1GI6A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi6A02
3BTDE 1HAOH 3LH1A 1BJUA 4A7IB 4OS6A 3UWIA 4X6NA 1SOTA 1MTVA 3V3MA 2VVCA 1W2KH 2Q6FA 1AN1E 2BD9A 2Z9LA 3EYDA 4FUJA 1GJCB 4GCHG 2UUYA 2ULLA 1T8MA 2FESH 3AAVA 4D7FA 1IQIA 1AKSA 4NIVA 1HAXB 4AG1A 2BY7X 1WCZA 1C5OH 1GMHG 4K8YA 2A4QA 1SL3A 4FUHA 4X1QU 1O3HA 3GY2A 2ZQ1A 8ESTE 1TQ7B 4XBBA 2M5TA 4DT7B 1AGJA 1UVTH 1A1RA 1FPHH 3TITA 2PGQB 4GVUA 1GMHF 1TMUH 1KIGH 4BXSA 5EW2H 3SNBA 1F0RA 3LH3A 1O2RA 4D7GA 4IN1A 4YLUA 2BHGA 1W0ZU 2O8TA 1TMTH 1EB1H 2Z9KA 1FY4A 1FY5A 1BRAA 4K2YA 1GI6A 3P8FA 3ZVBA 2WINI 5GIBA 4ZUHA 3RXVA 5PTPA 1EATA 3AVZA 5K7RA 3ATMA 1H9LB 1TOCB 2SNVA 1UHBB 1NRPH 3JZ2B 1GI9B 2A32A 1SQTA 5J4SA 1BTUA 1GBIA 1A3EH 1GCTC 4IN2A 7LPRA 5JBTA 1MTNC 1A0HB 1LVMA 1DM4B 4JYTA 3AW0A 1A3BH 1GMDG 1HRTH 2Z9JA 5FPTA 3KL6A 4FUCA 2D2DA 2AGGX 4JCNA 2BZ6H 4AFQA 1LVYA 2GDDA 4IW4E 3DD2H 1TB6H 1HGTH 2D8WA 2G8TA 1Y3YA 1GMDF 3AAUA 3U8RH 1LHEH 3E91A 2G81E 5HGGA 4DY7B 1CE5A 1K1LA 2OC0A 1AI8H 1DFPA 3PB1E 1HXFH 1YLDA 1Y3WA 1QCPA 1Y5BT 3DFLA 4RKJB 4DJZB 4YM9A 1C2MA 5A0AE 1KXCA 1EZQA 1OWKA 4UFFH 2GCHG 5ETXA 1A46H 2VNTA 1L1GA 4WMFA 3UQOA 1BTWA 2ALPA 1UVOA 1DITH 1HUTH 2EI8A 1GHZA 4MPVA 2GCHF 2KAIA 4E7NA 2ZECA 2BY5X 1P06A 1VJ9U 1P8VC 4CRAA 3F9GA 3RU4E 3BV9B 2AYWA 1LPGB 3A83A 1C5QA 3GCNA 4X2WA 3ZZDA 2C3SA 3ODDA 4FU7A 1G3EA 2OLGA 3LU9B 4NFEA 1HPGA 2D1JA 2OC7A 3FZZA 2G00A 3A8CA 3SNCA 1UTQA 2JKHA 3RXLA 2Y7ZA 3K65B 2FOAA 1VITG 3MU0A 1ZJKA 4ASHA 5FX5A 2QCYA 2QAAA 1FLEE 1CA0C 1SHYA 1OWEA 1RTKA 2AIPA 2OUAA 1C1SA 1VITF 3D62A 4KGAA 3SGAE 4IC5A 1ZPCA 3DUXH 2C93B 1TA6A 3QO6A 1ETSH 3VB4A 3RXMA 1ARCA 1MZDA 3T62A 1P04A 1NC6A 3ZZ6A 1QFKH 1Y3XA 2TIOA 1GHAF 1ZHMA 3RP2A 1DICA 3P8NA 5HXFA 1KYNA 4CH2B 1S81A 1A7SA 2VIPA 1ZSJA 1HAZB 4MQAA 2CXVA 5T6GA 2FS9A 2AH4X 4TWYA 3SV9A 4UFGH 2W26A 1DPOA 2Z9IA 2BXTH 1G37A 2OBQA 1LMWB 2EC9H 5DKMA 2QXIA 1O3LA 3DT0H 1VCQA 4X6MA 1GI2A 2QA9E 2RA3A 3MU5A 2FODA 1TRMA 1QB1A 4Z0KA 2QY0B 1OXGA 1E34B 1EASA 4INHA 2TPIZ 4X2XA 1OPHB 4FVDA 2QGRA 3L6PA 1PPGE 4I8HA 1GBJA 1C1QA 1TPSA 1KXEA 4RKOB 1NRRH 5DJ7A 1P2MA 1EPTA 4X1PU 4WVPE 3LGYA 1DWCH 1Y3VA 2BD7A 2FEQH 4XBDA 3QTVH 3BG4B 4Z6AH 1C1NA 3M5MA 3MYWA 4B73A 3ATKA 5A8YA 1O2SA 4WH8A 2PUXB 2PSYA 4KTSA 5GCHG 3EA9A 2F83A 1EJAA 1QNJA 1SLUB 1O0DH 1UTJA 1C5UA 1HB0B 1SI5H 2VWNA 4Y79A 1SGFA 4RSPA 3PMHB 1ZPZA 3BTGE 3M7QA 2BXUH 1F2SE 4UD9H 1YCPH 2XWBI 2FOFA 2ZG0H 2FTLE 5GCHF 4J1YA 4Y8ZA 3LC5A 3PWBA 3M7TA 1ANEA 2VWMA 5EQQA 1EJMA 1MKXK 4X8SH 4Y71A 1AMHA 2H9TH 4X2YA 2TGTA 1O3EA 5GPIB 3OTJE 3SU3A 2XCNA 4I33A 5J4QA 3GYLB 3FP7E 1ANDA 4JZIA 2XXLA 1XUFA 2BZAA 4AG2A 1DDJA 1AB9B 2ZZUH 2BD8A 4M7GA 1TX8A 4NCYA 4O3UA 2AERH 3F9EA 4WY3A 2B8OH 2ZIQH 3A8BA 4X8UH 1F0SA 1B0FA 2GV7A 3SU5A 3S9CA 1AVWA 3V0XA 1C2GA 3TH4H 2WV5A 1DSTA 3A80A 1KDQB 1GI1A 3UIRA 3RM0H 1O34A 3ESTA 1UTKA 1O3CA 1E0FD 3BIVH 3LPRA 2ANKH 2VINA 2ZDAH 4GHTA 1GJ9B 2A7JA 1L1JA 2WPMS 4BANB 2DUCA 1PFXC 4WXVA 2LPRA 2ZPSA 1EX3A 1C1VH 1YPJH 2WPJS 3ZZAA 1O2YA 2GV6A 4FUDA 1GG6C 2EI7A 1GBKA 2I6QA 1CA8B 5FPSA 1C5XB 1NM6A 4ZH8A 3M3VA 1AFEH 1INCA 2Z6BD 3RXRA 3I78A 2QF0A 4IS5A 3GY3A 4GUXA 4LXBH 2FXRA 1WTGH 1MUEB 1BCUH 2WPIS 2V35A 1DXPA 5EXMA 1WOFA 5C5OA 5C67A 3L33A 1XXDA 3KQDA 2HPQH 2J94A 1L2EA 5ABWA 2DE9A 1CHOF 1EOJA 1P05A 3RXJA 2VGCB 1TYNA 2IJOB 5E0JA 3SNEA 1AHTH 4MNVA 3UOUA 2SGDE 1TGTA 3F1SB 1TGCA 4I8LA 1QRXA 3ATIA 5F03A 1E35B 4D76A 3GCTG 5AFZH 3BG4C 3ATWA 2TGPZ 3U1IB 4XSKU 4HZHA 1D9IA 4OS4A 1LKAA 1C2KA 3IG6B 5DGJA 1V2UT 4X1SU 2BB4A 7KMEH 1Z1JA 3MNSA 3GCHB 3S9BA 1P11E 1Z1IA 4K1TA 1O3JA 1TQ0B 4KTCA 1S5SA 1FNIA 4DG4A 3U8OH 1SGFG 1LHCH 3SI3H 2P8OB 3HGPA 3A88A 5GWZA 1K1OA 1C2JA 1UVPA 1T8OA 2P16A 5F6MA 4R0IA 4YESB 1NESE 1GI0A 3OSYA 1RRKA 3RXAA 1XKAC 1DX5M 1HAPH 3RXCA 3U98H 2R2MB 5T6FA 1C1OA 3RM2H 1AVXA 4A1TA 1AB9C 1XX9A 1HIAA 1TGSZ 1V2PT 3KF2A 3NWUA 1C5SA 1O2XA 1O3PB 4B71A 2GZ7A 5FCRA 2ZHFH 1TX7A 3NK8A 1OP0A 1KTSB 1ID5H 1BIOA 1W10U 1BRCE 4ISOA 2QIQA 2UUJB 3RUOA 1BJVA 1WUNH 5AF9H 3UY9A 2P3UB 4YZUA 3QN7A 1Z8GA 1A5IA 5LGOA 2A5IA 1GMCG 1QTFA 2ALVA 4IBLH 3SHAH 1QRZA 4TY7A 1PQAA 2C4FH 1CO7E 1OWHA 1CQQA 2H6MA 2Z7FE 1W3CA 1C5TA 1GMCF 3RXGA 1V2KT 2BD2A 1HAVA 3WY8A 2NU1E 1TX6A 1PPHE 2F9VA 2PUQH 2PSXA 3N7OA 5DO4H 1IQMA 3PMAB 1F7ZA 2P94A 1T4VH 1H4WA 1N8OB 3SNAA 1HJAC 1S83A 1Z71A 2XC5A 1LVOA 1O38A 2FI5E 2BD3A 2OQUA 3P92A 4HTCH 1LTOA 1MU6B 2BX4A 3Q3KA 4WMDA 3MO9A 5DP5A 2Q6DA 3U1JB 2EA3A 3GY4A 3FFGA 1CT2E 1AKSB 5SGAE 2A4RA 5L30H 1BA8B 1ELCA 3A86A 1MAYA 3UNSA 1P2QA 4U30A 8KME2 1EB2A 1P10A 1UJ1A 1CBWC 5E8EH 4LZ1H 3AASA 3ENSB 3ZZ9A 1MQ5A 1O2HA 1W8BH 3A7ZA 3ZVCA 1P12E 1H8IH 4SGAE 1IQNA 1C1PA 1OP8A 2OC1A 2YNBA 4O3TA 1ZTJA 1GWAA 2BLWA 3MH7A 3QUMP 2XC4A 3EGKH 1XXFA 1ZMJA 2ZU1A 1JBUH 4XFQA 2A2XH 5DK1A 4A92A 5JB8S 2F91A 1YPHE 4KKDA 1HJ9A 2R3YA 4OS2A 1IQJA 1S85A 2HALA 1JIRA 4GPGA 1RIWB 1EJNA 1O2JA 3OX7U 8GCHF 3QWCH 3KIDU 1SGNE 1O2TA 2OBOA 1KTTB 2ANMH 1C1WH 4CRFA 1GHBG 1TRYA 1O2PA 2P59A 2R0KA 1K21H 1BB0B 3SI4H 4GAWA 2FX6A 2P93A 1RXPA 3ZYEA 2ZCHP 3HATH 3S69A 1ZR0A 1V2NT 3PM3A 1GJBB 1O5GH 2PKAA 3F9HA 1AVGH 