1GI6A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi6A02
1V2VT 3K6YA 3NUMA 3PV4A 3SU4A 1FY5A 1PPGE 4AORA 1YC0A 4BXSA 3SU1A 1KDQA 1SL3A 3MMGA 5JBBS 1T8NA 1YF4A 4TPIZ 2A4QA 2ZDLA 4LOYH 1S6HA 2EI7A 2BQWB 1OP2A 1SR5C 1TE0A 1E34B 4ZKRU 4NIVA 1HAGE 5EGMA 2P95A 2JH5D 4KTCA 3SO3A 2PWXA 4X1QU 2BY6X 1DY8A 1ANCA 1CHOG 4K1SA 2BD8A 1MCVA 1TABE 4LZ1H 1P0SH 2TRMA 4Y8YA 1B0FA 1LHEH 2JETC 1NO9H 2HALA 2ZDKA 5AFZH 1XM1A 3MU0A 1HIAB 2NU2E 4INLA 1SGQE 3DFLA 3HKJB 4U2WA 3EE0B 2PSYA 3S7KB 1GJDB 2SNWA 4ESTE 3NCLA 2XC0A 1GI2A 2BD3A 1YCPK 1MD7A 3PLKA 5DK1A 3RUOA 1AKSA 1ABJH 3M3TA 3A7YA 4FUJA 2GMTB 3M3VA 4MTBA 5F8ZA 1EZUC 4BXWA 4X6MA 1AIXH 3RXEA 1UMAH 3SU0A 3F6UH 1D3QB 3LH3A 2FPZA 2AERH 1TOCB 1O3EA 4DIHH 3LC5A 2PKAA 1CQQA 2WYJA 2ZCHP 1BBRE 2FLRH 3ZZDA 2SGAA 4FUIA 1CHGA 3FAOA 1GI1A 4M7GA 2H5CA 1CT0E 1ID5H 1ESBA 3FP6E 3STJA 1CU1A 1W0YH 3NXPA 1CO7E 1B0EA 1TX6A 1ELAA 1GJBB 1HAZB 1W7XH 1QURH 4WY3A 1JBUH 2FYRA 3SQHE 1S82A 2A4OA 2Z9GA 1M9UA 5GXPA 3P8OA 1V2QT 3E91A 1LDTT 1DWCH 4BAKB 4ISIH 3ODFA 4FUBA 4ZH8A 3SJIA 3ATLA 1TAWA 2ZTZA 4CBOA 4JZEH 4IGDA 2JH6D 1P2QA 3RXCA 2STAE 1EOLA 2BLOA 1GDUA 3LH1A 1UK4A 1CSOE 1JXPA 4B75A 1DE7H 2ZDNA 1UVSH 1LVBA 3CENA 4A1TA 4Y0YE 1EJAA 4TYDA 1V6DA 2CJIA 2C8XB 1IQEA 3VPKA 3RXDA 2PTCE 4YESB 2H5DA 1C1VH 2HPPH 4YO9A 1TRYA 2BYAX 3A7TA 1O2SA 5EW1H 4CRGA 2ZHDA 4FU8A 2ZDVH 1EOJA 1A3BH 3D62A 1T7CA 1A0LA 3ZVEA 1O3IA 2OC8A 3BN9A 5DO4H 4IC5A 1O37A 1RTFB 1QHRB 1P04A 1IQNA 1W0ZU 5FXLA 1GVKB 1P2NA 1PYTC 1A7SA 2I6QA 1AB9C 1TGBA 2UWPA 4JZFH 4MVNA 1YPLH 2ZFTA 2AIQA 3RMLH 4OGYA 2WINI 4JYVH 4FUEA 2R2WU 1K1NA 1HV7A 1FY8E 1UTLM 2ZFRH 1BRBE 1GJAB 3QGJA 2IJOB 1EAIA 2RDLA 2VIDA 2F9OA 3EDXB 3RXBA 2G4TA 1NROH 2A4RA 1YCPH 1C5LH 2DUCA 2W26A 3ZVAA 3RXRA 1CGHA 1ELVA 1SOZA 1GHWH 3F9FA 2P93A 1D9IA 1SGFA 1TBQH 5DJ7A 8GCHF 1ZJKA 2SFAA 2XC5A 3GY7A 3P8NA 4VGCC 2A5KA 1EZQA 2ZGXH 2VVCA 3A7XA 1UTPA 1YLCA 1O2IA 1GHAF 3URCA 3EQ0H 1GJCB 3A7WA 3FP8E 3GY5A 3GCTF 2OTVA 1A0JA 3VXFH 4ZKSU 1AY6H 2LNCA 3EA9A 2GP9B 3S9CA 1FAXA 1LCYA 3TNSA 5DPAA 1SBWA 1PQ5A 5FPTA 1G3BA 4I8JA 1HXFH 2Y5HA 1W10U 1QA0A 4FXGH 5DP7A 3RXHA 4WMEA 2R0LA 3SJOA 2G55A 1QRXA 2XBVA 1SGNE 1OKXA 3M35A 4LZ4B 2BX4A 5J4SA 5CHAC 2UWOA 4WXIA 1GCTC 5T6DA 4ZKOU 4ZUHA 3P95A 1ESTA 1P06A 1SHHB 1XUIA 1RTKA 3LGUA 4IS5A 2J94A 2AIPA 3BF6H 3M5OA 4ISOA 2A7HA 2RCEA 3GCNA 1D3DB 2AMQA 1HJAB 1UTJA 4HZHA 3A8DA 3GICB 1UJ1A 2WV5A 3BG8A 1HAVA 1O3PB 2BDGA 4RN6A 2FI4E 1O2GH 2ZU3A 1QL8A 3AAUA 3MU5A 2RA3A 4CHAC 3P70B 2J9NA 5F8TA 3GCHC 5LH8A 5FCKA 2XXLA 3BTTE 3CS0A 5HXFA 1SFQB 2NU0E 3M36A 3M7UA 4Y0ZE 1GG6B 1UK3A 1GWAA 4GSOA 3MNXA 3RC6A 1YPMH 4JYUH 2P59A 3M61U 4MPUA 4CRFA 3ATIA 1MD8A 3ODDA 3ZYEA 2ZFFH 1XUKA 3S69A 1FV9A 1GBTA 2UUKB 5FX5A 1OXGA 1BOQA 2SGEE 1ZMNA 1BTYA 5EXMA 1Z1JA 1H1BA 2B5TB 2XWAA 5T6FA 1O2MA 3SUFA 1H8IH 2JKHA 3KGPA 2PUQH 3LPRA 2R2MB 2XCFA 3GY2A 1GJ5H 2TGPZ 1U6QA 2AGIX 1Y3VA 1Q31A 4ZMAH 3QTOH 3O8DA 1TMUH 1LVOA 2VIQA 3K6ZA 5L30H 1GBHA 1F0RA 1ABIH 5DG6A 2K1QA 3ZZ6A 1AFQB 2NU1E 1TPOA 3LGTA 7GCHF 2PGQB 3F9GA 4YLQH 4NWLA 4IC6A 1AE8H 1C1MA 2R3UA 1K21H 1WQSA 3AAVA 3A8CA 1AZZA 4I8GA 1NRSH 3ZZ4A 1TBRH 1ELTA 2C3SA 1D3PB 4H42U 4I8HA 4UD9H 1ELEE 1TGNA 1MQ5A 3RM2H 3RU4D 5J4QA 5ETXA 1EPTB 4YZUA 2GT7A 3RXAA 2ZHWH 1A46H 5GDSH 1ZSKA 5JPMH 3TGJE 1P2JA 1NRQH 4R0IA 4YLUA 1J16A 2NU4E 1RIWC 2BLQA 3RXMA 3VGCB 5I25A 1OWIA 1MZAA 3F1SB 2W7SA 3RXOA 5EXLA 3TGKE 2ZFQH 1N1LA 2GCHF 4CRAA 3RP2A 2A2QH 1K1PA 3BTQE 5E0JA 1C2FA 2OP9A 3P92A 3U8RH 3SOSA 1C5TA 4AYYB 2Y7ZA 2P8OB 2SGDE 3PTNA 4TY6A 3U1JB 4YT6H 1LPKB 1SFIA 1TNIA 2AS9A 4X6NA 1NFWA 1JMOH 2O8WA 1O3MA 1O2WA 1NS3A 4K3JA 2AEIH 1C5UA 5C5NA 4D8NA 3RMNH 2UUYA 1O3FA 8GCHG 5C1UA 1DXPA 1YPGH 1LMWB 3KN2A 3M3SA 3ZV9A 1BMAA 2FOAA 1L4ZA 1S0RA 4Q2KA 1CVWH 3F9EA 6CHAC 1O34A 5F03A 4WF8A 3LONA 5A0BA 1OYQA 4JK6A 2QY0B 4Y8ZA 2O8LA 4X8TH 5LGOA 1AUJA 1JIMA 1VCWA 2BY8X 1CHOF 2FZZA 2A2XH 4DCDA 1CT4E 1SLWB 1KXCA 1A5HA 2UWLA 4ABEA 2A31A 1C2JA 3VB4A 5FPYA 2Z3EA 4FVDA 1BTHH 1C1NA 1F0TA 1P01A 4ZHMU 1O3JA 3KF2A 1FMGA 2ESTE 1B5GH 3CS7A 1H9HE 4Y11E 1C5QA 1VJAU 1ELCA 1VCPA 1GJ6A 1Z7KA 4NFEA 4FU9A 3TJVA 4MLFB 3UWIA 2B0FA 1KXBA 1THSH 2ULLA 2J92A 4CREA 1C4V2 2F91A 2G51A 2G5VA 4CR5A 1C1PA 4Y10E 1QL9A 3QO6A 2BVRH 1MUEB 1ZGVA 4U32A 1TPAE 4A6LA 1SGPE 5HM2A 4RSPA 4LK4A 2ZG0H 1WOFA 1K1OA 1TYNA 5HM9A 1BUIA 2A45B 1NFYA 4FUHA 2XC4A 1DFPA 1BA8B 4WMDA 3UOUA 1CA8B 2B9LA 1BHXF 5HYOA 2H9HA 1GBBA 1VITG 1W8BH 4ZXXH 1CA0B 1OSSA 2BZAA 2FI3E 1BMLA 1FY3A 2YOLA 3R0FA 1DT2A 1GHZA 1TNGA 1W11U 1YKTA 1O2ZA 4GHTA 3SV7A 4NGAH 3TK5A 1KXFA 1TFXA 2ZU4A 4TWWA 1GMCG 4NCYA 1DANH 5A8XA 1W2KH 1XUGA 1IAUA 3E8LA 2Z3DA 2BQ7B 1V2JT 2H1UA 3MFJA 5T3HA 1EB1H 3SNDA 5SGAE 5C1XA 1HIAA 2ZHFH 3KEEA 2W7UA 3LJOA 7GCHG 3RLYH 3Q3YA 4BOHA 1FY1A 1P2OA 2GGVB 1SGTA 4MNVA 5A0CA 1C2EA 1DM4B 2AGGX 1JIRA 4MPVA 2STBE 3M7TA 3MTYA 3C27B 3BG4C 1FIZA 3EAJA 2CHAC 3TH3H 3UQVA 3E3TA 1L1NA 1P12E 1YPHC 1QGFA 1MQ6A 2GKVE 4XBCA 5LPFA 1EAUA 4GCHG 1FY4A 2YNAA 4UDWH 1H9LB 4GUXA 1TONA 1T4UH 4KTUA 3SGQE 1ELFA 2ODPA 4ZXYH 1ZGIA 4K69A 3MYWA 1YPEH 2BD7A 1BZXE 