1GI6A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi6A02
1BRAA 1Y3VA 1YPJH 5EQSA 1C4V2 4MNWA 1P9SA 2H9EH 3TITA 1TNHA 1XXDA 1PQAA 2G4TA 2WYJA 1L4DA 1TNKA 2ZCLP 1TMBH 2A0QB 1GHAF 2QV1A 2ZQ1A 2F9VA 1MZAA 5E2OA 1HAXB 3OY6U 2PKSC 3FZDA 2H1UA 3GOVB 2PHBA 4AFQA 5DKMA 4CREA 4I8JA 4E7NA 3VXFH 2BY9X 1XVOA 2QXIA 2BB4A 3F9GA 1P05A 2BHGA 3HK6B 4YZUA 4YLQH 1K1LA 3MH7A 2BLOA 1EZQA 5DPAA 1GBHA 2BQWB 3SJ8A 1QCPA 5JPMH 3MU8A 2ZFQH 4WH8A 1C4U2 4E06H 2ZTYA 1MKWH 3LJJA 2ZA5A 3QZQA 1TOMH 3NXPA 5ETXA 1OX1A 1SGFA 2BTCE 4XDEA 3UY9A 2EEKA 4X1SU 1W10U 1Z6EA 1O2SA 4FXGH 1KXBA 3AASA 5HM2A 2HRVA 5E0GA 1QR3E 1QB9A 1W8BH 4X6NA 2W7SA 2GDDA 2AIPA 2F9NA 1BZXE 3O8CA 1QNJA 4CHAB 1DS2E 1TIOA 3NZIA 5I46H 1KXFA 3GY6A 1FPCH 2WINI 2G4UA 3M5NA 3R3GB 1ZTKA 2ZPRA 5LH8A 2J34A 3SU2A 3TLOA 3BEIB 1ZGIA 1TBZH 4E05H 3PYHA 5DP7A 1S84A 3A87A 4MTBA 2QN5T 3BIVH 3FP7E 4JZEH 3RXKA 2GDEH 2IPHA 2ZZUH 1SGQE 4B2CA 1CU1A 3QZRA 1MBQA 1RXPA 3RXLA 4CRAA 2G81E 4X0WU 7GCHG 8ESTE 1YC0A 3SNCA 4YLUA 4LXBH 2A32A 3NWUA 3SJKA 3IG6B 1O3KA 3PO1C 1L4ZA 1ELVA 3ZVDA 1LCYA 4K2YA 1IHSH 4AN7A 3DUXH 4MDSA 1T7CA 3VB5A 3KHVA 4BTTB 3U98H 3A8CA 3VXEH 1TQ0B 1BMNH 1C2GA 1VCQA 2XCNA 2QA9E 1MCTA 1A46H 1D3PB 1S6FA 4Q7XA 1ZPZA 3A88A 1YP9A 4THNH 2H5CA 2OBQA 1KTSB 3QN7A 2B9LA 2GZ9A 1YCPM 3UFAA 3GY3A 2CHAC 2UWLA 2W26A 1MU6B 1NZQH 3ESTA 1K1OA 1NRRH 2ULLA 2PLXA 3EA7A 1L1NA 3HKJB 4WH6A 1DWDH 1KYNA 2AS9A 4RSPA 3RMMH 2GT7A 3P92A 1BJVA 1YKTA 2CMYA 2SNWA 2VINA 7GCHF 2FI3E 1Z8RA 3MYWA 1HPGA 1DXPA 4H42U 1ZRKA 2BD4A 2ZU3A 5C5NA 1EAXA 1OP2A 1TBRH 2Z3EA 3MO3A 1QRWA 1AE5A 4OS1A 1BUIA 2HALA 4UD9H 2EI7A 2Y7XA 4NFFA 2GMTC 1LQDB 4RKOB 1HGTH 2BD7A 1SLVB 1SGTA 3LGWA 4LZ4B 2K1QA 1O2XA 1UTKA 2XBVA 1GCDA 4FU7A 2FOGA 1AMHA 1Z8IB 1UK2A 2P93A 2ZGBH 2BX3A 1AWHB 1ZR0A 2Y6TA 2FDAA 3TJUA 3P8FA 4H4FA 1JRSA 2VVVA 2BDHA 3URDA 1V2JT 1TGSZ 2FMJA 4A6LA 1ZMLA 2ZWLH 4TWWA 3KL6A 2GP9B 4NA7A 3K2UA 2BLQA 1GPZA 1BTUA 1ZYOA 2OC7A 4JMYA 2H5DA 3GY4A 5EPYA 2FWWA 1XMNB 4TY6A 1KTTB 2A7HA 1H9IE 4KP0A 1YF4A 4ZUHA 2R3YA 4NSVA 2F9UA 3ZZ6A 1G2MA 1LVYA 3QWCH 1GL1A 1NU9A 1GJ5H 1A0LA 3PLKA 1DSUA 3DA9B 4NIYA 2ZDNA 2ASUB 3KQDA 3UR9A 1V2MT 2VIQA 4ISOA 4D7FA 3ZYEA 4KGAA 2PKAA 2XC0A 5JB8S 1XUGA 3BG4B 2VU8E 2GD4B 3LGVA 1GI8B 3GY8A 1BMAA 1P02A 1J9CH 3HKIB 1BMMH 1UK3A 1CO7E 1O3HA 2XWBI 1SGIB 3E0PB 2ZGHA 3ZZ8A 2ZHDA 6ESTA 4ISNA 4AYYB 1AVGH 3V13A 3S9BA 1FN8A 3FANA 4YTAA 1O3NA 4MNYA 2DE8A 3D62A 4X1RU 1C5ZB 1LKAA 1EQ9A 4GPGA 1YM0A 2FOAA 4ZXXH 2ZP0H 8GCHG 3UREA 1YPHE 5DK1A 3GDUA 3BIUH 3R0FA 1BHXB 5LPEA 4Z6AH 5A2MH 1DX5M 3DFJA 1W0ZU 4ASHA 3RC6A 4B2BA 7LPRA 2A45B 2BDAA 1W11U 1K28D 1QRZA 1XM1A 3RLYH 1A7SA 1DOJA 2P3UB 1C5XB 1SGDE 3PWBA 2FTLE 1B0FA 2P95A 1O3JA 2ZKSA 3UQVA 3SNEA 2FEQH 1AKSB 1C5TA 1TMTH 5FPTA 3C1KA 1V2WT 3S7KB 1M9UA 1O39A 1FI8A 1G2LA 4HZHA 1PPFE 3MMGA 3E8LA 4IMZA 5EU8A 5F6MA 3QGJA 1TB6H 9LPRA 3EQ0H 3RXUA 1TNIA 4FUHA 4YESB 3SUDA 4AB9A 1LHDH 1O31A 2FTMA 3SV6A 1GI3A 2JETC 2GT8A 1QL8A 5C1UA 1DSTA 4WVPE 4MNXA 1XUKA 3A7VA 1LPKB 5FXLA 1LKBA 4KTSA 2OTVA 5F8ZA 4K1SA 2C4FH 2C8WB 1QY6A 1NPMA 1C1NA 4ZXYH 2G5VA 2OD3B 2CJIA 3S9AA 3Q3YA 4E7RG 4ZAEA 1EPTA 2G00A 2PTCE 1MD7A 4NWLA 2BQ6B 2FZZA 1HLTH 2ZDAH 1BTYA 1SBWA 3M35A 3RU4T 1DDJA 1GMDF 1DXWA 3U8OH 1FY8E 3RU4E 2O8TA 2ZECA 3H5CB 1P03A 1FDPA 4OGYA 3SU4A 1IQLA 4I8GA 1K2I1 2BY7X 1CE5A 1O2RA 2BY5X 5GXPA 5BRRE 1CA0B 4Y10E 3UOUA 1K9OE 3BSQA 2C3SA 5A8ZA 1V2VT 5AHGH 1C5OH 4TPIZ 3TH4H 1MQ6A 2BX4A 1TGBA 1TNLA 4KTCA 3RU4D 1O3MA 4HTCH 4ESTE 3MU4A 1GJAB 1KSNA 4IC5A 3ZZCA 5A8XA 1J8AA 1L2EA 3BF6H 4XOJA 4NG9H 1TGCA 3GICB 4M7GA 1MKXH 1OWIA 1G9IE 1O3IA 5C5OA 1XUIA 1SL3A 2V0BA 1Y8TA 3SGBE 2PGQB 2WV4A 4RKJB 1AN1E 4UDWH 1NN6A 4FVBA 5C2ZA 1EATA 4KELA 5B6OA 2TGAA 1F5RA 3O8DA 1VJ9U 3CENA 1C5SA 2XW9A 3B23B 3D65E 4D7GA 7ESTE 1MH0A 2WPKS 2A2QH 3EA9A 3T26A 4DW2U 2AYWA 3SU1A 4NGAH 2TPIZ 1GI2A 1H9HE 1THSH 2OC8A 1QA7A 2PGBB 4WXVA 4YO9A 3UWJH 4GLYA 2Q6FA 2P16A 3RXVA 4Q2KA 3M5MA 2M5TA 5JBTA 2W7UA 1ZHRA 5EOKA 3K9XB 2WV5A 1C1WH 3UPEA 1EB1H 1HAPH 3PMJA 2V3HH 1NY22 1HJAB 4ABDA 3L6PA 2V35A 1V3XA 1BTZA 1CHOG 1PPGE 2VVUA 4JYUH 4Y76A 3GY2A 2BMGB 1QTFA 2VWLA 1QL7A 2ZHQH 4O9VA 4BAKB 2C8XB 3MHWU 3RXRA 1VGCC 1LVOA 3RDZA 1FUJA 1P3CA 1OWDA 5GDSH 3V7TA 2BZ6H 1AO5A 1D3DB 1BRUP 2I6QA 1Y5AT 2ZGJA 4AFUA 1SGFG 2FM2A 2PR3A 3LC3A 2BDIA 3VPKA 4UFFH 2STBE 1SG8B 4K1TA 4INKA 3ZVFA 1IHTH 1O2YA 3FAOA 5AVDA 3T2NA 4D9RA 1DY8A 1SHYA 5GCHG 1O2ZA 3M61U 1UVPA 1ZSJA 4AG2A 4Q80A 1GJ4H 1C2HA 1TPAE 1AQ7A 1SGRE 2QXJA 1AFEH 3FZZA 4Y79A 1T32A 4ISLA 1S5SA 3RXEA 1GBBA 1SPJA 1CHOF 1IQEA 1P8VC 2ALPA 3ODDA 3PTBA 3MH6A 2RA0A 2BD2A 3A82A 3F6UH 1KIGH 4AG1A 4X2XA 1PPEE 1GJ9B 1ABJH 4CR9A 2XTTB 1V2QT 1F5KU 2H6MA 1J17T 2TGPZ 5HYOA 1DWCH 5EW1H 2ZI2H 1Q31A 2GZ7A 4NIWA 3TK6A 3H7TA 3UOPA 2AMDA 1SQAA 4H6TA 1SSXA 1GHAG 1GWAA 1UHBA 1CGHA 2P59A 4ABFA 4UE7H 2HNTF 1VGCB 2ZFTA 3SJOA 4X8SH 1IQKA 5HGGA 1XX9A 1L1GA 1RTLA 2VB0A 1SHHB 1O2UA 1P2IA 3HATH 1OYQA 3QK1A 4OS7A 1H9LB 1RS0A 1FNIA 4FU8A 3SBKA 2R3UA 5E2PA 4CHAC 2A7CA 2QIQA 1GDUA 2V3OH 1Y5BT 3TJNA 3AW0A 1TABE 1JOUB 1AY6H 1QL9A 