2Q6GA 1GL1A 1PPZA 2R2WU 1D6RA 3IITA 2FI3E 2FOGA 2ILNA 2J38A 4E05H 5JBAS 2AEIH 3Q3XA 1C5PA 1HLTH 3MU8A 3URDA 2Y81A 1GI5A 1MTWA 2ZHQH 3VB6A 1MH0A 1Y8TA 2JH0D 1UK2A 5E0GA 4B1TA 3UREA 3M35A 1SLWB 1HXEH 2Z3CA 2K1QA 2R9PA 1VGCB 3D23A 1SC8U 2OTVA 3VB3A 2JH5D 4NIXA 2A7CA 2FOMB 4JMYA 3E16B 3U8TH 1C2EA 4MTBA 2RCEA 1SGCA 4GCHF 3TPIZ 2GT8A 5TCCA 1LHFH 2H9HA 1ZTKA 2BOHB 2P3TB 2C8ZB 2AMQA 1O3IA 4U32A 1C5VA 1ELAA 2BDCA 3CS7A 1RGQA 3DFJA 1TALA 5DP6A 1OP2A 1N8OC 2A7HA 1KLJH 4Y7BA 5A0BA 2KAIB 4LOYH 1FPCH 3T28A 4CR5A 2ZI2H 3SQHE 5K0HA 2GZ9A 3PTNA 1B7XB 2VIVA 1D3DB 3LOXA 1DLEA 1FN6A 5FPYA 3RXSA 2P95A 1IAUA 4IGDA 2YNAA 3SUGA 4IMZA 3ATLA 4NSYA 1EKBB 4NFFA 1ZYOA 1YCPM 3A7VA 2VH6A 2BOKA 1EUFA 1SLVB 1G30B 1QL7A 8LPRA 2GX4A 3B23B 3PV4A 3RXTA 1TLDA 1YP9A 1RS0A 4WMEA 1MCVA 3GDVA 3A85A 5E0HA 3UNRA 5BPEA 2BQWB 1ESTA 3GDUA 3E3TA 2BDHA 4Y8YA 1V6DA 3HKJB 1C2IA 3QK1A 1NRSH 2PWXA 4NIYA 3VPKA 5JPMH 2D26C 4ZKNU 3G01A 2O8MA 3SORA 1Q2WA 5EPNA 1NFXA 1A4WH 1FAKH 1SQAA 1BRBE 3S0NA 4ZHLU 3RXEA 1T7CA 4UEHH 1GI4A 2J2UA 1AZZA 1FXYA 4NA9H 3PLBA 1C2DA 1W7GH 3KN2A 1V2VT 3VGCB 1T8LA 1EAWA 2IOTA 5EGMA 2BY6X 1RIWC 2XC0A 2H5CA 1EOLA 1FUJA 1O2WA 2Z9GA 1O5EH 4I7YH 1OWJA 3ZZ8A 1AWHB 3IWMA 1S82A 3EA8A 1NY22 1DY9A 1W0YH 2WYGA 3D65E 2PTCE 4K69A 2BD4A 1GBCA 2FOBA 3EAJA 1ZSLA 3SV2H 5CHAC 2G51A 1K2I1 2H2ZA 1O3NA 2PKSB 1NZQH 5C20A 2XW9A 4ZAEA 3Q3YA 2PV9B 1TFXA 2QF3A 1BMNH 1UTMA 1GVKB 2R3UA 1EPTB 1UTOA 4ISNA 1Y5AT 3ITIA 4O97A 5FHTA 1O3KA 4I8JA 1K1MA 1XM1A 4BTUB 1VGCC 1W13U 2RDLA 2F9OA 1SHHB 1Z6EA 3LONA 2W7SA 3TK6A 2NU4E 2BQ6B 4Q7YA 5JDUB 1TPAE 4TY6A 1YPLH 1XVOA 4D9RA 1H1BA 1SFIA 3SU6A 3K2UA 4E7RG 1C2FA 4I32A 5E2PA 1MKWH 3P17H 2BVRH 3ZV9A 2O9QA 3ODFA 3QZQA 4X1NU 4FUEA 2VJ1A 4UONA 2GZ8A 2OC8A 4OGXA 4I31A 1LKBA 2H5DA 1SR5C 1IOEA 1VR1H 4MNYA 3TGJE 5FBEA 1ZLRA 3SUDA 3MH4A 3E0PB 2ZC9H 1C5ZB 2HNTC 3W94A 2FLBH 7ESTE 3K6ZA 3SJKA 1EP5A 4YOIA 3FP6E 3RXIA 1BT7A 3HKIB 4ZKRU 4Y0ZE 4D8NA 1ELFA 1ELVA 4O9VA 1O5FH 3UPEA 3BEUA 1EZSC 1C9PA 4CBNA 1K28D 1EAXA 3PMJA 3TH3H 4K5ZA 5A8ZA 1GJ7B 3TJOA 1BTHH 1O2GH 3GY5A 1C4V2 1G2LA 5FAHA 3UOPA 3UQVA 4AYYB 1MQ6A 3A87A 1UTPA 4ABEA 4YTAA 4B74A 1YCPK 1GJ4H 2ZDVH 2ZFTA 1EAIA 1FIZA 2XWAA 7GCHG 2ANWA 2RG3A 3SU4A 1MD8A 1O33A 3VGCC 2Z94A 4NWLA 2ZHDA 2VB0A 4THNH 4ZHMU 3E1XB 1FI8A 5L2YH 1O5BB 1ELTA 4JYUH 1YPEH 1BTZA 1HAYB 1ETTH 3SV8A 2A4OA 4JK6A 4Y10E 5FX6A 1UMAH 4U01A 2ZEBA 1D3PB 3HK3B 4PROA 3PTBA 3PYHA 1GHXH 1DWDH 1SGRE 3BEFB 3B9FH 3RU4T 4WF8A 1GHYH 2PKSC 2ZHEH 3KQBA 1HFDA 1IQHA 2WYJA 1N6YA 1V2MT 4TPIZ 1QBVH 1PJPA 1GBDA 1TNHA 1EPTC 4NIWA 5DP3A 4Q7XA 2ZO3H 3M5LA 1LVBA 2V0BA 3GY6A 3RXHA 1O2VA 1SOZA 1TBRH 5FXLA 1O35A 4BAQB 1AE8H 2GP9B 2ZDLA 4LZ4B 2JETB 4YOGA 2ODYB 4CRGA 5JBBS 3GICB 1ZRKA 3GISB 2ZU2A 4CRCA 2HLCA 1HYLA 4FUBA 2XYAA 1K1JA 1GI8B 4INLA 2QC2A 1E37B 3RC4A 3KHVA 1QL8A 2G4UA 1D3TB 3BG8A 1XUHA 1LPZB 1HJ8A 3FZDA 3S7HB 1QY6A 1G9IE 2BVXH 3T29A 1DLKB 3KQCA 1MTSA 1AZ8A 2CHAB 1QHRB 3BTFE 3RDZA 1FN8A 1EZUC 3SU0A 4XBCA 1NTPA 1O2UA 4NA7A 1DANH 4H4FA 1SVPA 1HIAB 1KLIH 1QL9A 3QGJA 2WPKS 3BN9A 3GY8A 2Y5GA 5H4IB 4INKA 1O2QA 4Q2KA 1BMMH 1CGHA 3BEIB 4NG9H 1P01A 2FOCA 1S6HA 4Q7ZA 2ZTXA 2HPPH 5F8XA 3OYPA 2NWNA 1UCYH 4Y0YE 1RTLA 1MTUA 2FP7B 2FYQA 2GT7A 2WV4A 3BIUH 3ZZ3A 2ZU3A 5FCKA 3RXBA 3E90B 1KXDA 5A8XA 1QGFA 1AUJA 3Q00A 4WXIA 4X8TH 5IDKA 5DP9A 4MPWA 1BQYA 3RLWH 2B5TB 1GCDA 4OGYA 5ESTE 4UFEH 3CP7A 1AU8A 2FLRH 2ODPA 2DE8A 4ZMAH 2A0QB 3F6UH 3SUEA 2XBWA 1HAVB 1QQ4A 2HVXA 4ZROA 3EQ0H 4DCDA 3BTEE 3M3TA 3ZVGA 3ZZBA 4MG3A 2W5EA 1FONA 2WPLS 1MU8B 1TPOA 2W3IA 1SQOA 2IPHA 5FBIA 1EAUA 2WUBA 5LPFA 1K1NA 2SGEE 2UUFB 1NS3A 3GCTF 3MH5A 1C4Y2 1O3FA 1UK4A 3CS0A 4AGJA 5L2ZH 2F3CE 4AFUA 1S0RA 1O32A 3LJJA 2GDEH 1EZXC 1A0LA 3K9XB 3LGUA 5HM2A 2G52A 2ZFFH 1FY8E 3SGQE 1NFWA 2B0FA 2WPHS 3SJ8A 2HNTE 1THSH 3TGKE 1OWDA 1GJAB 3PWCA 4DOQA 6GCHG 1F0TA 1CSOE 2JETC 4FXGH 1LQEA 1WBGB 1C4U2 5LPRA 3MHWU 2PGBB 5LPEA 4ISLA 3H5CB 3ZVAA 3PMBB 6GCHF 1NU7B 4D9QA 2J9NA 2V3HH 5EOKA 1MMJN 1VZQH 1XUIA 1F5KU 3MI4A 1DVAH 2A31A 3RXUA 3RLYH 4BOHA 3O8DA 3LT3A 4MVNA 1GDNA 3URCA 1G3BA 5DP7A 2ZTZA 1FQ3A 4CHAB 3A89A 1OX1A 2CHAC 1QBNA 2VVUA 4ABIA 1YKTA 1C5MD 1YGCH 4JZDH 5F8ZA 2ASUB 1ZSKA 3SUFA 1Z6JH 2ZU4A 1BDAA 2XCFA 3GYMA 5E2OA 1DE7H 3P8GA 3I77A 1YC0A 1ZMLA 1GBBA 1W11U 1LCYA 3ZVDA 1OSSA 2HWLB 1QJ7B 4J2YB 1O31A 5DP8A 1KLTA 4IMQA 3A81A 1JRTA 3OU0A 3QZRA 1LO6A 2RA0A 3PO1B 1GGDB 4GHQA 2CF8H 5CE1A 2PKAB 4FVBA 3HPTB 3SJOA 3SJIA 3PLPA 3SV6A 5I25A 4HGCA 1C5YB 1G3DA 4B2AA 1C1RA 1H9HE 3MTYA 5EG4A 1RTFB 3M36A 3BTKE 2A2QH 1S84A 3KEEA 1GL0E 1W14U 2VGCC 3O8BA 3TK5A 3O8RA 1TE0A 1PQ8A 1ZHRA 2VWLA 3UUZA 3NCLA 4XE4A 4UE7H 2PHBA 1X7AC 2FM2A 5EPYA 3LIWA 1JWTA 1A5HA 4DGJA 3QLPH 1GBHA 1IQLA 2O8WA 3RMOH 2J95A 3ZZCA 1TABE 1SGEE 1RD3B 3LKWA 4BNRA 3ZYDA 2FZZA 3A8DA 2XRCA 3KNXA 3GCHC 1B0EA 1P2KA 3T26A 1W12U 2OQ5A 1GDQA 1A5GH 2PR3A 3V12A 4QT8C 1O3DA 2VIOA 4X1RU 1AWFH 1L0ZA 3Q77A 3QGNB 3S7KB 1AO5A 1HAIH 1HAGE 1SGTA 2P8OC 5GXPA 1O2NA 4TWWA 2I6SA 5ESBA 2BDIA 2QXJA 4BAMB 1MD7A 1BMAA 1F5RA 2OCVB 2Y7XA 4BTTB 1IQFA 1Z8IB 5JBCS 