4NSYA 1P05A 4IW4E 2ZIQH 3A88A 1AVGH 3ATMA 3PMBB 1GGDB 3GDUA 3UREA 4I7YH 2AGEX 2QV1A 2A7CA 1W14U 1GBAA 4DT7B 1UCYK 4I8LA 1FJSA 1VGCC 1HGTH 2G8TA 4INHA 1JRTA 1JOUB 2GT8A 5L6NH 1O3KA 1YPHE 3E90B 4AYVB 2PSXA 1RJXB 4MNYA 5AFYH 1BTZA 2OC7A 1C4Y2 2BZ6H 1BQYA 5I46H 3ENSB 2DE8A 4D7FA 3O8CA 2ILNA 2GZ8A 3KQEA 1NRPH 2HLCA 2F9NA 5E0HA 4NIWA 3P17H 3SU2A 1ZYOA 2ZHQH 1KIGH 3Q3KA 2BLVA 4D76A 3V12A 3GCOA 1TA2A 5DP8A 2FOCA 1GHVH 4JZ1A 3V0XA 4UFDH 1WCZA 2SGPE 1P8VC 2Z9KA 1MAXA 1K28D 2QAAA 3IWMA 1C9TA 3SJ8A 1ZHPA 4BAQB 1BJUA 1S5SA 3QZQA 1J17T 1Z6JH 2XW9A 2PW8H 3AW0A 3MH7A 3QN7A 3TJNA 1TQ0B 2RA0A 1ZSLA 2GZ7A 1NT1A 4HTCH 3M37A 1AMHA 1N8OB 2PTNA 3Q77A 1A61H 4O03A 7ESTE 2ZFSA 1O2UA 3P6ZB 1OWHA 4FUDA 5TCCA 1GJ7B 2A1DB 1X7AC 3PLPA 3VB7A 2ZU1A 3ZZ3A 3E0NB 1G2MA 1MTNB 1GHBF 4UFFH 5IDKA 1OWKA 2FP7B 4AG2A 3SBKA 1C2IA 3UOPA 2ZZUH 4YOJA 3TGIE 1GVLA 4CRBA 1FIWA 1DSTA 1O38A 1LPZB 3OY6U 1J14A 1L2EA 2FMJA 4NWKA 2W3IA 1O5CB 1SQOA 2F9BH 5FHTA 2BD4A 4ABFA 3OSYA 1QRWA 1DPOA 2C8WB 1ETRH 1QR3E 1AFEH 1P9SA 2EI8A 1O3BA 1ZMLA 3S7HB 1MTUA 4MDSA 3T5FH 1ZRKA 2VGCC 1ZPZA 3ATWA 3LIWA 4X8UH 4JZIA 3ZZ5A 1FONA 2OCVB 3SUEA 1BRUP 4RKOB 1NU7B 1O32A 2FM2A 1O2PA 1TIOA 3I29A 3JZ2B 1QB1A 1IQLA 2ZTXA 4E06H 5C3NA 3MWIU 1BCUH 1DWDH 5EQQA 1KTTB 1GBFA 2WUBA 3TK9A 3ZVCA 5A8YA 3T28A 3BTFE 2QN5T 3PB1E 2KAIB 4Y6DA 3TPIZ 1P57B 5CE1A 1SGCA 3H7OA 2V3OH 4CRDA 1TPPA 4E7RG 1TNLA 2VNTA 1EASA 1BT7A 2XBYA 3RXLA 1O5EH 2JETB 2G81E 4KGAA 1AN1E 3RXKA 1EB2A 3MNBA 1LVYA 1O5AB 1Y3UA 1HAIH 1A5IA 1GVZA 4I33A 1MKWK 1E38B 2QXIA 2WPJS 3SUDA 2CXVA 2GV7A 2ZA5A 2O8UA 3P8GA 3DHKH 3VB6A 3LJJA 3UIRA 1D6WA 1HYLA 3SQEE 5JB9S 5IYTA 2HGTH 1EKBB 1MKXK 4SGBE 4X2YA 1GI9B 1TRNA 4WH6A 2GVFA 2OUAA 1ELBA 1GL1A 3BIVH 4MPXA 4GHQA 2ZQ2A 1BB0B 3O8BA 4B1TA 2P3UB 2PKSC 1IHTH 3PMJA 4CRCA 1W3CA 1UHBB 1TX7A 1TOMH 1SGIB 1TNKA 2QA9E 1V3XA 1V2LT 1L1GA 4NA9H 4FVBA 2FEQH 4B2CA 2AYWA 1BIOA 2D26C 3PTBA 5A2MH 1OYTH 1EZXC 1VCQA 4DW2U 2CF8H 1ZJDA 4YOIA 1DITH 2CMYA 2ZGBH 1IQMA 3SORA 1OP0A 2PGBB 1N6YA 1NPMA 1O2TA 5HGGA 1WTGH 1NC6A 1MCTA 2ZHEH 2ZC9H 3B9FH 3KNXA 1A2CH 1EJMA 3S9BA 1EPTA 2I6SA 3RXIA 1TBZH 1C1RA 1ZR0A 1XVMA 3TNTA 3SHCH 5L2YH 3GY8A 1PPEE 1LQDB 2BLWA 1MMJN 4MG3A 1F7ZA 1N6XA 1S0QA 1KTSB 1Y8TA 3ZZBA 2BB4A 3UPEA 4TPYA 2BMGB 2ZWLH 3Q76A 3RU4E 4A5TS 1C5SA 5EQSA 1IQKA 4KKDA 2Z6BD 4HI3A 1WU1A 2NU3E 4DJZB 3A86A 4X1NU 2TPIZ 1GHBG 2O8MA 3ZZ8A 1Q3XA 1FQ3A 3EA8A 1LHCH 3BTDE 2BVXH 2J34A 4Y7AA 2J4IA 1ZOMA 7KMEH 4X6OA 3MU8A 3GYMA 3KL6A 3TJUA 4K1EA 2AMPA 2LPRA 1AB9B 2QYIA 3U8OH 3G01A 1HAHH 1Z8IB 1LHFH 1P10A 2FDAA 1HPGA 3OYPA 4NIYA 3MHWU 3PO1C 3URDA 2D1JA 4ZHLU 3VB3A 1XUHA 1J15A 4SGAE 1VITF 1THPB 2JH0D 1CGJE 1GI6A 1OX1A 1FXYA 3D65E 1HXEH 1JRSA 1XKBC 3TU7H 1O2LA 5GCHF 3NWUA 3QZRA 2GV6A 1CBWC 1GMCF 1XUFA 1KXAA 4VGCB 1MKXH 1NZQH 4WVPE 1P02A 1RGQA 1MBMA 4H6SB 4BTTB 2VWMA 1SGRE 1JWTA 1ANDA 9LPRA 1IHSH 1F0SA 2OXSA 2C4FH 5C1YA 1Y5BT 1NTPA 2VH0A 1XMNB 4E7NA 1O39A 4AB9A 5JBTA 1PPFE 1O3AA 1WSSH 2NWNA 2P16A 1LTOA 1OWDA 1GI4A 2G00A 5GPIB 1UVUH 5EXNA 1G30B 1Z8GA 3L3TA 4FUCA 2ZGJA 3SV9A 1TGTA 5BRRE 3SI4H 1XKAC 3RXQA 2ODYB 3TH2H 5CHAB 1DSUA 4GCHF 4BAHB 1NFXA 1DS2E 1GCTB 3UR9A 1SG8B 1IQHA 3D49H 3U9AH 5A8ZA 2Z3CA 4X0WU 1AU8A 6GCHF 1ELGA 3F9HA 3QX5H 3BTHE 3IG6B 1Y3XA 3K2UA 1PPBH 4OS4A 3DFJA 2Y7XA 2QXJA 1C2HA 4KTSA 3SW2B 5JBCS 5GIBA 3M5NA 1LQEA 2TIOA 4CHAB 1TQ7B 3A84A 4X2XA 3L33A 1YCPM 1CGIE 1D3TB 3GCHB 3KQCA 2J95A 1C1OA 1T32A 3AVZA 3PO1B 1EATA 2SNVA 1RFNA 3ZVGA 1EAWA 3M5LA 1J9CH 3OY5U 3PM3A 3VXEH 5FCRA 1AWFH 4K5ZA 1K1JA 2SGFE 3KCGH 5ESTE 2HWLB 3QGNB 5C20A 2BOKA 1P3EA 4AFSA 3BEFB 4ZKNU 1XVOA 4JK5A 2ALPA 3LOXA 4WXVA 1ESAA 2ZTYA 3RDZA 4OS2A 1GDNA 3SNCA 4B2BA 1GPZA 1A4WH 2H9EH 1O3DA 1UCYE 3SN8A 1KY9A 3AASA 2IPHA 2GCTC 1AGJA 1SSXA 1DDJA 1A0HB 3HATH 1C2DA 4R8TB 4UFGH 1C5ZB 1D6RA 4JCNA 1WQVH 3MO9A 4INKA 1EX3A 3VFEA 4IN2A 1YP9A 5DP9A 2GD4B 2XWBI 1LHDH 2VJ1A 3GY4A 1Y3WA 1SQTA 4FUFA 3DT0H 4Y71A 1Q2WA 1TRMA 2GX4A 2OBQA 3MI4A 3VEQB 5PTPA 5C2ZA 3RM0H 1O3LA 3NPSA 1KLIH 2EI6A 3RC4A 3E1XB 2BY7X 4NG9H 3U1IB 1LHGH 1GHYH 2V35A 2CF9H 1AI8H 2FOEA 3GDSA 2HRVA 4NA7A 3JZ1B 4D7GA 1C5WB 1O5FH 1QJ1B 2FYQA 4B76A 3SV2H 1AQ7A 1RIWB 1PFXC 3A89A 1GMDG 3DD2H 3W95A 3TJOA 2QF3A 2HVXA 1LKBA 2FS8A 1BTWA 4GVUA 2BQ6B 1GI8B 3RXVA 3U98H 2WUCA 1Z71A 2ZP0H 5C67A 2D8WA 3CP7A 5DP3A 2PLXA 1GMHF 2BDIA 2ZPQA 2QGRA 2WV4A 3SJKA 2ZU2A 1UK2A 5EPNA 4AOQA 3KQBA 3LKWA 2W5EA 1MU6B 2FXRA 1SI5H 2BY5X 1SOTA 3E16B 4DVAU 1C9PA 2J38A 1HUTH 2ZPRA 1S85A 5L2ZH 2CN0H 2H9TH 2BM2A 3E0PB 1EP6A 3ESTA 4ASHA 5GCHG 5EODA 3UNQA 1BJVA 4I31A 1C5VA 2ANYA 3M7QA 3R3GB 1AO5A 2QC2A 2VIOA 5GJ4B 5JYIA 1SGYE 4HFPB 3SV6A 1HDTH 1GI3A 2P3FH 4ISNA 3RU4T 4NSVA 1BTXA 2ANWA 1ZTKA 6CHAB 4CH2B 1P2IA 1YBWA 3SU6A 5FAHA 4YM9A 1QBOA 1NY22 1TX8A 3RXFA 2ZGCA 1UTNA 2M5TA 4XFQA 2FESH 4KP0A 1O2VA 1VITH 2QXGA 4B2AA 1OWEA 4OGXA 1TGSZ 3S0NA 9ESTA 4NZQA 2Y5FA 2C93B 1QIXB 2H2ZA 3RXPA 1FZZA 1EQ9A 3EA7A 1INCA 1O30A 4KELA 1F5LA 2ZF0H 3TIUA 1L1JA 1A1RA 2Y82A 2Y5GA 1C1TA 2HPQH 3ZVDA 1PJPA 2BD2A 4ABJA 5DP4A 3B8JA 1V2NT 3MNCA 3QDZB 4YT7H 