2FTLE

Crystal structure of trypsin complexed with bpti at 100k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Rigidification of a Flexible Protease Inhibitor Variant upon Binding to Trypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ftlE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ftlE02
1JBUH 3E8LA 1BT7A 2WV4A 2W5EA 3MNBA 1A0JA 1ZMLA 1GHVH 1NU9A 1P2OA 3RXMA 3STIA 4OGXA 2FI3E 4IGDA 4DOQA 1ZHPA 1GHXH 1ZMJA 1V2LT 2D8WA 2OC7A 4K1TA 1QY6A 1PQ5A 3NUMA 3QZQA 3MNSA 4ABGA 2F83A 2H9EH 4K8BA 4NA9H 4IS5A 2H2ZA 3LU9B 1D3DB 2P3FH 3OSYA 3UPEA 1C4Y2 2ZCLP 1YCPM 1NROH 1V2RT 4FUEA 2ANWA 4NWKA 1TBZH 3W94A 1PPCE 1D6RA 3RC5A 4ZAEA 4DT7B 3GCOA 4K2YA 1P0SH 2FDAA 1WOFA 4X0WU 2VVVA 2XTTB 2Z7FE 3SV8A 3A80A 1TRNA 2ZKSA 3LGWA 2SGFE 3BTFE 4GLYA 1UVPA 4FUJA 5E8EH 6CHAC 4WMEA 1HAIH 1NRNH 1EZUC 2F91A 1ZMNA 4I8LA 2Q1JA 4Y79A 2A4OA 4ZKNU 1C5NH 1QTFA 1YPHC 1EAXA 2IN2A 4I31A 4MNYA 1W10U 1O0DH 2B0FA 1GBJA 1KXFA 3SJOA 4F4OC 3QN7A 1GHWH 1NO9H 1SC8U 1FONA 2OUAA 3MU4A 1ZLRA 1PPGE 4IC5A 4X1PU 2W7SA 3JZ1B 3KHVA 1ESBA 3CS7A 4LZ1H 1C9TA 1QRXA 3EA7A 2Z9GA 2PUXB 4GCHG 1A2CH 3F68H 1FPCH 1GI6A 3OX7U 1BTPA 5H4IB 1AHTH 3RXCA 1IQGA 2ZP0H 1K2I1 1E35B 1L1NA 1G2LA 1K9OE 2FOAA 3E90B 1MD7A 2P3TB 3L6PA 1SGTA 4ABEA 1Y3WA 5DP6A 2QIQA 4FUIA 2XCFA 3K65B 1P2KA 1NTPA 1UTNA 4DGJA 2OC1A 5EXLA 2XC0A 1THPB 3K6ZA 5FBEA 5BRRE 2F9PA 2ZU5A 1TOCB 1KYNA 1TPSA 1AUTC 1EAWA 3BTKE 3FVFB 3IITA 1GJDB 5L2YH 1CHGA 1SMFE 1DWEH 3NWUA 5EQRA 3A88A 1DUEA 1GHAF 1EZQA 2FO9A 3TIUA 2ZGCA 1NFXA 1C2DA 2NU3E 2OP9A 2Z9JA 2O8LA 2AIPA 2RA3A 1VJAU 3TLOA 3A8BA 3E6PH 3RXJA 4YZUA 5IYTA 1GG6B 2Y5GA 1O2VA 1TALA 5DKMA 1EZSC 3MMGA 3ZVDA 2QN5T 3SU5A 3KIDU 4MPUA 4KTSA 3HGNA 2ZHWH 1S5SA 3B23B 5T3HA 5DGJA 2JH0D 1HAGE 2Y5HA 1EAUA 3EAJA 3BTQE 1ZZZA 3BIVH 3T2NA 5EU8A 1OWEA 1GMCF 2OCVB 2FTMA 1PQAA 4ABBA 5JPMH 1XUFA 5C5NA 1W2KH 3RXFA 3P92A 2WUCA 1W12U 2HRVA 3ZV9A 2A7HA 4ISOA 1UTOA 2BZAA 3T25A 5LPRA 2Y6TA 9ESTA 1L4DA 1P01A 2VGCC 3M7QA 1YPGH 1VR1H 3SU6A 1K28D 3RMOH 5AFYH 1MTNB 2HNTC 2BY9X 2THFB 3GY6A 4BAKB 4INLA 3LGTA 4K1SA 1OYTH 1C1QA 3U8OH 2QXGA 2H6MA 4I8GA 1MCVA 2QXHA 1YPEH 2Z3EA 3H7OA 3NK8A 1PPEE 1HIAA 2PSXA 1V2PT 1LQDB 4UE7H 4CRAA 2BQ6B 1CA0C 3GY4A 5FX6A 6LPRA 1C5MD 4AG1A 1HJAC 5EPNA 1YPHE 1CBWC 3AW0A 2D1JA 5HYOA 3VB6A 2QV1A 5GCHF 1O5FH 3D23A 2CHAC 3DFJA 3A87A 1NRRH 1P09A 1QHRB 1NS3A 1BMLA 1C1RA 1O3EA 1PQ8A 1FJSA 3ODFA 1TX6A 4JZDH 