B74A 9LPRA 4INLA 2P8OC 4CHAB 2FX6A 4A92A 1GMCG 5FCKA 1LCYA 3LIWA 1C2IA 5GDSH 1LDTT 2M5TA 3SUDA 3QTVH 1GI7B 1GJDB 1N6YA 2FOCA 1Z8GA 2JH5D 2ZDNA 4IW4E 4XFQA 1TNLA 2PWXA 1XMNB 1N6XA 2R0KA 3LC3A 4YM9A 2OBOA 1GJ4H 1EZUC 1KTSB 3R0FA 1C4U2 1QBVH 2NWNA 3A7VA 5CMXH 1ZHRA 2OC8A 2B8OH 5GWZA 4FUDA 1FONA 2PKAB 4CRFA 1XUHA 2XBYA 2GKVE 5HYOA 1QQUA 2Y81A 1C5NH 2GMTB 3MO6A 1RJXB 4MVNA 1YYY1 1TLDA 3RUOA 2QF3A 3LH3A 2BDAA 1ZJDA 3M7UA 2WPHS 4OGYA 1YGCH 3P70B 4GLYA 1ZMNA 2Y7XA 2PKSC 1NFWA 2BY7X 1O5EH 3LH1A 3LU9B 1Q3XA 2A0QB 1QL8A 5HMAA 4ISLA 1GCTC 1MAXA 2ANKH 1MKWH 1TGNA 2FI5E 3M37A 1TPPA 1UCYH 1EJAA 9ESTA 4E05H 1ZYOA 2FS8A 2VJ1A 2UUFB 1KXAA 2W7SA 1AB9C 4TY7A 3A7XA 4MNXA 1GBFA 1ACBE 1TBQH 5ESTE 1G3DA 2WPLS 1O3IA 1Y5BT 1ELBA 1Z8RA 2PUQH 2A31A 3NCLA 4Y0YE 2QY0B 3ZZ3A 4AOQA 1YPHE 3SV7A 4NG9H 1G36A 2BZAA 3RXLA 1TFXA 4DURA 1LHCH 2FESH 2NU1E 2VWLA 1GBIA 1ZMJA 3QZRA 2D2DA 3AW1A 1C5XB 2R3YA 1D3PB 1YC0A 2HPPH 3SJ8A 5EODA 2FZZA 4MQAA 2PSYA 3FP8E 4FUIA 4RSPA 1WBGB 2ZU2A 1Y5UT 3SV8A 4ABDA 4ESTE 1FY3A 4D9QA 2WINI 4Z6AH 1A5HA 1ETRH 4KGAA 4D7FA 1LO6A 1ZSKA 1Y3XA 3BEIB 1HFDA 3P95A 3H5CB 1O34A 4JMYA 4XOJA 2QAAA 3PB1E 2XC4A 3V0XA 1KLIH 1G2LA 1DUEA 5EXNA 3GYMA 4JCNA 1ARCA 1BA8B 1FN8A 3S7KB 1QJ1B 2P3UB 5TJXA 1THPB 4X1PU 3V12A 2WPIS 1T31A 5EG4A 5G4BA 1SFIA 3SQHE 2ZHDA 1VJAU 3RMMH 5C67A 1WTGH 4BTIB 2R3UA 1AUJA 4KTUA 2EC9H 4PROA 3PWCA 2GD4B 2A5IA 1LKBA 2GDEH 1GI2A 1L4ZA 4O3UA 5TCAA 3V13A 2V3HH 4BXWA 1BCUH 4X6PA 3GY2A 1PPCE 3OYPA 1ZPBA 3UWIA 2F9PA 1SLXB 4AFUA 1GBCA 4E7RG 1QGFA 1CGIE 1B7XB 1O2NA 1S85A 4R8TB 3KEEA 3MNSA 2GMTC 1TGCA 2CF8H 1RTLA 5JB8S 1TIOA 4UE7H 1SG8B 1JOUB 1O2XA 3RMLH 1HAPH 1JWTA 1UK2A 2HLCA 3EQ0H 1SQAA 3LJOA 3OY6U 4UDWH 2NU0E 3KCGH 3TH2H 1UCYK 1CSOE 4BTUB 1BIOA 1SGFG 3TJNA 2XYAA 7LPRA 3QUMP 3RU4D 5A8ZA 2ANYA 1ELDE 5B6OA 5H4IB 3SNEA 4FUCA 3KQBA 4NZQA 3KL6A 2Z3CA 3UY9A 1TWXB 4JZEH 4WMFA 4B2CA 1D3TB 3GCHC 1Z6JH 4YZUA 1OP2A 2A4OA 3A7YA 2Q1JA 2H9EH 4X2YA 4YT6H 1HNEE 5GIBA 1NU9A 2BDGA 1OP8A 4J2YB 2CXVA 3BN9A 2XCFA 1O3PB 2A7CA 2FOGA 2VIQA 1WTHD 2BD8A 5A0BA 5AFZH 2THFB 2SFAA 1TBRH 1DWBH 1KXEA 2EEKA 3IG6B 3TJUA 3EA7A 3ZZ5A 1BTZA 1MZAA 1NS3A 1BRCE 4MPWA 5BRRE 3AASA 1Z7KA 6GCHF 2HGTH 3ZYDA 2BY6X 2GTBA 2BHGA 1FNIA 1V2OT 1QJ6B 3GY7A 5A09A 1QTFA 1O3FA 1O2TA 1ANEA 5DP5A 5K7RA 1UTKA 3EE0B 2QGRA 2F9OA 2UWPA 1LHDH 3SU0A 1MTWA 4DJZB 1SQOA 1IQFA 1G9IE 2W26A 1O2IA 3SI3H 4ABHA 1WAYB 3S0NA 3UPEA 1IQMA 2OTVA 3GCTF 1EP6A 1PYTC 2HWLB 2C8WB 5J4SA 2RDLA 3ZYEA 4E06H 4TPIZ 5T6GA 2BMGB 2GX4A 3QZQA 2ILNA 1V2ST 1QY6A 1HIAB 3MH7A 1EOJA 1Z6EA 3K6YA 3W95A 2Z9GA 1C2DA 1THSH 2IPHA 1GBTA 1O2UA 1HAGE 4ZKRU 1AVWA 3M5OA 1W12U 3LGIA 2BOKA 2OCVB 1EKBB 1HV7A 4DT7B 4F49A 2QN5T 1L0ZA 3VB5A 4ZHAA 5F8XA 2VWMA 1QB9A 2WYJA 1H9IE 5I46H 1BTWA 1YPEH 4RKJB 4F4OC 2BXTH 1O33A 1VCWA 2ZHWH 4KKDA 5JBBS 6GCHG 3OY5U 5E8EH 1C1MA 3RXBA 3T28A 1C5ZB 3SGBE 6ESTA 4THNH 4X6OA 2GT8A 1DUAA 2BOHB 2ODYB 3ODFA 1P2MA 1YCPK 3GYLB 2W3KA 2PKSB 2VGCC 2ZDAH 1XKBC 4K69A 5JDUB 1SGCA 3SJ9A 1C4V2 3BIVH 4Z0KA 1QA7A 2GZ7A 3FVFB 1UCYE 2RA0A 2O8MA 3A8DA 3BV9B 1WCZA 1GG6B 2A2XH 4X8UH 3EA9A 1BBRK 3PLPA 3RXPA 5C20A 4JZ1A 1TA2A 2ANMH 1C5VA 3FP6E 3SGQE 4H6TA 5AF9H 4DY7B 1MTUA 3H7TA 1NM6A 1P57B
chains in the Genus database with same CATH superfamily