2GD4B 3GOVB 1GJ5H 1NFYA 4NSVA 2O8UA 3BTWE 5HM9A 4ABHA 3ZVFA 1ELEE 1KSNA 5DG6A 3LGWA 1SGPE 1YPGH 2BY9X 4NA8A 4Y8XA 1V2TT 3FVFB 1GCTB 2QYIA 3BSQA 3O8CA 2B7DH 2BX3A 1ZPBA 1THRH 2BVSH 2PLXA 4I8GA 1OKXA 4NZQA 4YO9A 1GVLA 3U69H 1H8DH 1V2ST 3RMLH 1QJ1B 5AFYH 1ZRBA 1C9TA 5HYOA 3NUMA 4ZHAA 1BTPA 2ZFPH 1O5CB 1P9SA 3EA7A 2B9LA 1GHBF 1KY9A 1O2IA 1T8NA 2ODQA 3ZZ5A 5LH8A 4BAOB 1HDTH 1SGDE 2VIQA 1OYTH 2A5AA 2VIDA 1SLXB 4BAHB 4A6LA 3TJVA 1BOQA 1HV7A 2Z3EA 1FY3A 3E8LA 1P02A 1C2HA 3ZVEA 3MNBA 1BHXF 1GJ6A 2G5VA 1WAYB 2VIWA 3U9AH 3PO1C 1FY1A 1DSUA 2PTNA 2Y82A 1V2OT 1ABJH 2ZFSA 3TNSA 1O5DH 2BDBA 1BRUP 3OY5U 1QR3E 3M61U 1TIOA 2FPZA 1ELDE 1SSXA 1W7XH 2FOEA 3SQEE 2SGAA 1MBMA 2HRVA 1JRSA 4ABGA 5AHGH 1BBRH 1C5NH 1P2JA 2BLVA 2EEKA 2PFEA 4YT7H 2AGEX 1LHGH 2ZP0H 4JZFH 1CHGA 4AB8A 4B76A 3TJNA 4JZ1A 2V6NA 3C1KA 1FIWA 5AVDA 2ZFRH 1GBMA 4MNXA 1ETRH 1O2MA 3P70B 1F0UA 4A1XA 1VCWA 4FU9A 3ELAH 2FWWA 2FYRA 2O8LA 2FOHA 3R3GB 2ZDMA 5B6OA 1J14A 3NZIA 4X0WU 1O3BA 1CA0B 2AMDA 1TAWA 3VXFH 1YF4A 3A7TA 3FANA 1MCTA 1ABIH 3JZ1B 1Z7KA 3A7WA 2ZKSA 2FI4E 1JOUB 2ZWLH 2FTMA 2NU2E 1U6QA 2Y80A 2BTCE 3BTHE 1AD8H 4CH8B 1UVSH 3MMGA 3KCGH 4H6TA 3A7YA 1NU9A 3I29A 4NWKA 1BTXA 1P03A 5F8TA 1PPFE 2BLOA 1O2OA 2FMJA 3QX5H 4DW2U 3NPSA 1C1UH 3Q76A 5CMXH 4KELA 4ISHH 4DURA 4MLFB 3DHKH 1GBTA 4AFZA 3L3TA 2CGAA 1P2IA 2CMYA 3FAOA 2NU0E 1RFNA 1ZOMA 4WJG2 1ZTLA 1O3AA 1NRQH 1F5LA 1D6WA 5A2MH 3VFEA 1MKWK 1ANCA 2ZGBH 4ABBA 1UCYE 1TA2A 2GMTB 1NT1A 1P57B 2THFB 5T6DA 1O5AB 5DPAA 3TLOA 3OY6U 2TGDA 1B5GH 5EQRA 5C1YA 1SB1H 4B75A 1H9IE 1BTYA 1GPZA 1FV9A 1YPMH 2QV1A 3R0FA 1XMNB 3RMMH 1ESAA 3BTME 3TK9A 3TNTA 5C2ZA 1S0QA 1SMFE 1P2OA 4K3JA 4ABAA 2W3KA 2J92A 1ARBA 4NZLA 1L4ZA 1V2WT 2UUKB 4JZEH 6ESTA 1UK3A 3TGIE 5IYTA 4Q80A 4K8BA 1SGYE 1IQKA 1Y5UT 1V2QT 3T5FH 2HOBA 2NU3E 3VEQB 1C5RA 4CBOA 2A4GA 2C8WB 4XDEA 3LGTA 2BLQA 2ZQ2A 1PQ5A 3VXEH 4AZ2B 1P2NA 1V3XA 1ZMNA 4MPXA 2ZGCA 4YT6H 4AYVB 1ZGIA 1P09A 2Q1JA 2C8XB 1TPPA 4SGBE 2ZPQA 4WH6A 1ANBA 2XTTB 3TH2H 5EW1H 3KQEA 1HBTH 3TJUA 2TBSA 3RXPA 1GHVH 1YM0A 2BQ7B 2P3FH 4AX9H 4CREA 2ZA5A 3TU7H 1KXAA 4ISIH 1FZZA 2IN2A 1O2KA 2PW8H 2VU8E 4MNWA 3SZNA 1WYKA 1K1PA 1QA7A 3K6YA 6CHAB 4MPUA 5BRRE 3TIUA 1TBQH 2TRMA 1C1MA 2ANYA 2F9UA 3GY7A 1GHWH 1GVZA 1UHBA 3FP8E 2ZHWH 1AFQB 2ZNKH 1GBEA 1G36A 4Y6DA 2EI6A 1TNLA 2Y5HA 3LJOA 1GHAG 1G32B 2G55A 4GSOA 4IC6A 5T3HA 4BXWA 1G2MA 2V3OH 1GG6B 1N6XA 2BYAX 2ZTYA 1CGJE 1SFQB 1IHSH 5GDSH 1D3QB 3PLKA 1DUAA 3F68H 5GJ4B 1GJDB 3RXFA 1VJAU 2J34A 4AOQA 4FUFA 2J4IA 1SGQE 4F49A 1DS2E 1TNIA 2QXGA 1OWIA 2GVFA 3RC6A 3BTQE 2BMGB 1CT4E 4AORA 2ZGHA 7GCHF 4WWYA 3MWIU 1LHDH 1NPMA 1MAXA 2ZFQH 4CRDA 1LDTT 3AW1A 3H7OA 1YLCA 3SNDA 3ZV8A 1PPBH 3RC5A 3PROA 4R8TB 3MO6A 3NXPA 3EE0B 5EQSA 3RXKA 2OXSA 5L6NH 2ZGJA 4LK4A 2OP9A 1WV7H 2GMTC 1GJ8B 2F9PA 1TBZH 4Y7AA 2YOLA 1KXBA 2H1UA 3MU4A 1DWBH 4ZKSU 2F9NA 5C1XA 1QJ6B 4AN7A 1C5WB 4MDSA 1ZGVA 6LPRA 1XVMA 1BMLA 2ZU5A 1E38B 1QB9A 1F92A 4Y11E 3ZZ7A 4ABJA 1AQ7A 1EP6A 4H42U 3T2NA 3TVJB 1ORFA 1Q31A 3LC3A 2SGPE 4OS5A 4TYDA 4ZXXH 3SJ9A 1GI3A 3UR6A 2XBVA 5DP4A 5C5NA 1NFUA 3STJA 4RN6A 1UCYK 3B8JA 3SGBE 2A5KA 4BTIB 3SV7A 2ZDNA 4OS1A 2XBXA 1UTLM 3P8OA 1A61H 1P3EA 4K1SA 3UR9A 1ESBA 1HCGA 2C90B 1TMBH 2OINA 2AIQA 3UNQA 1L1NA 2CJIA 3HGNA 3RXQA 2G4TA 3E0NB 1QB6A 9LPRA 1SG8B 2R0LA 6CHAC 4A5TS 2UWLA 1N1LA 2QXHA 1EXFA 2FX4A 1O30A 2CV3A 2STAE 3HK6B 5EXLA 5A0CA 1AFQC 2HNTF 2XBYA 2A45B 3C27B 1LQDB 4K60A 1MKXH 2H9EH 1CGIE 1AE5A 1BHXB 1Y59T 4F4OC 2UWOA 2FDAA 4KTUA 3BTTE 2A1DB 3V7TA 5I46H 1YPHC 3VB5A 1O3OA 1ZHPA 3P6ZB 3SW2B 1DXWA 1GDUA 1TGBA 2ESTE 2ZF0H 3UTUH 5EXNA 5TJXA 4JK5A 1ELGA 3MH6A 1PQ7A 2C8YB 2JH6D 2WUCA 3MNCA 1Z8JB 2UWPA 1CHOG 1MZAA 3D49H 1O37A 2VH0A 1L4DA 1QBOA 3LGVA 1WQSA 5A09A 2GCTB 4X6OA 3A84A 9ESTA 2VVVA 1PYTD 2CF9H 1UO6A 3MOCA 3QDZB 1DUEA 3M5OA 1TNGA 1NN6A 3H7TA 1HJAB 1SBWA 4YLQH 2LNCA 1O3MA 1NO9H 1TWXB 1XKBC 3M3SA 1A0JA 1OOKB 4GLYA 4AGKA 1C1TA 5TCAA 4X2VA 1CU1A 2SNWA 1VCPA 1K22H 1C5LH 1FMGA 5C1UA 1CBWB 2BDGA 1J16A 2G5NA 5HMAA 3A82A 2STBE 1BBRE 1PPCE 3BF6H 2AMPA 2W7UA 3T25A 4DIIH 1P3CA 1AY6H 4NGAH 4X6PA 2F9BH 4K1EA 1YBWA 3RU4D 4CRBA 4ZKOU 2FO9A 1KDQA 4B2BA 1O36A 3P95A 3UWJH 1PPEE 1CVWH 4HI3A 1SGIB 1D4PB 1GBAA 1FDPA 4DVAU 3F9FA 4FUGA 1XUJA 3M7UA 1HNEE 3MFJA 4VGCB 3CENA 1DT2A 1BZXE 3RXOA 3QTOH 1OYQA 2AGIX 4I8KA 4TPYA 1QURH 5C3NA 3UFAA 2FS8A 4DIHH 2CN0H 4JYVH 2ZDKA 1FAXA 1XUGA 2TGAA 1TRNA 1JIMA 4X8VH 3V13A 1WQVH 1O39A 1YYY1 2HGTH 1EQ9A 2BDAA 4ZXYH 4BAKB 1WU1A 3GDSA 3SN8A 3SU2A 1J8AA 1QRWA 2BD5A 1G3CA 1TNKA 4XOJA 1O2ZA 1V2JT 1GBFA 1J9CH 1V2LT 1IQEA 3A7XA 5G4BA 3EDXB 3SBKA 1DOJA 2FIRH 3M37A 4ABFA 1T31A 1PYTC 5EU8A 1WTHD 1IQGA 1O3GA 2GGVB 4A1VA 1CT0E 1VITH 3MU1A 3SOSA 2BDYA 4O03A 3VB7A 2ZCLP 1SPJA 3NKKA 1BUIA 2GCTC 1TOMH 4FUIA 1WSSH 1Y3UA 1S6FA 1K1IA 1QIXB 4KP0A 1JXPA 5JYIA 1Q3XA 1M9UA 3MNXA 3STIA 4E06H 2SGFE 5JB9S 1NRNH 1MBQA 3SO3A 2AS9A 1K9OE 3A8AA 4AFSA 4HFPB 3S9AA 4ABDA 3GCOA 3SHCH 3RXDA 1UTNA 1ACBE 4CR9A 1J17T 4ESTE 5EODA 1QA0A 1UVUH 3SU1A 1JMOH 4AB9A 1J15A 1IHTH 3KGPA 1YPKH 1A2CH 2GKVE 3LDXH 1NROH 1P9UA 1THPB 1LPKB 1FJSA 4FU8A 1QQUA 2AFQB 1P0SH 1OS8A 1AIXH 4OS7A 4B2CA 2Y5FA 1Z8RA 2OD3B 3W95A 1C2LA 3MO3A 3RMNH 1BITA 1O2LA 1HAHH 4U2WA 1DY8A 1E36B 2BY8X 8GCHG 1MTNB 2SFAA 4YOJA 2SGQE 3T27A 4VGCC 1KXFA 1GI7B 2ZCKP 1TNJA 2VWOA 4CHAC 1XUKA 4H6SB 1ELBA 4UDWH 3E6PH 1TONA 3ZZ4A 2ZPRA 1ZZZA 2GTBA 4UFDH 3DA9B 1RJXB 1BBRK 4Y76A 1GBLA 1T32A 2BM2A 2Z3DA 1T4UH 1V2RT 1ZJDA 2ZGXH 1AUTC 3LGIA 2XNIA 3M5NA 5CHAB 2Y6TA 1TGNA 2QN5T 1GGDC 1DWEH