1T8MA 1TAWA 4GHQA 3PMJA 1BJVA 2VU8E 2NU2E 1O34A 1NZQH 1P3CA 2DUCA 4ABIA 3PO1C 1C1PA 3RXKA 1ZSLA 4XSKU 1S81A 1EXFA 2FOEA 2G52A 5JYIA 1HBTH 4BXSA 2J9NA 1HPGA 1SG8B 1KTTB 2FYRA 1O3DA 4LXBH 3SOSA 2GDEH 2SGPE 1TRMA 4M7GA 1C1WH 1DY9A 1AUJA 3GY3A 1D6WA 4KKDA 4KTUA 2PR3A 4BAQB 3IWMA 1WTHD 1PPHE 2ZGHA 4A1XA 1ZGVA 2WPIS 5FPSA 4AN7A 4D76A 2ZECA 4TY6A 1BBRK 1CGIE 2QF3A 1DITH 2HGTH 3MU0A 1TNJA 2LNCA 1GI7B 3SJKA 1WBGB 4FUDA 5FHTA 1Y59T 1AZ8A 2SGEE 1P10A 3VXEH 1OSSA 3SI4H 3RXQA 5T6DA 1AFEH 1BB0B 2H9TH 1NC6A 3SUDA 3QWCH 3RXPA 3PB1E 4SGAE 2XW9A 2ZHQH 1LTOA 1YPJH 3A7TA 1GJAB 4ISHH 2G55A 1A61H 1TPAE 1L1GA 1SHHB 2VIVA 1S84A 4MQAA 4WXIA 3BTGE 2J92A 3SU0A 1O2TA 3M3VA 1B5GH 2WPMS 2OBOA 3A7ZA 3E0PB 2BDBA 4PROA 1FY4A 1A0HB 1ELDE 1TA6A 1V2NT 2CXVA 2HNTE 3TJOA 3KGPA 1P03A 4ISIH 4NCYA 4H6TA 1RGQA 3LGIA 1LO6A 3ZZ8A 3ZVAA 1IQFA 4K3JA 1HXFH 1KDQB 2BZ6H 1O3CA 4NA7A 1BRUP 1TRYA 2GMTC 1GI3A 5J4SA 3MNXA 1GBTA 2EEKA 3S0NA 1GBHA 4E06H 1AVWA 1V2QT 2O8UA 1CA0B 3PYHA 1RD3B 4BTUB 4AORA 4A92A 1IQIA 1MAYA 1VCQA 1ZGIA 2M5TA 4MNWA 4CRCA 5EXNA 1BTUA 1C1SA 1ZHRA 1O33A 2C90B 3O8RA 1GBIA 3TH3H 4KGAA 4YLUA 2G5NA 5FBIA 3BF6H 1GJ4H 1ELCA 1NT1A 4D9RA 3OY5U 1V6DA 4OS5A 1HAPH 2FLRH 5I25A 2JETC 1TONA 4I8JA 6GCHF 5HM2A 2STAE 2VB0A 1EP6A 2ZDAH 4ZUHA 3ZYEA 2A5IA 1YPLH 3GISB 1QJ6B 2YNAA 1J16A 1AE8H 2A2QH 1CO7E 4SGBE 1ETSH 1C5UA 1P2IA 1SB1H 1BMNH 1OP2A 2EI8A 1FV9A 4HFPB 3ITIA 5JDUB 4GAWA 3TNTA 1SFIA 2IOTA 1V2OT 2Y7ZA 1UCYH 1TLDA 2R3YA 1IQJA 1UO6A 1G3CA 4E05H 4ESTE 4IC6A 3H5CB 4HGCA 4O3TA 4Q7ZA 1DLKB 1XX9A 1QB1A 1TQ0B 3SNCA 3UFAA 1SGQE 1ELBA 1MUEB 2PKSC 4OGYA 1SGDE 5DP4A 1GL0E 2A32A 1A5IA 1WYKA 4B2BA 1GDUA 4UONA 1HUTH 3GY2A 1O38A 2BOKA 1VZQH 1PPBH 3RC6A 1V2MT 4NGAH 1MKWH 4NIXA 1BTYA 5EG4A 1K1IA 5E0JA 1F0RA 1EB2A 1A0LA 1B0FA 4B2CA 1C2LA 1ANBA 1O3NA 5EXMA 4Z0KA 3SUFA 1ZJDA 5E2PA 2J94A 2R0KA 2XC5A 2WV5A 3RXLA 2ZFPH 3TGJE 3MYWA 1P3EA 2ODQA 1O3MA 4X1SU 1GJCB 1O30A 1W7XH 3QGNB 1DWDH 1AE5A 1K1MA 1XXDA 3U9AH 1J9CH 2XBYA 1P02A 3A84A 3ATKA 1QL9A 4ABFA 1UK4A 1GHAG 3GCHB 1EP5A 1ZRKA 1G30B 3SHCH 1E36B 1VITG 2ZFSA 1O2RA 1O37A 3HK3B 4FUFA 1MCTA 4WMFA 1A4WH 1JOUB 1V3XA 2QXIA 4FUBA 4X2XA 4CHAC 2FOMB 1Z8RA 1KLIH 2ZDNA 1P04A 4WH8A 4BAOB 5G4BA 2STBE 1GJBB 4AFUA 4NIVA 1TGBA 4IBLH 3TJNA 1GBKA 5LH8A 1O39A 1FAKH 1AI8H 3UTUH 2GMTB 1DT2A 1W8BH 1J8AA 1S0QA 1G3BA 1VJ9U 2AGGX 2H5CA 3KN2A 4D8NA 6ESTA 1GJ6A 1HLTH 2BD3A 3ZZDA 1QBVH 