3SQEE 4GCHG 1V2TT 2KFWA 3GCTG 1GBDA 1ZRKA 4JYVH 4UD9H 2ZDMA 1DX5M 1C2MA 4YLQH 2AYWA 3TK6A 1MUEB 1GI0A 1P05A 3TNSA 1BTHH 2DE8A 1GDUA 2FYQA 1YLCA 4TYDA 3ZV9A 4MPVA 4K2YA 4X8VH 3QO6A 1Q31A 1OYQA 1AB9B 3UTUH 3QX5H 1YPKH 2WUBA 1A3EH 5GPIB 1FY5A 1JMOH 3RMNH 1OWHA 1WUNH 2Q6FA 1KXDA 1HIAA 4YOGA 4TSFD 1EASA 3SNDA 1SSXA 3LGUA 2BDHA 2G4TA 4OGXA 7GCHF 1WSSH 1PPGE 2VIVA 1F0SA 3SI4H 1F0TA 1NBMD 2Y5HA 4BXSA 4LXBH 4OS7A 4ZROA 3SU6A 3FO8D 4DIHH 1BHXB 3S9BA 1PQ5A 3RXUA 1F5KU 4OM9A 3URCA 2R2WU 3RXQA 1K1NA 1QJ7B 3F9HA 2FPZA 4UFFH 2EI6A 1BBRH 2OD3B 2FX4A 1P9UA 4IC5A 3ZZBA 2PV9B 1TQ7B 5C17A 1NRNH 2SGDE 1TPOA 1GDNA 3K65B 2XRCA 1EUFA 2B5TB 2ZTZA 3M3TA 1DXWA 2ZGCA 1QQ4A 1HXFH 1MTSA 1FMGA 1XXDA 1YY3A 5FX5A 1HLTH 1ARBA 2XBXA 3F6UH 1SVPA 1C9PA 1TRYA 3ATLA 3VFEA 3U8RH 1W3CA 4AFSA 5C2ZA 3ODDA 3LC5A 2WPJS 1MH0A 3UQOA 1E1QD 2VIWA 4K1TA 3RXCA 2DE9A 1UK3A 1BMAA 3UOPA 1F2SE 2SGQE 3QDZB 3RM0H 3RM2H 1EATA 4H42U 1ORFA 2PTCE 4X2XA 4ABJA 5FX6A 2Y7ZA 3EE7A 5JBAS 1OXGA 2ALPA 1SPJA 4UFEH 3RXTA 1UTJA 5EQRA 2TGPZ 5L2YH 1TGSZ 2A32A 1GI5A 1Y3YA 2HNTF 1EAIA 3KGPA 5SGAE 1GDQA 1L1JA 5A0AE 3LGVA 2Q6GA 3F2GA 1FPCH 2VGCB 2BYAX 4CHAC 5LPRA 1P09A 3ATMA 3FANA 4MLFB 1GMCF 3MNXA 8GCHF 5JBTA 1INCA 3QTOH 4XD7D 1VJ9U 2RG3A 1C1QA 5EIYA 1A0LA 2BLWA 1Y8TA 2XBVA 4HTCH 4JK5A 1GL1A 1LPGB 5HKKD 1QB6A 3K9XB 5HM2A 1EB2A 1DWEH 1IAUA 5EPYA 1EZXC 1BRUP 3RXIA 2BY8X 2VVUA 1S83A 5T6FA 1CE5A 2J38A 2W3IA 3MFJA 1HUTH 1H8HD 3BIUH 3MQKC 1G2MA 3KQEA 2ZU3A 4AORA 1S81A 2ZU5A 5C1YA 3HGNA 4YO9A 4CRBA 3TGJE 1LKAA 2QF5A 4WMDA 4BTTB 4XDEA 5E0HA 3TJVA 1NESE 4FUEA 3PMBB 4NIYA 3M35A 1SC8U 2PW8H 3ITIA 2AGEX 4HG6A 1T32A 2PGQB 3A81A 3NPSA 2H2ZA 1GJBB 2FOEA 1HAVA 3VPKA 5IDKA 3OSYA 1LQEA 2YOLA 1HPGA 1P2QA 2ALVA 4K8YA 5J4QA 3F9GA 1J8AA 3B23B 3UFAA 1QRWA 2W5EA 2ZO3H 1BZXE 3GCNA 3A86A 4ABGA 1O3GA 1BHXF 5HIZA 1AY6H 2VVCA 1GBHA 2ZECA 3WWBA 3DHKH 2UWOA 1G3EA 5F03A 4DW2U 2IOTA 2EI7A 1FDPA 2Z3DA 5JBCS 1Q2WA 3MHWU 3H7OA 3P8NA 5HGGA 4OS4A 1C1PA 1FXYA 2L74A 5E2PA 1P12E 2F9VA 2A45B 3T25A 1LQDB 1GBMA 3ZZ7A 1JXPA 3ZVAA 3Q3XA 1IQJA 2R2MB 1J16A 2FDAA 4B2BA 1TONA 1OOKB 2VINA 1S0RA 1FIZA 1CO7E 1P0SH 1LHEH 2TIOA 1PQ7A 1F0UA 1HAIH 2IJOB 4ZH8A 1KTTB 3ZVFA 1MTNC 2OXSA 2IN2A 2ZTXA 1YP9A 1BTUA 2VIPA 1W11U 4HFPB 4A5TS 5C0UA 5LPFA 4YOIA 1EZQA 3QN7A 1QR3E 3GDUA 3LGWA 4BNRA 4YOJA 1LPKB 5E0GA 5EPNA 1GI8B 3U28C 1GI4A 4U32A 3ZZAA 1ANBA 1OS8A 1QB1A 1C5WB 3BG4C 1GBJA 3DD2H 1AE8H 1RGQA 3SV6A 4O97A 1WV7H 1NU7B 1D3DB 1QL7A 3OEED 3SUGA 3DFJA 3E0NB 1VGCC 2BQWB 4FU8A 5DP4A 4DGJA 3SNAA 1MD7A 1CHOG 1D4PB 4OS2A 2PSXA 1O2YA 1T4VH 3GDVA 1K1IA 1GHAF 1CA0B 1O35A 1SBWA 2Z9IA 2XC5A 2HNTE 1S5SA 4MG3A 5HIYA 2TBSA 3T5FH 1YPHC 1UTPA 4Y7AA 1UK4A 3BTDE 1SLVB 5CHAC 1A0HB 1P10A 1C5LH 4IBLH 3RP2A 1TBZH 1BOQA 1LHGH 2FIRH 1VITH 1GBBA 1LVBA 2ODQA 3EDXB 2H1UA 2ZIQH 1YPMH 4AYYB 2G4UA 2J5UA 2Y82A 5DP6A 2TGDA 5EJZA 1CHOF 2A2QH 3N7DA 3RU4E 1A2CH 1C2EA 3EGKH 3P6ZB 4ZUHA 3RC6A 4A1TA 3ATIA 2UUKB 2ANWA 5A8YA 3AAVA 1EXFA 1DY9A 2ZHQH 4BAHB 2BLVA 1HAHH 1NFYA 4Y8ZA 5JPMH 1HCGA 2FI3E 1MU6B 3E91A 1D9IA 1NRSH 1BITA 1PJPA 1C9TA 5FXLA 1SGFA 1OX1A 1H9LB 1COWD 2OUAA 3VB7A 1IHSH 1GI6A 4K1EA 3PMAB 1MZDA 2V6NA 1C2HA 3BTWE 4AB9A 3SW2B 4AG2A 3TNTA 1KSNA 4I8JA 3LGTA 4K1SA 2AIPA 4Y6DA 1FN6A 1FJSA 4RN6A 2Y80A 1O3AA 5C94A 1YCPM 1MKXH 2GT7A 1Y3VA 4GUXA 4I8LA 4SGAE 1K22H 3M61U 3A8AA 1SR5C 2BD7A 1V2VT 3F0OA 4IC6A 1Y5AT 4R0IA 1UJ1A 2P3FH 2PHBA 1E37B 2UUJB 3SUFA 4A1VA 1O38A 2FTMA 4ABEA 2H9TH 1P2OA 1ELCA 3GY6A 1KIGH 1O2OA 1TNHA 1TGTA 2K1QA 2ULLA 3A89A 5KGOA 1IHTH 3BTHE 2FWWA 1AFEH 2J94A 1OP0A 2HPQH 5ESBA 1QURH 3SU2A 3SUEA 1DE7H 1XX9A 4Q2KA 3GCOA 2BDBA 4UONA 4BAOB 4CH2B 1G3BA 1O2GH 1XUKA 2GCHG 3OFND 4M7GA 1EPTC 1RIWC 3UR6A 1PPBH 1HYLA 1UHBA 5FBEA 