chains in the Genus database with same CATH superfamily
3BTDE 1HAOH 3LH1A 1BJUA 4A7IB 4OS6A 3UWIA 4X6NA 1YWUA 1SOTA 1MTVA 5T1VA 3V3MA 2VVCA 1W2KH 2Q6FA 1AN1E 2BD9A 2Z9LA 3EYDA 4FUJA 1GJCB 4GCHG 2UUYA 2ULLA 1T8MA 2FESH 3AAVA 4D7FA 1IQIA 1AKSA 4NIVA 1HAXB 4AG1A 2BY7X 1WCZA 1C5OH 1GMHG 4K8YA 2A4QA 1SL3A 4FUHA 4X1QU 5DSFA 1O3HA 3GY2A 2ZQ1A 8ESTE 1TQ7B 4XBBA 2M5TA 4DT7B 1AGJA 1UVTH 1A1RA 1FPHH 3TITA 2PGQB 4FOUC 4GVUA 1GMHF 1TMUH 1KIGH 4BXSA 5EW2H 3SNBA 1F0RA 2YMSD 3LH3A 1O2RA 4D7GA 4IN1A 4YLUA 2BHGA 1W0ZU 2O8TA 1TMTH 1EB1H 2Z9KA 1FY4A 1FY5A 1BRAA 4K2YA 1GI6A 3P8FA 3ZVBA 3F2FA 2WINI 3OAAD 5GIBA 4ZUHA 3RXVA 5PTPA 1EATA 3AVZA 5K7RA 3ATMA 2IPQX 1H9LB 1TOCB 2SNVA 1UHBB 1NRPH 3JZ2B 1GI9B 2A32A 1SQTA 5J4SA 1BTUA 1GBIA 1A3EH 1GCTC 4IN2A 7LPRA 5JBTA 1MTNC 1A0HB 1LVMA 1DM4B 4JYTA 3AW0A 1A3BH 1GMDG 1HRTH 2Z9JA 5FPTA 3KL6A 4FUCA 2D2DA 2AGGX 4JCNA 2BZ6H 4AFQA 1LVYA 2GDDA 4IW4E 3DD2H 1TB6H 1HGTH 2D8WA 2G8TA 1Y3YA 1GMDF 3AAUA 3U8RH 1LHEH 3E91A 2G81E 5HGGA 4DY7B 1CE5A 1K1LA 2OC0A 1AI8H 1DFPA 2JIZD 1SQRA 3PB1E 1HXFH 1YLDA 1Y3WA 1QCPA 2EY4C 1Y5BT 3DFLA 4RKJB 3PV2A 4DJZB 4YM9A 1C2MA 5A0AE 1KXCA 1EZQA 1OWKA 4UFFH 2GCHG 5ETXA 1A46H 2VNTA 1L1GA 4WMFA 3UQOA 1BTWA 2ALPA 3PV5A 1UVOA 1DITH 1HUTH 3FOAA 2EI8A 1GHZA 4MPVA 2GCHF 2KAIA 4E7NA 2ZECA 2BY5X 1P06A 1VJ9U 1P8VC 4CRAA 3F9GA 3RU4E 3BV9B 2AYWA 1LPGB 2YMSC 3A83A 1C5QA 3GCNA 4X2WA 3ZZDA 2C3SA 3ODDA 4FU7A 1G3EA 2OLGA 4FETA 3LU9B 4NFEA 1HPGA 2D1JA 2OC7A 3FZZA 2G00A 3A8CA 3SNCA 1UTQA 2JKHA 3RXLA 2Y7ZA 3K65B 2FOAA 1VITG 3MU0A 1ZJKA 4ASHA 5FX5A 2QCYA 2QAAA 5EJZA 1FLEE 1CA0C 1SHYA 1OWEA 1RTKA 2AIPA 2OUAA 1C1SA 1VITF 3D62A 4KGAA 2K0QA 3SGAE 4IC5A 1ZPCA 3DUXH 2C93B 1TA6A 3QO6A 1ETSH 3VB4A 3RXMA 1ARCA 1MZDA 3T62A 1P04A 1NC6A 3ZZ6A 1QFKH 1Y3XA 2TIOA 1GHAF 1ZHMA 3RP2A 4AC9A 2QF4A 1DICA 3P8NA 5HXFA 1KYNA 4CH2B 1S81A 1A7SA 2VIPA 1ZSJA 1HAZB 4MQAA 2CXVA 5T6GA 2FS9A 2AH4X 4TWYA 3SV9A 4UFGH 2W26A 1DPOA 2Z9IA 2BXTH 1G37A 2OBQA 1LMWB 2EC9H 5DKMA 2QXIA 1O3LA 3DT0H 1VCQA 4X6MA 1GI2A 2QA9E 2RA3A 3MU5A 2FODA 1TRMA 1QB1A 4Z0KA 2QY0B 1OXGA 1E34B 1EASA 4INHA 2TPIZ 4X2XA 1OPHB 4FVDA 2QGRA 3L6PA 1PPGE 4I8HA 1GBJA 1C1QA 1TPSA 1KXEA 4RKOB 4ACAA 1NRRH 5DJ7A 1P2MA 1EPTA 4X1PU 4WVPE 4Z1MD 3LGYA 1DWCH 1Y3VA 2BD7A 2FEQH 4XBDA 3QTVH 3BG4B 4Z6AH 1C1NA 3M5MA 3MYWA 4B73A 3ATKA 5A8YA 3FKSD 5EIYA 1O2SA 4WH8A 2PUXB 2PSYA 3F0PA 4KTSA 5GCHG 3EA9A 2F83A 1EJAA 1QNJA 1SLUB 1O0DH 1UTJA 1C5UA 1HB0B 1SI5H 2VWNA 4Y79A 5GNDA 1SGFA 4RSPA 3PMHB 1ZPZA 3BTGE 2WV9A 3M7QA 2BXUH 1F2SE 4UD9H 3PRBA 1YCPH 2XWBI 2FOFA 2ZG0H 2FTLE 2XNDD 4J1YA 4Y8ZA 5GCHF 3LC5A 3PWBA 2V3MA 3M7TA 1ANEA 2VWMA 5EQQA 1EJMA 1MKXK 4X8SH 4Y71A 1AMHA 2H9TH 4X2YA 2TGTA 1O3EA 5GPIB 3OTJE 3SU3A 2W6ID 2XCNA 3WWBA 4F48B 4I33A 5J4QA 3GYLB 3FP7E 1ANDA 4JZIA 2XXLA 1XUFA 2BZAA 4XRNA 4AG2A 1DDJA 1AB9B 2ZZUH 2BD8A 4M7GA 1TX8A 4NCYA 4O3UA 2AERH 3F9EA 4WY3A 2B8OH 2ZIQH 3A8BA 4X8UH 1F0SA 1B0FA 2GV7A 3SU5A 3S9CA 1AVWA 3V0XA 1C2GA 3TH4H 2WV5A 1DSTA 3A80A 1KDQB 1GI1A 3UIRA 3RM0H 1O34A 3ESTA 1UTKA 1O3CA 1E0FD 3BIVH 3LPRA 2ANKH 2VINA 2ZDAH 4GHTA 1GJ9B 2A7JA 1L1JA 2WPMS 4BANB 2DUCA 1PFXC 4WXVA 2LPRA 2ZPSA 1EX3A 1C1VH 1YPJH 2WPJS 3ZZAA 1O2YA 2GV6A 4FUDA 1GG6C 2EI7A 1GBKA 2I6QA 1CA8B 5FPSA 1C5XB 1NM6A 4ZH8A 3M3VA 1AFEH 1INCA 2Z6BD 3RXRA 3I78A 2QF0A 4IS5A 3GY3A 4GUXA 4LXBH 2FXRA 1WTGH 1MUEB 1BCUH 2WPIS 2V35A 1DXPA 5EXMA 1WOFA 5C5OA 5C67A 3L33A 1XXDA 3KQDA 2HPQH 2J94A 1L2EA 2J97A 2M2AA 5ABWA 2DE9A 1CHOF 1EOJA 1P05A 3RXJA 2VGCB 1TYNA 2IJOB 5E0JA 3SNEA 1AHTH 4MNVA 3UOUA 2SGDE 1TGTA 3F1SB 1TGCA 4I8LA 1QRXA 3ATIA 5F03A 1E35B 4D76A 3GCTG 5AFZH 3BG4C 2HLDD 3ATWA 2TGPZ 3U1IB 4XSKU 4HZHA 1D9IA 4OS4A 1LKAA 1C2KA 1SKYE 3IG6B 5DGJA 1V2UT 4X1SU 2BB4A 7KMEH 1Z1JA 3MNSA 3GCHB 3S9BA 1P11E 1Z1IA 4K1TA 1O3JA 3U28C 1TQ0B 4KTCA 1S5SA 1FNIA 4DG4A 3U8OH 2L6OA 1SGFG 1LHCH 3SI3H 2P8OB 3HGPA 3A88A 5GWZA 1K1OA 1C2JA 1UVPA 1T8OA 2P16A 5F6MA 4HG6A 4R0IA 4YESB 1NESE 1GI0A 3OSYA 1RRKA 3RXAA 1XKAC 1DX5M 1HAPH 3RXCA 3U98H 2R2MB 5T6FA 1C1OA 3RM2H 1AVXA 3FO8D 4A1TA 1AB9C 1XX9A 1HIAA 1TGSZ 1V2PT 3KF2A 3UB0A 3NWUA 1C5SA 1O2XA 1O3PB 4B71A 2GZ7A 5FCRA 2ZHFH 1TX7A 3NK8A 1OP0A 1KTSB 1ID5H 1BIOA 1W10U 1BRCE 4ISOA 2KX4A 2QIQA 2UUJB 3RUOA 1BJVA 1WUNH 5AF9H 3UY9A 2P3UB 3FN8A 4YZUA 5F53A 3QN7A 1Z8GA 1A5IA 5LGOA 2A5IA 1GMCG 1QTFA 2ALVA 4IBLH 3W1EA 3SHAH 1QRZA 4TY7A 1PQAA 2C4FH 1CO7E 1OWHA 1CQQA 2H6MA 2Z7FE 3OEHD 1W3CA 1C5TA 1GMCF 3RXGA 1V2KT 2BD2A 1HAVA 3WY8A 2NU1E 1TX6A 1PPHE 2F9VA 2PUQH 2PSXA 3N7OA 5DO4H 3WW7A 1IQMA 3PMAB 1F7ZA 3SZEA 2P94A 1T4VH 1H4WA 1N8OB 3SNAA 1HJAC 1S83A 1Z71A 2J98A 