3BEUA 5E2OA 1OYQA 3D65E 1GPZA 2ESTE 2ZHEH 2OTVA 2A4QA 1UTKA 1O5BB 1EB1H 3A7YA 3B9FH 3STJA 1SGRE 1H9LB 4E7RG 1GL1A 2GP9B 2Y82A 4YT6H 4DVAU 1WUNH 1GHYH 3ZZ9A 1O2WA 5CHAC 1FIZA 2FYQA 1V2UT 2JETB 1GVLA 1MBQA 1O3BA 3TGIE 3SU2A 1Y5AT 1BTHH 1O31A 1EJNA 4FUHA 1N8OB 1YCPH 3D62A 5A09A 1DXWA 4JK6A 1EUFA 1QA7A 1ARCA 3A83A 5C1UA 2HWLB 1EPTB 1EASA 1GHBF 1D3PB 2FOHA 3LIWA 4X8UH 3FZZA 1ZHMA 1P11E 2BDGA 4ZMAH 1AFQC 1XMNB 2A7CA 1VGCB 1AB9B 2LPRA 5GJ4B 1RJXB 4AFZA 4X2VA 2GT8A 1YKTA 2VIQA 2P8OB 3A7XA 4IMZA 1WU1A 1B7XB 2IJOB 1UVSH 2DE8A 1FPHH 4ISLA 4TYDA 3RLYH 2TIOA 3M3SA 5DP7A 5A2MH 3P17H 3GCTF 5CMXH 4BOHA 2BLWA 1KSNA 4JZ1A 5L30H 3UQOA 2AMQA 3FAOA 3MH5A 1UTQA 2NU1E 1AQ7A 1NRSH 2ZU1A 1C5TA 2ZC9H 4A6LA 1SGPE 2VIOA 1Z71A 2I6SA 2FPZA 3DUXH 1OKXA 3AAVA 1C1UH 1L4ZA 3OY6U 1ARBA 3KEEA 3RXBA 3ZVEA 5AF9H 1SQOA 1JIRA 4KELA 2NU4E 4DJZB 3S7HB 3PMHB 3HKIB 4I7YH 1S85A 5DJ7A 1KXEA 2VIPA 4AYVB 2P93A 3KCGH 4B75A 1LHFH 1OWDA 4XFQA 1YPKH 4UDWH 2VNTA 2FTLE 1P2NA 8LPRA 1O2JA 2Y80A 2A5KA 3GDVA 5EQQA 1ELGA 3LH1A 1UTMA 4B73A 1IHSH 1HDTH 1FN8A 1Z8GA 2FOBA 4CHAB 1FY5A 2ASUB 3RDZA 2TGPZ 4AB9A 3TJUA 1BZXE 1C2KA 2GT7A 1F5LA 1P9SA 1W0ZU 1JRTA 5JBCS 1C1VH 1GBMA 2Z9KA 3S9AA 5BPEA 4CBOA 1EX3A 1A1RA 4U30A 1IQEA 4UFDH 5C5OA 1LVOA 2VIDA 2DE9A 1DSUA 2VINA 3D49H 1N6YA 2B5TB 3TITA 5JBAS 2BVXH 2EA3A 4BAHB 1F5RA 1RIWC 5DP3A 4FU7A 3RXUA 3PLPA 1P06A 1RTKA 1DS2E 2P94A 1NY22 3K9XB 2KAIB 3PV4A 4LOYH 5DP9A 2ZTXA 1QB6A 3MTYA 2ZU2A 2K1QA 3RXRA 2A0QB 2PGBB 1TIOA 1YGCH 2GV7A 4X6PA 3MH4A 1TPOA 3PM3A 4ZXXH 1T8NA 2O9QA 2OXSA 2XRCA 4OS6A 4Y71A 3SU3A 3TK5A 1HAHH 1NN6A 4FVBA 2V0BA 1AIXH 1G3EA 1DVAH 2H9HA 1RFNA 2FM2A 1ZTJA 4D9QA 5F8ZA 1HV7A 4K60A 1CQQA 1AFQB 1GGDC 2PV9B 1T4VH 1GBEA 2BDYA 8KME2 1GVZA 2JH6D 1TMBH 1TOMH 2CV3A 5FXLA 3MNCA 1O2LA 4R0IA 3MH6A 4MPVA 5GIBA 2R2MB 4GVUA 2AGIX 3M7TA 3GYMA 1NRQH 4BTIB 1T31A 1DICA 4J1YA 3ZZ6A 2UWOA 4WMDA 1BUIA 2HLCA 1SGEE 4LZ4B 2B7DH 4RKJB 5JB9S 1TMTH 1LKBA 2ZO3H 3RXVA 2ZTZA 5ETXA 1F92A 3T29A 4FUGA 1P2MA 1V2KT 4H6SB 1IQNA 1THRH 2HPPH 4Y0ZE 5GXPA 1UK3A 5ABWA 1NM6A 2ZNKH 1SFQB 1O5CB 1DOJA 3M7UA 1O3OA 2I6QA 4B2AA 3AAUA 2BLVA 3MFJA 2FI5E 2ZFTA 1NESE 3ZZBA 3G01A 2TPIZ 2BDCA 2GKVE 1EJMA 1J14A 1OS8A 1E38B 1O5GH 3VEQB 4FUCA 4TPIZ 6CHAB 1P12E 5A8YA 1F0SA 1C2HA 4I8KA 3ZZ7A 3UQVA 5C1YA 1LVBA 1QQUA 2ZGXH 2RG3A 1WCZA 4R8TB 1DUAA 1J15A 1MTWA 1S0RA 3EGKH 1O3JA 3SU1A 3VB7A 1ID5H 3HGPA 1QJ1B 4VGCC 