1NRQH 4RT1A 1YKTA 2TPIZ 4K5ZA 4QT8C 7KMEH 3D62A 1UVTH 3HKIB 1LTOA 3KNXA 3PMHB 2O8UA 1AIXH 1O3NA 4TPYA 1T8OA 3FOAA 1P01A 2IPQX 1SGPE 3E3TA 1WQSA 1IQLA 1EP5A 1TABE 1SGYE 1HRTH 3M5NA 5DP8A 2BTCE 1NRRH 5LH8A 3TITA 3H09A 3NUMA 1TAWA 1N1LA 2H5CA 3STIA 2ZC9H 5GXPA 4CBNA 1O37A 1OWEA 1ZSJA 4FVDA 4TT3D 4IMZA 2P94A 4DIIH 4WWYA 4WJG2 5L2ZH 1GJ9B 3TK9A 1DVAH 3F68H 1AUTC 1UVSH 1G30B 1HJ8A 3T29A 2W7UA 1JIMA 1DICA 2A5KA 4OS6A 3IWMA 2H6MA 2FP7B 1JRTA 2K8IA 1ELAA 3DSPA 5AVDA 2CMYA 1CU1A 4FU7A 3BTTE 3RXAA 1IQKA 3VEQB 5L30H 2ZKSA 1AE5A 1RXPA 1XVMA 1L4DA 3UNRA 4ZKOU 2KCPA 4DVAU 5CE1A 1BBRE 3MI4A 2BY5X 1QHRB 1ABJH 4BAMB 5GNDA 1BTYA 3VB4A 1NT1A 1DSTA 2TRMA 2C8XB 1GL0E 1WU1A 4HI3A 4AC9A 4I8HA 6CHAB 4MTBA 4BAKB 2C4FH 1CGHA 3F2HA 1TPAE 2FMJA 3CENA 2XNIA 5EGMA 1O0DH 1W0YH 3M3VA 3MWIU 5JYIA 1FPHH 4X6MA 1THRH 1QRZA 3RXDA 2FEQH 2WV9A 4X2VA 1O5BB 1EJNA 2ZF0H 5EXLA 1TMBH 1PPFE 4YLUA 4WXVA 2FM2A 4O9VA 3E6PH 3L33A 5LPEA 1O3HA 1DFPA 1EPTA 4YESB 2QA9E 1ETTH 3GY3A 1B5GH 1BJVA 5DP9A 1ESBA 2ZTYA 2JIZD 1SL3A 4NGAH 3ZVEA 1L1NA 1XUGA 3PM3A 2CJIA 2XWBI 2HLDD 3FKSD 1KXFA 1KYNA 1O2KA 2C8YB 1FZZA 3RXEA 4U2WA 1J14A 4I7YH 1A5GH 2ZGBH 3RXFA 4SGBE 2GDDA 1MQ5A 1Y3UA 1C2GA 3S9CA 1CBWB 4LZ4B 3FZDA 1CA8B 1G3CA 1TNGA 5FCRA 1AU8A 1XUJA 1A1RA 4Y71A 1H4WA 5GCHF 1BRAA 3MNCA 3BTKE 2OK5A 1TNIA 1DLKB 2F9NA 1EJMA 5CDFE 1TQ0B 4IGDA 1AO5A 8GCHG 3A80A 1AVXA 4AGJA 3VB3A 1ZHMA 2OINA 1OKXA 1QBOA 1Y59T 3A7WA 1AFQB 1C2KA 4K3JA 1FLEE 3SN8A 3A8BA 1ELGA 1NZQH 2ZHEH 1UVOA 1DS2E 1KLJH 2P95A 2YNAA 3UUZA 1W13U 2BD2A 4FUBA 3E90B 4NSVA 3TU7H 4CRGA 2GJGA 2NU3E 1RFNA 2RFKC 2QXJA 5EXMA 6LPRA 1NBME 2R9PA 1P9SA 1HAZB 4WY3A 2Q6DA 5GCHG 1P2NA 1AZZA 1J17T 4B76A 3KN2A 3SHCH 3RLWH 4H4FA 1C5UA 4ZAEA 4NSYA 2QCYA 3OTJE 1ZJKA 4IN2A 2ZGHA 2V3OH 4DOQA 3EYDA 2BD4A 3PO1C 1SGTA 1RTKA 4INHA 4UFDH 2ZCLP 3Q00A 1SLWB 2VH0A 1RIWB 5DSFA 1T7CA 4X1RU 5C1UA 3ZZ4A 1BJUA 1CGJE 4JZFH 1TOMH 8ESTE 2FXRA 3RU4T 3BEUA 1O3MA 1C1NA 2BLOA 4YTAA 1TMTH 3SNCA 5EOKA 2ZFRH 1O3DA 3ZIAD 1SQTA 4NFEA 4RT0A 5C5OA 2Y5GA 4B73A 1GJ8B 3BG8A 2RCEA 1ZTLA 3RXMA 2QC2A 3JZ2B 4CRDA 2RDEA 2OC7A 2XW9A 4GVUA 1IOEA 1C4Y2 1MTVA 2YMSD 4MPXA 5C5NA 1O2ZA 1S82A 3GISB 1FAKH 2FOMB 1ABIH 1ZGVA 1QNJA 1RD3B 1HXEH 1L2EA 1MKWK 1C1OA 4FVBA 2JJ1D 1KMHB 3MH6A 3SZEA 3GY8A 1GMDF 2VWNA 3N7EA 2H9HA 2JDID 4TWWA 1ZLRA 3PRDA 1P8VC 2NU2E 2ZP0H 4VGCC 4B75A 1O5DH 3M5LA 3TGIE 1KDQA 2WUCA 4FUFA 2ZDKA 3D65E 3Q3YA 1BTPA 3RXJA 2WPKS 2ZPRA 3U8TH 1AKSB 4XBBA 2Z9LA 1GHAG 1TRNA 2A1DB 3UNQA 4ASHA 1HAXB 1CBWC 2UWLA 2ZQ1A 2FOAA 2I6QA 1QCPA 3U8OH 5DK1A 2BX4A 8KME2 5DO4H 2BZ6H 1SGQE 1ZPCA 2F9UA 1SLUB 3B8JA 1NRPH 2QXGA 1GJ7B 4YT7H 1K9OE 5F8ZA 1NTPA 3MH5A 3BG4B 3RXGA 3ZZ6A 1WQVH 1EOLA 4K60A 3E1XB 3Q77A 3NKKA 5T3HA 1SGRE 3WY8A 1BMFD 4LZ1H 3ATKA 4MDSA 3EAJA 1H8DH 5B6LA 1NC6A 4BAQB 3SV2H 4AFZA 1C1WH 1MQ6A 2SGPE 1SGEE 1Z71A 3TH4H 3LGYA 4X6NA 3EA8A 3UWJH 5HXFA 3D23A 2C93B 4Y0ZE 5FPTA 1FY1A 3MU1A 3S69A 2AHME 2AMQA 4GPGA 1QRXA 2XTTB 8LPRA 3M5MA 2ZHFH 2FS9A 2GZ9A 2ESTE 2OLGA 1UTMA 1J9CH 3PRBA 2KR7A 4E7NA 1C5TA 1PFXC 1HJAB 1C5YB 4JZIA 1H9HE 3SZNA 4B6FA 1MTNB 1BMLA 1VR1H 2GP9B 5I25A 3OTPA 1YCPH 1V2MT 1B0EA 2OQUA 2NU4E 1DPOA 2KZ4A 4ZHLU 5A0CA 2RA3A 1GVZA 1C2JA 3GOVB 5DP3A 4CREA 1A5IA 5DPAA 1VITF 1C5SA 1RRKA 3I77A 2G51A 4Q7ZA 3ZVBA 1O2WA 2CHAB 2M2AA 4IMQA 3PTNA 4I32A 3PROA 3URDA 3IITA 4U30A 4FETA 2PLXA 1GMHG 1HB0B 3UOUA 1W7XH 2CGAA 1S84A 4AYVB 1LVMA 2C90B 1IQGA 1UMAH 2TGTA 2LNCA 3F3BA 1HAOH 5IK2D 1XVOA 2BD9A 2Z3EA 3E8LA 2HALA 2A4RA 