5H4IB 3TNSA 1TYNA 5HM9A 4FUFA 1EAUA 1CA8B 5A0AE 1TFXA 4MQAA 1HAYB 1O38A 4CRFA 1THPB 1QA0A 3MO6A 3E6PH 2GTBA 1A5GH 1T31A 1MD8A 3SO3A 1QJ6B 2BLVA 2FI5E 2HNTE 1GBEA 2BM2A 1AIXH 1QQ4A 2AIQA 4GCHF 3HGPA 4CBNA 4IMQA 3F9FA 1H4WA 1AHTH 4X2YA 1C1RA 4KTUA 1O5BB 4BTIB 1TNGA 3BEUA 1EX3A 1GBDA 1GI1A 2Z3CA 4QT8C 1BT7A 3F9EA 1C5QA 2SGPE 6LPRA 4OS5A 4Y7AA 1O2MA 4XBBA 2JKHA 1DY9A 4WXIA 4ABJA 3A81A 1F7ZA 1O34A 1MCVA 1EZSC 4PROA 1ZJKA 2WPLS 3E0NB 2NU1E 1J16A 2QY0B 2OQUA 1ELEE 3KNXA 5FPSA 1O3PB 3LPRA 3SNDA 1A3EH 4MPUA 3GCTF 1ZMJA 5EODA 1FY1A 1ZOMA 1DWBH 2VNTA 5C1YA 5DP4A 4VGCB 4X8VH 3STJA 1Q2WA 2WYGA 2THFB 2Y82A 3NK8A 4NIVA 1LHCH 1KXCA 1GJ6A 1VZQH 2PTNA 4B2AA 1IQNA 1P57B 2CF9H 5AFZH 1C5RA 3SV9A 2UUFB 2OQ5A 2FO9A 2JH5D 3BG8A 1T4VH 2KAIA 1ANBA 3ZZBA 1SLWB 2NU3E 5G4BA 2Y5GA 1NRNH 1Y3WA 1YYY1 1WYKA 5GJ4B 3Q00A 1PYTD 2O8UA 2ZO3H 4MVNA 1MTUA 4ABIA 2J2UA 5FCKA 1GGDC 4AX9H 3LU9B 4NZQA 1O2VA 1V2KT 1DUEA 2FS9A 3A80A 2QXGA 1NRQH 1TX7A 4DY7B 4R0IA 1S6HA 1GHWH 1ELGA 4FUDA 2P3TB 1LPGB 2WPJS 4XBDA 3UNQA 1C2DA 3KGPA 1S0QA 4JK5A 3RMLH 1TPSA 4AFZA 5L6NH 1C5WB 1P2JA 1C1VH 4U01A 1ELAA 1PPBH 1XKAC 1D6RA 5LPRA 2SGEE 2ILNA 1SGYE 3MTYA 1NS3A 2Y5FA 2J92A 2AMQA 2XC4A 1TGNA 3O8RA 1SFQB 4WMDA 5C20A 5CMXH 1RRKA 1SQTA 3SJ9A 1ELTA 1DM4B 4AB8A 2ZHEH 1YCPH 2CV3A 1EZXC 2SFAA 1WUNH 1F0UA 2FESH 5FX6A 4BAQB 1N6YA 1UCYE 2V6NA 1YPLH 4DOQA 4B74A 1HAOH 1EAIA 5F8TA 5JYIA 5T6DA 3OSYA 1TQ7B 5EXNA 1K1JA 1FONA 4OS6A 3BG4C 1A2CH 1FQ3A 1KLIH 1CVWH 2B5TB 3M37A 3G01A 1OWJA 1TWXB 2TRMA 2I6SA 1Z71A 2Z9LA 1UVTH 4ZH8A 1BA8B 4I32A 3PLBA 3PTNA 1TA2A 1XUHA 1HXFH 3NUMA 1QB6A 2JH0D 4MPVA 1IQIA 4JZFH 1GGDB 1Z1JA 3TK5A 1PPHE 1DLKB 1N1LA 5GWZA 4TPYA 1TRNA 4BTUB 3U1IB 2EI8A 2FODA 2PSYA 1HB0B 2FOMB 1AI8H 1P12E 1SVPA 1C5NH 4Y8ZA 1HIAB 1UO6A 1OOKB 1VJAU 3SV8A 3ATLA 1WTGH 1WTHD 1O5GH 1MTVA 3GCNA 5LPFA 1JXPA 1XKBC 1HAZB 2QXHA 3Q77A 1GJBB 5T3HA 4U32A 5AF9H 5A0BA 2FYQA 1ELFA 2ZG0H 3ATMA 1GI0A 3TK9A 1NRPH 1HAHH 3LGUA 1FAKH 1HV7A 3SW2B 1HUTH 2VJ1A 4O97A 4NWKA 1FLEE 1P10A 1G3EA 3RXSA 3CS0A 1TRMA 2ZHWH 4JYTA 2ANYA 3GY5A 1W2KH 5A8YA 1ETRH 5DP9A 1KDQB 3BTEE 2ZHFH 1AZ8A 1NTPA 1MKXK 3M36A 1MUEB 1UTPA 2XBYA 4I31A 4R8TB 3ZZ3A 1T4UH 1ABIH 1C1UH 1LVBA 1N8OC 4I8HA 1RIWB 2F83A 1HBTH 2OLGA 4GHQA 3DHKH 2LPRA 1BCUH 1ZPCA 3I77A 4ABEA 3FFGA 4TYDA 3U8RH 2F9OA 1ELBA 1GMHF 3KIDU 2A5KA 3GY7A 4JZ1A 2C93B 4I8LA 2C8YB 5CE1A 4I33A 1O30A 1K1IA 3TGKE 1YPKH 1FN6A 4NFEA 1E35B 2FOEA 4SGBE 1C2FA 3PMBB 1LHFH 1P09A 2YNBA 2FLBH 4Y11E 2SGDE 1ELDE 3MU1A 1OSSA 1PFXC 1CA0C 3MI4A 3OYPA 1MTNB 4AYVB 2Z9KA 5DP3A 3RXAA 1XXFA 1NC6A 4XE4A 4UEHH 1C1MA 5HXFA 1ZGVA 1IQFA 4B73A 2ZFRH 1WQSA 4ZHAA 1GMDG 4KKDA 1O2WA 2ODPA 1FIZA 3N7OA 1TPPA 1ZJDA 3T27A 5T6GA 4UONA 1BBRH 1SGCA 3SOSA 2PFEA 1SGEE 1V2TT 1NU7B 2FOFA 4OS4A 3PLPA 5TCAA 3BTME 3M5LA 3RXFA 1F0TA 1O3BA 1QURH 2BVXH 5DP6A 1A5HA 2XYAA 3UTUH 2VIDA 1SLXB 3URCA 2PUXB 3SN8A 1FY3A 3A8DA 4RN6A 1H8IH 3A85A 1HNEE 3QTOH 2J9NA 4SGAE 1CT4E 1UK4A 3GISB 3TGIE 4AGJA 4X8TH 4MPXA 1N8OB 1GHXH 2AMPA 2XXLA 1KXAA 4TWYA 1O2PA 2BXTH 4DCDA 1AVXA 1O5AB 3KCGH 1E36B 3L3TA 3NKKA 3LJOA 1BBRE 2D1JA 1C5YB 3ZZ9A 1GVKB 3UUZA 3P8GA 4IS5A 1CQQA 1GHBG 1SC8U 1QBNA 1EKBB 2Q6GA 3ZVGA 2BVSH 3U1JB 3RXPA 1AFQC 3GCHC 2VH6A 5PTPA 5IYTA 1HJAC 1A1RA 3M3TA 3T25A 1A0HB 2BOKA 4Y8XA 1AZZA 4K3JA 4DVAU 1Z6JH 1OPHB 4CR5A 2FLRH 5FCRA 4IN2A 2GCTB 3BN9A 1O36A 4WF8A 1O35A 1SGNE 5GPIB 3ATIA 3RMOH 1UVOA 1FV9A 5JBBS 2HGTH 1NFXA 1OKXA 5E8EH 1ZTJA 4BAHB 2O8LA 1HAVB 3RUOA 1T8NA 3BTWE 4DIIH 1TMUH 3V3MA 1AWFH 1S82A 3BTDE 3LT3A 3ZZ4A 3A8BA 1V2RT 2QC2A 3VEQB 1GBAA 5JB9S 1F0SA 3A7TA 3ZYDA 3M3SA 1CBWC 3SU0A 1RTKA 3DT0H 3SHCH 1EXFA 4WJG2 6CHAC 3VB7A 1L0ZA 3SNAA 1S85A 1GHBF 1W0YH 1O2KA 1QBOA 3BTGE 4ZKOU 5J4SA 1NM6A 2CN0H 3NPSA 1J14A 3TH2H 1FXYA 4B75A 1O3AA 1O3FA 1C5VA 1DUAA 2Z6BD 1BDAA 1O2OA 5F8XA 2O9QA 1KLTA 4YOIA 4CRBA 1W14U 2C8ZB 1BRBE 3PM3A 2ZQ2A 4GHTA 5TJXA 4GSOA 1IAUA 3B8JA 4K8BA 3U9AH 1EOLA 2GVFA 2G8TA 3JZ1B 2VH0A 1J15A 4D9QA 3S69A 1D3QB 1AFQB 3BTHE 3GCHB 3RXIA 1HJ8A 3M7TA 5T6FA 1UVUH 4WMFA 2A4QA 4K5ZA 4FUCA 5EQQA 1GHZA 1B7XB 1C1PA 2ZNKH 1BRCE 2TBSA 2G55A 1O2LA 1NRSH 2Z9GA 3S9CA 1GBJA 3OY5U 2AERH 1GBKA 3QO6A 2YOLA 9ESTA 1GHVH 5DP8A 1HAGE 1MKWK 4Y71A 3SI3H 3C27B 4U30A 4ZHLU 2STAE 1CBWB 1FPHH 1S81A 3OU0A 4IGDA 1YLCA 4INLA 1EB2A 3V12A 4FVDA 1ANCA 1OP8A 4A1TA 3LIWA 1W12U 3MOCA 6CHAB 4OS2A 3RXMA 2Z3DA 3MNBA 2RG3A 1EOJA 2AH4X 1O3DA 5JBAS 2Z9IA 1YPMH 2CGAA 4K60A 2PUQH 3LOXA 1WSSH 5F03A 3DFLA 2J38A 1O3GA 2SGAA 4X1QU 1PPCE 1ZSLA 2J4IA 3Q76A 1GDQA 5C67A 2VGCC 5EXLA 4YOJA 4JYVH 2XNIA 1HYLA 1JRTA 1MU8B 3RXOA 4FUGA 1HRTH 3AW1A 1VITF 2ZDVH 1P2NA 2SNVA 2ZPQA 4FUIA 2P8OC 1VITH 5A0CA 1F2SE 3AVZA 1C4Y2 4FUEA 2ZU4A 2UUYA 2FP7B 3MNCA 1TGTA 3UIRA 1Y3UA 1C2JA 1GDNA 2ZFPH 4ZKSU 3RXCA 3ZV9A 3SHAH 2R2WU 1LO6A 3BEFB 3BTTE 4GCHG 2CF8H 1B5GH 4OGXA 1Z8GA 1ZHMA 1GBMA 2SGQE 3A7ZA 3BTFE 3LONA 1D3TB 4NA8A 5DJ7A 2BDYA 2BLWA 1MAXA 1YPGH 3UWIA 1GBTA 4F49A 1LHEH 1ORFA 1IQHA 3W94A 4JZDH 2R2MB 3U69H 1EUFA 1CSOE 1UVSH 1C1TA 1GHYH 1QGFA 3A86A 4AOQA 1K1MA 4X2WA 4VGCC 