2XBWA 1BMNH 1PPHE 3LGYA 1GJ8B 1TALA 2VVUA 4X8SH 6GCHG 3EYDA 1RD3B 2ZECA 2R3YA 4Y8XA 1HJ9A 1FPCH 1O3HA 2BDHA 4XDEA 4X8VH 4GPGA 3BEIB 4D9QA 4E05H 1HAXB 4IMQA 2A4GA 1F5KU 1QBNA 1UO6A 1DOJA 1W13U 4K60A 2Z9IA 5FBEA 2Z9LA 5TCAA 1QQUA 3UY9A 1YPJH 1E35B 1G2LA 1UVOA 1QB6A 1FI8A 4Z0KA 3KHVA 1QCPA 2VINA 1GBDA 1SVPA 1B7XB 2F9UA 1V2TT 3LGVA 1P2KA 2QXHA 1DWEH 4UE7H 2CGAA 1UTQA 1ARCA 4XE4A 3SGAE 4AN7A 5B6OA 3SGBE 2O9QA 4A92A 1G32B 3TH4H 1GI7B 3ZV8A 2OC1A 5AF9H 1GDQA 1ZHRA 4D9RA 2F9PA 1S83A 2HNTE 3HPTB 3BSQA 4XOJA 1SGEE 1LVMA 4FU7A 2BX3A 3RC5A 4THNH 3QLPH 1FNIA 3QK1A 1Z1IA 1P11E 2C90B 1DUAA 4ISHH 1QA7A 6ESTA 2OLGA 4QT8C 5FX6A 1O36A 1V2KT 4TY7A 5C5OA 4AFQA 1V2RT 1G36A 1H4WA 1NESE 3MU1A 2QIQA 1O0DH 1VJ9U 1T4VH 2WYGA 2C8ZB 3BG4B 2C8YB 2EA3A 2CHAB 1FN8A 2FS9A 3PROA 4J1YA 2CV3A 1HFDA 5EQRA 3Q00A 2XYAA 1LO6A 1GJ9B 1PQAA 1G37A 4X1RU 3UNRA 1Z8RA 1RTLA 3TVJB 1FPHH 4ABGA 5DKMA 3HK3B 3BTGE 1O5DH 1E0FD 3BTME 1UHBA 2R9PA 1NRRH 3QTVH 2ALVA 1BRAA 2Z9JA 3HGNA 4Q7YA 5JDUB 1C5YB 1V2UT 4B71A 1WUNH 4GAWA 2OINA 1MTWA 2AH4X 3AW1A 3I78A 5JB8S 1RS0A 2BTCE 3MH6A 1GMHG 1GJ4H 2HNTF 1VGCB 2F9VA 2ZPSA 2Q1JA 5E8EH 2BY9X 3ZYDA 2TGDA 3OTJE 1KYNA 1O2HA 3SJ9A 1HAOH 4DIIH 1F2SE 1O35A 2PR3A 1A5GH 3ZZCA 3W94A 4CH8B 1C5XB 5EOKA 4AX9H 3S9AA 1EP5A 2P94A 2ZQ1A 2FO9A 3GDVA 2ZI2H 1O31A 3ZZ9A 1TA6A 4B74A 1P09A 4MQAA 1T8LA 1K22H 1UCYH 2FTMA 2SGQE 5F6MA 1SC8U 2XNIA 4H4FA 1FDPA 1DVAH 3IITA 3FP7E 3PYHA 2VWOA 1L4DA 1SLVB 3QUMP 4AZ2B 1E36B 1KSNA 4AB8A 2FOFA 2J2UA 1BRCE 1TWXB 4Q7XA 4K1TA 4NIXA 3NK8A 3RXJA 4OS6A 2FX4A 1LPGB 5TJXA 1SLXB 4K8YA 1AUTC 1C1WH 3PMHB 2G4UA 3HK6B 2BDYA 4IBLH 1S81A 1V2WT 3A85A 2F3CE 4B73A 5A0AE 1KDQB 4A7IB 5CMXH 1ORFA 1BMMH 2WPKS 1TGCA 2ZCKP 4JYTA 2IN2A 2BDBA 2FOGA 1QY6A 2YNBA 1QJ6B 4BTIB 1KXEA 1MBQA 3ZVBA 4AGKA 1O2QA 2XBXA 3KIDU 4YTAA 3N7OA 1C5RA 3TK6A 1UVPA 1C5MD 2FIRH 3H7TA 4JZDH 1S6FA 2Y6TA 1C5NH 2BVSH 5EW2H 1HJAC 2Z94A 5F8XA 1KLJH 3F68H 3OX7U 4BAOB 1V2MT 1L0ZA 2B8OH 1ZRBA 1ZMJA 1NN6A 4Y7BA 2VIPA 5ESBA 1GBIA 1ZPBA 2ZDAH 2A0QB 4WJG2 1EXFA 4F4OC 4BNRA 1KXDA 2XRCA 1IQGA 1GG6C 1GBEA 4O9VA 3GY6A 2TBSA 2UUFB 2F83A 1AKSB 1ELDE 2AMDA 3MU4A 2FX6A 2EEKA 2OC0A 2VGCB 1A3EH 1F0UA 1PPCE 4AFZA 4UEHH 3A7VA 1O33A 1DLEA 1GBKA 2BOHB 3U8TH 2FWWA 1MZDA 1FN6A 1G9IE 4X2WA 1QFKH 2BDCA 3A87A 2PKAB 3BTKE 3GY3A 1SHYA 3BIUH 2Q6GA 1HAYB 2WPIS 6LPRA 4U30A 4F49A 3BTEE 3ITIA 4IN1A 4ISLA 3GISB 4Y79A 1O2KA 3FZDA 5FPSA 2WPLS 1AZ8A 2EC9H 1AFQC 3MOCA 1CT2E 4MPWA 5EU8A 2W3KA 2PHBA 2ZFPH 1J8AA 2A5IA 3ATKA 4PROA 1HAPH 1C2KA 3UQOA 1QRZA 1GI5A 1DUEA 2FOMB 1OPHB 3FZZA 1QJ7B 4YOGA 1K1IA 1G3DA 2OBOA 5GWZA 1GMDF 3ZZ7A 1HJ8A 3SUGA 1EPTC 3MH5A 1BBRK 4BTUB 2B7DH 4Z6AH 4LXBH 2A5AA 1O5GH 1SPJA 2VWLA 1SLUB 5JBAS 1IQJA 1VR1H 5K0HA 1O2XA 1Y3YA 1O2NA 1V2OT 1C2MA 5H4IB 3VGCC 4CR9A 5K7RA 1QBVH 3DUXH 4I8KA 1BDAA 2H6MA 2HOBA 4OS1A 5HMAA 2PKSB 1HBTH 2VU8E 2WPHS 1MKWH 3QWCH 1ZHMA 2V0BA 1TNHA 2Y80A 1NRNH 3TLOA 1O2YA 1TMBH 8KME2 4ABHA 4ABBA 4MNWA 4DG4A 2P8OC 1RRKA 1EUFA 4K2YA 4HGCA 1AD8H 3FVFB 5BPEA 3MO6A 1FAKH 1ZZZA 1DLKB 1C1UH 1C5OH 1PYTD 1G3EA 1WBGB 4BANB 1O3OA 1P9UA 1YGCH 3K65B 4DGJA 1SGDE 2TGTA 4X1PU 1C1SA 3M5MA 3I77A 2VIVA 4ABIA 3RMOH 2Q6DA 4FUGA 1O2OA 4DOQA 2ZGHA 3PWCA 1FUJA 3T62A 3UUZA 1O3CA 1KLTA 3SHAH 1MH0A 3RXTA 2ASUB 1OOKB 3BV9B 5LPRA 3L6PA 1PPZA 3O8RA 3ZVFA 1O3NA 1BITA 5DP6A 1EJNA 1GBJA 2G52A 1ANEA 1TMTH 4Q80A 3RMMH 1C2LA 2Z7FE 1EZSC 5E2PA 1O2JA 1HCGA 2FI5E 1W7GH 1K1MA 1QTFA 1TB6H 2ZKSA 3C1KA 3UTUH 4ZROA 3U69H 1XXFA 1TNJA 3P8FA 1XX9A 1BTUA 1AHTH 3SU3A 3LC3A 3SZNA 1E37B 1BTPA 1S84A 3LU9B 3HGPA 3V7TA 1T8MA 1GHXH 1H9IE 4O3TA 2A32A 1MAYA 1YYY1 3RLWH 4A1XA 3VB5A 2ZDMA 2ZCLP 1YM0A 2XTTB 1T31A 4K8BA 1MU8B 8ESTE 2O8TA 1TLDA 4A1VA 3UR6A 3A83A 1F5RA 1WV7H 1BBRH 4ABAA 1XUJA 2ANKH 2VIWA 5AHGH 3SNEA 4GLYA 1YLDA 1DXWA 1HAVB 2OD3B 2XCNA 5DP5A 2AFQB 4ZHAA 1CBWB 2BHGA 4NZLA 4Y76A 1CA0C 4BAMB 3RXUA 5E2OA 3V13A 5A09A 2IOTA 1ETTH 1T8OA 1HNEE 1C5PA 3A8AA 4WWYA 1OWJA 2D2DA 5EPYA 3EGKH 2QCYA 3T29A 2ZO3H 4U01A 4OS5A 4NA8A 1C2GA 3UNSA 2FOHA 3LT3A 4WH8A 3SNAA 1THRH 1GHAG 1GBMA 1AVXA 1UTOA 3T26A 3ELAH 3GCTG 2VH6A 1HB0B 4TWYA 3ZZAA 1QNJA 4ZAEA 3FANA 1Y5AT 5T6GA 1Y5UT 4XSKU 1W12U 2GZ9A 3STIA 1ACBE 1VZQH 3FFGA 3V3MA 5G4BA 1MTSA 3TITA 3SU5A 3T27A 2OQ5A 1K9OE 2OQUA 1Z8JB 1GBCA 3LDXH 8LPRA 1K1LA 1ZLRA 3A8BA 2FOBA 1Y59T 1WTHD 1WYKA 1DICA 1SMFE 1P03A 2FTLE 1Z6EA 2QF0A 1SQAA 1G3CA 2GDEH 5E0GA 3UWJH 1AVWA 3RXGA 1GCDA 3MO3A 2VVVA 3DA9B 1SB1H 1O5BB 3HKIB 1O3GA 3KQDA 2DE9A 4OS7A 1YPKH 4DURA 1BHXB 1P2MA 1FLEE 1GGDC 4UONA 2PFEA 1IQIA 1DWBH 4J2YB 2R0KA 2BDAA 1ZPCA 1NU9A 1UTKA 1NFUA 3LGWA 2THFB 1PQ8A 1UTMA 2BXTH 1CE5A 3SI3H 1UVTH 5LPEA 3K9XB 1MTVA 4X1SU 1XXDA 3GYLB 4AG1A 4AGJA 3A82A 2UUJB 3GOVB 4MNXA 1P3CA 2VWNA 5DGJA 2BD5A 2RG3A 1GBLA 1C4U2 4X6PA 1HLTH 7LPRA 2GDDA 3T2NA 2FLBH 2ODQA 2GCTB 3MNSA 1TPSA 1PQ7A 1F92A 3B23B 3PWBA 2GTBA 4WMFA 2FODA 3UFAA 4O97A 5AVDA 3WY8A 3OU0A 1OP8A 3BEUA 2ANMH 4UFEH 1D4PB 4X2VA 1DY9A 4I32A 3LGIA 1OS8A 2BXUH 2ZNKH 4RKJB 3PMAB 5EG4A 2TGAA 5ABWA 1GI0A 1IQFA 1GL0E 3MH4A 4IMZA 4JMYA 4ABDA 1QB9A 1ZTLA 1K2I1 1V2ST 1HRTH 1N8OC 4Q7ZA 1IOEA 5FBIA 3RXSA 1SGFG 1AWHB 1LKAA 3SNBA 4XBBA 1H8DH 1ARBA 1MTNC 2WPMS 3T25A 3NKKA 3PLBA 3SV8A 2V6NA 1RXPA 2ZU5A 1QL7A 1DX5M 3D23A 1ANBA 4XBDA 1C1QA 4AFUA 2GMTC 2Q6FA 2HNTC 2P3TB 4O3UA 2ZEBA 3A80A 2Y81A 2A7JA 4DY7B 3E6PH 4CBNA 2V3HH 1V2PT 3H5CB 2G5NA 1AE5A 4NFFA 1WAYB 2PUXB 3A7ZA 3BTWE 2PV9B 4H6TA 2GCHG 1ETSH 1NM6A 1ZTJA 2BD9A 1QQ4A 3NZIA 1O2RA 3Q3XA 2KAIA 2VB0A 1ZSJA 1EAXA 3A81A