2BB4A 2WSSD 4AX9H 2G00A 2R0LA 3SGAE 1GBAA 1GGDB 2ZU1A 2BQ7B 2GV7A 4AFQA 1O2SA 3O8BA 2YMSB 3OEHD 2ZFQH 1MCTA 5CHAB 1P02A 1ELEE 1OPHB 2ZFSA 1VITG 1ZZZA 2P93A 3ZVGA 1GPZA 1ZHPA 3BSQA 1JRSA 2VIDA 2BQ6B 1NO9H 2F83A 2Z9JA 1C2LA 2SGAA 1N8OC 4XBDA 4XSKU 2LP6A 1JBUH 5F8TA 5FBIA 4J1YA 1NPMA 2AS9A 2QIQA 3LOXA 2Z94A 1C1SA 1O2MA 1O2JA 3UNSA 3KHVA 4KTCA 2G8TA 3SO3A 3VXFH 1P3CA 3AAUA 3I29A 4UFGH 4CR9A 3ZV8A 1C5OH 1LVYA 3RLYH 4ZXXH 1GI3A 2WV4A 1O36A 4NIXA 5EQSA 1UTQA 1K0HA 1TMUH 2XXLA 1XXFA 1O3JA 1GMHF 3MMGA 4ZXYH 3ESTA 2QF0A 2ZGXH 3UREA 2ZFFH 2FYRA 1RS0A 1AN1E 1OWKA 3U1JB 1U6QA 1WDIA 1GBLA 4B71A 1ZR0A 1SGDE 2ASUB 3VGCB 1SHYA 1HGTH 3QGJA 3OX7U 3STJA 4LK4A 1SOTA 2HNTC 4KTSA 3N7OA 5EU8A 3W94A 1W10U 2L6OA 5BPEA 4MNYA 1DDJA 2V35A 3T27A 3RXRA 2ZDLA 5E0JA 2CF9H 1ESTA 3SU1A 3PO1B 3M7TA 2VIOA 3A85A 1AMHA 1KLTA 3O8CA 1UTNA 1GBKA 2AIQA 4I86A 2SGEE 1SFQB 2BD5A 3D49H 4Z1MD 1XM1A 2J98B 3A7ZA 2G5VA 3ZVCA 4NIWA 4DCDA 1ZMLA 2A4GA 3LONA 1K1LA 1P11E 2BDYA 5FHTA 4A1XA 3DSGA 4YXWD 1EAUA 2BD3A 5ABWA 2B9LA 1KXCA 1FI8A 4JZDH 3ZZ9A 3QWCH 3E0PB 2F43B 3M36A 2ZWLH 4JYTA 1MD8A 2O8TA 2XBWA 2AMDA 4A6LA 2FOBA 1TALA 3C1KA 1O3EA 1TNJA 2G55A 3DA9B 3DUXH 1CQQA 5AFYH 1PPHE 3VGCC 1HAYB 2FI4E 4MNWA 3PTBA 1HAVB 1UO6A 1B0FA 4FXGH 1V2KT 4X2WA 1Z8JB 2J34A 3W1EA 2PKAA 1NY22 3MO9A 1J15A 2ZQ2A 2AERH 3FZZA 3LJJA 3T2NA 5EJLA 4IS5A 1E34B 3MU8A 4D7GA 1XKAC 2XWAA 3TK5A 3T26A 2GZ8A 5F53A 3QLPH 1TNKA 2AGGX 4INKA 4NA7A 1A3BH 4WVPE 5DP7A 1AGJA 3BF6H 3F1SB 5E2OA 1K2I1 3ELAH 4OS1A 2J98A 1FIWA 3O8RA 1SGNE 2KAIB 1K1JA 2JETC 1O2QA 2AEIH 2G5NA 1G32B 2J9NA 2LELA 1FY4A 3CP7A 2FLRH 1GI1A 3UR9A 1GHYH 1SGIB 3AW0A 2HVYB 5A8XA 1ZPZA 3K6ZA 2YNBA 1V2WT 1ESAA 2TGAA 1E38B 1PYTD 4Y8YA 1S6HA 1BDAA 1PQAA 1A61H 5CHBA 1P06A 1AD8H 1TE0A 4ZMAH 1GG6C 1O3CA 3RDZA 1WYKA 1K1PA 1FQ3A 1NROH 3U98H 3F9FA 4BOHA 1TOCB 1UTOA 2UUYA 2A7HA 3SV9A 1Y3WA 2FOHA 2ZPQA 4U01A 4K8BA 2FODA 4ABAA 1AKSA 4JK6A 1V2NT 1F92A 1EPTB 3A7TA 2OC1A 3PMJA 4CRCA 3ZZ8A 1M9UA 1O5FH 3P8OA 4D8NA 1O2RA 3LKWA 3MNBA 3RXHA 3DCLA 1TX8A 3NXPA 3SU5A 2LPRA 1DT2A 1E79D 3MO3A 1GBEA 1O3KA 3LT3A 1OWDA 3BTFE 3ENSB 4Y8XA 1E0FD 4X8TH 2J95A 1GVKB 2O8WA 2AH4X 1UW7A 1VCPA 5EW1H 2EA3A 2VNTA 4FOUC 1DITH 1SMFE 2FOFA 2ZPSA 3PLBA 3L6PA 4RKOB 2BM2A 1DOJA 2EI8A 2STAE 3LPRA 3AK5A 3MU5A 5EJ1A 3L3TA 1QA0A 3PWBA 4ISOA 4FUJA 3RMOH 1YM0A 3U9AH 3F0PA 1A0JA 3A83A 1VZQH 3TH3H 2QXIA 2BDCA 1YPJH 3ATWA 2HRVA 5IYTA 1ID5H 4GHQA 3K2UA 4F55A 1K28D 4H6SB 4IN1A 2P59A 3TIUA 4B2AA 2B0FA 3BEFB 1N8OB 1TA6A 5EQQA 1HJ9A 1O3OA 1MAYA 1BTXA 5DN6D 3VXEH 5A2MH 1FAXA 2D1JA 5JB9S 2AMPA 1C1TA 2K0QA 2D8WA 1P03A 1V2JT 1DXPA 2XCNA 4UEHH 2AFQB 2A5AA 2PGBB 1AZ8A 2QXHA 1LMWB 4D9RA 2V0BA 1SI5H 1O39A 1UTLM 1IQHA 4O03A 3KQDA 1D6RA 1C5MD 1Z1JA 2G52A 4Q7XA 4WXIA 1V2UT 1P2IA 1F5RA 2ZG0H 1ZRBA 1QZ8A 1O32A 2GVFA 3GY5A 3V7TA 2WPMS 1CT2E 1SKYE 4ISNA 3SJKA 1O2HA 2BVRH 2C3SA 1CVWH 3QK1A 4CBOA 2FO9A 4CH8B 4FUHA 3P92A 1O3BA 2OBQA 1VCQA 4DG4A 1BUIA 2KM0A 1TX6A 1HDTH 4GAWA 4Y79A 1AVGH 3BTGE 1C5QA 3MYWA 4ZCNA 3SORA 4ZHMU 1SB1H 1C5RA 1K21H 2Z7FE 1OWIA 3UQVA 1ZGIA 1CHGA 1DWCH 2PFEA 1GMDG 1W14U 5C3NA 3MOCA 4ZKSU 3PV5A 3TJOA 4XE4A 4AZ2B 1GJ6A 3RC5A 4HZHA 2DUCA 3S7HB 2GGVB 7ESTE 1MCVA 1DANH 1ELVA 1V2QT 1QBNA 3NRLA 4A7IB 5K0HA 4GSOA 4NWKA 4X1SU 2AGIX 3A84A 3HATH 2C8ZB 4X8SH 1GHXH 2GV6A 1DLEA 1P3EA 1HBTH 2EQNA 1GJ5H 2PTNA 2GCTC 4HGCA 3SU4A 3C27B 3NZIA 1ZSLA 3PYHA 3E16B 1CA0C 1EQ9A 1MBQA 3HKJB 1C1UH 5LGOA 1XUFA 1D3QB 1YBWA 1W8BH 4I31A 2Y6TA 1O5CB 4ZKNU 4GHTA 