2R0LA 2QGRA 2GGVB 3VB6A 2ZF0H 3EGKH 3SGAE 4TY7A 1V2UT 2DE9A 3EE0B 3VGCB 1YGCH 1G32B 3F68H 3M7UA 3FVFB 2A5IA 2EA3A 1BQYA 2D8WA 3QGNB 1SFIA 1ESTA 1P06A 4GUXA 5FBEA 4D76A 3GCTG 3SUFA 1L1JA 2A31A 3QTVH 1P2OA 2F3CE 2Z94A 3RXJA 4X2VA 4JZIA 4CH8B 1QHRB 1O2HA 2VVCA 2VGCB 2XCFA 3H7OA 2FIRH 5L2YH 1O3CA 3RC5A 3E3TA 1P04A 1BTPA 3B9FH 3TVJB 1W7GH 2P8OB 1YBWA 2UUKB 5FHTA 1WQVH 4O03A 1TX8A 3P8OA 4B71A 1TONA 1UJ1A 3EYDA 4DT7B 5J4QA 1SMFE 3RMNH 1RFNA 5ESBA 8KME2 4XFQA 3ITIA 4AORA 1D4PB 1O32A 3P8NA 2XBXA 4GAWA 2BQ7B 5FBIA 2HOBA 1E34B 1O2TA 1ESBA 3OTJE 2QF3A 3BTQE 2GCHG 1AGJA 1ZMNA 2PW8H 2WUBA 4MLFB 3TH3H 1HJ9A 2BDGA 2D2DA 1G30B 3NCLA 1OWKA 1MBMA 5ESTE 4AZ2B 1ID5H 2F9PA 2EC9H 4FUBA 2DUCA 1GJ7B 3F9HA 4DURA 2A4RA 2W3IA 1QJ7B 3M7QA 5CHAC 5EXMA 2PSXA 1GVZA 1CT0E 1LPZB 1EASA 2W5EA 4Y6DA 5E0JA 1ETTH 3ELAH 3TIUA 5JDUB 3CS7A 1C2IA 3MFJA 1NROH 1BMLA 2UUJB 3PMHB 2WPHS 1BITA 2J94A 1GBLA 2ZDMA 3A7YA 5FX5A 1DICA 4ZMAH 4DG4A 2Y5HA 1ACBE 2ZU1A 1BTWA 2ANMH 1QFKH 4YM9A 2ZU2A 1U6QA 2Y81A 5L2ZH 1ARCA 1MTSA 3E90B 3GCOA 4ABHA 1O2GH 2VWOA 2GCHF 1UCYH 1K1NA 1T8MA 2A2XH 1BOQA 3A8AA 4BAMB 4NSYA 1SOTA 4UFGH 5SGAE 1HXEH 4WMEA 3TNTA 3TJOA 3MH4A 3SQEE 2PKSB 1EZUC 3FP8E 1A61H 4B1TA 1D6WA 3IITA 5EGMA 3PB1E 4I8KA 5FAHA 1ELCA 1B0EA 1C5MD 1VCPA 3P70B 1P01A 1UTLM 4ZROA 2G5NA 1LVMA 2IOTA 4K1EA 2AEIH 4IC6A 1GBFA 1MZDA 1T8OA 1V2OT 1UTOA 4BANB 1IQJA 1GJDB 1A4WH 2BDCA 4A1XA 4K69A 1BBRK 2HPPH 2ZEBA 2FX4A 3PROA 4A7IB 2HWLB 3ZVCA 5CHAB 4F4OC 2XWAA 1CGIE 1ANEA 1TX6A 1OWEA 1TE0A 2FXRA 4ABGA 1O3EA 4IN1A 2O8MA 2Q1JA 1BTHH 3RC4A 1RIWC 3DD2H 2PKAB 1MAYA 1RJXB 1C1QA 3MNXA 4JK6A 1BB0B 3GYLB 3MNSA 4X1PU 2W3KA 1YPHC 4X1NU 5DGJA 1GI9B 1NFWA 1WAYB 1D9IA 1GG6C 3ATKA 1V2LT 4X6MA 3KQBA 1F92A 2AGIX 3EDXB 1OWHA 1TBQH 4DJZB 1W13U 2TGDA 5EW2H 4FUJA 1V6DA 4O3TA 3S0NA 1XVMA 4Y7BA 4H6SB 4GVUA 1DANH 4CH2B 1EPTC 3T62A 1Z8JB 2FI4E 3RXGA 2OP9A 1MTNC 5DG6A 1AU8A 3MH5A 1IOEA 2NU2E 1AB9C 1V2NT 3D49H 2BD9A 1P2KA 3PO1B 1GMHG 4ABBA 3SGQE 2AFQB 3E16B 1Y59T 4Z0KA 1FZZA 3PWCA 3SV2H 2QCYA 1BJUA 2BD5A 2GKVE 3U8TH 4J2YB 3LGTA 3EAJA 3SI4H 3AAUA 3F1SB 4HGCA 1MQ5A 4AGKA 3GYMA 5IDKA 3A7WA 2JH6D 2Z9JA 4Y0YE 1W7XH 4UFDH 1TRYA 2CHAB 2WPIS 2OINA 7KMEH 1QJ1B 1IQMA 1F0RA 3QLPH 2FX6A 2XC5A 4CRGA 1HCGA 1ARBA 1E0FD 1Q3XA 1OP0A 3RXTA 4IBLH 1H1BA 2ZTZA 1EJAA 2ZDLA 1DITH 5FPYA 1UTNA 2BD3A 3SORA 1SB1H 2BXUH 1K21H 2J95A 1C5UA 5EQRA 3SQHE 4CRCA 5C1XA 1P3EA 2BY6X 1O33A 5HMAA 4ZKNU 1KLJH 2PV9B 1NO9H 1O5CB 4U2WA 1DFPA 1NFYA 1BHXF 3KQEA 3TPIZ 1V2PT 3SZNA 1UMAH 1GG6B 2G52A 2P3FH 1H8DH 2FS8A 3W95A 3Q3XA 2BZAA 3ODFA 2ESTE 5GIBA 1AUTC 1K1PA 2GMTB 2ODYB 3KN2A 1GI6A 3UNSA 5L30H 1O5DH 2H9TH 1HIAA 1O2JA 1EPTB 2ZGXH 4MPWA 1GI4A 3RXDA 3Q3KA 2GCTC 1GI5A 3KEEA 4INHA 1JWTA 4B76A 1AB9B 4WWYA 4BNRA 1PQ7A 2VIVA 3HK3B 4JCNA 1LMWB 2A5AA 4LZ1H 1XUFA 2ZTXA 1OXGA 2F91A 1GI7B 2R9PA 2OUAA 3D23A 1A0JA 4D8NA 5EPNA 1TA6A 1FJSA 1O2IA 3LKWA 4Y0ZE 1CHGA 2LNCA 2H9HA 1G36A 2GV7A 2NU4E 3PMAB 3ZZDA 3VB4A 1RGQA 3QUMP 2ZPSA 3P17H 3ZV8A 2VIOA 1UTQA 3KF2A 3SU6A 3E1XB 1KDQA 2ZFSA 1PJPA 1DWEH 2C90B 8LPRA 1EP6A 3TU7H 1GVLA 1NESE 2HPQH 1O5EH 3K6YA 2Z7FE 4AFSA 2WUCA 2ODQA 1EAWA 5BPEA 1VCWA 2ZU5A 1O3OA 3M5OA 2A7JA 3RXHA 4HI3A 3ZZAA 1C1SA 1DPOA 3GDSA 3PV4A 3EA8A 8GCHF 4NZLA 2ZCHP 1YPEH 1UTJA 4X8UH 1C5PA 1WU1A 2NWNA 1TOCB 1S0RA 2O8WA 1SLUB 4DGJA 2IN2A 5JBCS 2F9BH 1ZRBA 2GZ8A 1T8LA 1HDTH 3ATWA 1RTFB 1ZZZA 3MO9A 1F5LA 1WCZA 4Y8YA 3ZZ7A 5A09A 3UNRA 2YNAA 2FOHA 2R0KA 1ZTLA 2GV6A 3IWMA 2XRCA 3ZVAA 1LQEA 3VFEA 1MTWA 3QDZB 2UWOA 4ISIH 3T29A 3RM0H 1AKSA 2PWXA 5LGOA 1KXEA 1WBGB 4ZHMU 1Z1IA 3P6ZB 3TJVA 3UR6A 4YT7H 4ABAA 2B7DH 3SU3A 1A3BH 3KQCA 1KXDA 3MU5A 2AGEX 3O8BA 3K65B 2OC0A 4LK4A 4A92A 1GJCB 4BXWA 1ETSH 4X6OA 2OBOA 1TLDA 1K22H 2BD8A 4O3UA 1DLEA 3ZZ5A 2SGFE 2RDLA 2VIWA 1AD8H 3STIA 1SQOA 3K6ZA 1SI5H 1DE7H 1E37B 2JETB 1P2QA 3LDXH 2ZCKP 2ZIQH 5E0HA 3MWIU 2G51A 4Q7ZA 3LH1A 1ZLRA 3AAVA 2AGGX 1N6XA 1Y3YA 2A4GA 1DVAH 2QF0A 1Y3XA 2CXVA 1V2ST 1C9PA 4NCYA 3LGIA 3RXBA 1FMGA 1P0SH 2ANKH 2XBWA 2IJOB 1O37A 1P11E 4HFPB 4CRDA 2GX4A 4A5TS 1O5FH 5I25A 3QX5H 1BIOA 4XBCA 3P95A 1G37A 1ZHPA 1QIXB 2UWPA 4LOYH 1O3LA 1X7AC 3RM2H 2Y80A 1NFUA 3ENSB 4YOGA 2D26C 2FYRA 2VWMA 3T28A 1RD3B 4XSKU 4BAOB 1QB1A 1E38B 1G3BA 1VITG 2WPMS 3SUEA 1CGJE 2BY8X 1LDTT 5AFYH 1W3CA 1G3DA 2A1DB 4J1YA 1GMCG 1HAVA 3CP7A 3TGJE 1ANDA 1UHBB 3L33A 3SU5A 1NT1A 1GBCA 1AUJA 3LC5A 1G3CA 3VGCC 5DO4H 1PQ8A 1QBVH 3HGNA 3SV7A 3BTKE 4BOHA 2RA3A 4I7YH 3BV9B 1GCTC 2HNTC 1JMOH 5K7RA 1C2LA 2BOHB 4ZKRU 1C5LH 1MMJN 1EJNA 2HVXA 4NA9H 3RXQA 1QQUA 1TNJA 2BYAX 1S83A 1XUJA 3GDVA 2TIOA 2P94A 1VR1H 4WY3A 3LH3A 1TAWA 3ZVBA 2VWNA 1ESAA 3JZ2B 4A1VA 4NIXA 2TGTA 1IQGA 4BXSA 1CT2E 2OCVB 3V0XA 1EJMA 4CBOA 2NU0E 5DP5A 1FIWA 2ANWA 2FOBA 1P2MA 1C2MA 1JIRA 1QRXA 1AVWA 3A84A 2OC1A 1O2QA 1O2NA 1LTOA 2ALVA 1GMCF 1GL0E 2RCEA 1LHGH 5K0HA 1UTMA 5TCCA 1FY4A 3SJIA 1UCYK 1O0DH 1OYTH 1TPOA 1SGPE 2OXSA 2Q6DA 3A83A 3MU0A 4MNVA 6GCHG 3ZVEA 2ZFFH 2QYIA 5ABWA 4X6PA 3RLWH 1Y5UT 3RP2A 1A5IA 1C9TA 1P9UA 1WOFA 1SR5C 1Z7KA 3T5FH 1OS8A 2HLCA 3M3VA 1JBUH 1PYTC 1INCA 2EI6A 2H2ZA 1ZPBA 4ISHH 1GBIA 1C2KA 1SOZA 4YT6H 2ZC9H 3FP6E 2VIPA 1YLDA 2A4OA 3A89A 1AE8H 3VB3A 4MG3A 4Q7YA 3A7XA 3I29A 3LGYA 4K8YA 2B0FA 5GCHF 1YCPK 4FU9A 1HFDA 3I78A 1BTXA 1TALA 2ZDKA 1EP5A 3UQOA 4DIHH 2Y7ZA 1GCTB 5EG4A 2BDBA 4UFEH 1KY9A 1ZSKA 3SUGA 3SNBA 3S7HB 3E91A 1FY5A 1THRH 2QAAA 1PPZA 1FAXA 1HAIH 1DT2A 1JIMA 2BVRH 3OX7U 3WY8A 5C3NA 6GCHF 1C2EA 1WV7H 3HPTB 2KAIB 4IW4E 1C1OA 1PQ5A 2ZGCA 2FOCA 2B8OH 2FPZA 1GJ8B