chains in the Genus database with same CATH superfamily
1V2VT 3K6YA 3NUMA 3PV4A 3SU4A 1FY5A 1PPGE 4AORA 1YC0A 4BXSA 3SU1A 1KDQA 1SL3A 3MMGA 5JBBS 1T8NA 1YF4A 4TPIZ 2A4QA 2ZDLA 4LOYH 1S6HA 2EI7A 2BQWB 1OP2A 1SR5C 1TE0A 1E34B 4ZKRU 4NIVA 1HAGE 5EGMA 2P95A 2JH5D 4KTCA 3SO3A 1E1RD 2PWXA 1YLNA 4X1QU 2BY6X 2L74A 1DY8A 2QF5A 1ANCA 1CHOG 4K1SA 2BD8A 1MCVA 1TABE 4LZ1H 1P0SH 2TRMA 2VBCA 4Y8YA 1B0FA 1LHEH 2JETC 1NO9H 2HALA 2ZDKA 5AFZH 1XM1A 3MU0A 1HIAB 2NU2E 3OEHD 4INLA 1SGQE 3DFLA 3HKJB 4U2WA 3EE0B 2PSYA 3S7KB 1GJDB 2SNWA 4ESTE 3NCLA 2XC0A 1GI2A 2BD3A 1YCPK 1MD7A 2JIZD 3PLKA 1BMFD 5DK1A 3RUOA 1AKSA 1ABJH 3M3TA 3A7YA 4FUJA 2GMTB 3M3VA 4MTBA 5F8ZA 1EZUC 4BXWA 2EQNA 4X6MA 1AIXH 3RXEA 1UMAH 3SU0A 3F6UH 1D3QB 3LH3A 2FPZA 3W1EA 2AERH 1TOCB 1O3EA 4DIHH 3LC5A 2PKAA 1CQQA 2WYJA 2ZCHP 1BBRE 2FLRH 3ZZDA 2SGAA 4FUIA 1H8ED 1CHGA 3FAOA 4B6FA 1GI1A 4M7GA 3OTPA 2H5CA 1CT0E 1ID5H 1ESBA 3FP6E 3STJA 1CU1A 1W0YH 3NXPA 1CO7E 1B0EA 1TX6A 1ELAA 1GJBB 1HAZB 1W7XH 1QURH 4WY3A 1JBUH 2FYRA 3SQHE 1S82A 2A4OA 2Z9GA 1M9UA 5GXPA 3P8OA 1V2QT 3E91A 1LDTT 1DWCH 4BAKB 4ISIH 3ODFA 4FUBA 4ZH8A 3SJIA 3ATLA 1S6LA 1TAWA 2ZTZA 4CBOA 5F53A 4JZEH 4IGDA 2JH6D 1P2QA 3RXCA 2STAE 4RI0A 1EOLA 2BLOA 1GDUA 3LH1A 1UK4A 1CSOE 1JXPA 1UW7A 4B75A 1DE7H 2ZDNA 1UVSH 1LVBA 3CENA 4A1TA 4Y0YE 1EJAA 4TYDA 1V6DA 2CJIA 1VKYA 2C8XB 1IQEA 3VPKA 3DCLA 2PTCE 3RXDA 4YESB 2H5DA 1C1VH 2HPPH 4YO9A 1TRYA 2BYAX 3A7TA 1O2SA 5EW1H 4CRGA 4B6EA 2ZHDA 4FU8A 2ZDVH 1EOJA 1A3BH 3D62A 1T7CA 1A0LA 3ZVEA 1O3IA 2OC8A 3BN9A 5DO4H 4IC5A 1O37A 1RTFB 1QHRB 1P04A 1IQNA 1W0ZU 5FXLA 1GVKB 1P2NA 1PYTC 1A7SA 2I6QA 1AB9C 1TGBA 2UWPA 4JZFH 4MVNA 1YPLH 2ZFTA 2AIQA 3RMLH 4OGYA 2WINI 4JYVH 4FUEA 2R2WU 1K1NA 1HV7A 1FY8E 1UTLM 2ZFRH 1BRBE 1GJAB 3QGJA 2IJOB 1EAIA 2RDLA 2VIDA 2F9OA 3EDXB 3RXBA 2G4TA 1NROH 2A4RA 1YCPH 1C5LH 2DUCA 2W26A 3ZVAA 3RXRA 1CGHA 1ELVA 1SOZA 1GHWH 3F9FA 2P93A 1D9IA 1SGFA 1TBQH 5DJ7A 4ACBA 8GCHF 1ZJKA 2SFAA 2XC5A 3GY7A 3P8NA 4VGCC 2A5KA 1EZQA 2ZGXH 2VVCA 3A7XA 1UTPA 5HIYA 1YLCA 1O2IA 1GHAF 3URCA 3EQ0H 1GJCB 3A7WA 3FP8E 3GY5A 3GCTF 2OTVA 1A0JA 3VXFH 4ZKSU 1AY6H 2LNCA 3EA9A 2GP9B 3S9CA 1FAXA 1LCYA 3TNSA 5DPAA 1SBWA 1PQ5A 5FPTA 1G3BA 4I8JA 1HXFH 2Y5HA 1W10U 1QA0A 4FXGH 5DP7A 3RXHA 4Q63A 4WMEA 2R0LA 3SJOA 2G55A 1QRXA 2XBVA 1SGNE 1OKXA 3M35A 4LZ4B 2BX4A 5J4SA 5CHAC 2LP6A 2UWOA 4WXIA 1GCTC 5T6DA 4ZKOU 4ZUHA 3P95A 1ESTA 1P06A 1SHHB 1XUIA 1RTKA 3LGUA 4IS5A 2J94A 2AIPA 3BF6H 3M5OA 4ISOA 2A7HA 2RCEA 3GCNA 1D3DB 2AMQA 1HJAB 1UTJA 4HZHA 3A8DA 3GICB 1UJ1A 2WV5A 3BG8A 1HAVA 1O3PB 2BDGA 4RN6A 2FI4E 1O2GH 2ZU3A 1QL8A 3AAUA 3MU5A 2RA3A 3N7DA 4CHAC 3P70B 2J9NA 5F8TA 3GCHC 5LH8A 5FCKA 2XXLA 3BTTE 3CS0A 5HXFA 1SFQB 2NU0E 3M36A 3M7UA 4Y0ZE 1GG6B 1UK3A 1GWAA 4GSOA 2J5UA 3MNXA 3RC6A 1YPMH 4JYUH 2P59A 3M61U 4MPUA 4CRFA 3ATIA 1MD8A 3ODDA 3ZYEA 2ZFFH 1XUKA 3S69A 1FV9A 1GBTA 2UUKB 5FX5A 1OXGA 1BOQA 2SGEE 1ZMNA 4OM9A 1BTYA 5EXMA 1Z1JA 1H1BA 2B5TB 2XWAA 5T6FA 1O2MA 3SUFA 1H8IH 2JKHA 3KGPA 3SYJA 2PUQH 3LPRA 2R2MB 2XCFA 3GY2A 1GJ5H 3UB0A 2TGPZ 1U6QA 2AGIX 5GNDA 1Y3VA 1Q31A 3DSOA 3QTOH 3O8DA 1TMUH 1LVOA 2VIQA 3K6ZA 4ZMAH 1GBHA 5L30H 1F0RA 1ABIH 5DG6A 2K1QA 3ZZ6A 1AFQB 2NU1E 1TPOA 3LGTA 7GCHF 2PGQB 3F9GA 4YLQH 4NWLA 4IC6A 1AE8H 1C1MA 2R3UA 1K21H 1WQSA 3AAVA 3A8CA 1AZZA 4I8GA 1NRSH 3ZZ4A 1TBRH 1ELTA 2C3SA 1D3PB 4H42U 4I8HA 4UD9H 1ELEE 1TGNA 1MQ5A 3RM2H 3RU4D 5J4QA 5ETXA 1EPTB 4YZUA 2GT7A 3RXAA 2ZHWH 1A46H 2KFWA 5GDSH 1ZSKA 5JPMH 3TGJE 1P2JA 1NRQH 4R0IA 4YLUA 1J16A 2NU4E 1RIWC 2BLQA 2JJ2D 3RXMA 3VGCB 5I25A 2GJGA 1OWIA 1MZAA 3F1SB 2W7SA 3RXOA 5EXLA 3TGKE 2ZFQH 1N1LA 2GCHF 3PRBA 4CRAA 3RP2A 2A2QH 1K1PA 3BTQE 5E0JA 1C2FA 2OP9A 3P92A 3U8RH 3SOSA 1C5TA 4AYYB 2Y7ZA 2P8OB 2SGDE 3PTNA 4TY6A 5EJLA 3U1JB 4HG6A 4YT6H 1LPKB 1SFIA 1TNIA 2AS9A 4X6NA 1NFWA 2L6OA 1JMOH 2O8WA 1O3MA 1O2WA 1NS3A 4K3JA 2AEIH 1C5UA 5C5NA 4D8NA 3RMNH 2UUYA 1O3FA 8GCHG 5C1UA 1DXPA 1YPGH 1LMWB 3KN2A 3M3SA 3ZV9A 1BMAA 2FOAA 1L4ZA 1S0RA 4Q2KA 1CVWH 3F9EA 5CHBA 1O34A 5F03A 4WF8A 6CHAC 3LONA 5A0BA 1OYQA 4JK6A 2QY0B 4Y8ZA 3DSGA 2O8LA 4X8TH 5LGOA 1AUJA 1JIMA 1VCWA 2BY8X 1CHOF 2FZZA 2A2XH 4DCDA 1CT4E 1SLWB 1KXCA 1A5HA 2UWLA 4ABEA 2A31A 1C2JA 3VB4A 5FPYA 2Z3EA 4FVDA 1BTHH 1C1NA 1F0TA 1P01A 4ZHMU 1O3JA 3KF2A 1FMGA 2ESTE 1B5GH 3CS7A 1H9HE 3FN8A 4Y11E 1C5QA 1VJAU 1ELCA 1VCPA 1GJ6A 1Z7KA 2OK5A 4NFEA 4FU9A 3TJVA 4MLFB 2EY4C 5CDFE 3UWIA 2WSSD 2B0FA 1KXBA 1THSH 2ULLA 2J92A 4CREA 1C4V2 2F91A 2G51A 3WWFA 2G5VA 4CR5A 1C1PA 2AHME 4Y10E 1QL9A 3QO6A 2BVRH 4F48B 1MUEB 3F3BA 1ZGVA 4U32A 1TPAE 4A6LA 1SGPE 5HM2A 4RSPA 4LK4A 2ZG0H 1WOFA 1K1OA 