3ZVDA 1P2KA 3WWFA 1O5AB 1H1BA 2J92A 4NFFA 1NN6A 4WH8A 1UVPA 5T6DA 1O31A 3B9FH 2FTLE 1BQYA 2J2UA 2FLBH 4Q4LA 2PUXB 3CNRA 2A7JA 3CS7A 2ZFTA 1F5LA 3FP7E 4VGCB 2P8OB 1PPZA 3TGKE 1GHZA 3NK8A 1AWFH 1JIRA 1FV9A 2GCTB 1SOZA 2A4QA 2BVXH 1A7SA 1T8NA 1EB1H 3A8CA 3CS0A 3U69H 4ABBA 1F7ZA 3OE7D 4JYUH 3BTQE 2HOBA 3FAOA 4Q7YA 1GWAA 4AG1A 2J4IA 5DJ7A 1A4WH 2JETB 2Z9KA 1BT7A 2OC0A 5EW2H 2VBCA 2ZDVH 3M3SA 3RXOA 1ZTJA 1GJCB 1DM4B 1EAWA 1ELFA 1YPGH 2Y5FA 5KEDA 4Q80A 1BMMH 1OYTH 1S6FA 2JH0D 3RXVA 4D76A 1BRBE 1ANCA 4Y10E 4LOYH 5L6NH 1KY9A 1IQIA 4AB8A 2BVSH 1C1RA 2F3CE 1AI8H 1IQNA 2ZA5A 5PTPA 3HK3B 3SBKA 4I8GA 1YPLH 2O9QA 1MKXK 2ZU4A 1EAXA 3ZZDA 1CT4E 1QIXB 2QE7D 1EZSC 2ZNKH 1K1MA 5C1XA 2D26C 4ACAA 1O3LA 1NFXA 1V2PT 1YLDA 5ETXA 2XOKD 3P8FA 5DG6A 5HM9A 2ZGJA 1GI9B 2ZFPH 3GCHB 1IQEA 1E35B 2VU8E 2QV1A 2STBE 3GDSA 1HJAC 2CN0H 4BANB 3KQ5A 2QYIA 1BMNH 4Y76A 4ACBA 2ZCHP 3T62A 1T4UH 1F0RA 1GHWH 1D6WA 1GHBG 3R3GB 3A88A 3HPTB 4Y11E 3RXSA 2F4LA 1SHHB 1V3XA 1EX3A 1TYNA 2BX3A 1KXBA 1DSUA 3DFLA 4AN7A 5AHGH 3PLKA 5FAHA 1MABB 1E1RD 1O5GH 1T8MA 4AGKA 2OQ5A 1A46H 1K1OA 4P00A 4X0WU 3GY4A 3PV4A 1AHTH 3FFGA 1C5PA 4I33A 3V3MA 2VB0A 2VH6A 3SNBA 2SGFE 3TLOA 1YF4A 1QL9A 3Q76A 4XBCA 2P3TB 3LDXH 1LPZB 1E36B 2PR3A 3JZ1B 1LHFH 3S9AA 1W7GH 2WHXA 1GGDC 3MU4A 3KF2A 3MTYA 1TB6H 4B6EA 2XC0A 3Q3KA 3RXKA 4ABIA 1Z8IB 2F91A 4WH6A 1TX7A 1S0QA 3QGNB 3UAIC 1RTFB 1BB0B 3N99A 4F48B 3HGPA 1V6DA 3KIDU 4I8KA 2OP9A 4O3TA 3BTEE 1AWHB 2GCHF 4X1QU 1VGCB 5T1VA 1LVOA 1DWDH 5DGJA 1PPEE 1FUJA 2JKHA 2O8LA 1GHVH 5TCCA 2H5DA 4X1NU 3TPIZ 2CHAC 6CHAC 1Z1IA 1C1VH 2BY9X 1V2LT 2JH6D 1KDQB 4ISHH 3SJIA 1GJAB 5DKMA 3GICB 1ANDA 3KQCA 1DY8A 1GCDA 1AQ7A 3NWUA 4NCYA 4TWYA 1ZTKA 1GVLA 3DT0H 4NIVA 4CR5A 3WW7A 2F9BH 4B1TA 1OSSA 3F9EA 2ZEBA 4OS5A 7GCHG 2SNWA 3HK6B 4M9FA 1P04A 1UVUH 3P8GA 1FY8E 1G37A 1P2JA 2WYGA 1TGBA 3TVJB 4CRAA 2BXUH 2VVVA 4FU9A 4NA9H 5GJ4B 1GCTB 3MH4A 2J97A 3U1IB 1MBMA 4WMEA 1ETSH 1XUIA 2KAIA 3MU0A 2BLQA 4MNVA 3OU0A 2WV5A 1O2VA 2SNVA 2HVXA 3G01A 3SU3A 3ZZCA 1V2RT 4GCHF 1CT0E 5FPYA 1TRMA 1W2KH 3M7QA 4DT4A 2ZZUH 2B7DH 3UIRA 2I6SA 4Y7BA 2BDIA 4FUGA 4ISIH 3RC4A 1L1GA 1GHBF 3P17H 2ZI2H 1O2LA 2G81E 2V3MA 1ELTA 1MMJN 2KX4A 2Z6BD 3A82A 3O8DA 1S6LA 1O30A 4NA8A 1WXRA 2ODPA 2VWOA 1ZOMA 4Q63A 3GS9A 1AFQC 4WF8A 1QFKH 2P16A 4KELA 4MPUA 4NWLA 4NZLA 4TY6A 1TPSA 3VB6A 3A87A 3SOSA 1NFUA 1UHBB 1WOFA 1W0ZU 1H8IH 3AVZA 3SJOA 2CV3A 1O2PA 4KP0A 1PQ8A 5F6MA 1MU8B 3SHAH 3I78A 1C2FA 1OWJA 2EY4C 1X7AC 2ZCKP 1T8LA 3BTME 4XRNA 5FPSA 4ABFA 4B74A 9LPRA 3KYFA 4INLA 2P8OC 4CHAB 2FX6A 4A92A 1GMCG 5FCKA 1LCYA 3LIWA 1C2IA 5GDSH 1LDTT 2M5TA 3SUDA 3QTVH 1GI7B 2W6ID 1GJDB 1N6YA 2FOCA 1Z8GA 2JH5D 2ZDNA 4IW4E 4XFQA 1TNLA 2PWXA 1XMNB 1N6XA 2R0KA 3LC3A 4YM9A 1EFRD 3F2FA 2OBOA 1GJ4H 1EZUC 1KTSB 3R0FA 1C4U2 1QBVH 2NWNA 2V7QD 3A7VA 5CMXH 1ZHRA 2OC8A 2B8OH 5GWZA 4FUDA 1FONA 2PKAB 4CRFA 1XUHA 2XBYA 2GKVE 5HYOA 1QQUA 2JJ2D 2Y81A 1C5NH 2GMTB 3MO6A 1RJXB 4MVNA 2QF4A 2YMSC 5KECA 1YYY1 1W0JD 1TLDA 3RUOA 2QF3A 3LH3A 2BDAA 1ZJDA 3M7UA 2WPHS 4OGYA 1YGCH 3P70B 4GLYA 1ZMNA 2Y7XA 2PKSC 1NFWA 2BY7X 1O5EH 3LH1A 3LU9B 1Q3XA 2A0QB 1QL8A 5HMAA 4ISLA 1GCTC 1MAXA 2ANKH 1MKWH 1TGNA 2FI5E 3M37A 2IJD1 1TPPA 4ASUD 1UCYH 1EJAA 9ESTA 4E05H 1ZYOA 2FS8A 2VJ1A 2UUFB 1KXAA 3FN8A 2W7SA 1AB9C 4TY7A 3A7XA 4MNXA 1GBFA 1ACBE 1TBQH 5ESTE 1G3DA 2CK3D 2WPLS 1O3IA 1Y5BT 1ELBA 1Z8RA 2PUQH 2A31A 3NCLA 4Y0YE 2QY0B 3ZZ3A 4AOQA 1YPHE 3SV7A 4NG9H 1G36A 2BZAA 3RXLA 1TFXA 3PV2A 4DURA 1LHCH 2FESH 2NU1E 2VWLA 1GBIA 