2XC5A 1LVOA 1O38A 2FI5E 2WZQA 2BD3A 2OQUA 2VBCA 1H8ED 3P92A 4HTCH 3N99A 1LTOA 1MU6B 2BX4A 3Q3KA 4WMDA 3MO9A 5DP5A 2Q6DA 3U1JB 2EA3A 3GY4A 3FFGA 1CT2E 1AKSB 5SGAE 2A4RA 5L30H 1BA8B 1ELCA 3A86A 1MAYA 3UNSA 3DSOA 1P2QA 4U30A 8KME2 5B6LA 1EB2A 1P10A 1UJ1A 1CBWC 5E8EH 4LZ1H 3AASA 3N7EA 3ENSB 3ZZ9A 1MQ5A 1O2HA 1W8BH 5C94A 3A7ZA 3ZVCA 1P12E 1H8IH 4SGAE 1IQNA 1C1PA 1OP8A 2OC1A 2YNBA 4O3TA 1ZTJA 1GWAA 2BLWA 3MH7A 3QUMP 2XC4A 4B6FA 3EGKH 1XXFA 1ZMJA 2ZU1A 1JBUH 4XFQA 2A2XH 5DK1A 4A92A 5JB8S 2F91A 1YPHE 4KKDA 1HJ9A 2R3YA 4OS2A 1IQJA 1S85A 2HALA 1JIRA 4GPGA 1RIWB 1EJNA 1O2JA 3OX7U 8GCHF 3QWCH 3KIDU 1SGNE 1O2TA 2OBOA 1KTTB 2ANMH 1C1WH 1EFRD 4CRFA 1GHBG 1TRYA 1O2PA 2P59A 2R0KA 1K21H 5C17A 1BB0B 3SI4H 4GAWA 2FX6A 2P93A 1RXPA 3ZYEA 2ZCHP 3HATH 3S69A 1ZR0A 1V2NT 3PM3A 1GJBB 1O5GH 2PKAA 3F9HA 1AVGH 2Q6GA 1GL1A 1PPZA 2R2WU 1D6RA 3IITA 2FI3E 2FOGA 2ILNA 2J38A 2KFWA 4E05H 5JBAS 2AEIH 3Q3XA 1C5PA 1HLTH 3MU8A 3URDA 2Y81A 1GI5A 1MTWA 2ZHQH 3VB6A 1MH0A 1Y8TA 2JH0D 1UK2A 5E0GA 4B1TA 3UREA 3M35A 1SLWB 1HXEH 2Z3CA 2K1QA 2R9PA 1VGCB 3D23A 1SC8U 2OTVA 3VB3A 2JH5D 4ACBA 4NIXA 2A7CA 2FOMB 4JMYA 3E16B 3U8TH 1C2EA 4MTBA 2RCEA 1SGCA 3AK5A 4GCHF 3TPIZ 2GT8A 5TCCA 1LHFH 2H9HA 1ZTKA 2BOHB 5HIZA 2P3TB 2C8ZB 2AMQA 1O3IA 4U32A 1C5VA 1ELAA 2BDCA 2KCPA 3CS7A 1RGQA 3DFJA 1TALA 5DP6A 1OP2A 1N8OC 2A7HA 1KLJH 4Y7BA 5A0BA 2KAIB 4LOYH 1FPCH 3T28A 4CR5A 2ZI2H 3SQHE 3OE7D 2GZ9A 3PTNA 1B7XB 2VIVA 5K0HA 1D3DB 3LOXA 1DLEA 1FN6A 5FPYA 3RXSA 3F2HA 2P95A 1IAUA 4IGDA 2YNAA 3SUGA 4IMZA 3ATLA 4NSYA 1EKBB 4NFFA 1ZYOA 1YCPM 3A7VA 2VH6A 2BOKA 1EUFA 1SLVB 1G30B 1QL7A 8LPRA 2GX4A 3B23B 3PV4A 3RXTA 1TLDA 1YP9A 1RS0A 4WMEA 1MCVA 3GDVA 3A85A 5E0HA 3UNRA 5BPEA 2BQWB 1ESTA 3GDUA 5FBIA 3E3TA 2BDHA 4Y8YA 1W0JD 5C0UA 3KQ5A 1V6DA 3HKJB 1C2IA 3QK1A 3N7DA 2F43B 1NRSH 2PWXA 4NIYA 3VPKA 5JPMH 2D26C 4ZKNU 3G01A 2O8MA 3SORA 1Q2WA 2WHXA 5EPNA 1NFXA 1A4WH 1FAKH 1SQAA 1BRBE 3S0NA 4ZHLU 3RXEA 1T7CA 4UEHH 1GI4A 2J2UA 1AZZA 1FXYA 4NA9H 3PLBA 1C2DA 1W7GH 3NRLA 3KN2A 1V2VT 3VGCB 1T8LA 1EAWA 2IOTA 1S6LA 5EGMA 2BY6X 4TSFD 1RIWC 2XC0A 2H5CA 1EOLA 1FUJA 1O2WA 2Z9GA 1O5EH 4I7YH 3WWFA 1OWJA 3ZZ8A 1AWHB 3IWMA 1S82A 3EA8A 1NY22 1DY9A 1W0YH 2WYGA 3D65E 2PTCE 4K69A 2BD4A 1GBCA 2FOBA 3EAJA 1ZSLA 3SV2H 5CHAC 2G51A 1K2I1 2H2ZA 1COWD 1O3NA 2PKSB 1NZQH 5C20A 2XW9A 4ZAEA 3Q3YA 2PV9B 1TFXA 2QF3A 1BMNH 1UTMA 1GVKB 2R3UA 1EPTB 1UTOA 4ISNA 1Y5AT 3ITIA 4O97A 5FHTA 1O3KA 4I8JA 1K1MA 2HVYB 1XM1A 4BTUB 1VGCC 5CDFE 1W13U 2RDLA 2F9OA 1SHHB 1Z6EA 3LONA 2W7SA 3TK6A 2NU4E 2BQ6B 4Q7YA 5JDUB 1TPAE 4TY6A 1YPLH 1XVOA 4D9RA 1H1BA 1SFIA 3SU6A 3K2UA 4E7RG 1C2FA 4I32A 5E2PA 1MKWH 3P17H 3OEED 2BVRH 3ZV9A 2O9QA 3EE7A 3ODFA 3QZQA 2AHME 4X1NU 4FUEA 2VJ1A 4UONA 2GZ8A 2OC8A 4OGXA 4I31A 1LKBA 2H5DA 1SR5C 1IOEA 1VR1H 4MNYA 3TGJE 5FBEA 1ZLRA 3SUDA 2CK3D 3MH4A 3E0PB 2ZC9H 1C5ZB 2HNTC 3W94A 2FLBH 7ESTE 3K6ZA 3SJKA 1EP5A 4YOIA 3FP6E 3RXIA 5KEDA 3HKIB 1BT7A 4ZKRU 4Y0ZE 4D8NA 1ELFA 1ELVA 4O9VA 1O5FH 3UPEA 3BEUA 1EZSC 3UAIC 1C9PA 2KZ4A 4CBNA 1K28D 1EAXA 3PMJA 2IJD1 1E79D 3TH3H 4K5ZA 5A8ZA 1GJ7B 3TJOA 1BTHH 1O2GH 3GY5A 1C4V2 1G2LA 5FAHA 3UOPA 3UQVA 4AYYB 1MQ6A 3A87A 1UTPA 4ABEA 4YTAA 4B74A 1YCPK 1GJ4H 2ZDVH 2ZFTA 1EAIA 1FIZA 2XWAA 7GCHG 2ANWA 2RG3A 3SU4A 1MD8A 1O33A 3VGCC 2Z94A 4NWLA 2ZHDA 2VB0A 4THNH 4ZHMU 3E1XB 1FI8A 5L2YH 1O5BB 1ELTA 4JYUH 1YPEH 1BTZA 1HAYB 1ETTH 5KECA 4F55A 3SV8A 2A4OA 4JK6A 4Y10E 5FX6A 1UMAH 4U01A 3DSPA 2ZEBA 1D3PB 3HK3B 4OM9A 4PROA 3PTBA 3PYHA 1GHXH 1DWDH 1SGRE 3BEFB 3B9FH 3RU4T 4WF8A 1GHYH 2PKSC 2ZHEH 3KQBA 1HFDA 1IQHA 2WYJA 1N6YA 1V2MT 4TPIZ 1QBVH 1PJPA 1GBDA 1TNHA 1EPTC 4NIWA 5DP3A 4Q7XA 2ZO3H 3M5LA 1LVBA 2V0BA 3GY6A 3RXHA 1O2VA 1SOZA 1TBRH 5FXLA 1O35A 4BAQB 1AE8H 2GP9B 3OFND 2ZDLA 4LZ4B 2JETB 4YOGA 2ODYB 4CRGA 5JBBS 2V7QD 3GICB 1ZRKA 3GISB 2ZU2A 2L74A 4CRCA 2HLCA 1HYLA 4FUBA 2XYAA 1K1JA 1GI8B 4INLA 2QC2A 1E37B 3RC4A 3KHVA 1QL8A 2G4UA 1D3TB 3BG8A 1XUHA 1LPZB 1HJ8A 3FZDA 3S7HB 1QY6A 1G9IE 2BVXH 3T29A 1DLKB 3KQCA 1MTSA 1AZ8A 2CHAB 1QHRB 3BTFE 3RDZA 1FN8A 1EZUC 3SU0A 4XBCA 1NTPA 1O2UA 4NA7A 1DANH 4H4FA 1SVPA 1HIAB 1KLIH 1QL9A 3QGJA 2WPKS 3BN9A 3GY8A 2Y5GA 5H4IB 4INKA 1O2QA 4Q2KA 1BMMH 1CGHA 3BEIB 4NG9H 1P01A 2FOCA 1S6HA 4Q7ZA 2ZTXA 2HPPH 5F8XA 3OYPA 2NWNA 1UCYH 4Y0YE 1RTLA 1MTUA 2FP7B 2FYQA 2GT7A 2WV4A 3BIUH 3ZZ3A 2ZU3A 5FCKA 2EQNA 3RXBA 3E90B 1KXDA 5A8XA 1QGFA 1AUJA 3Q00A 4WXIA 4X8TH 5IDKA 5DP9A 4MPWA 1K0HA 1BQYA 3RLWH 2B5TB 1GCDA 4OGYA 5ESTE 4UFEH 3CP7A 1AU8A 2FLRH 2ODPA 4ZCNA 2DE8A 4ZMAH 2A0QB 3F6UH 3SUEA 2XBWA 1HAVB 1QQ4A 2HVXA 4ZROA 1NBMD 3EQ0H 5IK2D 4DCDA 3BTEE 3M3TA 3ZVGA 3ZZBA 4MG3A 2W5EA 1FONA 2WPLS 1MU8B 1TPOA 2W3IA 1SQOA 2IPHA 2QF5A 1EAUA 3KYGA 2WUBA 5LPFA 1K1NA 2SGEE 2UUFB 1NS3A 3GCTF 3MH5A 5HIYA 1C4Y2 1O3FA 1UK4A 3CS0A 2J98B 4AGJA 5L2ZH 2F3CE 4AFUA 1S0RA 1O32A 3LJJA 2GDEH 1EZXC 1A0LA 3K9XB 3LGUA 5HM2A 2G52A 2ZFFH 1FY8E 3SGQE 1NFWA 2B0FA 2WPHS 3SJ8A 2HNTE 1THSH 3TGKE 2WSSD 4P02A 2KCAA 1OWDA 1GJAB 3PWCA 4DOQA 6GCHG 1F0TA 1CSOE 2JETC 4FXGH 1LQEA 1WBGB 1C4U2 5LPRA 3MHWU 2PGBB 5LPEA 