chains in the Genus database with same CATH superfamily
1BRAA 1Y3VA 1YPJH 5EQSA 1C4V2 4MNWA 1P9SA 2H9EH 3TITA 1TNHA 1XXDA 1PQAA 2G4TA 2WYJA 1L4DA 1TNKA 2ZCLP 1SKYE 1TMBH 2A0QB 1GHAF 2QV1A 2ZQ1A 2F9VA 1MZAA 5E2OA 1HAXB 5C0UA 3OY6U 2PKSC 3FZDA 2H1UA 3GOVB 2PHBA 4AFQA 5DKMA 4CREA 4I8JA 4E7NA 3VXFH 2BY9X 1KMHB 1XVOA 2QXIA 2BB4A 3F9GA 1P05A 2BHGA 3HK6B 4YZUA 4YLQH 1K1LA 3MH7A 2BLOA 2KCOA 1EZQA 5DPAA 1GBHA 2BQWB 3SJ8A 1QCPA 5JPMH 3MU8A 2ZFQH 4WH8A 1C4U2 4E06H 2ZTYA 1MKWH 3LJJA 2L6OA 2ZA5A 3QZQA 1TOMH 3NXPA 5ETXA 1OX1A 1SGFA 2BTCE 4XDEA 3UY9A 2EEKA 4X1SU 1W10U 1Z6EA 1O2SA 4FXGH 1KXBA 3AASA 5HM2A 2HRVA 5E0GA 1QR3E 1QB9A 1W8BH 4X6NA 2W7SA 2GDDA 2AIPA 2F9NA 1BZXE 3O8CA 1QNJA 4CHAB 1DS2E 1TIOA 3NZIA 5I46H 1KXFA 3GY6A 1FPCH 2WINI 2G4UA 3M5NA 1W0KD 3R3GB 1ZTKA 2ZPRA 5LH8A 2J34A 3SU2A 3TLOA 3BEIB 1ZGIA 1TBZH 4E05H 3PYHA 5DP7A 1S84A 3A87A 4MTBA 2QN5T 3BIVH 3FP7E 4JZEH 3DSPA 2GDEH 2IPHA 2ZZUH 3RXKA 1SGQE 1H8HD 4B2CA 3FOAA 1CU1A 3QZRA 1MBQA 1RXPA 3RXLA 5KECA 4CRAA 2G81E 4X0WU 7GCHG 8ESTE 1YC0A 3SNCA 4YLUA 4LXBH 2A32A 3NWUA 3SJKA 3IG6B 1O3KA 3PO1C 1L4ZA 1ELVA 3ZVDA 1LCYA 4K2YA 1IHSH 4AN7A 3DUXH 4MDSA 1T7CA 3VB5A 3KHVA 4BTTB 3U98H 3A8CA 3VXEH 1TQ0B 1BMNH 1C2GA 1VCQA 2XCNA 2QA9E 1MCTA 1A46H 1D3PB 1S6FA 3OEHD 4Q7XA 5CHBA 1ZPZA 3A88A 1YP9A 4THNH 2H5CA 2OBQA 1KTSB 3QN7A 2B9LA 1E1QD 2GZ9A 1YCPM 3UFAA 3GY3A 2CHAC 2UWLA 4RT1A 1YWUA 2W26A 1MU6B 1NZQH 3ESTA 1K1OA 1NRRH 2ULLA 2GJGA 2PLXA 3EA7A 1L1NA 3HKJB 4WH6A 1DWDH 1KYNA 2AS9A 4RSPA 3RMMH 2GT7A 3OE7D 1BJVA 1YKTA 2CMYA 2SNWA 2VINA 3P92A 7GCHF 2FI3E 1Z8RA 3MYWA 3PRBA 1HPGA 1DXPA 4H42U 1ZRKA 2BD4A 2ZU3A 5C5NA 1EAXA 1OP2A 1TBRH 2Z3EA 3MO3A 1QRWA 1AE5A 4OS1A 1E79D 1BUIA 2HALA 4UD9H 2EI7A 2Y7XA 4NFFA 2GMTC 1LQDB 4RKOB 1HGTH 2BD7A 1EFRD 1SLVB 1SGTA 2WPDD 3LGWA 4LZ4B 2K1QA 1O2XA 1UTKA 2XBVA 1GCDA 2WZQA 4FU7A 2FOGA 1AMHA 1Z8IB 1UK2A 2P93A 2ZGBH 5DN6D 2BX3A 1AWHB 1ZR0A 2Y6TA 2FDAA 3TJUA 3P8FA 4H4FA 1JRSA 2VVVA 2BDHA 3URDA 1V2JT 1TGSZ 4ACBA 2FMJA 4A6LA 1ZMLA 2ZWLH 4TWWA 5DSFA 3KL6A 2GP9B 4NA7A 3K2UA 2BLQA 1GPZA 1BTUA 1ZYOA 2OC7A 4JMYA 2H5DA 3GY4A 5EPYA 2FWWA 1XMNB 4TY6A 1KTTB 2A7HA 1H9IE 4KP0A 1YF4A 4ZUHA 2R3YA 4NSVA 2F9UA 3ZZ6A 1G2MA 1LVYA 3QWCH 1GL1A 1NU9A 1GJ5H 1A0LA 3PLKA 1DSUA 3DA9B 4NIYA 2ZDNA 2ASUB 3KQDA 5C94A 3UR9A 1V2MT 2VIQA 4ISOA 5HIZA 4D7FA 3ZYEA 4KGAA 2PKAA 2XC0A 5JB8S 1XUGA 3BG4B 2VU8E 2GD4B 3LGVA 1GI8B 3GY8A 1BMAA 1P02A 1J9CH 3HKIB 1WDIA 1BMMH 1UK3A 1CO7E 1O3HA 2XWBI 1SGIB 3E0PB 2ZGHA 3ZZ8A 2ZHDA 6ESTA 4ISNA 4AYYB 1AVGH 1S6LA 3V13A 3S9BA 1FN8A 3FANA 4YTAA 1O3NA 2JIZD 4MNYA 2DE8A 3D62A 4X1RU 1C5ZB 1LKAA 1EQ9A 4GPGA 1YM0A 2FOAA 4ZXXH 2ZP0H 8GCHG 3UREA 1YPHE 5DK1A 3GDUA 3BIUH 3R0FA 1BHXB 5LPEA 4Z6AH 5A2MH 1DX5M 3DFJA 1W0ZU 5EJZA 4ASHA 3RC6A 4B2BA 7LPRA 3DSGA 2A45B 2BDAA 2KCAA 1W11U 1K28D 3KQ5A 1QRZA 1XM1A 3RLYH 1A7SA 1DOJA 2P3UB 1C5XB 1SGDE 3PWBA 2FTLE 1B0FA 2P95A 1O3JA 2ZKSA 3UQVA 3SNEA 2FEQH 1AKSB 1C5TA 1TMTH 5FPTA 3C1KA 1V2WT 3S7KB 1M9UA 1O39A 1FI8A 1G2LA 4HZHA 1PPFE 3MMGA 3E8LA 2KR7A 4IMZA 5EU8A 5F6MA 3QGJA 1TB6H 9LPRA 3EQ0H 3RXUA 1TNIA 4FUHA 4YESB 3SUDA 4AB9A 1LHDH 1O31A 2FTMA 3SV6A 1GI3A 2JETC 2GT8A 1QL8A 5C1UA 1DSTA 4WVPE 2PP6A 4MNXA 1XUKA 3A7VA 3H09A 1LPKB 5FXLA 1LKBA 4KTSA 2OTVA 5F8ZA 4K1SA 2C4FH 2C8WB 1QY6A 1NPMA 1C1NA 4ZXYH 2G5VA 2OD3B 2CJIA 3S9AA 3Q3YA 4E7RG 3ZIAD 4ZAEA 1EPTA 2G00A 2PTCE 1MD7A 4NWLA 2BQ6B 2FZZA 1HLTH 2ZDAH 1BTYA 1SBWA 3M35A 3RU4T 1DDJA 1GMDF 1DXWA 3U8OH 1FY8E 3RU4E 2O8TA 2ZECA 3H5CB 1P03A 1FDPA 4OGYA 3SU4A 1MABB 1IQLA 4I8GA 1K2I1 2BY7X 1CE5A 1O2RA 1NBME 2BY5X 5GXPA 5BRRE 3PV5A 1CA0B 4Y10E 3UOUA 1K9OE 3BSQA 2C3SA 5A8ZA 1V2VT 5AHGH 1C5OH 4TPIZ 3TH4H 1MQ6A 2BX4A 1TGBA 1TNLA 4KTCA 3RU4D 1O3MA 4HTCH 4ESTE 3MU4A 1GJAB 1KSNA 4IC5A 3ZZCA 5A8XA 1NBMD 1J8AA 1L2EA 3BF6H 4XOJA 4NG9H 1TGCA 3GICB 4M7GA 4ASUD 1MKXH 1K0HA 1OWIA 1G9IE 1O3IA 5C5OA 1XUIA 1SL3A 2V0BA 1Y8TA 1COWD 3SGBE 2PGQB 4P02A 4XD7D 2EQNA 2WV4A 4RKJB 1AN1E 4UDWH 1NN6A 4FVBA 2RDEA 5C2ZA 1EATA 4KELA 5B6OA 2TGAA 1F5RA 3FO8D 3O8DA 1VJ9U 3CENA 1C5SA 2XW9A 3B23B 3D65E 3GS9A 4D7GA 7ESTE 1MH0A 2WPKS 2A2QH 2J98B 3EA9A 3T26A 4DW2U 2AYWA 3SU1A 4NGAH 2TPIZ 1GI2A 1H9HE 1THSH 2OC8A 1QA7A 2PGBB 4WXVA 4YO9A 3UWJH 4GLYA 2Q6FA 2P16A 3RXVA 4Q2KA 3M5MA 2M5TA 5JBTA 2W7UA 1ZHRA 5EOKA 3K9XB 2WV5A 1C1WH 3UPEA 1EB1H 1HAPH 3PMJA 2V3HH 1NY22 1HJAB 4ABDA 3L6PA 2V35A 1V3XA 1BTZA 1CHOG 1PPGE 2VVUA 4JYUH 4Y76A 3GY2A 2BMGB 1QTFA 2VWLA 1QL7A 2ZHQH 4O9VA 4BAKB 2C8XB 3MHWU 3RXRA 1VGCC 1LVOA 3VG8A 3RDZA 1FUJA 1P3CA 1OWDA 5GDSH 3V7TA 2BZ6H 1AO5A 1D3DB 1BRUP 2I6QA 1Y5AT 2ZGJA 4AFUA 1SQRA 