1ZMJA 2KCOA 3QZRA 2D2DA 3AW1A 1C5XB 2R3YA 1D3PB 1YC0A 2HPPH 3SJ8A 5EODA 2FZZA 4MQAA 2PSYA 3FP8E 4FUIA 4RSPA 1WBGB 2ZU2A 1Y5UT 3SV8A 4ABDA 4ESTE 1FY3A 4D9QA 2WINI 4Z6AH 1A5HA 5C0TA 1ETRH 4KGAA 4D7FA 1LO6A 1ZSKA 1Y3XA 3BEIB 1HFDA 3P95A 3H5CB 1O34A 4JMYA 4XOJA 2QAAA 3PB1E 2XC4A 3V0XA 1KLIH 1G2LA 1DUEA 5EXNA 3GYMA 4JCNA 1ARCA 1BA8B 1FN8A 3S7KB 1QJ1B 2P3UB 5TJXA 1THPB 4X1PU 3V12A 2WPIS 1T31A 5EG4A 5G4BA 1SFIA 3VG8A 3SQHE 2ZHDA 1VJAU 3RMMH 5C67A 1WTGH 4BTIB 2R3UA 1AUJA 4KTUA 2EC9H 4PROA 3PWCA 2GD4B 2A5IA 1SQRA 1LKBA 2GDEH 1GI2A 1L4ZA 4O3UA 5TCAA 3V13A 2V3HH 4BXWA 1BCUH 4X6PA 3GY2A 1PPCE 3OYPA 1ZPBA 3UWIA 2F9PA 1SLXB 4AFUA 1GBCA 1W0KD 1QGFA 4E7RG 1CGIE 1B7XB 1O2NA 1S85A 4R8TB 3KEEA 1OHHD 3MNSA 2GMTC 1TGCA 2CF8H 1RTLA 5JB8S 1TIOA 4UE7H 1SG8B 1JOUB 1O2XA 3RMLH 1HAPH 1JWTA 1UK2A 2HLCA 3EQ0H 1SQAA 3LJOA 3OY6U 4UDWH 2NU0E 3KCGH 3TH2H 1UCYK 1CSOE 4BTUB 1VKYA 1BIOA 1SGFG 2KCAA 3TJNA 2XYAA 7LPRA 3QUMP 3RU4D 5A8ZA 2ANYA 1ELDE 5B6OA 5H4IB 3SNEA 4FUCA 3KQBA 3SYJA 5FL7D 4NZQA 3KL6A 2Z3CA 3UY9A 1TWXB 4JZEH 4WMFA 4B2CA 1D3TB 3GCHC 1Z6JH 4YZUA 1OP2A 2A4OA 3A7YA 2Q1JA 2H9EH 4X2YA 2KCYA 4YT6H 1HNEE 5GIBA 2W6JD 1NU9A 2BDGA 1OP8A 3OAAD 2CXVA 4J2YB 3BN9A 2XCFA 1O3PB 2A7CA 2FOGA 2VIQA 1WTHD 2BD8A 5A0BA 5AFZH 2THFB 3KYGA 2SFAA 1TBRH 1DWBH 1KXEA 2EEKA 3IG6B 3TJUA 3EA7A 3ZZ5A 1BTZA 1MZAA 1NS3A 1BRCE 4MPWA 5BRRE 3AASA 1Z7KA 6GCHF 2HGTH 3ZYDA 2BY6X 2GTBA 2BHGA 1FNIA 1V2OT 1QJ6B 3GY7A 5A09A 1QTFA 1O3FA 1O2TA 1ANEA 5DP5A 5K7RA 1UTKA 3EE0B 2QGRA 2F9OA 2UWPA 1LHDH 3SU0A 1MTWA 4DJZB 1SQOA 1IQFA 1G9IE 2W26A 1O2IA 3SI3H 4ABHA 1WAYB 1YWUA 3S0NA 2PP6A 1IQMA 3UPEA 2OTVA 3GCTF 1EP6A 1PYTC 2HWLB 2C8WB 5J4SA 2RDLA 3ZYEA 4E06H 4TPIZ 2XNDD 1FX0B 5T6GA 2BMGB 2GX4A 3QZQA 2ILNA 1V2ST 1QY6A 1HIAB 3MH7A 1EOJA 1Z6EA 3K6YA 3W95A 2Z9GA 1C2DA 1THSH 2IPHA 1GBTA 1O2UA 1HAGE 2WZQA 4RI0A 4ZKRU 1AVWA 3M5OA 1W12U 3LGIA 2BOKA 2OCVB 1EKBB 1HV7A 4DT7B 4F49A 2QN5T 1L0ZA 3VB5A 4ZHAA 5F8XA 2VWMA 1QB9A 2WYJA 1H9IE 5I46H 1BTWA 1YPEH 4RKJB 4F4OC 2BXTH 1O33A 1VCWA 2ZHWH 4KKDA 5JBBS 6GCHG 3OY5U 5E8EH 1C1MA 3RXBA 3T28A 1C5ZB 3SGBE 6ESTA 4THNH 4X6OA 2GT8A 1DUAA 2BOHB 2ODYB 2WPDD 3ODFA 1P2MA 1YCPK 3GYLB 2W3KA 2PKSB 1H8ED 2VGCC 1XKBC 2ZDAH 4K69A 5JDUB 1SGCA 3SJ9A 1C4V2 3BIVH 4Z0KA 4P02A 1QA7A 2GZ7A 3FVFB 1UCYE 2RA0A 2O8MA 3DSOA 3A8DA 3BV9B 1WCZA 1GG6B 2A2XH 4X8UH 3EA9A 1BBRK 3PLPA 3RXPA 5C20A 4JZ1A 1TA2A 2ANMH 1C5VA 3FP6E 3UB0A 3SGQE 4H6TA 5AF9H 4DY7B 1MTUA 3H7TA 1NM6A 1P57B 1YLNA
chains in the Genus database with same CATH topology
3SQEE 4GCHG 1V2TT 3GCTG 1GBDA 1ZRKA 4JYVH 4UD9H 2ZDMA 1DX5M 1C2MA 4YLQH 2AYWA 3TK6A 1MUEB 1GI0A 1P05A 3TNSA 1BTHH 2DE8A 1GDUA 2FYQA 1YLCA 4TYDA 3ZV9A 4MPVA 4K2YA 4X8VH 3QO6A 1Q31A 1OYQA 1AB9B 3UTUH 3QX5H 1YPKH 2WUBA 1A3EH 5GPIB 1FY5A 1JMOH 3RMNH 1OWHA 1WUNH 2Q6FA 1KXDA 1HIAA 4YOGA 1EASA 3SNDA 1SSXA 3LGUA 2BDHA 2G4TA 4OGXA 7GCHF 1WSSH 1PPGE 2VIVA 1F0SA 3SI4H 1F0TA 2Y5HA 4BXSA 4LXBH 4OS7A 4ZROA 3SU6A 4DIHH 1BHXB 3S9BA 1PQ5A 3RXUA 1F5KU 3URCA 2R2WU 3RXQA 1K1NA 1QJ7B 3F9HA 2FPZA 4UFFH 2EI6A 1BBRH 2OD3B 2FX4A 1P9UA 4IC5A 3ZZBA 2PV9B 1TQ7B 1NRNH 2SGDE 1TPOA 1GDNA 3K65B 2XRCA 1EUFA 2B5TB 2ZTZA 3M3TA 1DXWA 2ZGCA 1QQ4A 1HXFH 1MTSA 1FMGA 1XXDA 5FX5A 1HLTH 1ARBA 2XBXA 3F6UH 1SVPA 1C9PA 1TRYA 3ATLA 3VFEA 3U8RH 1W3CA 4AFSA 5C2ZA 3ODDA 3LC5A 2WPJS 1MH0A 3UQOA 2VIWA 4K1TA 3RXCA 2DE9A 1UK3A 1BMAA 3UOPA 1F2SE 2SGQE 3QDZB 3RM0H 3RM2H 1EATA 4H42U 1ORFA 2PTCE 4X2XA 4ABJA 5FX6A 2Y7ZA 5JBAS 1OXGA 2ALPA 1SPJA 