1GCTC 1WAYB 1FI8A 3P8NA 4AFSA 3BTWE 3I78A 2UWLA 5GPIB 1XUIA 2BD9A 2OLGA 4ABDA 1Z7KA 2BXTH 1HGTH 9LPRA 1LPZB 1KIGH 1GBCA 4NA8A 1RIWB 1SGNE 1AKSB 1HYLA 1NFWA 2ZU4A 5FX5A 1TABE 2B8OH 5F03A 1C5OH 2ZI2H 4MPXA 5EW1H 2Y5FA 2J4IA 2G81E 2W3IA 1O3IA 1C4V2 3LC5A 1P2JA 4UD9H 3RC4A 1ELVA 1TNLA 3K2UA 3UOUA 1TGCA 4RKOB 2AGEX 3SNEA 1YLCA 2V6NA 1C2JA 2VH6A 3LJJA 3LC3A 1UCYE 4TWYA 3TK9A 2TGTA 2Z9IA 5E0HA 1UHBB 3RU4D 3KQBA 2XCNA 1KXDA 1O2QA 1TGTA 5ESTE 3KQEA 1NFYA 1XVOA 4NIWA 2ULLA 2ZQ2A 5GWZA 2A4RA 3BIUH 2FXRA 4TY7A 1GGDB 1VCPA 1GHZA 1XUGA 2ZF0H 1GMDG 2ZIQH 3I29A 3F9HA 1SLVB 3UREA 3S69A 4X1QU 1MKWK 1UJ1A 2ZFRH 4X8VH 4ZROA 3A85A 1G36A 1Q3XA 5A8ZA 1YBWA 3RU4T 2ANMH 3DHKH 1S6FA 3M37A 1UMAH 4JCNA 3MU5A 3ZZ4A 1UVOA 3ZVBA 2J34A 1Z1IA 2C8ZB 3TNSA 3MU8A 1BBRE 3E0NB 2YOLA 2F9BH 1TBRH 1Y8TA 2ZGJA 1DXPA 1O3FA 2O8WA 1FMGA 3PTBA 3P8GA 2AIQA 5TCCA 3E1XB 1DY8A 1K1OA 4UEHH 2WPLS 4QT8C 4BTTB 3RMNH 3RXEA 2F9OA 2XWAA 3Q3YA 3R3GB 2VGCB 3KF2A 2A2XH 3ZVFA 3DD2H 4B76A 3HKJB 4F49A 7LPRA 2ILNA 3ZVCA 2G51A 2WPJS 2GTBA 1ETTH 3GCNA 1XUJA 1BHXF 4I33A 3L3TA 3SQHE 1O2YA 3ZZAA 3SGQE 4NWLA 4Y6DA 8GCHF 1WTGH 1C2GA 2D26C 2ZPRA 3SNDA 1C5RA 1OPHB 4BNRA 3O8CA 1L0ZA 4TWWA 1M9UA 1SOTA 1ESTA 1XXFA 1T32A 1C1NA 7ESTE 3E91A 2CN0H 1O5DH 1AZZA 1Y3YA 3BEIB 3HATH 1S6HA 3DT0H 3M36A 1GBFA 5L6NH 3PWCA 2CGAA 4AG2A 4JK5A 2CF8H 2V35A 4MVNA 1G37A 1KY9A 1HAVB 1HJAB 1QIXB 1CBWB 2GGVB 4I8HA 3SV9A 1GCTB 4INHA 2FOFA 2BM2A 5SGAE 2G4TA 3VGCC 3M35A 2RDLA 3KL6A 3ZVGA 1CGJE 2CHAB 4Y76A 3UIRA 4DIIH 1ANDA 1GBLA 3P8FA 4D7FA 4OS2A 4B71A 1HJ8A 5L2ZH 1ETRH 1GI0A 2BX3A 3U1IB 1GI1A 1W3CA 5JB8S 4RSPA 1DANH 1O3AA 4Q7XA 1SGYE 3RM2H 3GICB 4DW2U 1YCPK 1PFXC 2RA0A 7KMEH 1CHOF 3PO1B 2WPKS 2Y81A 2F9VA 1YPMH 1ZYOA 1YM0A 4O97A 4XOJA 1AY6H 2ZGBH 3EA8A 5AVDA 3L33A 2BDHA 1VITH 1GCDA 3IG6B 3TVJB 3S9BA 1C1MA 1NFUA 2J2UA 4KP0A 2GX4A 1IQKA 2QXJA 2GCHF 1C5XB 1BCUH 1MKXK 1W13U 3LT3A 4WWYA 1LHEH 3U8TH 1K21H 2ZDVH 1S83A 2VWOA 1JXPA 3SNBA 3UNRA 2AS9A 1O36A 2ZA5A 1TNKA 2BD7A 4JYVH 1T8LA 2P59A 1O2SA 4FXGH 1BDAA 4THNH 2O8TA 1C5VA 4XBDA 5FAHA 3CP7A 3S7KB 5F6MA 1TMUH 3E16B 3T28A 4XBBA 1TQ7B 2BHGA 4MNVA 4CR5A 3A7VA 1NPMA 3AVZA 1ACBE 3QDZB 1HAZB 1O2HA 2H1UA 4Y8XA 3SJ9A 1OWHA 4XE4A 1BBRH 1BRAA 1AWFH 3V7TA 2WINI 3PMBB 1CT4E 1TX8A 2R2WU 1LHDH 2QA9E 2ZHDA 1FN6A 2Z9LA 4Y8YA 2PW8H 5LPEA 3UOPA 2ZFQH 1K1NA 5T6GA 2SNWA 1LHGH 4GHTA 5C67A 3ATWA 1OP8A 3ELAH 1QRWA 3QO6A 