1SGFG 2FM2A 2PR3A 3LC3A 2BDIA 3VPKA 4UFFH 2STBE 1SG8B 4K1TA 4INKA 3ZVFA 1IHTH 1O2YA 3FAOA 5AVDA 3T2NA 4D9RA 1DY8A 1SHYA 5GCHG 2JDID 1O2ZA 3M61U 1UVPA 1ZSJA 4AG2A 4Q80A 1GJ4H 1C2HA 1TPAE 1AQ7A 1SGRE 2QXJA 1AFEH 3FZZA 4Y79A 1T32A 4F48B 4ISLA 3DSOA 5EJLA 1S5SA 3RXEA 1GBBA 1SPJA 1CHOF 1IQEA 1P8VC 2ALPA 3ODDA 3PTBA 3MH6A 2RA0A 2BD2A 3A82A 3F6UH 1KIGH 4AG1A 3OAAD 4X2XA 1PPEE 1GJ9B 1ABJH 4CR9A 2XTTB 1V2QT 1F5KU 2H6MA 1J17T 1YY3A 2TGPZ 5HYOA 1DWCH 5EW1H 2ZI2H 1Q31A 2GZ7A 4NIWA 3TK6A 3H7TA 3UOPA 2AMDA 1SQAA 4H6TA 1SSXA 1GHAG 1GWAA 1UHBA 1CGHA 2P59A 4ABFA 4UE7H 2HNTF 4ACAA 1VGCB 2ZFTA 3SJOA 4X8SH 1IQKA 5HGGA 1XX9A 1L1GA 1RTLA 2VB0A 1SHHB 1O2UA 1P2IA 3HATH 1OYQA 3QK1A 4FOUC 4OS7A 1H9LB 1RS0A 5EJ1A 1FNIA 4FU8A 3SBKA 2R3UA 5E2PA 4CHAC 2A7CA 2QIQA 1GDUA 2V3OH 1Y5BT 3TJNA 3AW0A 1TABE 1JOUB 1AY6H 1QL9A 5H4IB 3TNSA 1TYNA 5HM9A 4FUFA 1EAUA 1CA8B 5A0AE 1TFXA 4MQAA 1HAYB 3N7EA 1O38A 4CRFA 1THPB 1QA0A 2L74A 3MO6A 3E6PH 2GTBA 1A5GH 1T31A 1MD8A 3SO3A 1QJ6B 2BLVA 2FI5E 2HNTE 1GBEA 2BM2A 1AIXH 1QQ4A 2AIQA 4GCHF 3HGPA 4CBNA 4IMQA 3F9FA 1H4WA 1AHTH 4X2YA 1C1RA 4KTUA 1O5BB 4BTIB 1TNGA 3BEUA 1EX3A 1GBDA 1GI1A 2Z3CA 4QT8C 1BT7A 3F9EA 1C5QA 2SGPE 6LPRA 4OS5A 4Y7AA 5GNDA 1O2MA 4XBBA 2JKHA 1DY9A 4WXIA 4ABJA 3A81A 1F7ZA 1O34A 1MCVA 1EZSC 4PROA 1YLNA 1ZJKA 2WPLS 3E0NB 2NU1E 1J16A 2QY0B 2OQUA 1ELEE 3KNXA 5FPSA 1O3PB 3LPRA 3SNDA 1A3EH 4MPUA 3GCTF 1ZMJA 5EODA 1FY1A 1ZOMA 1DWBH 2VNTA 5C1YA 5DP4A 4VGCB 4X8VH 3STJA 3MQKC 1Q2WA 2WYGA 2THFB 2Y82A 2M2AA 3NK8A 4NIVA 1LHCH 1KXCA 1GJ6A 1VZQH 2PTNA 4B2AA 1IQNA 1P57B 2CF9H 5AFZH 1C5RA 3SV9A 2UUFB 2OQ5A 2FO9A 2JH5D 3BG8A 1T4VH 2KAIA 1ANBA 3ZZBA 1SLWB 2NU3E 5G4BA 2Y5GA 1NRNH 1Y3WA 1YYY1 1WYKA 5GJ4B 3Q00A 1PYTD 2O8UA 2ZO3H 2K0QA 4MVNA 1MTUA 2KCPA 4ABIA 2J2UA 5FCKA 1GGDC 4AX9H 2V3MA 3LU9B 4NZQA 1O2VA 1V2KT 1DUEA 2FS9A 3A80A 2QXGA 1NRQH 1TX7A 4DY7B 4R0IA 1S6HA 1GHWH 1ELGA 4FUDA 2P3TB 1LPGB 2WPJS 4XBDA 3UNQA 1C2DA 3KGPA 1S0QA 4JK5A 3RMLH 1TPSA 4AFZA 5L6NH 1C5WB 1P2JA 1C1VH 4U01A 1ELAA 1PPBH 1XKAC 1D6RA 5LPRA 2SGEE 2ILNA 1SGYE 3MTYA 1NS3A 2Y5FA 2J92A 2AMQA 2XC4A 1TGNA 3O8RA 4Q4LA 1SFQB 1WXRA 4WMDA 5C20A 5CMXH 1RRKA 1SQTA 3SJ9A 1ELTA 1DM4B 4AB8A 2ZHEH 1YCPH 2CV3A 1EZXC 2SFAA 1WUNH 1F0UA 2FESH 5FX6A 4BAQB 1N6YA 1UCYE 2V6NA 1YPLH 4DOQA 4B74A 1HAOH 1EAIA 5F8TA 5JYIA 5T6DA 3OSYA 1TQ7B 5EXNA 1K1JA 1FONA 3PRDA 4OS6A 3BG4C 1A2CH 1FQ3A 2IPQX 1KLIH 1CVWH 2B5TB 3M37A 3G01A 1OWJA 1TWXB 2TRMA 2I6SA 1Z71A 2Z9LA 1UVTH 4ZH8A 1BA8B 4I32A 3PLBA 3PTNA 1TA2A 1XUHA 1HXFH 3NUMA 1QB6A 2JH0D 4MPVA 1IQIA 4JZFH 1GGDB 1Z1JA 3TK5A 1PPHE 1DLKB 1N1LA 5GWZA 4TPYA 2HVYB 1TRNA 4BTUB 3U1IB 2EI8A 2FODA 2PSYA 1HB0B 2FOMB 1AI8H 1P12E 1SVPA 1C5NH 4Y8ZA 1HIAB 1UO6A 1OOKB 1VJAU 3SV8A 3ATLA 1WTGH 1WTHD 1O5GH 1MTVA 3GCNA 5LPFA 1JXPA 3F3BA 1XKBC 1HAZB 2QXHA 3Q77A 1GJBB 5T3HA 4U32A 5AF9H 5A0BA 2FYQA 1ELFA 2ZG0H 2KCYA 3ATMA 1GI0A 3KYFA 3TK9A 1NRPH 5HIYA 1HAHH 3LGUA 1FAKH 1HV7A 3SW2B 1HUTH 2VJ1A 1VKYA 4O97A 4NWKA 1FLEE 1P10A 1G3EA 3RXSA 3CS0A 1TRMA 2ZHWH 3N99A 3WWBA 4JYTA 2ANYA 3GY5A 1W2KH 2WSSD 1ETRH 5A8YA 5DP9A 1KDQB 3BTEE 2ZHFH 1AZ8A 1NTPA 1MKXK 3M36A 1MUEB 1UTPA 2XBYA 4I31A 4R8TB 3ZZ3A 1T4UH 1ABIH 1C1UH 1LVBA 1N8OC 4I8HA 1RIWB 2F83A 1HBTH 2OLGA 4GHQA 3DHKH 2LPRA 1BCUH 1ZPCA 3I77A 4ABEA 3FFGA 4TYDA 3U8RH 2F9OA 1ELBA 1GMHF 3KIDU 2A5KA 3GY7A 4JZ1A 2C93B 4I8LA 2C8YB 5CE1A 4I33A 1O30A 1K1IA 3TGKE 1YPKH 1FN6A 4NFEA 1E35B 3WWFA 2FOEA 4SGBE 1C2FA 3PMBB 3U28C 1LHFH 1P09A 2YNBA 2FLBH 4Y11E 2SGDE 1ELDE 3MU1A 1OSSA 1PFXC 1CA0C 3MI4A 3OYPA 1MTNB 4AYVB 2Z9KA 5DP3A 3RXAA 1XXFA 1NC6A 3F2HA 4XE4A 2QF4A 4UEHH 1C1MA 5HXFA 1ZGVA 1IQFA 4B73A 2ZFRH 1WQSA 4ZHAA 1GMDG 4KKDA 1O2WA 2ODPA 1FIZA 3N7OA 1TPPA 1ZJDA 2IJD1 5T6GA 3T27A 1BBRH 4UONA 1SGCA 3SOSA 2PFEA 1H8ED 1SGEE 1V2TT 1NU7B 2FOFA 4OS4A 3PLPA 5TCAA 3BTME 3M5LA 3RXFA 1F0TA 1O3BA 1QURH 2BVXH 5DP6A 1A5HA 2XYAA 3UTUH 2VIDA 1SLXB 3URCA 2PUXB 3SN8A 1FY3A 3A8DA 4RN6A 1H8IH 3A85A 1HNEE 3QTOH 2J9NA 4SGAE 1CT4E 1UK4A 3GISB 3TGIE 4AGJA 4OM9A 4X8TH 4MPXA 1N8OB 1GHXH 2AMPA 2XXLA 1KXAA 4TWYA 1O2PA 2BXTH 4DCDA 1AVXA 1O5AB 3KCGH 1E36B 3L3TA 2LP6A 3NKKA 3LJOA 1BBRE 2D1JA 1C5YB 3ZZ9A 1GVKB 3UUZA 3P8GA 4IS5A 1CQQA 1GHBG 1SC8U 1QBNA 1EKBB 2Q6GA 3ZVGA 2BVSH 3U1JB 3RXPA 1AFQC 3GCHC 2VH6A 5PTPA 5IYTA 1HJAC 1A1RA 3M3TA 3T25A 1A0HB 2BOKA 4Y8XA 1AZZA 4K3JA 4DVAU 1Z6JH 2QE7D 1OPHB 4CR5A 2FLRH 5FCRA 4IN2A 2GCTB 3BN9A 2K8IA 1O36A 4WF8A 1O35A 1SGNE 5GPIB 3ATIA 3RMOH 1UVOA 1FV9A 5JBBS 2HGTH 1NFXA 1OKXA 5E8EH 1ZTJA 4BAHB 2O8LA 1HAVB 3RUOA 1T8NA 3BTWE 4DIIH 1TMUH 3V3MA 1AWFH 1S82A 3BTDE 3LT3A 3ZZ4A 3A8BA 1V2RT 2QC2A 3VEQB 1GBAA 5JB9S 1F0SA 3A7TA 3ZYDA 3M3SA 3OEED 1CBWC 3SU0A 1RTKA 1E1RD 3DT0H 3SHCH 1EXFA 4WJG2 6CHAC 3VB7A 1L0ZA 3SNAA 1S85A 1GHBF 1W0YH 1O2KA 1QBOA 3BTGE 2WV9A 4ZKOU 5J4SA 1NM6A 2CN0H 3NPSA 1J14A 3TH2H 4XRNA 1FXYA 4B75A 4YXWD 1O3AA 1O3FA 1C5VA 1DUAA 2Z6BD 1BDAA 1O2OA 5F8XA 2O9QA 1KLTA 4YOIA 4CRBA 1W14U 3SYJA 2C8ZB 1BRBE 3PM3A 2ZQ2A 4GHTA 5TJXA 4GSOA 1IAUA 3B8JA 2CK3D 4K8BA 3U9AH 1EOLA 2GVFA 2G8TA 3JZ1B 4B6FA 