4UFEH 3RXTA 1UTJA 5EQRA 2TGPZ 5L2YH 1TGSZ 2A32A 1GI5A 1Y3YA 2HNTF 1EAIA 3KGPA 5SGAE 1GDQA 1L1JA 5A0AE 3LGVA 2Q6GA 1FPCH 2VGCB 2BYAX 4CHAC 5LPRA 1P09A 3ATMA 3FANA 4MLFB 1GMCF 3MNXA 8GCHF 5JBTA 1INCA 3QTOH 1VJ9U 2RG3A 1C1QA 1A0LA 2BLWA 1Y8TA 2XBVA 4HTCH 4JK5A 1GL1A 1LPGB 1QB6A 3K9XB 5HM2A 1EB2A 1DWEH 1IAUA 5EPYA 1EZXC 1BRUP 3RXIA 2BY8X 2VVUA 1S83A 5T6FA 1CE5A 2J38A 2W3IA 3MFJA 1HUTH 3BIUH 1G2MA 3KQEA 2ZU3A 4AORA 1S81A 2ZU5A 5C1YA 3HGNA 4YO9A 4CRBA 3TGJE 1LKAA 4WMDA 4BTTB 4XDEA 5E0HA 3TJVA 1NESE 4FUEA 3PMBB 4NIYA 3M35A 1SC8U 2PW8H 3ITIA 2AGEX 1T32A 2PGQB 3A81A 3NPSA 2H2ZA 1GJBB 2FOEA 1HAVA 3VPKA 5IDKA 3OSYA 1LQEA 2YOLA 1HPGA 1P2QA 2ALVA 4K8YA 5J4QA 3F9GA 1J8AA 3B23B 3UFAA 1QRWA 2W5EA 2ZO3H 1BZXE 3GCNA 3A86A 4ABGA 1O3GA 1BHXF 1AY6H 2VVCA 1GBHA 2ZECA 3DHKH 2UWOA 1G3EA 5F03A 4DW2U 2IOTA 2EI7A 1FDPA 2Z3DA 5JBCS 1Q2WA 3MHWU 3H7OA 3P8NA 5HGGA 4OS4A 1C1PA 1FXYA 5E2PA 1P12E 2F9VA 2A45B 3T25A 1LQDB 1GBMA 3ZZ7A 1JXPA 3ZVAA 3Q3XA 1IQJA 2R2MB 1J16A 2FDAA 4B2BA 1TONA 1OOKB 2VINA 1S0RA 1FIZA 1CO7E 1P0SH 1LHEH 2TIOA 1PQ7A 1F0UA 1HAIH 2IJOB 4ZH8A 1KTTB 3ZVFA 1MTNC 2OXSA 2IN2A 2ZTXA 1YP9A 1BTUA 2VIPA 1W11U 4HFPB 4A5TS 5LPFA 4YOIA 1EZQA 3QN7A 1QR3E 3GDUA 3LGWA 4BNRA 4YOJA 1LPKB 5E0GA 5EPNA 1GI8B 1GI4A 4U32A 3ZZAA 1ANBA 1OS8A 1QB1A 1C5WB 3BG4C 1GBJA 3DD2H 1AE8H 1RGQA 3SV6A 4O97A 1WV7H 1NU7B 1D3DB 1QL7A 3SUGA 3DFJA 3E0NB 1VGCC 2BQWB 4FU8A 5DP4A 4DGJA 3SNAA 1MD7A 1CHOG 1D4PB 4OS2A 2PSXA 1O2YA 1T4VH 3GDVA 1K1IA 1GHAF 1CA0B 1O35A 1SBWA 2Z9IA 2XC5A 2HNTE 1S5SA 4MG3A 2TBSA 3T5FH 1YPHC 1UTPA 4Y7AA 1UK4A 3BTDE 1SLVB 5CHAC 1A0HB 1P10A 1C5LH 4IBLH 3RP2A 1TBZH 1BOQA 1LHGH 2FIRH 1VITH 1GBBA 1LVBA 2ODQA 3EDXB 2H1UA 2ZIQH 1YPMH 4AYYB 2G4UA 2Y82A 5DP6A 2TGDA 1CHOF 2A2QH 3RU4E 1A2CH 1C2EA 3EGKH 3P6ZB 4ZUHA 3RC6A 4A1TA 3ATIA 2UUKB 2ANWA 5A8YA 3AAVA 1EXFA 1DY9A 2ZHQH 4BAHB 2BLVA 1HAHH 1NFYA 4Y8ZA 5JPMH 1HCGA 2FI3E 1MU6B 3E91A 1D9IA 1NRSH 1BITA 1PJPA 1C9TA 5FXLA 1SGFA 1OX1A 1H9LB 2OUAA 3VB7A 1IHSH 1GI6A 4K1EA 3PMAB 1MZDA 2V6NA 1C2HA 3BTWE 4AB9A 3SW2B 4AG2A 3TNTA 1KSNA 4I8JA 3LGTA 4K1SA 2AIPA 4Y6DA 1FN6A 1FJSA 4RN6A 2Y80A 1O3AA 1YCPM 1MKXH 2GT7A 1Y3VA 4GUXA 4I8LA 4SGAE 1K22H 3M61U 3A8AA 1SR5C 2BD7A 1V2VT 4IC6A 1Y5AT 4R0IA 1UJ1A 2P3FH 2PHBA 1E37B 2UUJB 3SUFA 4A1VA 1O38A 2FTMA 4ABEA 2H9TH 1P2OA 1ELCA 3GY6A 1KIGH 1O2OA 1TNHA 1TGTA 2K1QA 2ULLA 3A89A 1IHTH 3BTHE 2FWWA 1AFEH 2J94A 1OP0A 2HPQH 5ESBA 1QURH 3SU2A 3SUEA 1DE7H 1XX9A 4Q2KA 3GCOA 2BDBA 4UONA 4BAOB 4CH2B 1G3BA 1O2GH 1XUKA 2GCHG 4M7GA 1EPTC 1RIWC 3UR6A 1PPBH 1HYLA 1UHBA 5FBEA 1NRQH 7KMEH 1YKTA 2TPIZ 4K5ZA 4QT8C 3D62A 1UVTH 3HKIB 1LTOA 3KNXA 3PMHB 2O8UA 1AIXH 1O3NA 4TPYA 1T8OA 1P01A 1SGPE 3E3TA 1WQSA 1IQLA 1EP5A 1TABE 1SGYE 1HRTH 3M5NA 5DP8A 2BTCE 1NRRH 5LH8A 3TITA 3NUMA 1TAWA 1N1LA 2H5CA 3STIA 2ZC9H 5GXPA 4CBNA 1O37A 1OWEA 1ZSJA 4FVDA 4IMZA 2P94A 4DIIH 4WWYA 4WJG2 5L2ZH 1GJ9B 3TK9A 1DVAH 3F68H 1AUTC 1UVSH 1G30B 1HJ8A 3T29A 2W7UA 1JIMA 1DICA 2A5KA 4OS6A 3IWMA 2H6MA 2FP7B 1JRTA 1ELAA 5AVDA 2CMYA 1CU1A 4FU7A 3BTTE 3RXAA 1IQKA 3VEQB 5L30H 2ZKSA 1AE5A 1RXPA 1XVMA 1L4DA 3UNRA 4ZKOU 4DVAU 5CE1A 1BBRE 3MI4A 2BY5X 1QHRB 1ABJH 4BAMB 1BTYA 3VB4A 1NT1A 1DSTA 2TRMA 2C8XB 1GL0E 1WU1A 4HI3A 4I8HA 6CHAB 4MTBA 4BAKB 2C4FH 1CGHA 1TPAE 2FMJA 3CENA 2XNIA 5EGMA 1O0DH 1W0YH 3M3VA 3MWIU 5JYIA 1FPHH 4X6MA 1THRH 1QRZA 3RXDA 2FEQH 4X2VA 1O5BB 1EJNA 2ZF0H 5EXLA 1TMBH 1PPFE 4YLUA 4WXVA 2FM2A 4O9VA 3E6PH 3L33A 5LPEA 1O3HA 1DFPA 1EPTA 4YESB 2QA9E 1ETTH 3GY3A 