1TYNA 5HM9A 1BUIA 2A45B 1NFYA 4FUHA 2XC4A 1DFPA 1BA8B 4WMDA 3DSPA 3H09A 3UOUA 1CA8B 2B9LA 3PV2A 1BHXF 5HYOA 2H9HA 1GBBA 1VITG 1W8BH 4ZXXH 1CA0B 1OSSA 2BZAA 2FI3E 1BMLA 1FY3A 2YOLA 3R0FA 1DT2A 1GHZA 1TNGA 1W11U 1YKTA 1O2ZA 4GHTA 3SV7A 4NGAH 3TK5A 1KXFA 1TFXA 2ZU4A 4TWWA 1GMCG 4NCYA 1DANH 5A8XA 1W2KH 3NRLA 1XUGA 1IAUA 3E8LA 3FOAA 2Z3DA 2BQ7B 2LELA 1V2JT 2H1UA 3MFJA 5T3HA 1EB1H 3SNDA 5SGAE 5C1XA 1HIAA 2ZHFH 3KEEA 2W7UA 3LJOA 7GCHG 3RLYH 3Q3YA 4BOHA 1FY1A 1P2OA 2GGVB 1MABB 1SGTA 4MNVA 5A0CA 1C2EA 1DM4B 2AGGX 1JIRA 4MPVA 2STBE 3M7TA 3MTYA 3C27B 3BG4C 1FIZA 3EAJA 2CHAC 3KYGA 3TH3H 3UQVA 3E3TA 1L1NA 1P12E 1YPHC 1QGFA 1MQ6A 2HVYB 2GKVE 4XBCA 5LPFA 1EAUA 4GCHG 1FY4A 2YNAA 4UDWH 1H9LB 4GUXA 1TONA 1T4UH 4KTUA 3SGQE 1ELFA 2HLDD 2ODPA 1ZGIA 4ZXYH 4K69A 3MYWA 1YPEH 2BD7A 5DSFA 1BZXE 4NSYA 1P05A 4IW4E 5C94A 2ZIQH 3A88A 1AVGH 4Q4LA 3ATMA 3PMBB 5B6LA 1GGDB 3GDUA 3UREA 4I7YH 2AGEX 2QV1A 2A7CA 1W14U 1GBAA 4DT7B 1UCYK 4I8LA 1FJSA 1VGCC 1HGTH 2G8TA 4INHA 1JRTA 1JOUB 2GT8A 5L6NH 1O3KA 1YPHE 3E90B 4AYVB 1SQRA 2PSXA 1RJXB 4MNYA 5AFYH 1BTZA 2OC7A 1C4Y2 2BZ6H 1BQYA 5I46H 3ENSB 1K0HA 2DE8A 4D7FA 3O8CA 2ILNA 2GZ8A 3KQEA 1NRPH 2HLCA 2F9NA 5E0HA 4NIWA 3P17H 3SU2A 1ZYOA 2ZHQH 1KIGH 3Q3KA 2BLVA 3FO8D 5HIZA 4D76A 3V12A 3GCOA 1TA2A 5DP8A 2FOCA 1GHVH 4JZ1A 3V0XA 4UFDH 1WCZA 2SGPE 1P8VC 2Z9KA 1MAXA 1K28D 2QAAA 3IWMA 1C9TA 3SJ8A 1ZHPA 4BAQB 1BJUA 1S5SA 3QZQA 2M2AA 1J17T 1Z6JH 2XW9A 3F2HA 2PW8H 3AW0A 3MH7A 3QN7A 2F43B 3TJNA 1TQ0B 2RA0A 1ZSLA 2GZ7A 1NT1A 4HTCH 3M37A 1AMHA 1N8OB 2PTNA 3Q77A 1A61H 4O03A 7ESTE 2ZFSA 1O2UA 3P6ZB 1OWHA 4FUDA 5TCCA 1GJ7B 2A1DB 1X7AC 3PLPA 3VB7A 2ZU1A 3ZZ3A 3E0NB 1G2MA 1MTNB 1GHBF 4UFFH 5IDKA 1OWKA 2FP7B 4AG2A 3SBKA 1C2IA 3KQ5A 3UOPA 2ZZUH 4YOJA 3TGIE 1GVLA 4CRBA 1FIWA 1DSTA 1O38A 1LPZB 1WDIA 3OY6U 1J14A 1L2EA 2FMJA 4NWKA 2W3IA 1O5CB 1SQOA 2F9BH 5FHTA 2KZ4A 2BD4A 4ABFA 3OSYA 1QRWA 1DPOA 2C8WB 1ETRH 1QR3E 1AFEH 1P9SA 2EI8A 2J98A 1O3BA 1ZMLA 3S7HB 1MTUA 4MDSA 3T5FH 1ZRKA 2VGCC 1ZPZA 3ATWA 3LIWA 4X8UH 4JZIA 3ZZ5A 1FONA 2OCVB 3SUEA 1BRUP 4RKOB 1NU7B 1WXRA 1O32A 2FM2A 1O2PA 1TIOA 3I29A 3JZ2B 1QB1A 1IQLA 2ZTXA 4E06H 5C3NA 3MWIU 1BCUH 1DWDH 5EQQA 3WWBA 1KTTB 1GBFA 2WUBA 2YMSD 3TK9A 3ZVCA 5A8YA 3T28A 3BTFE 2QN5T 3PB1E 2KAIB 4Y6DA 4Z1MD 3TPIZ 1P57B 5CE1A 1SGCA 3H7OA 2V3OH 4CRDA 1TPPA 4E7RG 2KM0A 1TNLA 2VNTA 1EASA 1BT7A 2XBYA 3RXLA 1O5EH 2JETB 2G81E 4KGAA 1AN1E 3RXKA 1EB2A 1H8HD 3MNBA 3U28C 4I86A 1LVYA 1O5AB 1Y3UA 1HAIH 1A5IA 1GVZA 4I33A 3OEED 1MKWK 1E38B 2QXIA 2WPJS 3SUDA 2CXVA 2GV7A 2ZA5A 2O8UA 3P8GA 3DHKH 3VB6A 3LJJA 3UIRA 1D6WA 1HYLA 3SQEE 5JB9S 5EJZA 5IYTA 2HGTH 1EKBB 1MKXK 4SGBE 4X2YA 1GI9B 1TRNA 4WH6A 2GVFA 2OUAA 1ELBA 1GL1A 3BIVH 4MPXA 4GHQA 2ZQ2A 1BB0B 3O8BA 2CK3D 2P3UB 2PKSC 1IHTH 3PMJA 4B1TA 4CRCA 1W3CA 1UHBB 1TX7A 1TOMH 1SGIB 1TNKA 2QA9E 1V3XA 1V2LT 2KR7A 1L1GA 4NA9H 4FVBA 2FEQH 3UAIC 4B2CA 2AYWA 1BIOA 3SZEA 2D26C 3PTBA 5A2MH 1OYTH 3GS9A 1EZXC 1VCQA 4DW2U 2CF8H 1ZJDA 4YOIA 1DITH 2CMYA 2ZGBH 1IQMA 3SORA 1OP0A 2PGBB 1N6YA 1NPMA 1O2TA 5C17A 5HGGA 1WTGH 4M9FA 1NC6A 1MCTA 2ZHEH 4F55A 2ZC9H 3B9FH 3KNXA 1A2CH 1EJMA 3S9BA 1EPTA 2I6SA 3RXIA 2WPDD 1TBZH 1C1RA 1ZR0A 1XVMA 1EFRD 3SHCH 3TNTA 5L2YH 3GY8A 1PPEE 1LQDB 2BLWA 1MMJN 4MG3A 1F7ZA 1N6XA 1S0QA 1KTSB 1Y8TA 3ZZBA 2BB4A 3UPEA 4TPYA 2BMGB 2ZWLH 3Q76A 3RU4E 4A5TS 1C5SA 3N99A 5EQSA 1IQKA 4KKDA 2Z6BD 4HI3A 1WU1A 2NU3E 4DJZB 3A86A 4X1NU 2TPIZ 1GHBG 2O8MA 3ZZ8A 1Q3XA 1FQ3A 3EA8A 1LHCH 3BTDE 2BVXH 2J34A 4Y7AA 2J4IA 1ZOMA 7KMEH 4X6OA 3MU8A 3GYMA 3KL6A 3TJUA 4K1EA 3ZIAD 2AMPA 2LPRA 1AB9B 2QYIA 3U8OH 3G01A 1HAHH 1Z8IB 1LHFH 1P10A 2FDAA 1HPGA 3OYPA 4NIYA 3MHWU 3PO1C 3URDA 2D1JA 4ZHLU 5C0UA 3VB3A 2W6ID 1XUHA 1J15A 4SGAE 1VITF 1THPB 2JH0D 1CGJE 1GI6A 1OX1A 1FXYA 3D65E 1HXEH 1JRSA 1XKBC 3TU7H 1O2LA 5GCHF 3NWUA 3QZRA 2GV6A 1CBWC 1GMCF 1XUFA 1KXAA 4VGCB 1MKXH 1NZQH 4WVPE 1P02A 1RGQA 1MBMA 4H6SB 4BTTB 2VWMA 1SGRE 1JWTA 1ANDA 3KYFA 9LPRA 1IHSH 1F0SA 2OXSA 2C4FH 5C1YA 1Y5BT 1NTPA 1OHHD 1XMNB 2VH0A 1O39A 4E7NA 4AB9A 5JBTA 1PPFE 1O3AA 3N7EA 1WSSH 2NWNA 2P16A 1LTOA 1OWDA 1GI4A 2G00A 5GPIB 1UVUH 5EXNA 1G30B 1Z8GA 3L3TA 4FUCA 2ZGJA 3SV9A 1TGTA 5BRRE 3SI4H 3VG8A 1XKAC 3RXQA 2ODYB 3TH2H 5CHAB 1DSUA 4GCHF 4BAHB 1NFXA 1DS2E 1GCTB 3UR9A 1SG8B 5EJ1A 1IQHA 3D49H 3U9AH 5A8ZA 2Z3CA 4X0WU 1AU8A 6GCHF 1ELGA 3F9HA 3QX5H 3BTHE 3IG6B 1Y3XA 3K2UA 1PPBH 4OS4A 3DFJA 2Y7XA 2QXJA 1C2HA 4KTSA 3SW2B 5JBCS 5GIBA 3M5NA 1LQEA 2J97A 2TIOA 4CHAB 1TQ7B 3A84A 4X2XA 3L33A 1YCPM 1CGIE 1D3TB 3GCHB 3KQCA 2J95A 1C1OA 1T32A 3AVZA 2XOKD 1EATA 2SNVA 1RFNA 3PO1B 3ZVGA 1EAWA 3M5LA 1J9CH 3OY5U 3PM3A 3VXEH 5FCRA 1AWFH 4K5ZA 1K1JA 2SGFE 3KCGH 5ESTE 2HWLB 3QGNB 5C20A 2BOKA 1P3EA 4AFSA 4XD7D 3BEFB 4ZKNU 1XVOA 4JK5A 2ALPA 3LOXA 4WXVA 1ESAA 2ZTYA 3RDZA 4ACAA 4OS2A 1GDNA 3SNCA 4B2BA 1GPZA 1A4WH 2H9EH 1O3DA 4YXWD 1UCYE 3SN8A 1KY9A 3AASA 2IPHA 2GCTC 1AGJA 1SSXA 1DDJA 1A0HB 3HATH 1C2DA 4R8TB 4UFGH 1C5ZB 1D6RA 4JCNA 1WQVH 3MO9A 4INKA 1EX3A 3VFEA 4IN2A 1YP9A 5DP9A 2GD4B 2XWBI 1LHDH 4TT3D 2VJ1A 5FL7D 3GY4A 1Y3WA 1SQTA 