2VH0A 1J15A 4D9QA 3S69A 1D3QB 1AFQB 3BTHE 3GCHB 3RXIA 1HJ8A 2KZ4A 3M7TA 5T6FA 1UVUH 2HLDD 4WMFA 2A4QA 4K5ZA 4FUCA 5EQQA 1GHZA 1B7XB 1C1PA 2ZNKH 1BRCE 2TBSA 2G55A 1O2LA 3EE7A 1NRSH 2Z9GA 2F4LA 1GBJA 3S9CA 3OY5U 2AERH 1GBKA 3QO6A 2YOLA 9ESTA 1GHVH 5DP8A 1HAGE 1MKWK 4Y71A 3SI3H 3C27B 4U30A 4ZHLU 2STAE 4M9FA 1CBWB 1FPHH 1S81A 3OU0A 4IGDA 1YLCA 4INLA 1EB2A 3V12A 4FVDA 1ANCA 1OP8A 4A1TA 3LIWA 1W12U 3MOCA 6CHAB 4OS2A 3RXMA 2Z3DA 3MNBA 2RG3A 1EOJA 2AH4X 1O3DA 5JBAS 2Z9IA 1YPMH 2CGAA 4K60A 2PUQH 3LOXA 1WSSH 5F03A 3DFLA 2J38A 1O3GA 2SGAA 4X1QU 4FETA 1PPCE 1ZSLA 2YMSD 2J4IA 4ZCNA 3Q76A 1GDQA 2J98A 5C67A 2VGCC 5EXLA 4YOJA 4JYVH 2XNIA 1HYLA 1JRTA 1MU8B 4TSFD 4FUGA 3RXOA 3WW7A 1HRTH 3AW1A 1VITF 2ZDVH 1P2NA 2SNVA 2ZPQA 4F55A 4FUIA 2P8OC 1VITH 4DT4A 5A0CA 1F2SE 3AVZA 1C4Y2 4FUEA 2ZU4A 2UUYA 2FP7B 3MNCA 1TGTA 5FL7D 3UIRA 1Y3UA 2VBCA 1C2JA 1GDNA 2ZFPH 4ZKSU 3RXCA 3ZV9A 3SHAH 2R2WU 1LO6A 3BEFB 3BTTE 4GCHG 2CF8H 1B5GH 4OGXA 1Z8GA 1ZHMA 1GBMA 2SGQE 3A7ZA 3BTFE 3LONA 1D3TB 4NA8A 5DJ7A 2BDYA 2BLWA 3DCLA 1MAXA 1YPGH 3UWIA 1GBTA 4F49A 1LHEH 1ORFA 1IQHA 3W94A 4JZDH 2R2MB 3U69H 1EUFA 1CSOE 1UVSH 1C1TA 1GHYH 1QGFA 3A86A 4AOQA 1K1MA 4X2WA 4VGCC 2R0LA 2QGRA 2GGVB 3VB6A 2ZF0H 3EGKH 3SGAE 4TY7A 1V2UT 2DE9A 3EE0B 3VGCB 1YGCH 1G32B 3F68H 4HG6A 3M7UA 3FVFB 2A5IA 2EA3A 1BQYA 2D8WA 5F53A 2KM0A 3QGNB 1SFIA 1ESTA 1P06A 4GUXA 5FBEA 4D76A 3GCTG 3SUFA 1L1JA 2A31A 3QTVH 1P2OA 2F3CE 2Z94A 3RXJA 1UW7A 4X2VA 4JZIA 4CH8B 1QHRB 1O2HA 2VVCA 2VGCB 5B6LA 2XCFA 3H7OA 2FIRH 5L2YH 1O3CA 3RC5A 5C0TA 3E3TA 1P04A 1BTPA 3B9FH 3TVJB 1W7GH 2P8OB 1YBWA 2UUKB 5FHTA 1WQVH 4O03A 2J5UA 1TX8A 3P8OA 4B71A 1TONA 1UJ1A 3EYDA 4DT7B 3AK5A 5J4QA 1SMFE 3RMNH 1RFNA 4B6EA 5ESBA 8KME2 4XFQA 3ITIA 4AORA 1D4PB 1O32A 3P8NA 2XBXA 3OFND 4GAWA 2BQ7B 5FBIA 2HOBA 1E34B 1O2TA 1ESBA 3OTJE 2QF3A 3BTQE 2GCHG 1AGJA 1ZMNA 2PW8H 2WUBA 4MLFB 3TH3H 1HJ9A 2BDGA 2D2DA 1G30B 3NCLA 1OWKA 1MBMA 5ESTE 4AZ2B 1ID5H 2F9PA 2EC9H 4FUBA 2DUCA 1GJ7B 3F9HA 4DURA 3F2FA 2A4RA 2W3IA 1QJ7B 3M7QA 2OK5A 5CHAC 5EXMA 2PSXA 1GVZA 1CT0E 1LPZB 1EASA 2W5EA 4Y6DA 5E0JA 5T1VA 1ETTH 1W0JD 3ELAH 3TIUA 5JDUB 3CS7A 1C2IA 3MFJA 1NROH 1BMLA 2UUJB 3PMHB 2WPHS 1BITA 2J94A 1GBLA 2ZDMA 3A7YA 5FX5A 1DICA 4ZMAH 4DG4A 2Y5HA 1ACBE 2ZU1A 1BTWA 2ANMH 1QFKH 4YM9A 2ZU2A 1U6QA 2Y81A 5L2ZH 1ARCA 1MTSA 3E90B 3GCOA 4ABHA 1O2GH 2VWOA 2GCHF 1UCYH 1K1NA 1T8MA 2A2XH 1BOQA 3A8AA 4BAMB 4NSYA 1SOTA 4UFGH 5SGAE 3FKSD 1HXEH 4WMEA 3TNTA 3TJOA 3MH4A 3NRLA 3SQEE 2KX4A 2PKSB 3N7DA 1EZUC 3FP8E 1A61H 4B1TA 1D6WA 3IITA 5EGMA 3PB1E 4I8KA 5FAHA 1ELCA 4Q63A 1B0EA 1C5MD 1VCPA 3P70B 1P01A 1UTLM 4ZROA 2G5NA 1LVMA 2IOTA 4K1EA 2AEIH 4IC6A 1GBFA 1MZDA 1T8OA 1V2OT 1UTOA 4BANB 1IQJA 1GJDB 1A4WH 2BDCA 2KFWA 4A1XA 4K69A 1BBRK 2HPPH 2ZEBA 2FX4A 3PROA 4A7IB 2HWLB 3ZVCA 5CHAB 4F4OC 2XWAA 1CGIE 1ANEA 1TX6A 1OWEA 1TE0A 2FXRA 4ABGA 1O3EA 5HKKD 4IN1A 2O8MA 2Q1JA 1BTHH 3RC4A 1RIWC 2JJ2D 3DD2H 2PKAB 1MAYA 1RJXB 1C1QA 3MNXA 4JK6A 1BB0B 3SZEA 3GYLB 3MNSA 4X1PU 2J97A 2W3KA 1YPHC 4X1NU 5DGJA 1GI9B 1NFWA 1WAYB 1D9IA 1GG6C 3ATKA 1V2LT 4X6MA 3KQBA 1F92A 2AGIX 3EDXB 1OWHA 1TBQH 1BMFD 4DJZB 2RFKC 1W13U 2TGDA 5EW2H 4FUJA 1V6DA 4O3TA 3S0NA 1XVMA 4Y7BA 4H6SB 4GVUA 1DANH 4CH2B 1EPTC 3T62A 1Z8JB 2FI4E 3RXGA 2OP9A 1MTNC 5DG6A 1AU8A 3MH5A 1IOEA 2NU2E 1AB9C 1V2NT 3D49H 2BD9A 1P2KA 3PO1B 1GMHG 4ABBA 3SGQE 2AFQB 3E16B 5KEDA 1Y59T 4Z0KA 2W6JD 1FZZA 3PWCA 3SV2H 2QCYA 1BJUA 2BD5A 2GKVE 3U8TH 4J2YB 3LGTA 3EAJA 3SI4H 3AAUA 1OHHD 3F1SB 3F2GA 4HGCA 1MQ5A 4AGKA 3GYMA 5IDKA 3A7WA 2JH6D 2Z9JA 4Y0YE 1W7XH 4UFDH 1TRYA 2CHAB 2WPIS 2OINA 7KMEH 1QJ1B 1IQMA 1F0RA 3QLPH 2FX6A 2XC5A 4CRGA 1HCGA 1ARBA 1E0FD 1Q3XA 1OP0A 3RXTA 4IBLH 1H1BA 2ZTZA 1EJAA 2ZDLA 1DITH 5FPYA 1UTNA 2BD3A 3SORA 1SB1H 2BXUH 1K21H 2J95A 1C5UA 5EQRA 3SQHE 4CRCA 5C1XA 1P3EA 2BY6X 1O33A 5HMAA 4ZKNU 1KLJH 2PV9B 1NO9H 1O5CB 4U2WA 1DFPA 1NFYA 1BHXF 3KQEA 3TPIZ 1V2PT 2LELA 3SZNA 1UMAH 1GG6B 2G52A 2P3FH 1H8DH 2FS8A 3W95A 3Q3XA 2BZAA 3ODFA 2ESTE 5GIBA 1AUTC 1K1PA 2GMTB 2ODYB 3KN2A 1GI6A 3UNSA 3UAIC 5L30H 1O5DH 3UB0A 2H9TH 1HIAA 1O2JA 1EPTB 2ZGXH 4MPWA 1GI4A 3RXDA 3Q3KA 2GCTC 1GI5A 3KEEA 4INHA 1JWTA 4B76A 1AB9B 2XOKD 4WWYA 4BNRA 1PQ7A 2VIVA 3HK3B 4JCNA 1LMWB 2A5AA 4LZ1H 1XUFA 2ZTXA 1OXGA 2F91A 1GI7B 2R9PA 2OUAA 3D23A 1A0JA 4D8NA 5EPNA 1TA6A 1FJSA 1O2IA 3LKWA 4Y0ZE 1CHGA 2LNCA 2H9HA 1G36A 2GV7A 2NU4E 3PMAB 3ZZDA 3VB4A 1RGQA 3QUMP 2ZPSA 3P17H 3ZV8A 2VIOA 1UTQA 3KF2A 3SU6A 3E1XB 1KDQA 2ZFSA 1PJPA 1DWEH 2C90B 8LPRA 1EP6A 3TU7H 1GVLA 1NESE 2HPQH 2JJ1D 1O5EH 3K6YA 2Z7FE 4AFSA 1QZ8A 2WUCA 2ODQA 1EAWA 5BPEA 1VCWA 2ZU5A 1O3OA 3M5OA 2A7JA 3RXHA 4HI3A 3ZZAA 2QF5A 1C1SA 1DPOA 3GDSA 3PV4A 3EA8A 8GCHF 4NZLA 2ZCHP 1YPEH 1UTJA 4X8UH 1C5PA 1WU1A 2NWNA 1TOCB 1S0RA 2O8WA 1SLUB 4DGJA 2IN2A 5JBCS 2F9BH 1ZRBA 2GZ8A 1T8LA 1HDTH 3ATWA 1RTFB 1ZZZA 3F0PA 3MO9A 1F5LA 1WCZA 4Y8YA 3ZZ7A 5A09A 3UNRA 2YNAA 2FOHA 2R0KA 2EY4C 1ZTLA 2GV6A 3IWMA 2XRCA 3ZVAA 1LQEA 3VFEA 1MTWA 3QDZB 2UWOA 4ISIH 3T29A 3PV2A 3RM0H 1AKSA 2YMSC 2PWXA 5LGOA 1KXEA 1WBGB 4ZHMU 1Z1IA 3P6ZB 