1B5GH 1BJVA 5DP9A 1ESBA 2ZTYA 1SL3A 4NGAH 3ZVEA 1L1NA 1XUGA 3PM3A 2CJIA 2XWBI 1KXFA 1KYNA 1O2KA 2C8YB 1FZZA 3RXEA 4U2WA 1J14A 4I7YH 1A5GH 2ZGBH 3RXFA 4SGBE 2GDDA 1MQ5A 1Y3UA 1C2GA 3S9CA 1CBWB 4LZ4B 3FZDA 1CA8B 1G3CA 1TNGA 5FCRA 1AU8A 1XUJA 1A1RA 4Y71A 1H4WA 5GCHF 1BRAA 3MNCA 3BTKE 1TNIA 1DLKB 2F9NA 1EJMA 1TQ0B 4IGDA 1AO5A 8GCHG 3A80A 1AVXA 4AGJA 3VB3A 1ZHMA 2OINA 1OKXA 1QBOA 1Y59T 3A7WA 1AFQB 1C2KA 4K3JA 1FLEE 3SN8A 3A8BA 1ELGA 1NZQH 2ZHEH 1UVOA 1DS2E 1KLJH 2P95A 2YNAA 3UUZA 1W13U 2BD2A 4FUBA 3E90B 4NSVA 3TU7H 4CRGA 2NU3E 1RFNA 2QXJA 5EXMA 6LPRA 2R9PA 1P9SA 1HAZB 4WY3A 2Q6DA 5GCHG 1P2NA 1AZZA 1J17T 4B76A 3KN2A 3SHCH 3RLWH 4H4FA 1C5UA 4ZAEA 4NSYA 2QCYA 3OTJE 1ZJKA 4IN2A 2ZGHA 2V3OH 4DOQA 3EYDA 2BD4A 3PO1C 1SGTA 1RTKA 4INHA 4UFDH 2ZCLP 3Q00A 1SLWB 2VH0A 1RIWB 1T7CA 4X1RU 5C1UA 3ZZ4A 1BJUA 1CGJE 4JZFH 1TOMH 8ESTE 2FXRA 3RU4T 3BEUA 1O3MA 1C1NA 2BLOA 4YTAA 1TMTH 3SNCA 5EOKA 2ZFRH 1O3DA 1SQTA 4NFEA 5C5OA 2Y5GA 4B73A 1GJ8B 3BG8A 2RCEA 1ZTLA 3RXMA 2QC2A 3JZ2B 4CRDA 2XW9A 2OC7A 4GVUA 1IOEA 1C4Y2 1MTVA 4MPXA 5C5NA 1O2ZA 1S82A 3GISB 1FAKH 2FOMB 1ABIH 1ZGVA 1QNJA 1RD3B 1HXEH 1L2EA 1MKWK 1C1OA 4FVBA 3MH6A 3GY8A 1GMDF 2VWNA 2H9HA 4TWWA 1ZLRA 1P8VC 2NU2E 2ZP0H 4VGCC 4B75A 1O5DH 3M5LA 3TGIE 1KDQA 2WUCA 4FUFA 2ZDKA 3D65E 3Q3YA 1BTPA 3RXJA 2WPKS 2ZPRA 3U8TH 1AKSB 4XBBA 2Z9LA 1GHAG 1TRNA 2A1DB 3UNQA 4ASHA 1HAXB 1CBWC 2UWLA 2ZQ1A 2FOAA 2I6QA 1QCPA 3U8OH 5DK1A 2BX4A 8KME2 5DO4H 2BZ6H 1SGQE 1ZPCA 2F9UA 1SLUB 3B8JA 1NRPH 2QXGA 1GJ7B 4YT7H 1K9OE 5F8ZA 1NTPA 3MH5A 3BG4B 3RXGA 3ZZ6A 1WQVH 1EOLA 4K60A 3E1XB 3Q77A 3NKKA 5T3HA 1SGRE 3WY8A 4LZ1H 3ATKA 4MDSA 3EAJA 1H8DH 1NC6A 4BAQB 3SV2H 4AFZA 1C1WH 1MQ6A 2SGPE 1SGEE 1Z71A 3TH4H 3LGYA 4X6NA 3EA8A 3UWJH 5HXFA 3D23A 2C93B 4Y0ZE 5FPTA 1FY1A 3MU1A 3S69A 2AMQA 4GPGA 1QRXA 2XTTB 8LPRA 3M5MA 2ZHFH 2FS9A 2GZ9A 2ESTE 2OLGA 1UTMA 1J9CH 4E7NA 1C5TA 1PFXC 1HJAB 1C5YB 4JZIA 1H9HE 3SZNA 1MTNB 1BMLA 1VR1H 2GP9B 5I25A 1YCPH 1V2MT 1B0EA 2OQUA 2NU4E 1DPOA 4ZHLU 5A0CA 2RA3A 1GVZA 1C2JA 3GOVB 5DP3A 4CREA 1A5IA 5DPAA 1VITF 1C5SA 1RRKA 3I77A 2G51A 4Q7ZA 3ZVBA 1O2WA 2CHAB 4IMQA 3PTNA 4I32A 3PROA 3URDA 3IITA 4U30A 2PLXA 1GMHG 1HB0B 3UOUA 1W7XH 2CGAA 1S84A 4AYVB 1LVMA 2C90B 1IQGA 1UMAH 2TGTA 2LNCA 1HAOH 1XVOA 2BD9A 2Z3EA 3E8LA 2HALA 2A4RA 2BB4A 4AX9H 2G00A 2R0LA 3SGAE 1GBAA 1GGDB 2ZU1A 2BQ7B 2GV7A 4AFQA 1O2SA 3O8BA 2ZFQH 1MCTA 5CHAB 1P02A 1ELEE 1OPHB 2ZFSA 1VITG 1ZZZA 2P93A 3ZVGA 1GPZA 1ZHPA 3BSQA 1JRSA 2VIDA 2BQ6B 1NO9H 2F83A 2Z9JA 1C2LA 2SGAA 1N8OC 4XBDA 4XSKU 5FBIA 1JBUH 5F8TA 4J1YA 1NPMA 2AS9A 2QIQA 3LOXA 2Z94A 1C1SA 1O2MA 1O2JA 3UNSA 3KHVA 4KTCA 2G8TA 3SO3A 3VXFH 1P3CA 3AAUA 3I29A 4UFGH 4CR9A 3ZV8A 1C5OH 1LVYA 3RLYH 4ZXXH 1GI3A 2WV4A 1O36A 4NIXA 5EQSA 1UTQA 1TMUH 2XXLA 1XXFA 1O3JA 1GMHF 3MMGA 4ZXYH 3ESTA 2QF0A 2ZGXH 3UREA 2ZFFH 2FYRA 1RS0A 1AN1E 1OWKA 3U1JB 1U6QA 1GBLA 4B71A 1ZR0A 1SGDE 2ASUB 3VGCB 1SHYA 1HGTH 3QGJA 3OX7U 3STJA 4LK4A 1SOTA 2HNTC 4KTSA 3N7OA 5EU8A 3W94A 1W10U 5BPEA 4MNYA 1DDJA 2V35A 3T27A 3RXRA 2ZDLA 5E0JA 2CF9H 1ESTA 3SU1A 3PO1B 3M7TA 2VIOA 3A85A 1AMHA 1KLTA 3O8CA 1UTNA 1GBKA 2AIQA 2SGEE 1SFQB 2BD5A 3D49H 1XM1A 3ZVCA 3A7ZA 2G5VA 4DCDA 4NIWA 1ZMLA 2A4GA 3LONA 1K1LA 1P11E 2BDYA 5FHTA 4A1XA 1EAUA 2BD3A 5ABWA 2B9LA 1KXCA 1FI8A 4JZDH 3ZZ9A 3QWCH 3E0PB 3M36A 2ZWLH 4JYTA 1MD8A 2O8TA 2XBWA 2AMDA 4A6LA 2FOBA 1TALA 3C1KA 1O3EA 1TNJA 2G55A 3DA9B 3DUXH 1CQQA 5AFYH 1PPHE 3VGCC 1HAYB 2FI4E 4MNWA 3PTBA 1HAVB 1UO6A 1B0FA 4FXGH 1V2KT 4X2WA 1Z8JB