4FUFA 3DT0H 4Y71A 1Q2WA 1TRMA 2GX4A 2OBQA 3MI4A 3VEQB 5PTPA 5C2ZA 3RM0H 1O3LA 2K0QA 3NPSA 1KLIH 2EI6A 3RC4A 3E1XB 2BY7X 4NG9H 3U1IB 1LHGH 1GHYH 2V35A 2CF9H 1AI8H 2FOEA 3GDSA 2HRVA 4NA7A 3JZ1B 4D7GA 2RFKC 1C5WB 1O5FH 1QJ1B 2FYQA 4B76A 3SV2H 1AQ7A 1RIWB 1PFXC 3A89A 1GMDG 3DD2H 3W95A 3TJOA 2QF3A 2HVXA 1LKBA 2FS8A 1BTWA 4GVUA 2BQ6B 1GI8B 3RXVA 3U98H 2WUCA 1Z71A 1FX0B 2ZP0H 5C67A 2D8WA 3CP7A 5DP3A 2PLXA 1GMHF 2BDIA 2ZPQA 2QGRA 2WV4A 3SJKA 2ZU2A 1UK2A 5EPNA 4AOQA 3KQBA 3LKWA 2W5EA 1MU6B 2WZQA 2FXRA 1SI5H 2BY5X 4ASUD 1SOTA 3CNRA 3E16B 1W0KD 4DVAU 1C9PA 2J38A 1HUTH 2ZPRA 1S85A 5L2ZH 2CN0H 2H9TH 2KX4A 2BM2A 3E0PB 1EP6A 3ESTA 4ASHA 5GCHG 5EODA 3UNQA 1BJVA 4I31A 1C5VA 2ANYA 3M7QA 3R3GB 1AO5A 2QC2A 2VIOA 5GJ4B 5JYIA 1SGYE 4HFPB 3SV6A 1HDTH 1E79D 1GI3A 2P3FH 4ISNA 3RU4T 4NSVA 1BTXA 2ANWA 1ZTKA 6CHAB 4CH2B 1P2IA 1YBWA 3SU6A 5FAHA 4YM9A 1QBOA 1NY22 1TX8A 3RXFA 2ZGCA 1UTNA 2M5TA 4XFQA 2FESH 4KP0A 1O2VA 1VITH 2QXGA 4B2AA 1OWEA 4OGXA 1TGSZ 3S0NA 9ESTA 4NZQA 2Y5FA 2C93B 1QIXB 2H2ZA 3RXPA 1FZZA 1EQ9A 3EA7A 1INCA 1O30A 4KELA 1F5LA 2ZF0H 3TIUA 1L1JA 1A1RA 2Y82A 2Y5GA 1C1TA 2HPQH 3ZVDA 1PJPA 2BD2A 4ABJA 5DP4A 3B8JA 1V2NT 3MNCA 3QDZB 4YT7H 2XBWA 1BMNH 1PPHE 3LGYA 1GJ8B 1TALA 2VVUA 2XNDD 4X8SH 1YWUA 3EYDA 6GCHG 1RD3B 2ZECA 2R3YA 4Y8XA 1HJ9A 1FPCH 1O3HA 2BDHA 4XDEA 4X8VH 4GPGA 3BEIB 4D9QA 4E05H 1HAXB 4IMQA 2A4GA 1F5KU 1QBNA 1UO6A 1DOJA 1W13U 4K60A 2Z9IA 5FBEA 2Z9LA 5TCAA 1QQUA 3UY9A 1YPJH 1E35B 1G2LA 1UVOA 2YMSC 1QB6A 1FI8A 4Z0KA 3KHVA 1QCPA 2VINA 1GBDA 1SVPA 1B7XB 2F9UA 1V2TT 5C0TA 3LGVA 1P2KA 2QXHA 1DWEH 4UE7H 2CGAA 1UTQA 1ARCA 4XE4A 3SGAE 4AN7A 5B6OA 2WHXA 3SGBE 2O9QA 4A92A 1G32B 3TH4H 1GI7B 3ZV8A 2OC1A 5AF9H 1GDQA 1ZHRA 4D9RA 2F9PA 1S83A 2HNTE 3HPTB 3BSQA 4XOJA 1SGEE 1SKYE 1LVMA 4FU7A 2BX3A 3RC5A 4THNH 3QLPH 1FNIA 3QK1A 1Z1IA 1P11E 2C90B 1DUAA 4ISHH 1QA7A 6ESTA 2OLGA 4QT8C 5FX6A 1O36A 1V2KT 4TY7A 5C5OA 4AFQA 1V2RT 1G36A 1H4WA 1NESE 3MU1A 2QIQA 1O0DH 1VJ9U 1T4VH 2WYGA 2C8ZB 3BG4B 2C8YB 4XRNA 2EA3A 2CHAB 1FN8A 2FS9A 1QZ8A 3PROA 4J1YA 2CV3A 1HFDA 5EQRA 3Q00A 4P00A 2XYAA 1LO6A 1GJ9B 1PQAA 1G37A 4X1RU 3UNRA 1Z8RA 1RTLA 3TVJB 1FPHH 4ABGA 5DKMA 3HK3B 3BTGE 1O5DH 1E0FD 3BTME 1UHBA 2R9PA 1NRRH 3QTVH 2ALVA 1BRAA 2Z9JA 3HGNA 4Q7YA 5JDUB 1C5YB 1V2UT 4B71A 1WUNH 4GAWA 2OINA 1MTWA 2AH4X 3AW1A 3I78A 5JB8S 1RS0A 2BTCE 3MH6A 1GMHG 1GJ4H 2HNTF 1VGCB 2F9VA 2ZPSA 2Q1JA 5E8EH 2BY9X 2YMSB 3ZYDA 2TGDA 3OTJE 1KYNA 1O2HA 3WW7A 3SJ9A 1HAOH 4DIIH 1F2SE 1O35A 2PR3A 1A5GH 3ZZCA 3W94A 2QF4A 4CH8B 1C5XB 5EOKA 4AX9H 3S9AA 1EP5A 2P94A 2ZQ1A 2FO9A 3GDVA 2ZI2H 1O31A 3ZZ9A 1TA6A 4B74A 1P09A 4MQAA 1T8LA 1K22H 1UCYH 2FTMA 2SGQE 5F6MA 1SC8U 2XNIA 2KCAA 4H4FA 1FDPA 3F2FA 1DVAH 3IITA 3FP7E 3PYHA 2VWOA 2KCOA 1L4DA 4TSFD 1SLVB 3QUMP 4AZ2B 1E36B 1KSNA 4AB8A 2FOFA 2J2UA 1BRCE 1TWXB 4Q7XA 1W0JD 4K1TA 4NIXA 3NK8A 3RXJA 4OS6A 2FX4A 1LPGB 5TJXA 1SLXB 4K8YA 1AUTC 1C1WH 3PMHB 2G4UA 3HK6B 3MQKC 2BDYA 4IBLH 1S81A 1V2WT 3A85A 2F3CE 4B73A 5A0AE 1KDQB 4A7IB 5CMXH 1ORFA 1BMMH 2WPKS 1TGCA 3FKSD 2ZCKP 2V7QD 4JYTA 2IN2A 2BDBA 2FOGA 1QY6A 2YNBA 1QJ6B 4BTIB 1KXEA 1MBQA 3ZVBA 4AGKA 1O2QA 2XBXA 3KIDU 4YTAA 3N7OA 1C5RA 3TK6A 1UVPA 1C5MD 2FIRH 3H7TA 4JZDH 1S6FA 2Y6TA 1C5NH 2BVSH 5EW2H 1HJAC 2Z94A 5F8XA 1KLJH 3F68H 3OX7U 4BAOB 1V2MT 1L0ZA 2B8OH 1ZRBA 1ZMJA 1E1QD 1NN6A 4Y7BA 2VIPA 5ESBA 1GBIA 1ZPBA 2ZDAH 2A0QB 4WJG2 1EXFA 4FOUC 4F4OC 4BNRA 1KXDA 2XRCA 1IQGA 4P02A 1GG6C 1GBEA 4O9VA 3GY6A 2TBSA 2UUFB 2F83A 1AKSB 1ELDE 2AMDA 3MU4A 2FX6A 2EEKA 2OC0A 2VGCB 1A3EH 1F0UA 1PPCE 4AFZA 4UEHH 3A7VA 1O33A 1DLEA 1GBKA 3PV5A 2BOHB 2F4LA 3U8TH 2FWWA 1MZDA 1FN6A 1G9IE 4X2WA 1QFKH 2BDCA 3A87A 2PKAB 3F2GA 3BTKE 3GY3A 1SHYA 3BIUH 2Q6GA 1HAYB 3PRDA 2WPIS 6LPRA 4U30A 4F49A 3BTEE 3ITIA 4IN1A 4ISLA 3GISB 4Y79A 1O2KA 3FZDA 5FPSA 2J98B 2WPLS 1AZ8A 2EC9H 1AFQC 3MOCA 1CT2E 4MPWA 5EIYA 5EU8A 1YY3A 2W3KA 2PHBA 2ZFPH 1J8AA 2A5IA 3ATKA 4PROA 2KCYA 1HAPH 1C2KA 3UQOA 1QRZA 1GI5A 1DUEA 2FOMB 2IJD1 1OPHB 3FZZA 1QJ7B 4YOGA 1K1IA 1G3DA 2OBOA 5GWZA 1GMDF 2QE7D 3ZZ7A 1HJ8A 3SUGA 1EPTC 3MH5A 1BBRK 4BTUB 2B7DH 4Z6AH 4LXBH 2A5AA 1O5GH 1SPJA 2VWLA 1SLUB 5JBAS 1IQJA 1VR1H 5K0HA 4FETA 1O2XA 1Y3YA 1O2NA 1V2OT 1C2MA 5H4IB 3VGCC 4CR9A 5K7RA 1QBVH 3DUXH 4I8KA 1BDAA 2H6MA 2HOBA 4OS1A 5HMAA 2PKSB 1HBTH 2VU8E 2WPHS 1MKWH 3QWCH 1ZHMA 2V0BA 1TNHA 2Y80A 1NRNH 3TLOA 1O2YA 1TMBH 8KME2 4ABHA 4ABBA 4MNWA 4DG4A 2P8OC 1RRKA 1EUFA 4K2YA 4HGCA 1AD8H 3FVFB 3F0PA 5BPEA 3MO6A 1FAKH 1ZZZA 1DLKB 1C1UH 1C5OH 1PYTD 1G3EA 1WBGB 4BANB 1O3OA 1P9UA 1YGCH 2JDID 3K65B 4DGJA 1SGDE 2TGTA 2PP6A 4X1PU 4DT4A 1C1SA 2KCPA 3M5MA 3I77A 2VIVA 4ABIA 3RMOH 2Q6DA 4FUGA 1O2OA 4DOQA 2ZGHA 3PWCA 1FUJA 3T62A 3UUZA 1O3CA 1KLTA 3SHAH 1MH0A 3RXTA 2ASUB 1OOKB 3BV9B 5LPRA 3L6PA 1PPZA 3O8RA 3ZVFA 1O3NA 1BITA 5DP6A 1EJNA 1GBJA 1COWD 2G52A 1ANEA 2WV9A 1TMTH 4Q80A 3RMMH 1C2LA 2Z7FE 1EZSC 5E2PA 1O2JA 2IPQX 1HCGA 2FI5E 1W7GH 1K1MA 1QTFA 1TB6H 2ZKSA 3C1KA 3UTUH 4ZROA 3U69H 1XXFA 1TNJA 3P8FA 1XX9A 1BTUA 1AHTH 3SU3A 3LC3A 3SZNA 1E37B 1BTPA 1S84A 3LU9B 3HGPA 3V7TA 1T8MA 