3TJVA 3UR6A 4YT7H 4ABAA 2B7DH 3SU3A 1A3BH 3KQCA 1KXDA 3MU5A 2AGEX 4Z1MD 3O8BA 3K65B 2OC0A 4LK4A 4A92A 1GJCB 4BXWA 1ETSH 4X6OA 2OBOA 1TLDA 1K22H 2BD8A 4O3UA 1DLEA 3ZZ5A 4P00A 2SGFE 2RDLA 2VIWA 1AD8H 3STIA 1SQOA 3K6ZA 1SI5H 2V7QD 4AC9A 1DE7H 1E37B 2JETB 1P2QA 3LDXH 2ZCKP 2ZIQH 5E0HA 3MWIU 2G51A 4Q7ZA 3LH1A 1ZLRA 3AAVA 2AGGX 1N6XA 1Y3YA 2A4GA 1DVAH 2QF0A 1Y3XA 2CXVA 1V2ST 1C9PA 4NCYA 3LGIA 3RXBA 1FMGA 1P0SH 2ANKH 2XBWA 2IJOB 1O37A 1P11E 4HFPB 4CRDA 2GX4A 4A5TS 1O5FH 5I25A 3QX5H 1BIOA 4XBCA 3P95A 1G37A 1ZHPA 1QIXB 2UWPA 4LOYH 1O3LA 1X7AC 3RM2H 2Y80A 1NFUA 3F0OA 3ENSB 4YOGA 2D26C 2FYRA 2VWMA 3T28A 1RD3B 4XSKU 4BAOB 1QB1A 1E38B 1G3BA 1VITG 2WPMS 3SUEA 1CGJE 4TT3D 2BY8X 3W1EA 1LDTT 5AFYH 1W3CA 1G3DA 2A1DB 4J1YA 1GMCG 1HAVA 3CP7A 1FX0B 1ANDA 3TGJE 1UHBB 3L33A 2YMSB 3SU5A 1NT1A 1GBCA 1AUJA 3LC5A 1G3CA 3FN8A 3VGCC 5DO4H 1PQ8A 1QBVH 3HGNA 3SV7A 3BTKE 4BOHA 2RA3A 4I7YH 3BV9B 1GCTC 2HNTC 1JMOH 5K7RA 1C2LA 3KYGA 2BOHB 4ZKRU 1C5LH 1MMJN 1EJNA 2HVXA 4NA9H 3RXQA 1QQUA 1TNJA 2BYAX 1S83A 1XUJA 3GDVA 5CDFE 2TIOA 2P94A 1VR1H 4WY3A 3LH3A 1TAWA 3ZVBA 2VWNA 2XNDD 1ESAA 3JZ2B 4A1VA 4I86A 4NIXA 2TGTA 1IQGA 4BXSA 1CT2E 2OCVB 3V0XA 1EJMA 4CBOA 5EIYA 2NU0E 5DP5A 1FIWA 2ANWA 2FOBA 1P2MA 1C2MA 1JIRA 1QRXA 1AVWA 2WHXA 3A84A 2OC1A 1O2QA 1O2NA 1LTOA 2ALVA 1GMCF 1GL0E 2RCEA 1LHGH 5K0HA 1UTMA 5TCCA 1FY4A 5KGOA 3SJIA 1UCYK 1O0DH 1OYTH 1TPOA 1SGPE 2OXSA 2Q6DA 3A83A 3MU0A 4MNVA 6GCHG 2W6ID 3ZVEA 2ZFFH 3CNRA 2QYIA 5ABWA 4X6PA 3RLWH 1Y5UT 3RP2A 1A5IA 1C9TA 1P9UA 1WOFA 1SR5C 1Z7KA 3T5FH 1OS8A 2HLCA 3M3VA 1JBUH 1PYTC 1INCA 2EI6A 2H2ZA 1ZPBA 4ISHH 1GBIA 4RI0A 1C2KA 1SOZA 4YT6H 2ZC9H 3FP6E 2VIPA 1YLDA 2A4OA 3A89A 1AE8H 3VB3A 4MG3A 4Q7YA 3A7XA 3I29A 3LGYA 4RT0A 2AHME 4K8YA 2B0FA 5GCHF 1YCPK 4FU9A 1HFDA 3I78A 1BTXA 1TALA 2ZDKA 1EP5A 3UQOA 4DIHH 5IK2D 2Y7ZA 1GCTB 5C17A 5EG4A 2BDBA 4UFEH 1KY9A 1ZSKA 3SUGA 3SNBA 3S7HB 3E91A 1FY5A 1THRH 2QAAA 1PPZA 1FAXA 1HAIH 1DT2A 1JIMA 2BVRH 3OTPA 3OX7U 3WY8A 5C3NA 6GCHF 1C2EA 1WV7H 3HPTB 2KAIB 4IW4E 1C1OA 1PQ5A 2ZGCA 2FOCA 2B8OH 2FPZA 1GJ8B 2F43B
chains in the Genus database with same CATH topology
1BRAA 1Y3VA 1YPJH 5EQSA 1C4V2 4MNWA 1P9SA 2H9EH 3TITA 1TNHA 1XXDA 1PQAA 2G4TA 2WYJA 1L4DA 1TNKA 2ZCLP 1TMBH 2A0QB 1GHAF 2QV1A 2ZQ1A 2F9VA 1MZAA 5E2OA 1HAXB 3OY6U 2PKSC 3FZDA 2H1UA 3GOVB 2PHBA 4AFQA 5DKMA 4CREA 4I8JA 4E7NA 3VXFH 2BY9X 1XVOA 2QXIA 2BB4A 3F9GA 1P05A 2BHGA 3HK6B 4YZUA 4YLQH 1K1LA 3MH7A 2BLOA 1EZQA 5DPAA 1GBHA 2BQWB 3SJ8A 1QCPA 5JPMH 3MU8A 2ZFQH 4WH8A 1C4U2 4E06H 2ZTYA 1MKWH 3LJJA 2ZA5A 3QZQA 1TOMH 3NXPA 5ETXA 1OX1A 1SGFA 2BTCE 4XDEA 3UY9A 2EEKA 4X1SU 1W10U 1Z6EA 1O2SA 4FXGH 1KXBA 3AASA 5HM2A 2HRVA 5E0GA 1QR3E 1QB9A 1W8BH 4X6NA 2W7SA 2GDDA 2AIPA 2F9NA 1BZXE 3O8CA 1QNJA 4CHAB 1DS2E 1TIOA 3NZIA 5I46H 1KXFA 3GY6A 1FPCH 2WINI 2G4UA 3M5NA 3R3GB 1ZTKA 2ZPRA 5LH8A 2J34A 3SU2A 3TLOA 3BEIB 1ZGIA 1TBZH 4E05H 3PYHA 5DP7A 1S84A 3A87A 4MTBA 2QN5T 3BIVH 3FP7E 4JZEH 3RXKA 2GDEH 2IPHA 2ZZUH 1SGQE 4B2CA 1CU1A 3QZRA 1MBQA 1RXPA 3RXLA 4CRAA 2G81E 4X0WU 7GCHG 8ESTE 1YC0A 3SNCA 4YLUA 4LXBH 2A32A 3NWUA 3SJKA 3IG6B 1O3KA 3PO1C 1L4ZA 1ELVA 3ZVDA 1LCYA 4K2YA 1IHSH 4AN7A 3DUXH 4MDSA 1T7CA 3VB5A 3KHVA 4BTTB 3U98H 3A8CA 3VXEH 1TQ0B 1BMNH 1C2GA 1VCQA 2XCNA 2QA9E 1MCTA 1A46H 1D3PB 1S6FA 4Q7XA 1ZPZA 3A88A 1YP9A 4THNH 2H5CA 2OBQA 1KTSB 3QN7A 2B9LA 2GZ9A 1YCPM 3UFAA 3GY3A 2CHAC 2UWLA 2W26A 1MU6B 1NZQH 3ESTA 1K1OA 1NRRH 2ULLA 2PLXA 3EA7A 1L1NA 3HKJB 4WH6A 1DWDH 1KYNA 2AS9A 4RSPA 3RMMH 2GT7A 3P92A 1BJVA 1YKTA 2CMYA 2SNWA 2VINA 7GCHF 2FI3E 1Z8RA 3MYWA 1HPGA 1DXPA 4H42U 1ZRKA 2BD4A 2ZU3A 5C5NA 1EAXA 1OP2A 1TBRH 2Z3EA 3MO3A 1QRWA 1AE5A 4OS1A 1BUIA 2HALA 4UD9H 2EI7A 2Y7XA 4NFFA 2GMTC 1LQDB 4RKOB 1HGTH 2BD7A 1SLVB 1SGTA 3LGWA 4LZ4B 2K1QA 1O2XA 1UTKA 2XBVA 1GCDA 4FU7A 2FOGA 1AMHA 1Z8IB 1UK2A 2P93A 2ZGBH 2BX3A 1AWHB 1ZR0A 2Y6TA 2FDAA 3TJUA 3P8FA 4H4FA 1JRSA 2VVVA 2BDHA 3URDA 1V2JT 1TGSZ 2FMJA 4A6LA 1ZMLA 2ZWLH 4TWWA 3KL6A 2GP9B 4NA7A 3K2UA 2BLQA 1GPZA 1BTUA 1ZYOA 2OC7A 4JMYA 2H5DA 3GY4A 5EPYA 2FWWA 1XMNB 4TY6A 1KTTB 2A7HA 1H9IE 4KP0A 1YF4A 4ZUHA 2R3YA 4NSVA 2F9UA 3ZZ6A 1G2MA 1LVYA 3QWCH 1GL1A 1NU9A 1GJ5H 1A0LA 3PLKA 1DSUA 3DA9B 4NIYA 2ZDNA 2ASUB 3KQDA 3UR9A 1V2MT 2VIQA 4ISOA 4D7FA 3ZYEA 4KGAA 2PKAA 2XC0A 5JB8S 1XUGA 3BG4B 2VU8E 2GD4B 3LGVA 1GI8B 3GY8A 1BMAA 1P02A 1J9CH 3HKIB 1BMMH 1UK3A 1CO7E 1O3HA 2XWBI 1SGIB 3E0PB 2ZGHA 3ZZ8A 2ZHDA 6ESTA 4ISNA 4AYYB 1AVGH 3V13A 3S9BA 1FN8A 3FANA 4YTAA 1O3NA 4MNYA 2DE8A 3D62A 4X1RU 1C5ZB 1LKAA 1EQ9A 4GPGA 1YM0A 2FOAA 4ZXXH 2ZP0H 8GCHG 3UREA 1YPHE 5DK1A 3GDUA 3BIUH 3R0FA 1BHXB 5LPEA 4Z6AH 5A2MH 1DX5M 3DFJA 1W0ZU 4ASHA 3RC6A 4B2BA 7LPRA 2A45B 2BDAA 1W11U 1K28D 1QRZA 1XM1A 3RLYH 1A7SA 1DOJA 2P3UB 1C5XB 1SGDE 3PWBA 2FTLE 1B0FA 2P95A 1O3JA 2ZKSA 3UQVA 3SNEA 2FEQH 1AKSB 1C5TA 1TMTH 5FPTA 3C1KA 1V2WT 3S7KB 1M9UA 1O39A 1FI8A 1G2LA 4HZHA 1PPFE 3MMGA 3E8LA 4IMZA 5EU8A 5F6MA 3QGJA 1TB6H 9LPRA 3EQ0H 3RXUA 1TNIA 4FUHA 4YESB 3SUDA 4AB9A 1LHDH 1O31A 2FTMA 3SV6A 1GI3A 2JETC 2GT8A 1QL8A 5C1UA 1DSTA 4WVPE 