3CS0A 1OOKB 3KQCA 3OYPA 5FCRA 2AMPA 5C1XA 1H9HE 2GZ7A 2OC8A 4YOJA 2YNBA 2C93B 2C8YB 5A0AE 1ZTKA 1LVMA 3BG4C 2EI7A 3RXOA 4A1TA 1AWHB 1MBMA 2WYJA 2SGDE 1ZR0A 2PTNA 4X6NA 1BMAA 2BB4A 1BJUA 2JH5D 1ELAA 2RCEA 1Z8JB 3TGKE 1CA8B 1SPJA 1BQYA 4DURA 1O35A 1T4UH 4X8SH 1HFDA 1F0TA 2ZCHP 2FP7B 1IAUA 1K1PA 1XKAC 1ZJKA 1MU6B 1EQ9A 2FEQH 2V3OH 4UFFH 1ESAA 1XUKA 2JKHA 1CT2E 1GMCG 1N6XA 3Q3XA 3A86A 1E37B 1TFXA 3F9GA 1O3GA 3A81A 1QB9A 2HOBA 4ABAA 3GY7A 1TWXB 4JZEH 3SGAE 5K7RA 5EPYA 1O3LA 2HVXA 1MH0A 1YLDA 2BTCE 2QAAA 3BG8A 1DFPA 1EKBB 1TB6H 3R0FA 3V0XA 1O5EH 3S9CA 2V3HH 3LPRA 2FX6A 1U6QA 2BXUH 1P9UA 3RMMH 3A8DA 1CT0E 1GJ9B 3PROA 1A5HA 1P8VC 4BANB 1ABIH 1ELTA 4K1EA 2Z3CA 3FP7E 1AVXA 1C2FA 1C5ZB 1SLUB 1CSOE 3N7OA 4MLFB 1MTSA 4AB8A 4XBCA 1KDQA 1P05A 1ZPCA 3BEFB 1GBAA 3UR6A 3MO3A 1DDJA 2F3CE 2W7UA 1QR3E 4U01A 4WH6A 2A4GA 3A7WA 2PKSB 5GCHG 4ZKRU 2ANKH 1A7SA 1Y3VA 2PKAA 2BVSH 1EJAA 1FY3A 1PPFE 3UUZA 3SN8A 3BTME 5EW2H 1FY8E 4LK4A 2BLQA 4CH8B 1VCWA 2PSYA 1GG6C 1HIAB 4XDEA 3M61U 2BDIA 3EDXB 3QTVH 2AMDA 1O3KA 2AEIH 4NIYA 2O8MA 1FY1A 3QZRA 3DA9B 2C3SA 2BOHB 1C2EA 2FLBH 2G4UA 4IN1A 2BY5X 3U8RH 2BD4A 1XUHA 1W7GH 1UTPA 3ZV8A 4IMQA 2C8WB 3B8JA 4MG3A 1TX7A 3SGBE 1B0EA 1WQVH 2CF9H 2P95A 1GI9B 1SSXA 4CRFA 3Q77A 1O2KA 2ALPA 1J17T 4O03A 1LMWB 1QBNA 1AD8H 2ZU3A 1V2ST 2FOCA 1F0UA 4WF8A 1FZZA 2BX4A 3MOCA 1Y5BT 1MTNC 5PTPA 3VB4A 3VXFH 3P70B 3BG4B 1LPGB 1GVKB 1O2GH 3LGVA 3K6YA 2A45B 1BIOA 3QK1A 1DWCH 2BY6X 1V2TT 5AFZH 2CJIA 3RXIA 3RXGA 1G32B 1KXCA 3Q76A 3FZDA 1K1JA 1C1OA 2BYAX 4CH2B 1FLEE 4MDSA 2GD4B 1CU1A 2FOGA 1C2IA 2J95A 3MHWU 4DG4A 5CHAB 2ZZUH 2Z3DA 3DFLA 3RUOA 2ODYB 2OINA 3V3MA 3SU4A 2AYWA 2ZPSA 1EAIA 2FS9A 3RXTA 4JMYA 3PLKA 5T6FA 3PMAB 4A1VA 5TCAA 1EATA 3UWIA 8GCHG 4YM9A 4MNXA 1BTWA 3ZYDA 3AASA 3KNXA 1D3QB 1O5AB 1V2WT 1ELEE 4RN6A 3BV9B 4GSOA 1GWAA 2TBSA 2XBXA 1W11U 2GZ9A 2C8XB 1SI5H 4NSYA 5DO4H 3SUGA 3SUEA 1L2EA 2VWLA 4BXWA 1EZXC 3RM0H 2UUYA 1DLEA 2GV6A 2SFAA 3RXAA 1FUJA 1SGIB 3U1JB 3JZ2B 3OU0A 3Q00A 2P16A 3AW1A 3EA9A 1C5YB 3GYLB 4ZHMU 2FIRH 3HPTB 1VITF 4Q2KA 4Y7AA 3PTNA 3V12A 3BTTE 3GDSA 3KQDA 3NXPA 1PPZA 1P2QA 2G5VA 4K5ZA 5E0GA 4YO9A 1MZDA 2QCYA 4GUXA 1S82A 5DP5A 6GCHG 1DWBH 2FX4A 2G8TA 1OX1A 3ZZ3A 1ZOMA 1BRBE 2PGQB 1CHOG 3SZNA 3F9FA 2P3UB 1D9IA 7GCHF 2PUQH 1A3BH 2Q6GA 1K1LA 1HAYB 1WSSH 1QCPA 4CRGA 1EPTA 1L1JA 2VWNA 3NCLA 4Q80A 1FIWA 3EQ0H 2R3UA 1C4U2 4MPWA 5A0CA 2GCHG 3QX5H 