4ISLA 3H5CB 3ZVAA 3PMBB 6GCHF 1NU7B 4D9QA 2J9NA 3GS9A 2V3HH 5EOKA 1MMJN 1VZQH 1XUIA 1F5KU 3MI4A 1DVAH 2A31A 3RXUA 3RLYH 4BOHA 3O8DA 3LT3A 4MVNA 1GDNA 3URCA 1G3BA 5DP7A 2ZTZA 5DN6D 1FQ3A 4CHAB 3A89A 1OX1A 2CHAC 1QBNA 2VVUA 4I86A 1YKTA 4ABIA 1C5MD 1YGCH 4JZDH 5F8ZA 2ASUB 1ZSKA 3SUFA 1Z6JH 2ZU4A 1BDAA 2XCFA 3GYMA 5E2OA 2KM0A 1DE7H 3P8GA 3I77A 1YC0A 1ZMLA 1GBBA 1W11U 1LCYA 3ZVDA 1OSSA 2HWLB 1QJ7B 4J2YB 1O31A 5DP8A 1KLTA 4IMQA 3A81A 1JRTA 3OU0A 3QZRA 1LO6A 2JJ1D 2RA0A 3PO1B 1GGDB 4GHQA 2CF8H 5CE1A 2PKAB 4FVBA 3HPTB 3SJOA 3SJIA 3PLPA 3SV6A 5I25A 4HGCA 1C5YB 1G3DA 4B2AA 1C1RA 1H9HE 3MTYA 5EG4A 1RTFB 3M36A 3BTKE 2A2QH 1S84A 2JDID 3KEEA 1GL0E 1W14U 2VGCC 3O8BA 2XOKD 3TK5A 3O8RA 1TE0A 1PQ8A 3F2GA 1ZHRA 2VWLA 3UUZA 3NCLA 4XE4A 4UE7H 2PHBA 1X7AC 2FM2A 5EPYA 3LIWA 1JWTA 1A5HA 4DGJA 3QLPH 1GBHA 3ZIAD 1IQLA 2O8WA 3RMOH 2J95A 3ZZCA 1TABE 1SGEE 1RD3B 3LKWA 4BNRA 3ZYDA 2FZZA 3A8DA 5KGOA 2XRCA 3KNXA 3GCHC 1B0EA 1P2KA 3T26A 1W12U 2OQ5A 1GDQA 1A5GH 2PR3A 3V12A 4QT8C 1O3DA 2VIOA 4X1RU 1AWFH 5CHBA 1L0ZA 3Q77A 3QGNB 3S7KB 1AO5A 1HAIH 1HAGE 1SGTA 2P8OC 3VG8A 2QE7D 1O2NA 4TWWA 5GXPA 2I6SA 5ESBA 2BDIA 2QXJA 4BAMB 1MD7A 1BMAA 1F5RA 2OCVB 2F4LA 2Y7XA 4BTTB 1E1RD 1IQFA 1Z8IB 5JBCS 2GD4B 3GOVB 1GJ5H 2WPDD 1NFYA 4NSVA 2O8UA 3PRDA 3BTWE 5HM9A 4ABHA 3ZVFA 1ELEE 1KSNA 5DG6A 3LGWA 1SGPE 1YPGH 2BY9X 4NA8A 1E1QD 3MQKC 4Y8XA 1V2TT 3FVFB 1GCTB 2QYIA 3BSQA 3O8CA 2B7DH 2JJ2D 2BX3A 1ZPBA 1THRH 2BVSH 2PLXA 4I8GA 1OKXA 4NZQA 4YO9A 1GVLA 3U69H 1H8DH 1V2ST 3RMLH 1QJ1B 5AFYH 1ZRBA 1C9TA 5HYOA 3NUMA 4ZHAA 1BTPA 2ZFPH 1O5CB 1P9SA 3EA7A 2B9LA 1GHBF 4RI0A 1KY9A 1O2IA 1T8NA 2ODQA 3ZZ5A 5LH8A 4BAOB 1HDTH 1SGDE 2VIQA 1OYTH 2A5AA 2VIDA 1SLXB 4BAHB 4A6LA 3TJVA 1BOQA 1HV7A 2Z3EA 1FY3A 3E8LA 1P02A 1C2HA 3ZVEA 3MNBA 4RT0A 1BHXF 1GJ6A 2G5VA 1WAYB 2VIWA 3U9AH 3PO1C 1FY1A 1DSUA 1OHHD 2PTNA 2Y82A 1V2OT 1ABJH 2ZFSA 3TNSA 1O5DH 3F3BA 2BDBA 1BRUP 3OY5U 1QR3E 3M61U 1TIOA 2FPZA 1ELDE 1SSXA 1W7XH 2FOEA 3SQEE 2SGAA 1MBMA 2HRVA 1JRSA 4ABGA 3OTPA 5AHGH 1BBRH 1C5NH 1P2JA 2BLVA 2EEKA 2PFEA 2YMSB 3KYFA 2K8IA 4YT7H 2AGEX 1LHGH 2ZP0H 4JZFH 1CHGA 4AB8A 4B76A 3TJNA 4JZ1A 2V6NA 3C1KA 1FIWA 5AVDA 2ZFRH 1GBMA 1KMHB 4MNXA 1ETRH 4Q4LA 1O2MA 3P70B 4XD7D 1F0UA 1YLNA 1VCWA 4FU9A 4A1XA 3ELAH 2FWWA 2FYRA 5FL7D 2O8LA 2FOHA 3R3GB 2ZDMA 5B6OA 1J14A 3NZIA 4X0WU 1O3BA 1CA0B 2AMDA 1UW7A 1TAWA 3VXFH 1YF4A 3A7TA 3FANA 1MCTA 5C0TA 1ABIH 3JZ1B 1Z7KA 2KCYA 3A7WA 2ZKSA 2FI4E 1JOUB 2ZWLH 2FTMA 2NU2E 1U6QA 2Y80A 2BTCE 3BTHE 1AD8H 4CH8B 1UVSH 3MMGA 3KCGH 4H6TA 1BMFD 3A7YA 1NU9A 3I29A 4NWKA 1BTXA 1P03A 5F8TA 1PPFE 2BLOA 1O2OA 4M9FA 2FMJA 3QX5H 4DW2U 3NPSA 1C1UH 3Q76A 5CMXH 4KELA 4ISHH 4DURA 4MLFB 3DHKH 1GBTA 4AFZA 3L3TA 2CGAA 1P2IA 2CMYA 3FAOA 2NU0E 3DCLA 1RFNA 1ZOMA 4WJG2 1ZTLA 1O3AA 1NRQH 1F5LA 1D6WA 5A2MH 3VFEA 1MKWK 1ANCA 1NBME 2ZGBH 4ABBA 1UCYE 1TA2A 2GMTB 1NT1A 1P57B 2THFB 5T6DA 1O5AB 5DPAA 3TLOA 3OY6U 2TGDA 1B5GH 5EQRA 5C1YA 1SB1H 4B75A 1H9IE 1BTYA 1GPZA 1FV9A 1YPMH 2QV1A 3R0FA 4YXWD 2W6JD 1XMNB 3RMMH 1VKYA 1ESAA 2KCOA 3BTME 2KR7A 3TK9A 3TNTA 5C2ZA 1S0QA 1SMFE 1P2OA 4K3JA 4ABAA 2W3KA 2J92A 1ARBA 4NZLA 1L4ZA 1V2WT 2UUKB 4JZEH 6ESTA 1UK3A 3TGIE 5IYTA 4Q80A 4K8BA 1SGYE 1IQKA 1Y5UT 1V2QT 3T5FH 2HOBA 2NU3E 4P00A 3VEQB 1C5RA 4CBOA 2A4GA 2C8WB 4XDEA 3LGTA 2BLQA 2ZQ2A 1PQ5A 3VXEH 4AZ2B 1P2NA 1V3XA 1ZMNA 4MPXA 2ZGCA 4YT6H 4AYVB 1ZGIA 1P09A 2Q1JA 2C8XB 1TPPA 4SGBE 2ZPQA 4WH6A 1ANBA 2XTTB 3TH2H 5EW1H 3KQEA 1HBTH 1YY3A 3TJUA 2TBSA 3RXPA 1GHVH 1YM0A 2BQ7B 2P3FH 1QZ8A 4AX9H 2ZA5A 3TU7H 4CREA 1KXAA 4ISIH 1FZZA 2IN2A 1O2KA 2PW8H 2VU8E 4MNWA 3SZNA 1WYKA 1K1PA 1MABB 1QA7A 3K6YA 6CHAB 4MPUA 5BRRE 3TIUA 1TBQH 2TRMA 1C1MA 2ANYA 2F9UA 3GY7A 4TT3D 1GHWH 1GVZA 1UHBA 3FP8E 2ZHWH 1AFQB 2ZNKH 1GBEA 1G36A 4Y6DA 2EI6A 1TNLA 2Y5HA 3LJOA 1GHAG 1G32B 2G55A 4GSOA 4IC6A 5T3HA 4BXWA 1G2MA 2V3OH 1GG6B 1N6XA 2BYAX 4DT4A 2ZTYA 1CGJE 1SFQB 1IHSH 5GDSH 1D3QB 3PLKA 1DUAA 3F68H 5GJ4B 1GJDB 3RXFA 1VJAU 2J34A 4AOQA 4FUFA 2J4IA 1SGQE 4F49A 1DS2E 1TNIA 2QXGA 1OWIA 2GVFA 3RC6A 3BTQE 2BMGB 1CT4E 4AORA 2ZGHA 7GCHF 4WWYA 3MWIU 1H8HD 1LHDH 1NPMA 1MAXA 2ZFQH 4CRDA 1LDTT 3AW1A 3H7OA 1YLCA 3SNDA 3ZV8A 1PPBH 3RC5A 3PROA 4R8TB 3MO6A 3NXPA 3EE0B 5EQSA 3RXKA 2OXSA 5L6NH 2ZGJA 4LK4A 2OP9A 1WV7H 2GMTC 3CNRA 1GJ8B 2F9PA 1TBZH 4Y7AA 2YOLA 1KXBA 2H1UA 3MU4A 1DWBH 4ZKSU 2F9NA 5C1XA 1QJ6B 4AN7A 1C5WB 4MDSA 1ZGVA 6LPRA 1XVMA 1BMLA 2ZU5A 1E38B 1QB9A 1F92A 4Y11E 3ZZ7A 4ABJA 1AQ7A 1EP6A 4H42U 3T2NA 3TVJB 1ORFA 1Q31A 3LC3A 2SGPE 4OS5A 3H09A 4TYDA 4ZXXH 3DSGA 1GI3A 3SJ9A 3UR6A 2XBVA 5DP4A 4Q63A 5C5NA 1WXRA 1NFUA 3SYJA 3STJA 4RN6A 1UCYK 3B8JA 3SGBE 2A5KA 4BTIB 3SV7A 2ZDNA 4OS1A 2XBXA 1UTLM 3P8OA 1A61H 1P3EA 4K1SA 3UR9A 1ESBA 1HCGA 2C90B 1TMBH 2OINA 2AIQA 3UNQA 1L1NA 2CJIA 1W0KD 1WDIA 3HGNA 3RXQA 2G4TA 3E0NB 1QB6A 9LPRA 1SG8B 2R0LA 6CHAC 4A5TS 2UWLA 1N1LA 2QXHA 1EXFA 2FX4A 1O30A 2CV3A 2STAE 3HK6B 5EXLA 5A0CA 1AFQC 2HNTF 2XBYA 2A45B 3C27B 1LQDB 4K60A 1MKXH 2H9EH 1CGIE 1AE5A 1BHXB 1Y59T 4F4OC 2UWOA 2FDAA 4KTUA 3BTTE 2A1DB 3V7TA 2RDEA 5I46H 1YPHC 