4MNXA 1XUKA 3A7VA 1LPKB 5FXLA 1LKBA 4KTSA 2OTVA 5F8ZA 4K1SA 2C4FH 2C8WB 1QY6A 1NPMA 1C1NA 4ZXYH 2G5VA 2OD3B 2CJIA 3S9AA 3Q3YA 4E7RG 4ZAEA 1EPTA 2G00A 2PTCE 1MD7A 4NWLA 2BQ6B 2FZZA 1HLTH 2ZDAH 1BTYA 1SBWA 3M35A 3RU4T 1DDJA 1GMDF 1DXWA 3U8OH 1FY8E 3RU4E 2O8TA 2ZECA 3H5CB 1P03A 1FDPA 4OGYA 3SU4A 1IQLA 4I8GA 1K2I1 2BY7X 1CE5A 1O2RA 2BY5X 5GXPA 5BRRE 1CA0B 4Y10E 3UOUA 1K9OE 3BSQA 2C3SA 5A8ZA 1V2VT 5AHGH 1C5OH 4TPIZ 3TH4H 1MQ6A 2BX4A 1TGBA 1TNLA 4KTCA 3RU4D 1O3MA 4HTCH 4ESTE 3MU4A 1GJAB 1KSNA 4IC5A 3ZZCA 5A8XA 1J8AA 1L2EA 3BF6H 4XOJA 4NG9H 1TGCA 3GICB 4M7GA 1MKXH 1OWIA 1G9IE 1O3IA 5C5OA 1XUIA 1SL3A 2V0BA 1Y8TA 3SGBE 2PGQB 2WV4A 4RKJB 1AN1E 4UDWH 1NN6A 4FVBA 5C2ZA 1EATA 4KELA 5B6OA 2TGAA 1F5RA 3O8DA 1VJ9U 3CENA 1C5SA 2XW9A 3B23B 3D65E 4D7GA 7ESTE 1MH0A 2WPKS 2A2QH 3EA9A 3T26A 4DW2U 2AYWA 3SU1A 4NGAH 2TPIZ 1GI2A 1H9HE 1THSH 2OC8A 1QA7A 2PGBB 4WXVA 4YO9A 3UWJH 4GLYA 2Q6FA 2P16A 3RXVA 4Q2KA 3M5MA 2M5TA 5JBTA 2W7UA 1ZHRA 5EOKA 3K9XB 2WV5A 1C1WH 3UPEA 1EB1H 1HAPH 3PMJA 2V3HH 1NY22 1HJAB 4ABDA 3L6PA 2V35A 1V3XA 1BTZA 1CHOG 1PPGE 2VVUA 4JYUH 4Y76A 3GY2A 2BMGB 1QTFA 2VWLA 1QL7A 2ZHQH 4O9VA 4BAKB 2C8XB 3MHWU 3RXRA 1VGCC 1LVOA 3RDZA 1FUJA 1P3CA 1OWDA 5GDSH 3V7TA 2BZ6H 1AO5A 1D3DB 1BRUP 2I6QA 1Y5AT 2ZGJA 4AFUA 1SGFG 2FM2A 2PR3A 3LC3A 2BDIA 3VPKA 4UFFH 2STBE 1SG8B 4K1TA 4INKA 3ZVFA 1IHTH 1O2YA 3FAOA 5AVDA 3T2NA 4D9RA 1DY8A 1SHYA 5GCHG 1O2ZA 3M61U 1UVPA 1ZSJA 4AG2A 4Q80A 1GJ4H 1C2HA 1TPAE 1AQ7A 1SGRE 2QXJA 1AFEH 3FZZA 4Y79A 1T32A 4ISLA 1S5SA 3RXEA 1GBBA 1SPJA 1CHOF 1IQEA 1P8VC 2ALPA 3ODDA 3PTBA 3MH6A 2RA0A 2BD2A 3A82A 3F6UH 1KIGH 4AG1A 4X2XA 1PPEE 1GJ9B 1ABJH 4CR9A 2XTTB 1V2QT 1F5KU 2H6MA 1J17T 2TGPZ 5HYOA 1DWCH 5EW1H 2ZI2H 1Q31A 2GZ7A 4NIWA 3TK6A 3H7TA 3UOPA 2AMDA 1SQAA 4H6TA 1SSXA 1GHAG 1GWAA 1UHBA 1CGHA 2P59A 4ABFA 4UE7H 2HNTF 1VGCB 2ZFTA 3SJOA 4X8SH 1IQKA 5HGGA 1XX9A 1L1GA 1RTLA 2VB0A 1SHHB 1O2UA 1P2IA 3HATH 1OYQA 3QK1A 4OS7A 1H9LB 1RS0A 1FNIA 4FU8A 3SBKA 2R3UA 5E2PA 4CHAC 2A7CA 2QIQA 1GDUA 2V3OH 1Y5BT 3TJNA 3AW0A 1TABE 1JOUB 1AY6H 1QL9A 5H4IB 3TNSA 1TYNA 5HM9A 4FUFA 1EAUA 1CA8B 5A0AE 1TFXA 4MQAA 1HAYB 1O38A 4CRFA 1THPB 1QA0A 3MO6A 3E6PH 2GTBA 1A5GH 1T31A 1MD8A 3SO3A 1QJ6B 2BLVA 2FI5E 2HNTE 1GBEA 2BM2A 1AIXH 1QQ4A 2AIQA 4GCHF 3HGPA 4CBNA 4IMQA 3F9FA 1H4WA 1AHTH 4X2YA 1C1RA 4KTUA 1O5BB 4BTIB 1TNGA 3BEUA 1EX3A 1GBDA 1GI1A 2Z3CA 4QT8C 1BT7A 3F9EA 1C5QA 2SGPE 6LPRA 4OS5A 4Y7AA 1O2MA 4XBBA 2JKHA 1DY9A 4WXIA 4ABJA 3A81A 1F7ZA 1O34A 1MCVA 1EZSC 4PROA 1ZJKA 2WPLS 3E0NB 2NU1E 1J16A 2QY0B 2OQUA 1ELEE 3KNXA 5FPSA 1O3PB 3LPRA 3SNDA 1A3EH 4MPUA 3GCTF 1ZMJA 5EODA 1FY1A 1ZOMA 1DWBH 2VNTA 5C1YA 5DP4A 4VGCB 4X8VH 3STJA 1Q2WA 2WYGA 2THFB 2Y82A 3NK8A 4NIVA 1LHCH 1KXCA 1GJ6A 1VZQH 2PTNA 4B2AA 1IQNA 1P57B 2CF9H 5AFZH 1C5RA 3SV9A 2UUFB 2OQ5A 2FO9A 2JH5D 3BG8A 1T4VH 2KAIA 1ANBA 3ZZBA 1SLWB 2NU3E 5G4BA 2Y5GA 1NRNH 1Y3WA 1YYY1 1WYKA 5GJ4B 3Q00A 1PYTD 2O8UA 2ZO3H 4MVNA 1MTUA 4ABIA 2J2UA 5FCKA 1GGDC 4AX9H 3LU9B 4NZQA 1O2VA 1V2KT 1DUEA 2FS9A 3A80A 2QXGA 1NRQH 1TX7A 4DY7B 4R0IA 1S6HA 1GHWH 1ELGA 4FUDA 2P3TB 1LPGB 2WPJS 4XBDA 3UNQA 1C2DA 3KGPA 1S0QA 4JK5A 3RMLH 1TPSA 4AFZA 5L6NH 1C5WB 1P2JA 1C1VH 4U01A 1ELAA 1PPBH 1XKAC 1D6RA 5LPRA 2SGEE 2ILNA 1SGYE 3MTYA 1NS3A 2Y5FA 2J92A 2AMQA 2XC4A 1TGNA 3O8RA 1SFQB 4WMDA 5C20A 5CMXH 1RRKA 1SQTA 3SJ9A 1ELTA 1DM4B 4AB8A 2ZHEH 1YCPH 2CV3A 1EZXC 2SFAA 1WUNH 1F0UA 2FESH 5FX6A 4BAQB 1N6YA 1UCYE 2V6NA 1YPLH 4DOQA 4B74A 1HAOH 1EAIA 5F8TA 5JYIA 5T6DA 3OSYA 1TQ7B 5EXNA 1K1JA 1FONA 4OS6A 3BG4C 1A2CH 1FQ3A 1KLIH 1CVWH 2B5TB 3M37A 3G01A 1OWJA 1TWXB 2TRMA 2I6SA 1Z71A 2Z9LA 1UVTH 4ZH8A 1BA8B 4I32A 3PLBA 3PTNA 1TA2A 1XUHA 1HXFH 3NUMA 1QB6A 2JH0D 4MPVA 1IQIA 4JZFH 1GGDB 1Z1JA 3TK5A 1PPHE 1DLKB 1N1LA 5GWZA 4TPYA 1TRNA 4BTUB 3U1IB 2EI8A 2FODA 2PSYA 1HB0B 2FOMB 1AI8H 1P12E 1SVPA 1C5NH 4Y8ZA 1HIAB 1UO6A 1OOKB 1VJAU 3SV8A 3ATLA 1WTGH 1WTHD 1O5GH 1MTVA 3GCNA 5LPFA 1JXPA 1XKBC 1HAZB 2QXHA 3Q77A 1GJBB 5T3HA 4U32A 5AF9H 5A0BA 2FYQA 1ELFA 2ZG0H 3ATMA 1GI0A 3TK9A 1NRPH 1HAHH 3LGUA 1FAKH 1HV7A 3SW2B 1HUTH 2VJ1A 4O97A 4NWKA 1FLEE 1P10A 1G3EA 3RXSA 3CS0A 1TRMA 2ZHWH 4JYTA 2ANYA 3GY5A 1W2KH 5A8YA 1ETRH 5DP9A 1KDQB 3BTEE 2ZHFH 1AZ8A 1NTPA 1MKXK 3M36A 1MUEB 1UTPA 2XBYA 4I31A 4R8TB 3ZZ3A 1T4UH 1ABIH 1C1UH 1LVBA 1N8OC 4I8HA 1RIWB 2F83A 1HBTH 2OLGA 4GHQA 3DHKH 2LPRA 1BCUH 1ZPCA 3I77A 4ABEA 3FFGA 4TYDA 3U8RH 2F9OA 1ELBA 1GMHF 3KIDU 2A5KA 3GY7A 4JZ1A 2C93B 4I8LA 2C8YB 5CE1A 4I33A 1O30A 1K1IA 3TGKE 1YPKH 1FN6A 4NFEA 1E35B 2FOEA 4SGBE 1C2FA 3PMBB 1LHFH 1P09A 2YNBA 2FLBH 4Y11E 2SGDE 1ELDE 3MU1A 1OSSA 1PFXC 1CA0C 3MI4A 3OYPA 1MTNB 4AYVB 2Z9KA 5DP3A 3RXAA 1XXFA 1NC6A 4XE4A 4UEHH 1C1MA 5HXFA 1ZGVA 1IQFA 4B73A 2ZFRH 1WQSA 4ZHAA 1GMDG 4KKDA 1O2WA 2ODPA 1FIZA 3N7OA 1TPPA 1ZJDA 3T27A 5T6GA 4UONA 1BBRH 1SGCA 3SOSA 2PFEA 1SGEE 1V2TT 1NU7B 2FOFA 4OS4A 3PLPA 5TCAA 3BTME 3M5LA 3RXFA 1F0TA 1O3BA 1QURH 2BVXH 5DP6A 1A5HA 2XYAA 3UTUH 2VIDA 1SLXB 3URCA 2PUXB 3SN8A 1FY3A 3A8DA 4RN6A 1H8IH 3A85A 1HNEE 3QTOH 2J9NA 4SGAE 1CT4E 1UK4A 3GISB 3TGIE