1GHXH 1H9IE 4O3TA 2A32A 1MAYA 1YYY1 3RLWH 4A1XA 3VB5A 2ZDMA 2ZCLP 1YM0A 2XTTB 1T31A 4K8BA 1MU8B 8ESTE 2O8TA 1TLDA 4A1VA 3UR6A 3A83A 1F5RA 1WV7H 1BBRH 4ABAA 1XUJA 2ANKH 2VIWA 5AHGH 3SNEA 4GLYA 1YLDA 1DXWA 1HAVB 2OD3B 2XCNA 5DP5A 2AFQB 4ZHAA 1CBWB 2BHGA 4NZLA 4Y76A 1CA0C 4BAMB 3RXUA 5E2OA 3V13A 5A09A 2IOTA 1ETTH 1T8OA 1HNEE 1C5PA 3A8AA 4WWYA 1OWJA 2D2DA 5EPYA 3EGKH 2QCYA 4RT0A 3T29A 2ZO3H 4U01A 4OS5A 4NA8A 1C2GA 3UNSA 2FOHA 3LT3A 4WH8A 3SNAA 1THRH 1GHAG 1GBMA 1AVXA 1UTOA 3T26A 3ELAH 3GCTG 2JJ1D 1HB0B 2VH6A 4TWYA 3ZZAA 1QNJA 4ZAEA 3FANA 1Y5AT 5T6GA 1Y5UT 4XSKU 1W12U 5T1VA 2GZ9A 3STIA 1ACBE 1VZQH 3FFGA 3V3MA 5G4BA 1MTSA 5KECA 3TITA 3SU5A 3T27A 2OQ5A 1K9OE 2OQUA 1Z8JB 1GBCA 3LDXH 8LPRA 1K1LA 1ZLRA 3A8BA 2FOBA 2K8IA 1Y59T 1WTHD 1WYKA 1DICA 1SMFE 1P03A 2FTLE 1Z6EA 2QF0A 1SQAA 1G3CA 2GDEH 5E0GA 3UWJH 1AVWA 1NBME 3RXGA 1GCDA 3MO3A 2VVVA 3DA9B 1SB1H 1O5BB 3HKIB 1O3GA 3KQDA 2DE9A 4OS7A 1YPKH 4DURA 1BHXB 1P2MA 1FLEE 1GGDC 4UONA 2PFEA 1IQIA 1DWBH 4J2YB 2R0KA 2BDAA 1ZPCA 1NU9A 1UTKA 1NFUA 3LGWA 2THFB 1PQ8A 4RT1A 1UTMA 2BXTH 1CE5A 4ZCNA 3SI3H 1UVTH 5LPEA 3K9XB 1MTVA 4X1SU 1XXDA 3GYLB 4AG1A 4AGJA 3A82A 2UUJB 3GOVB 4MNXA 1P3CA 2VWNA 5DGJA 3OFND 2BD5A 2RG3A 1GBLA 1C4U2 4X6PA 1HLTH 7LPRA 2GDDA 3T2NA 2FLBH 2ODQA 2GCTB 3MNSA 1TPSA 1PQ7A 1F92A 5IK2D 3B23B 3PWBA 2GTBA 4WMFA 2FODA 3UFAA 4O97A 5AVDA 5KGOA 3WY8A 3OU0A 1OP8A 3BEUA 3OAAD 2ANMH 4UFEH 1D4PB 4X2VA 1DY9A 3OE7D 4I32A 3LGIA 1OS8A 2BXUH 2W6JD 2ZNKH 4RKJB 3PMAB 5EG4A 2TGAA 5ABWA 1GI0A 1IQFA 1GL0E 3MH4A 4IMZA 4JMYA 4ABDA 1QB9A 5KEDA 1ZTLA 1K2I1 1V2ST 5HKKD 1HRTH 1N8OC 4Q7ZA 1IOEA 5FBIA 3RXSA 1SGFG 1AWHB 1LKAA 3AK5A 3SNBA 4XBBA 1H8DH 1ARBA 1MTNC 2WPMS 3T25A 3NKKA 3PLBA 3SV8A 2V6NA 1RXPA 2ZU5A 1QL7A 1DX5M 3D23A 1NBMD 1ANBA 4XBDA 1C1QA 4AFUA 2GMTC 2Q6FA 5DN6D 2HNTC 2RDEA 2P3TB 4O3UA 2ZEBA 3A80A 2Y81A 2A7JA 4DY7B 3EE7A 3E6PH 4CBNA 2V3HH 1KMHB 1V2PT 3H5CB 4AC9A 2G5NA 1AE5A 4NFFA 1WAYB 2PUXB 3A7ZA 3F0OA 3BTWE 2PV9B 4H6TA 2GCHG 1ETSH 1NM6A 1ZTJA 2BD9A 1QQ4A 2V3MA 3NZIA 1O2RA 3Q3XA 2KAIA 2VB0A 1ZSJA 1EAXA 3A81A
chains in the Genus database with same CATH topology
1V2VT 3K6YA 3NUMA 3PV4A 3SU4A 1FY5A 1PPGE 4AORA 1YC0A 4BXSA 3SU1A 1KDQA 1SL3A 3MMGA 5JBBS 1T8NA 1YF4A 4TPIZ 2A4QA 2ZDLA 4LOYH 1S6HA 2EI7A 2BQWB 1OP2A 1SR5C 1TE0A 1E34B 4ZKRU 4NIVA 1HAGE 5EGMA 2P95A 2JH5D 4KTCA 3SO3A 2PWXA 4X1QU 2BY6X 1DY8A 1ANCA 1CHOG 4K1SA 2BD8A 1MCVA 1TABE 4LZ1H 1P0SH 2TRMA 4Y8YA 1B0FA 1LHEH 2JETC 1NO9H 2HALA 2ZDKA 5AFZH 1XM1A 3MU0A 1HIAB 2NU2E 4INLA 1SGQE 3DFLA 3HKJB 4U2WA 3EE0B 2PSYA 3S7KB 1GJDB 2SNWA 4ESTE 3NCLA 2XC0A 1GI2A 2BD3A 1YCPK 1MD7A 3PLKA 5DK1A 3RUOA 1AKSA 1ABJH 3M3TA 3A7YA 4FUJA 2GMTB 3M3VA 4MTBA 5F8ZA 1EZUC 4BXWA 4X6MA 1AIXH 3RXEA 1UMAH 3SU0A 3F6UH 1D3QB 3LH3A 2FPZA 2AERH 1TOCB 1O3EA 4DIHH 3LC5A 2PKAA 1CQQA 2WYJA 2ZCHP 1BBRE 2FLRH 3ZZDA 2SGAA 4FUIA 1CHGA 3FAOA 1GI1A 4M7GA 2H5CA 1CT0E 1ID5H 1ESBA 3FP6E 3STJA 1CU1A 1W0YH 3NXPA 1CO7E 1B0EA 1TX6A 1ELAA 1GJBB 1HAZB 1W7XH 1QURH 4WY3A 1JBUH 2FYRA 3SQHE 1S82A 2A4OA 2Z9GA 1M9UA 5GXPA 3P8OA 1V2QT 3E91A 1LDTT 1DWCH 4BAKB 4ISIH 3ODFA 4FUBA 4ZH8A 3SJIA 3ATLA 1TAWA 2ZTZA 4CBOA 4JZEH 4IGDA 2JH6D 1P2QA 3RXCA 2STAE 1EOLA 2BLOA 1GDUA 3LH1A 1UK4A 1CSOE 1JXPA 4B75A 1DE7H 2ZDNA 1UVSH 1LVBA 3CENA 4A1TA 4Y0YE 1EJAA 4TYDA 1V6DA 2CJIA 2C8XB 1IQEA 3VPKA 3RXDA 2PTCE 4YESB 2H5DA 1C1VH 2HPPH 4YO9A 1TRYA 2BYAX 3A7TA 1O2SA 5EW1H 4CRGA 2ZHDA 4FU8A 2ZDVH 1EOJA 1A3BH 3D62A 1T7CA 1A0LA 3ZVEA 1O3IA 2OC8A 3BN9A 5DO4H 4IC5A 1O37A 1RTFB 1QHRB 1P04A 1IQNA 1W0ZU 5FXLA 1GVKB 1P2NA 1PYTC 1A7SA 2I6QA 1AB9C 1TGBA 2UWPA 4JZFH 4MVNA 1YPLH 2ZFTA 2AIQA 3RMLH 4OGYA 2WINI 4JYVH 4FUEA 2R2WU 1K1NA 1HV7A 1FY8E 1UTLM 2ZFRH 1BRBE 1GJAB 3QGJA 2IJOB 1EAIA 2RDLA 2VIDA 2F9OA 3EDXB 3RXBA 2G4TA 1NROH 2A4RA 1YCPH 1C5LH 2DUCA 2W26A 3ZVAA 3RXRA 1CGHA 1ELVA 1SOZA 1GHWH 3F9FA 2P93A 1D9IA 1SGFA 1TBQH 5DJ7A 8GCHF 1ZJKA 2SFAA 2XC5A 3GY7A 3P8NA 4VGCC 2A5KA 1EZQA 2ZGXH 2VVCA 3A7XA 1UTPA 1YLCA 1O2IA 1GHAF 3URCA 3EQ0H 1GJCB 3A7WA 3FP8E 3GY5A 3GCTF 2OTVA 1A0JA 3VXFH 4ZKSU 1AY6H 2LNCA 3EA9A 2GP9B 3S9CA 1FAXA 1LCYA 3TNSA 5DPAA 1SBWA 1PQ5A 5FPTA 1G3BA 4I8JA 1HXFH 2Y5HA 1W10U 1QA0A 4FXGH 5DP7A 3RXHA 4WMEA 2R0LA 3SJOA 2G55A 1QRXA 2XBVA 1SGNE 1OKXA 3M35A 4LZ4B 2BX4A 5J4SA 5CHAC 2UWOA 4WXIA 1GCTC 5T6DA 4ZKOU 4ZUHA 3P95A 1ESTA 1P06A 1SHHB 1XUIA 1RTKA 3LGUA 4IS5A 2J94A 2AIPA 3BF6H 3M5OA 4ISOA 2A7HA 2RCEA 3GCNA 1D3DB 2AMQA 1HJAB 1UTJA 4HZHA 3A8DA 3GICB 1UJ1A 2WV5A 3BG8A 1HAVA 1O3PB 2BDGA 4RN6A 2FI4E 1O2GH 2ZU3A 1QL8A 3AAUA 3MU5A 2RA3A 4CHAC 3P70B 2J9NA 5F8TA 3GCHC 5LH8A 5FCKA 2XXLA 3BTTE 3CS0A 5HXFA 1SFQB 2NU0E 3M36A 3M7UA 4Y0ZE 1GG6B 1UK3A 1GWAA 4GSOA 3MNXA 3RC6A 1YPMH 4JYUH 2P59A 3M61U 4MPUA 4CRFA 3ATIA 1MD8A 3ODDA 3ZYEA 2ZFFH 1XUKA 3S69A 1FV9A 1GBTA 2UUKB 5FX5A 1OXGA 1BOQA 2SGEE 1ZMNA 1BTYA 5EXMA 1Z1JA 1H1BA 2B5TB 2XWAA 5T6FA 1O2MA 3SUFA 1H8IH 2JKHA 3KGPA 2PUQH 3LPRA 2R2MB 2XCFA 3GY2A 1GJ5H 2TGPZ 1U6QA 2AGIX 1Y3VA 1Q31A 4ZMAH 3QTOH 3O8DA 1TMUH 1LVOA 2VIQA 3K6ZA 5L30H 1GBHA 1F0RA 1ABIH 5DG6A 