3VB5A 1O3OA 1ZHPA 3P6ZB 3SW2B 1DXWA 1GDUA 1TGBA 2ESTE 2ZF0H 3UTUH 5EXNA 5TJXA 4JK5A 1ELGA 3MH6A 1PQ7A 2C8YB 4B6EA 2JH6D 2WUCA 3MNCA 1Z8JB 2UWPA 1CHOG 1MZAA 3D49H 1O37A 2VH0A 1L4DA 1QBOA 3LGVA 1WQSA 5A09A 2GCTB 4X6OA 3A84A 2J5UA 9ESTA 2VVVA 1PYTD 2CF9H 1UO6A 3MOCA 3QDZB 1DUEA 3M5OA 1TNGA 1NN6A 5HKKD 3H7TA 1HJAB 1SBWA 4YLQH 2LNCA 1O3MA 1NO9H 1TWXB 1XKBC 2PP6A 3M3SA 1A0JA 1OOKB 2RFKC 4GLYA 4AGKA 1C1TA 5TCAA 4X2VA 1CU1A 4RT1A 2SNWA 1VCPA 1K22H 1C5LH 2LELA 1FMGA 5C1UA 1CBWB 2BDGA 1J16A 2G5NA 5HMAA 3A82A 2STBE 1BBRE 1PPCE 3BF6H 2AMPA 2W7UA 3T25A 4DIIH 1P3CA 1AY6H 4NGAH 4X6PA 2F9BH 4K1EA 1YBWA 2OK5A 3RU4D 4CRBA 4ZKOU 2FO9A 1KDQA 4B2BA 1O36A 3P95A 3UWJH 1PPEE 1CVWH 4HI3A 1SGIB 1D4PB 1GBAA 1FDPA 4DVAU 3F9FA 4FUGA 1XUJA 3M7UA 1HNEE 3MFJA 4VGCB 3CENA 1DT2A 1BZXE 3RXOA 2GJGA 3QTOH 1OYQA 2AGIX 4I8KA 4TPYA 1QURH 5C3NA 3UFAA 2FS8A 4DIHH 5EJLA 2CN0H 4JYVH 2ZDKA 1FAXA 1XUGA 2TGAA 1TRNA 1JIMA 4X8VH 3V13A 1WQVH 1O39A 1YYY1 2HGTH 1EQ9A 2BDAA 4ZXYH 4BAKB 1WU1A 3GDSA 3SN8A 3SU2A 1J8AA 1QRWA 2BD5A 1G3CA 1TNKA 4XOJA 1O2ZA 1V2JT 1GBFA 1J9CH 1V2LT 1IQEA 3A7XA 5G4BA 3EDXB 3SBKA 1DOJA 2FIRH 3M37A 4ABFA 1T31A 1PYTC 5EU8A 1WTHD 1IQGA 1O3GA 2GGVB 4A1VA 1CT0E 1VITH 3MU1A 3SOSA 2BDYA 4O03A 3VB7A 2ZCLP 1SPJA 3NKKA 1BUIA 2GCTC 1TOMH 4FUIA 1WSSH 1Y3UA 4ASUD 1S6FA 1K1IA 1QIXB 4KP0A 1JXPA 5JYIA 1Q3XA 1M9UA 3MNXA 3STIA 3F0OA 4E06H 2SGFE 5JB9S 1NRNH 1MBQA 3SO3A 2AS9A 1K9OE 3A8AA 4AFSA 4HFPB 3S9AA 4ABDA 3GCOA 3SHCH 3RXDA 1UTNA 1ACBE 4CR9A 1J17T 4ESTE 5EODA 1QA0A 1UVUH 3SU1A 1JMOH 4AB9A 1J15A 1FX0B 1IHTH 3KGPA 1YPKH 1A2CH 2GKVE 3LDXH 1NROH 1P9UA 1THPB 1LPKB 5EJ1A 1FJSA 4FU8A 1QQUA 2AFQB 1P0SH 1OS8A 1AIXH 4OS7A 4B2CA 2Y5FA 1Z8RA 2OD3B 3W95A 1C2LA 3MO3A 3RMNH 1BITA 1O2LA 1HAHH 4U2WA 1DY8A 1E36B 2BY8X 8GCHG 1MTNB 2SFAA 4YOJA 2SGQE 3T27A 4VGCC 1KXFA 1GI7B 2ZCKP 1TNJA 2VWOA 4CHAC 1XUKA 4H6SB 1ELBA 4UDWH 3E6PH 1TONA 3ZZ4A 2ZPRA 1ZZZA 2GTBA 4UFDH 3DA9B 1RJXB 1BBRK 4Y76A 1GBLA 1T32A 2BM2A 2Z3DA 1T4UH 1V2RT 1ZJDA 2ZGXH 1AUTC 2LP6A 3LGIA 2XNIA 3M5NA 5CHAB 2Y6TA 1TGNA 2QN5T 1GGDC 1DWEH
chains in the Genus database with same CATH topology
3BTDE 1HAOH 3LH1A 1BJUA 4A7IB 4OS6A 3UWIA 4X6NA 1SOTA 1MTVA 3V3MA 2VVCA 1W2KH 2Q6FA 1AN1E 2BD9A 2Z9LA 3EYDA 4FUJA 1GJCB 4GCHG 2UUYA 2ULLA 1T8MA 2FESH 3AAVA 4D7FA 1IQIA 1AKSA 4NIVA 1HAXB 4AG1A 2BY7X 1WCZA 1C5OH 1GMHG 4K8YA 2A4QA 1SL3A 4FUHA 4X1QU 1O3HA 3GY2A 2ZQ1A 8ESTE 1TQ7B 4XBBA 2M5TA 4DT7B 1AGJA 1UVTH 1A1RA 1FPHH 3TITA 2PGQB 4GVUA 1GMHF 1TMUH 1KIGH 4BXSA 5EW2H 3SNBA 1F0RA 3LH3A 1O2RA 4D7GA 4IN1A 4YLUA 2BHGA 1W0ZU 2O8TA 1TMTH 1EB1H 2Z9KA 1FY4A 1FY5A 1BRAA 4K2YA 1GI6A 3P8FA 3ZVBA 2WINI 5GIBA 4ZUHA 3RXVA 5PTPA 1EATA 3AVZA 5K7RA 3ATMA 1H9LB 1TOCB 2SNVA 1UHBB 1NRPH 3JZ2B 1GI9B 2A32A 1SQTA 5J4SA 1BTUA 1GBIA 1A3EH 1GCTC 4IN2A 7LPRA 5JBTA 1MTNC 1A0HB 1LVMA 1DM4B 4JYTA 3AW0A 1A3BH 1GMDG 1HRTH 2Z9JA 5FPTA 3KL6A 4FUCA 2D2DA 2AGGX 4JCNA 2BZ6H 4AFQA 1LVYA 2GDDA 4IW4E 3DD2H 1TB6H 1HGTH 2D8WA 2G8TA 1Y3YA 1GMDF 3AAUA 3U8RH 1LHEH 3E91A 2G81E 5HGGA 4DY7B 1CE5A 1K1LA 2OC0A 1AI8H 1DFPA 3PB1E 1HXFH 1YLDA 1Y3WA 1QCPA 1Y5BT 3DFLA 4RKJB 4DJZB 4YM9A 1C2MA 5A0AE 1KXCA 1EZQA 1OWKA 4UFFH 2GCHG 5ETXA 1A46H 2VNTA 1L1GA 4WMFA 3UQOA 1BTWA 2ALPA 1UVOA 1DITH 1HUTH 2EI8A 1GHZA 4MPVA 2GCHF 2KAIA 4E7NA 2ZECA 2BY5X 1P06A 1VJ9U 1P8VC 4CRAA 3F9GA 3RU4E 3BV9B 2AYWA 1LPGB 3A83A 1C5QA 3GCNA 4X2WA 3ZZDA 2C3SA 3ODDA 4FU7A 1G3EA 2OLGA 3LU9B 4NFEA 1HPGA 2D1JA 2OC7A 3FZZA 2G00A 3A8CA 3SNCA 1UTQA 2JKHA 3RXLA 2Y7ZA 3K65B 2FOAA 1VITG 3MU0A 1ZJKA 4ASHA 5FX5A 2QCYA 2QAAA 1FLEE 1CA0C 1SHYA 1OWEA 1RTKA 2AIPA 2OUAA 1C1SA 1VITF 3D62A 4KGAA 3SGAE 4IC5A 1ZPCA 3DUXH 2C93B 1TA6A 3QO6A 1ETSH 3VB4A 3RXMA 1ARCA 1MZDA 3T62A 1P04A 1NC6A 3ZZ6A 1QFKH 1Y3XA 2TIOA 1GHAF 1ZHMA 3RP2A 1DICA 3P8NA 5HXFA 1KYNA 4CH2B 1S81A 1A7SA 2VIPA 1ZSJA 1HAZB 4MQAA 2CXVA 5T6GA 2FS9A 2AH4X 4TWYA 3SV9A 4UFGH 2W26A 1DPOA 2Z9IA 2BXTH 1G37A 2OBQA 1LMWB 2EC9H 5DKMA 2QXIA 1O3LA 3DT0H 1VCQA 4X6MA 1GI2A 2QA9E 2RA3A 3MU5A 2FODA 1TRMA 1QB1A 4Z0KA 2QY0B 1OXGA 1E34B 1EASA 4INHA 2TPIZ 4X2XA 1OPHB 4FVDA 2QGRA 3L6PA 1PPGE 4I8HA 1GBJA 1C1QA 1TPSA 1KXEA 4RKOB 1NRRH 5DJ7A 1P2MA 1EPTA 4X1PU 4WVPE 3LGYA 1DWCH 1Y3VA 2BD7A 2FEQH 4XBDA 3QTVH 3BG4B 4Z6AH 1C1NA 3M5MA 3MYWA 4B73A 3ATKA 5A8YA 1O2SA 4WH8A 2PUXB 2PSYA 4KTSA 5GCHG 3EA9A 2F83A 1EJAA 1QNJA 1SLUB 1O0DH 1UTJA 1C5UA 1HB0B 1SI5H 2VWNA 4Y79A 1SGFA 4RSPA 3PMHB 1ZPZA 3BTGE 3M7QA 2BXUH 1F2SE 4UD9H 1YCPH 2XWBI 2FOFA 2ZG0H 2FTLE 5GCHF 4J1YA 4Y8ZA 3LC5A 3PWBA 3M7TA 1ANEA 2VWMA 5EQQA 1EJMA 1MKXK 4X8SH 4Y71A 1AMHA 2H9TH 4X2YA 2TGTA 1O3EA 5GPIB 3OTJE 3SU3A 2XCNA 4I33A 5J4QA 3GYLB 3FP7E 1ANDA 4JZIA 2XXLA 1XUFA 2BZAA 4AG2A 1DDJA 1AB9B 2ZZUH 2BD8A 4M7GA 1TX8A 4NCYA 4O3UA 2AERH 3F9EA 4WY3A 2B8OH 2ZIQH 3A8BA 4X8UH 1F0SA 1B0FA 2GV7A 3SU5A 3S9CA 1AVWA 3V0XA 1C2GA 3TH4H 2WV5A 1DSTA 3A80A 1KDQB 1GI1A 3UIRA 3RM0H 1O34A 3ESTA 1UTKA 1O3CA 1E0FD 3BIVH 3LPRA 2ANKH 2VINA 2ZDAH 4GHTA 1GJ9B 2A7JA 1L1JA 2WPMS 4BANB 2DUCA 1PFXC 4WXVA 2LPRA 2ZPSA 1EX3A 1C1VH 1YPJH 2WPJS 3ZZAA 