4AFQA 3QTOH 1Z1JA 2GVFA 1HRTH 2ODPA 3SBKA 4E7NA 3RMLH 3F9EA 4J2YB 4BAMB 2SGAA 1AU8A 4NFFA 1V2JT 4FU8A 4X2YA 3TU7H 1H9IE 1OWKA 1GI4A 4OS1A 1O2ZA 3FFGA 4DY7B 3QUMP 3VB5A 5LGOA 1AVGH 3W95A 1GI5A 4UFEH 4CREA 1WQSA 3WY8A 3NPSA 1TNIA 3VB3A 4ABJA 2UUJB 4JYUH 1BA8B 1H8DH 2Z6BD 2PHBA 5A8XA 1XM1A 1TNGA 1AMHA 1G3DA 3M5OA 4WVPE 1SGCA 2ZCKP 4Y11E 1UTJA 3VPKA 4K8YA 1HAOH 4OS4A 1QQ4A 3LOXA 2BQWB 2OQUA 4A7IB 4AGJA 1GMHF 2HNTF 1Q2WA 4H4FA 5HXFA 2UUKB 5A0BA 1C2MA 2ZHFH 1DX5M 1KXAA 2HALA 1GJ5H 3RXSA 2XBVA 2ZFFH 1FAXA 4B74A 1TBQH 3TK6A 3SW2B 3U69H 1QJ7B 4U2WA 1LVYA 3SORA 3O8DA 1T8OA 2A5AA 3NKKA 1H4WA 4YOIA 1H1BA 3M5NA 3QGJA 1Z6EA 1AGJA 1HB0B 4GPGA 1C5LH 1Y5UT 3I77A 1Z6JH 4ZXYH 1C1TA 4I32A 1ANEA 1IQLA 1UCYK 1O2PA 3FANA 1FXYA 1GDQA 1OP0A 2FMJA 3TH4H 1RRKA 1CGHA 3T62A 1KLTA 2J38A 3UR9A 1YYY1 1ZSKA 5LPFA 1KTSB 3SO3A 2A7JA 5F8TA 1HJ9A 1IHTH 3MO6A 1NRPH 3ATIA 2BLOA 2EI6A 2GZ8A 2VH0A 2NU0E 1QGFA 2WUBA 1G2MA 3GOVB 2A31A 4IW4E 2QGRA 5C20A 5B6OA 1X7AC 5FPYA 1LQEA 4X6OA 1A46H 2UUFB 2TGAA 5K0HA 2ZDLA 3O8BA 5ESBA 3U98H 1UVUH 1P57B 4AYYB 3UNQA 2XC4A 4JZIA 3FP8E 4CRDA 3P8OA 1MMJN 1C5PA 3SJIA 1TGNA 4Q7YA 2KAIA 1JMOH 1THSH 1SLXB 4UFGH 1GI8B 1MAXA 5DP8A 2NWNA 1UVTH 3M3TA 2SNVA 1GJ7B 2ZTYA 2VJ1A 1H8IH 3RU4E 3A82A 4MTBA 2Q6FA 4A5TS 3BN9A 1W0YH 3RLWH 1GHBG 1RXPA 1G9IE 1V2VT 2IPHA 3PWBA 1GDNA 3V13A 3QLPH 1C5SA 2A1DB 4GCHF 5I46H 2XWBI 1F7ZA 2CMYA 2BY7X 4YLQH 4TPYA 1BTXA 1SQAA 2VVUA 2SGQE 5EODA 5IDKA 1MZAA 1ZPZA 2F9NA 4CRBA 1SGFA 1HAXB 4Y8ZA 1ZPBA 1BITA 4NG9H 1MQ6A 1WV7H 3GCHC 3OTJE 4K69A 3TJVA 2BDAA 3EYDA 3H7TA 2QY0B 3GCTG 3M5MA 3F6UH 2GCTC 2ZPQA 4ZKOU 3ATLA 4U32A 4X8TH 4ZH8A 2FI4E 1PYTC 5DG6A 1C5QA 1E0FD 1Q31A 4ASHA 2C4FH 3RXHA 3EE0B 2BD5A 4VGCB 1HNEE 2ZDMA 1Y3XA 3GY5A 1CVWH 1TPPA 4JYTA 1SVPA 1MU8B 1C9PA 1DSTA 3ZZ5A 3SV6A 5AHGH 3E3TA 4HTCH 1FDPA 4X6MA 3URDA 1SGFG 4FU9A 1ZTLA 3FP6E 1QNJA 4WXVA 3MO9A 2UWPA 4Z6AH 2ANYA 4JZFH 3SV2H 3TPIZ 2PKAB 1TA2A 4WY3A 2BVRH 3RP2A 3T5FH 1RS0A 1TNHA 1QBOA 2PFEA 3F1SB 3P6ZB 4HI3A 2AFQB 5FCKA 3UY9A 2BD2A 1OWJA 1OWIA 2EC9H 5F8XA 4ISNA 1O2XA 1YP9A 3SI3H 1EOLA 1MTVA 4O3UA 3LKWA 1E34B 4YT7H 1BOQA 1DM4B 1HXEH 1ZSJA 5JBBS 2H5DA 2QF0A 3T27A 3ZZCA 3ENSB 2AERH 2VIWA 5TJXA 2FESH 1EOJA 3A8AA 1N8OC 5JBTA 1F5KU 5J4QA 4DIHH 2FODA 1EPTC 1OXGA 2OQ5A 2OC0A 1CE5A 1AN1E 3TH2H 1MQ5A 2QYIA 1SL3A 5EOKA 1VGCC 1FQ3A 2PWXA 1AB9C 1O2NA 1JWTA 3VFEA 2P8OC 1LPKB 4CR9A 4DCDA 4FVDA 