2K1QA 3ZZ6A 1AFQB 2NU1E 1TPOA 3LGTA 7GCHF 2PGQB 3F9GA 4YLQH 4NWLA 4IC6A 1AE8H 1C1MA 2R3UA 1K21H 1WQSA 3AAVA 3A8CA 1AZZA 4I8GA 1NRSH 3ZZ4A 1TBRH 1ELTA 2C3SA 1D3PB 4H42U 4I8HA 4UD9H 1ELEE 1TGNA 1MQ5A 3RM2H 3RU4D 5J4QA 5ETXA 1EPTB 4YZUA 2GT7A 3RXAA 2ZHWH 1A46H 5GDSH 1ZSKA 5JPMH 3TGJE 1P2JA 1NRQH 4R0IA 4YLUA 1J16A 2NU4E 1RIWC 2BLQA 3RXMA 3VGCB 5I25A 1OWIA 1MZAA 3F1SB 2W7SA 3RXOA 5EXLA 3TGKE 2ZFQH 1N1LA 2GCHF 4CRAA 3RP2A 2A2QH 1K1PA 3BTQE 5E0JA 1C2FA 2OP9A 3P92A 3U8RH 3SOSA 1C5TA 4AYYB 2Y7ZA 2P8OB 2SGDE 3PTNA 4TY6A 3U1JB 4YT6H 1LPKB 1SFIA 1TNIA 2AS9A 4X6NA 1NFWA 1JMOH 2O8WA 1O3MA 1O2WA 1NS3A 4K3JA 2AEIH 1C5UA 5C5NA 4D8NA 3RMNH 2UUYA 1O3FA 8GCHG 5C1UA 1DXPA 1YPGH 1LMWB 3KN2A 3M3SA 3ZV9A 1BMAA 2FOAA 1L4ZA 1S0RA 4Q2KA 1CVWH 3F9EA 6CHAC 1O34A 5F03A 4WF8A 3LONA 5A0BA 1OYQA 4JK6A 2QY0B 4Y8ZA 2O8LA 4X8TH 5LGOA 1AUJA 1JIMA 1VCWA 2BY8X 1CHOF 2FZZA 2A2XH 4DCDA 1CT4E 1SLWB 1KXCA 1A5HA 2UWLA 4ABEA 2A31A 1C2JA 3VB4A 5FPYA 2Z3EA 4FVDA 1BTHH 1C1NA 1F0TA 1P01A 4ZHMU 1O3JA 3KF2A 1FMGA 2ESTE 1B5GH 3CS7A 1H9HE 4Y11E 1C5QA 1VJAU 1ELCA 1VCPA 1GJ6A 1Z7KA 4NFEA 4FU9A 3TJVA 4MLFB 3UWIA 2B0FA 1KXBA 1THSH 2ULLA 2J92A 4CREA 1C4V2 2F91A 2G51A 2G5VA 4CR5A 1C1PA 4Y10E 1QL9A 3QO6A 2BVRH 1MUEB 1ZGVA 4U32A 1TPAE 4A6LA 1SGPE 5HM2A 4RSPA 4LK4A 2ZG0H 1WOFA 1K1OA 1TYNA 5HM9A 1BUIA 2A45B 1NFYA 4FUHA 2XC4A 1DFPA 1BA8B 4WMDA 3UOUA 1CA8B 2B9LA 1BHXF 5HYOA 2H9HA 1GBBA 1VITG 1W8BH 4ZXXH 1CA0B 1OSSA 2BZAA 2FI3E 1BMLA 1FY3A 2YOLA 3R0FA 1DT2A 1GHZA 1TNGA 1W11U 1YKTA 1O2ZA 4GHTA 3SV7A 4NGAH 3TK5A 1KXFA 1TFXA 2ZU4A 4TWWA 1GMCG 4NCYA 1DANH 5A8XA 1W2KH 1XUGA 1IAUA 3E8LA 2Z3DA 2BQ7B 1V2JT 2H1UA 3MFJA 5T3HA 1EB1H 3SNDA 5SGAE 5C1XA 1HIAA 2ZHFH 3KEEA 2W7UA 3LJOA 7GCHG 3RLYH 3Q3YA 4BOHA 1FY1A 1P2OA 2GGVB 1SGTA 4MNVA 5A0CA 1C2EA 1DM4B 2AGGX 1JIRA 4MPVA 2STBE 3M7TA 3MTYA 3C27B 3BG4C 1FIZA 3EAJA 2CHAC 3TH3H 3UQVA 3E3TA 1L1NA 1P12E 1YPHC 1QGFA 1MQ6A 2GKVE 4XBCA 5LPFA 1EAUA 4GCHG 1FY4A 2YNAA 4UDWH 1H9LB 4GUXA 1TONA 1T4UH 4KTUA 3SGQE 1ELFA 2ODPA 4ZXYH 1ZGIA 4K69A 3MYWA 1YPEH 2BD7A 1BZXE 4NSYA 1P05A 4IW4E 2ZIQH 3A88A 1AVGH 3ATMA 3PMBB 1GGDB 3GDUA 3UREA 4I7YH 2AGEX 2QV1A 2A7CA 1W14U 1GBAA 4DT7B 1UCYK 4I8LA 1FJSA 1VGCC 1HGTH 2G8TA 4INHA 1JRTA 1JOUB 2GT8A 5L6NH 1O3KA 1YPHE 3E90B 4AYVB 2PSXA 1RJXB 4MNYA 5AFYH 1BTZA 2OC7A 1C4Y2 2BZ6H 1BQYA 5I46H 3ENSB 2DE8A 4D7FA 3O8CA 2ILNA 2GZ8A 3KQEA 1NRPH 2HLCA 2F9NA 5E0HA 4NIWA 3P17H 3SU2A 1ZYOA 2ZHQH 1KIGH 3Q3KA 2BLVA 4D76A 3V12A 3GCOA 1TA2A 5DP8A 2FOCA 1GHVH 4JZ1A 3V0XA 4UFDH 1WCZA 2SGPE 1P8VC 2Z9KA 1MAXA 1K28D 2QAAA 3IWMA 1C9TA 3SJ8A 1ZHPA 4BAQB 1BJUA 1S5SA 3QZQA 1J17T 1Z6JH 2XW9A 2PW8H 3AW0A 3MH7A 3QN7A 3TJNA 1TQ0B 2RA0A 1ZSLA 2GZ7A 1NT1A 4HTCH 3M37A 1AMHA 1N8OB 2PTNA 3Q77A 1A61H 4O03A 7ESTE 2ZFSA 1O2UA 3P6ZB 1OWHA 4FUDA 5TCCA 1GJ7B 2A1DB 1X7AC 3PLPA 3VB7A 2ZU1A 3ZZ3A 3E0NB 1G2MA 1MTNB 1GHBF 4UFFH 5IDKA 1OWKA 2FP7B 4AG2A 3SBKA 1C2IA 3UOPA 2ZZUH 4YOJA 3TGIE 1GVLA 4CRBA 1FIWA 1DSTA 1O38A 1LPZB 3OY6U 1J14A 1L2EA 2FMJA 4NWKA 2W3IA 1O5CB 1SQOA 2F9BH 5FHTA 2BD4A 4ABFA 3OSYA 1QRWA 1DPOA 2C8WB 1ETRH 1QR3E 1AFEH 1P9SA 2EI8A 1O3BA 1ZMLA 3S7HB 1MTUA 4MDSA 3T5FH 1ZRKA 2VGCC 1ZPZA 3ATWA 3LIWA 4X8UH 4JZIA 3ZZ5A 1FONA 2OCVB 3SUEA 1BRUP 4RKOB 1NU7B 1O32A 2FM2A 1O2PA 1TIOA 3I29A 3JZ2B 1QB1A 1IQLA 2ZTXA 4E06H 5C3NA 3MWIU 1BCUH 1DWDH 5EQQA 1KTTB 1GBFA 2WUBA 3TK9A 3ZVCA 5A8YA 3T28A 3BTFE 2QN5T 3PB1E 2KAIB 4Y6DA 3TPIZ 1P57B 5CE1A 1SGCA 3H7OA 2V3OH 4CRDA 1TPPA 4E7RG 1TNLA 2VNTA 1EASA 1BT7A 2XBYA 3RXLA 1O5EH 2JETB 2G81E 4KGAA 1AN1E 3RXKA 1EB2A 3MNBA 1LVYA 1O5AB 1Y3UA 1HAIH 1A5IA 1GVZA 4I33A 1MKWK 1E38B 2QXIA 2WPJS 3SUDA 2CXVA 2GV7A 2ZA5A 2O8UA 3P8GA 3DHKH 3VB6A 3LJJA 3UIRA 1D6WA 1HYLA 3SQEE 5JB9S 5IYTA 2HGTH 1EKBB 1MKXK 4SGBE 4X2YA 1GI9B 1TRNA 4WH6A 2GVFA 2OUAA 1ELBA 1GL1A 3BIVH 4MPXA 4GHQA 2ZQ2A 1BB0B 3O8BA 4B1TA 2P3UB 2PKSC 1IHTH 3PMJA 4CRCA 1W3CA 1UHBB 1TX7A 1TOMH 1SGIB 1TNKA 2QA9E 1V3XA 1V2LT 1L1GA 4NA9H 4FVBA 2FEQH 4B2CA 2AYWA 1BIOA 2D26C 3PTBA 5A2MH 1OYTH 1EZXC 1VCQA 4DW2U 2CF8H 1ZJDA 4YOIA 1DITH 2CMYA 2ZGBH 1IQMA 3SORA 1OP0A 2PGBB 1N6YA 1NPMA 1O2TA 5HGGA 1WTGH 1NC6A 1MCTA 2ZHEH 2ZC9H 3B9FH 3KNXA 1A2CH 1EJMA 3S9BA 1EPTA 2I6SA 3RXIA 1TBZH 1C1RA 1ZR0A 1XVMA 3TNTA 3SHCH 5L2YH 3GY8A 1PPEE 1LQDB 2BLWA 1MMJN 4MG3A 1F7ZA 1N6XA 1S0QA 1KTSB 1Y8TA 3ZZBA 2BB4A 3UPEA 4TPYA 2BMGB 2ZWLH 3Q76A 3RU4E 4A5TS 1C5SA 5EQSA 1IQKA 4KKDA 2Z6BD 4HI3A 1WU1A 2NU3E 4DJZB 3A86A 4X1NU 2TPIZ 1GHBG 2O8MA 3ZZ8A 1Q3XA 1FQ3A 3EA8A 1LHCH 3BTDE 2BVXH 2J34A 4Y7AA 2J4IA 1ZOMA 7KMEH 4X6OA 3MU8A 3GYMA 3KL6A 3TJUA 4K1EA 2AMPA 2LPRA 1AB9B 2QYIA 3U8OH 3G01A 1HAHH 1Z8IB 1LHFH 1P10A 2FDAA 1HPGA 3OYPA 4NIYA 3MHWU 3PO1C 3URDA 2D1JA 4ZHLU 3VB3A 1XUHA 1J15A 4SGAE 1VITF 1THPB 2JH0D 1CGJE 1GI6A 1OX1A 1FXYA 3D65E 1HXEH 1JRSA 1XKBC 3TU7H 1O2LA 5GCHF 3NWUA 3QZRA 2GV6A 1CBWC 1GMCF 1XUFA 1KXAA 4VGCB 1MKXH 1NZQH 4WVPE 1P02A 1RGQA 1MBMA 4H6SB 4BTTB 2VWMA 1SGRE 1JWTA 1ANDA 9LPRA 1IHSH 1F0SA 2OXSA 2C4FH 5C1YA 1Y5BT 1NTPA 2VH0A 1XMNB 4E7NA 1O39A 4AB9A 5JBTA 1PPFE 1O3AA 1WSSH 2NWNA