1O2YA 2GV6A 4FUDA 1GG6C 2EI7A 1GBKA 2I6QA 1CA8B 5FPSA 1C5XB 1NM6A 4ZH8A 3M3VA 1AFEH 1INCA 2Z6BD 3RXRA 3I78A 2QF0A 4IS5A 3GY3A 4GUXA 4LXBH 2FXRA 1WTGH 1MUEB 1BCUH 2WPIS 2V35A 1DXPA 5EXMA 1WOFA 5C5OA 5C67A 3L33A 1XXDA 3KQDA 2HPQH 2J94A 1L2EA 5ABWA 2DE9A 1CHOF 1EOJA 1P05A 3RXJA 2VGCB 1TYNA 2IJOB 5E0JA 3SNEA 1AHTH 4MNVA 3UOUA 2SGDE 1TGTA 3F1SB 1TGCA 4I8LA 1QRXA 3ATIA 5F03A 1E35B 4D76A 3GCTG 5AFZH 3BG4C 3ATWA 2TGPZ 3U1IB 4XSKU 4HZHA 1D9IA 4OS4A 1LKAA 1C2KA 3IG6B 5DGJA 1V2UT 4X1SU 2BB4A 7KMEH 1Z1JA 3MNSA 3GCHB 3S9BA 1P11E 1Z1IA 4K1TA 1O3JA 1TQ0B 4KTCA 1S5SA 1FNIA 4DG4A 3U8OH 1SGFG 1LHCH 3SI3H 2P8OB 3HGPA 3A88A 5GWZA 1K1OA 1C2JA 1UVPA 1T8OA 2P16A 5F6MA 4R0IA 4YESB 1NESE 1GI0A 3OSYA 1RRKA 3RXAA 1XKAC 1DX5M 1HAPH 3RXCA 3U98H 2R2MB 5T6FA 1C1OA 3RM2H 1AVXA 4A1TA 1AB9C 1XX9A 1HIAA 1TGSZ 1V2PT 3KF2A 3NWUA 1C5SA 1O2XA 1O3PB 4B71A 2GZ7A 5FCRA 2ZHFH 1TX7A 3NK8A 1OP0A 1KTSB 1ID5H 1BIOA 1W10U 1BRCE 4ISOA 2QIQA 2UUJB 3RUOA 1BJVA 1WUNH 5AF9H 3UY9A 2P3UB 4YZUA 3QN7A 1Z8GA 1A5IA 5LGOA 2A5IA 1GMCG 1QTFA 2ALVA 4IBLH 3SHAH 1QRZA 4TY7A 1PQAA 2C4FH 1CO7E 1OWHA 1CQQA 2H6MA 2Z7FE 1W3CA 1C5TA 1GMCF 3RXGA 1V2KT 2BD2A 1HAVA 3WY8A 2NU1E 1TX6A 1PPHE 2F9VA 2PUQH 2PSXA 3N7OA 5DO4H 1IQMA 3PMAB 1F7ZA 2P94A 1T4VH 1H4WA 1N8OB 3SNAA 1HJAC 1S83A 1Z71A 2XC5A 1LVOA 1O38A 2FI5E 2BD3A 2OQUA 3P92A 4HTCH 1LTOA 1MU6B 2BX4A 3Q3KA 4WMDA 3MO9A 5DP5A 2Q6DA 3U1JB 2EA3A 3GY4A 3FFGA 1CT2E 1AKSB 5SGAE 2A4RA 5L30H 1BA8B 1ELCA 3A86A 1MAYA 3UNSA 1P2QA 4U30A 8KME2 1EB2A 1P10A 1UJ1A 1CBWC 5E8EH 4LZ1H 3AASA 3ENSB 3ZZ9A 1MQ5A 1O2HA 1W8BH 3A7ZA 3ZVCA 1P12E 1H8IH 4SGAE 1IQNA 1C1PA 1OP8A 2OC1A 2YNBA 4O3TA 1ZTJA 1GWAA 2BLWA 3MH7A 3QUMP 2XC4A 3EGKH 1XXFA 1ZMJA 2ZU1A 1JBUH 4XFQA 2A2XH 5DK1A 4A92A 5JB8S 2F91A 1YPHE 4KKDA 1HJ9A 2R3YA 4OS2A 1IQJA 1S85A 2HALA 1JIRA 4GPGA 1RIWB 1EJNA 1O2JA 3OX7U 8GCHF 3QWCH 3KIDU 1SGNE 1O2TA 2OBOA 1KTTB 2ANMH 1C1WH 4CRFA 1GHBG 1TRYA 1O2PA 2P59A 2R0KA 1K21H 1BB0B 3SI4H 4GAWA 2FX6A 2P93A 1RXPA 3ZYEA 2ZCHP 3HATH 3S69A 1ZR0A 1V2NT 3PM3A 1GJBB 1O5GH 2PKAA 3F9HA 1AVGH 2Q6GA 1GL1A 1PPZA 2R2WU 1D6RA 3IITA 2FI3E 2FOGA 2ILNA 2J38A 4E05H 5JBAS 2AEIH 3Q3XA 1C5PA 1HLTH 3MU8A 3URDA 2Y81A 1GI5A 1MTWA 2ZHQH 3VB6A 1MH0A 1Y8TA 2JH0D 1UK2A 5E0GA 4B1TA 3UREA 3M35A 1SLWB 1HXEH 2Z3CA 2K1QA 2R9PA 1VGCB 3D23A 1SC8U 2OTVA 3VB3A 2JH5D 4NIXA 2A7CA 2FOMB 4JMYA 3E16B 3U8TH 1C2EA 4MTBA 2RCEA 1SGCA 4GCHF 3TPIZ 2GT8A 5TCCA 1LHFH 2H9HA 1ZTKA 2BOHB 2P3TB 2C8ZB 2AMQA 1O3IA 4U32A 1C5VA 1ELAA 2BDCA 3CS7A 1RGQA 3DFJA 1TALA 5DP6A 1OP2A 1N8OC 2A7HA 1KLJH 4Y7BA 5A0BA 2KAIB 4LOYH 1FPCH 3T28A 4CR5A 2ZI2H 3SQHE 5K0HA 2GZ9A 3PTNA 1B7XB 2VIVA 1D3DB 3LOXA 1DLEA 1FN6A 5FPYA 3RXSA 2P95A 1IAUA 4IGDA 2YNAA 3SUGA 4IMZA 3ATLA 4NSYA 1EKBB 4NFFA 1ZYOA 1YCPM 3A7VA 2VH6A 2BOKA 1EUFA 1SLVB 1G30B 1QL7A 8LPRA 2GX4A 3B23B 3PV4A 3RXTA 1TLDA 1YP9A 1RS0A 4WMEA 1MCVA 3GDVA 3A85A 5E0HA 3UNRA 5BPEA 2BQWB 1ESTA 3GDUA 3E3TA 2BDHA 4Y8YA 1V6DA 3HKJB 1C2IA 3QK1A 1NRSH 2PWXA 4NIYA 3VPKA 5JPMH 2D26C 4ZKNU 3G01A 2O8MA 3SORA 1Q2WA 5EPNA 1NFXA 1A4WH 1FAKH 1SQAA 1BRBE 3S0NA 4ZHLU 3RXEA 1T7CA 4UEHH 1GI4A 2J2UA 1AZZA 1FXYA 4NA9H 3PLBA 1C2DA 1W7GH 3KN2A 1V2VT 3VGCB 1T8LA 1EAWA 2IOTA 5EGMA 2BY6X 1RIWC 2XC0A 2H5CA 1EOLA 1FUJA 1O2WA 2Z9GA 1O5EH 4I7YH 1OWJA 3ZZ8A 1AWHB 3IWMA 1S82A 3EA8A 1NY22 1DY9A 1W0YH 2WYGA 3D65E 2PTCE 4K69A 2BD4A 1GBCA 2FOBA 3EAJA 1ZSLA 3SV2H 5CHAC 2G51A 1K2I1 2H2ZA 1O3NA 2PKSB 1NZQH 5C20A 2XW9A 4ZAEA 3Q3YA 2PV9B 1TFXA 2QF3A 1BMNH 1UTMA 1GVKB 2R3UA 1EPTB 1UTOA 4ISNA 1Y5AT 3ITIA 4O97A 5FHTA 1O3KA 4I8JA 1K1MA 1XM1A 4BTUB 1VGCC 1W13U 2RDLA 2F9OA 1SHHB 1Z6EA 3LONA 2W7SA 3TK6A 2NU4E 2BQ6B 4Q7YA 5JDUB 1TPAE 4TY6A 1YPLH 1XVOA 4D9RA 1H1BA 1SFIA 3SU6A 3K2UA 4E7RG 1C2FA 4I32A 5E2PA 1MKWH 3P17H 2BVRH 3ZV9A 2O9QA 3ODFA 3QZQA 4X1NU 4FUEA 2VJ1A 4UONA 2GZ8A 2OC8A 4OGXA 4I31A 1LKBA 2H5DA 1SR5C 1IOEA 1VR1H 4MNYA 3TGJE 5FBEA 1ZLRA 3SUDA 3MH4A 3E0PB 2ZC9H 1C5ZB 2HNTC 3W94A 2FLBH 7ESTE 3K6ZA 3SJKA 1EP5A 4YOIA 3FP6E 3RXIA 1BT7A 3HKIB 4ZKRU 4Y0ZE 4D8NA 1ELFA 1ELVA 4O9VA 1O5FH 3UPEA 3BEUA 1EZSC 1C9PA 4CBNA 1K28D 1EAXA 3PMJA 3TH3H 4K5ZA 5A8ZA 1GJ7B 3TJOA 1BTHH 1O2GH 3GY5A 1C4V2 1G2LA 5FAHA 3UOPA 3UQVA 4AYYB 1MQ6A 3A87A 1UTPA 4ABEA 4YTAA 4B74A 1YCPK 1GJ4H 2ZDVH 2ZFTA 1EAIA 1FIZA 2XWAA 7GCHG 2ANWA 2RG3A 3SU4A 1MD8A 1O33A 3VGCC 2Z94A 4NWLA 2ZHDA 2VB0A 4THNH 4ZHMU 3E1XB 1FI8A 5L2YH 1O5BB 1ELTA 4JYUH 1YPEH 1BTZA 1HAYB 1ETTH 3SV8A 2A4OA 4JK6A 4Y10E 5FX6A 1UMAH 4U01A 2ZEBA 1D3PB 3HK3B 4PROA 3PTBA 3PYHA 1GHXH 1DWDH 1SGRE 3BEFB 3B9FH 3RU4T 4WF8A 1GHYH 2PKSC 2ZHEH 3KQBA 1HFDA 1IQHA 2WYJA 1N6YA 1V2MT 4TPIZ 1QBVH 1PJPA 1GBDA 1TNHA 1EPTC 4NIWA 5DP3A 4Q7XA 2ZO3H 3M5LA 1LVBA 2V0BA 3GY6A 3RXHA 1O2VA 1SOZA 1TBRH 5FXLA 1O35A 4BAQB 1AE8H 2GP9B 2ZDLA 4LZ4B 2JETB 4YOGA 2ODYB 4CRGA 5JBBS 3GICB 1ZRKA 3GISB 2ZU2A 4CRCA 2HLCA 1HYLA 4FUBA 2XYAA 1K1JA 1GI8B 4INLA 2QC2A 1E37B 3RC4A 3KHVA 1QL8A 2G4UA 1D3TB 3BG8A 1XUHA 1LPZB 1HJ8A 3FZDA 3S7HB 1QY6A 1G9IE 2BVXH 3T29A 1DLKB 3KQCA 1MTSA 1AZ8A 2CHAB 1QHRB 3BTFE 3RDZA 1FN8A 1EZUC 3SU0A