2BD8A 3UNSA 3LGUA 2QC2A 1AKSA 3MH7A 3SNAA 1SBWA 3BTDE 4AGKA 2R0LA 1LCYA 2FZZA 1PQ7A 3P95A 3BSQA 1O32A 1D3TB 2R9PA 1PYTD 1O2MA 1YC0A 4Y0YE 1AO5A 3MI4A 2TGDA 1KXBA 2GDDA 1BHXB 1DE7H 2VWMA 4D7GA 8ESTE 4ZHLU 1YF4A 2FS8A 1IQHA 1ABJH 2WPHS 1ELFA 4AZ2B 1DPOA 2VVCA 4NZLA 5GDSH 1LHCH 4IN2A 5HM9A 1O3PB 1UHBA 5EQSA 3URCA 3C27B 2XXLA 1A5GH 1KLJH 3LJOA 3M5LA 3HK6B 5HGGA 2XNIA 4ABHA 1RTLA 4OS7A 2W26A 1A3EH 3LDXH 4KTCA 3PLBA 1JRSA 2ZDKA 3ATMA 1ZRBA 2F9UA 1GJ8B 3ODDA 1SLWB 2GCTB 1TGSZ 2B9LA 4Y7BA 4O9VA 1BTZA 2Q6DA 1LKAA 3UWJH 1UK2A 1O3HA 1QA0A 3NZIA 4X1NU 4ZHAA 5FPTA 3LH3A 3RXDA 3A89A 1QFKH 1GBBA 4YOGA 2XBWA 3VGCB 2D2DA 1MTUA 1C5WB 2HPQH 4INKA 1TE0A 5C3NA 2TRMA 1JIMA 4YESB 5CE1A 1Z8IB 2ZWLH 1LDTT 2BQ7B 1RTFB 3GY8A 1QRZA 1ANCA 4X1RU 1GMDF 3LONA 1SR5C 1NU7B 1FNIA 1HCGA 3A8CA 7GCHG 2ZG0H 3SHAH 4NFEA 4X2WA 1XVMA 3MWIU 1GBDA 3SJ8A 3ESTA 1W14U 1INCA 2BMGB 4Y10E 4ZKSU 1QURH 2Y7XA 4AX9H 1K22H 3C1KA 4WJG2 2ZQ1A 4HZHA 1O2IA 1SHYA 1SQTA 3LGYA 3T26A 2ALVA 2PTCE 3BTHE 4B1TA 5DK1A 2OBQA 1BMMH 5EGMA 1ORFA 1O2OA 1T7CA 2Z94A 4AOQA 2BY8X 1O2UA 1N1LA 2AH4X 3SQEE 1SOZA 1UTLM 4NSVA 3SV7A 1HAVA 5C2ZA 5DPAA 3MU1A 1PJPA 3BTEE 2OD3B 4CBNA 1D4PB 1QL8A 3Q3KA 1IOEA 4NZQA 2XYAA 4H42U 2G00A 3GDUA 4YTAA 1F2SE 1GMHG 2WYGA 2W3KA 1BRCE 1IQMA 2PLXA 1MD8A 5HMAA 1XKBC 1MKXH 1Y3UA 1TYNA 2ZEBA 3CENA 1GI2A 2FWWA 1QL7A
chains in the Genus database with same CATH superfamily
1JBUH 3E8LA 1BT7A 3F0PA 2WV4A 2W5EA 3MNBA 1A0JA 1ZMLA 2KM0A 1GHVH 1NU9A 1P2OA 3RXMA 3STIA 4OGXA 2FI3E 4IGDA 4DOQA 1ZHPA 1GHXH 1ZMJA 1V2LT 2D8WA 2OC7A 4K1TA 1QY6A 1PQ5A 3NUMA 3QZQA 2KFWA 3MNSA 4ABGA 2F83A 2H9EH 4K8BA 4NA9H 4IS5A 2H2ZA 3LU9B 3W1EA 1D3DB 1UW7A 2P3FH 3OSYA 3UPEA 1C4Y2 2ZCLP 1YCPM 1NROH 4ASUD 1V2RT 4FUEA 2ANWA 4NWKA 1TBZH 3W94A 3GS9A 1PPCE 1D6RA 3RC5A 4ZAEA 4DT7B 3GCOA 4K2YA 1P0SH 2FDAA 1WOFA 4X0WU 3SYJA 2VVVA 2XTTB 2Z7FE 3SV8A 3A80A 1TRNA 2ZKSA 3LGWA 2SGFE 2QF5A 3BTFE 4GLYA 1UVPA 4FUJA 5E8EH 6CHAC 4WMEA 1HAIH 1NRNH 2CK3D 1EZUC 2F91A 1ZMNA 4I8LA 2Q1JA 4Y79A 2A4OA 4XD7D 4ZKNU 1C5NH 1QTFA 1YPHC 1EAXA 2IN2A 4I31A 4MNYA 1W10U 1O0DH 2B0FA 1GBJA 1KXFA 3SJOA 4F4OC 3QN7A 1GHWH 1NO9H 1SC8U 1FONA 2OUAA 3MU4A 1ZLRA 1PPGE 4IC5A 4X1PU 2W7SA 3JZ1B 3KHVA 1ESBA 3CS7A 4LZ1H 1C9TA 1QRXA 3EA7A 2Z9GA 2PUXB 4GCHG 1A2CH 3F68H 1FPCH 1GI6A 3OX7U 1BTPA 5H4IB 1AHTH 3RXCA 1IQGA 3UB0A 2ZP0H 1K2I1 1E35B 1L1NA 1G2LA 1K9OE 2FOAA 3E90B 1MD7A 2P3TB 3L6PA 1SGTA 4ABEA 1Y3WA 5DP6A 2QIQA 4FUIA 2XCFA 3K65B 1P2KA 1NTPA 1UTNA 4DGJA 2OC1A 5EXLA 2XC0A 1THPB 3K6ZA 5FBEA 5BRRE 2F9PA 2ZU5A 1TOCB 1KYNA 1TPSA 1AUTC 1EAWA 3BTKE 3FVFB 3IITA 1GJDB 5L2YH 2XNDD 1CHGA 1SMFE 1DWEH 3NWUA 5EQRA 3A88A 1DUEA 1GHAF 1EZQA 2FO9A 3TIUA 2ZGCA 1NFXA 1C2DA 2NU3E 2OP9A 2Z9JA 2O8LA 2AIPA 2RA3A 1VJAU 3TLOA 5GNDA 3A8BA 3E6PH 3RXJA 4YZUA 5IYTA 1GG6B 2Y5GA 1O2VA 1TALA 5DKMA 1EZSC 3MMGA 3ZVDA 2QN5T 3SU5A 3KIDU 4MPUA 2IJD1 4KTSA 3HGNA 2ZHWH 1S5SA 3B23B 5T3HA 5DGJA 2JH0D 1HAGE 2Y5HA 1EAUA 3EAJA 5DN6D 3BTQE 1ZZZA 3BIVH 3T2NA 5EU8A 1OWEA 1GMCF 2OCVB 2FTMA 1PQAA 4ABBA 5JPMH 1XUFA 5C5NA 1W2KH 3RXFA 3P92A 2WUCA 1EFRD 1W12U 2HRVA 3ZV9A 2A7HA 4ISOA 1UTOA 2BZAA 3T25A 5LPRA 2Y6TA 5C0TA 9ESTA 1L4DA 1P01A 2VGCC 2KR7A 3M7QA 1YPGH 1VR1H 3SU6A 1K28D 3RMOH 5AFYH 1MTNB 2HNTC 2BY9X 2THFB 3GY6A 4FETA 4BAKB 4INLA 3LGTA 4K1SA 1OYTH 1C1QA 3U8OH 2QXGA 2H6MA 4I8GA 1MCVA 2QXHA 1YPEH 2Z3EA 3H7OA 3NK8A 1PPEE 1HIAA 2PSXA 3NRLA 1V2PT 1LQDB 4UE7H 4CRAA 2BQ6B 1CA0C 3GY4A 5FX6A 6LPRA 1C5MD 5C0UA 4AG1A 1HJAC 5EPNA 1YPHE 1CBWC 3AW0A 2D1JA 5HYOA 3VB6A 2QV1A 5GCHF 1O5FH 3D23A 2CHAC 1E79D 3DFJA 3A87A 1NRRH 1P09A 1QHRB 1NS3A 1BMLA 1C1RA 1O3EA 1PQ8A 1FJSA 3ODFA 1TX6A 3ZIAD 4JZDH 2F43B 1T8MA 1TAWA 4GHQA 3PMJA 1BJVA 2VU8E 2NU2E 1O34A 1NZQH 1P3CA 2DUCA 4ABIA 3PO1C 1C1PA 3RXKA 1ZSLA 4XSKU 1S81A 1EXFA 2FOEA 2G52A 5JYIA 1HBTH 4BXSA 2J9NA 1HPGA 1SG8B 1KTTB 2FYRA 1O3DA 4LXBH 3SOSA 3OAAD 2GDEH 2SGPE 1TRMA 2J98B 4M7GA 1C1WH 1DY9A 1AUJA 3GY3A 1D6WA 4KKDA 4KTUA 2PR3A 3SZEA 4BAQB 2EQNA 3IWMA 1WTHD 1PPHE 2ZGHA 4A1XA 1ZGVA 2WPIS 5FPSA 4AN7A 3F2FA 4D76A 2ZECA 4TY6A 1BBRK 1CGIE 2QF3A 1DITH 2HGTH 3MU0A 1TNJA 2LNCA 1GI7B 4F55A 3SJKA 3PV5A 1WBGB 4FUDA 5FHTA 1Y59T 1AZ8A 2SGEE 1P10A 3VXEH 1OSSA 3SI4H 3RXQA 5T6DA 1AFEH 1BB0B 2H9TH 1NC6A 3SUDA 3QWCH 3RXPA 3PB1E 4SGAE 2XW9A 2ZHQH 2WPDD 1LTOA 1YPJH 3A7TA 1GJAB 4ISHH 2G55A 1A61H 1TPAE 2L6OA 1L1GA 1SHHB 2VIVA 1S84A 1BMFD 4MQAA 4WXIA 3BTGE 2J92A 3SU0A 1NBME 1O2TA 3M3VA 1B5GH 2WPMS 2OBOA 3A7ZA 3E0PB 2BDBA 4PROA 1FY4A 1A0HB 1ELDE 1TA6A 1V2NT 2CXVA 2HNTE 3TJOA 3KGPA 1P03A 4ISIH 4NCYA 4H6TA 1RGQA 2YMSC 3LGIA 1LO6A 3ZZ8A 4P00A 3ZVAA 1IQFA 4K3JA 1HXFH 1KDQB 2BZ6H 1O3CA 4NA7A 1BRUP 1TRYA 2GMTC 1GI3A 5J4SA 3MNXA 1GBTA 2EEKA 3S0NA 1GBHA 4E06H 1AVWA 1V2QT 2O8UA 1CA0B 3PYHA 1RD3B 4BTUB 4AORA 4A92A 1IQIA 1MAYA 1VCQA 1ZGIA 2M5TA 4MNWA 4CRCA 5EXNA 1BTUA 1C1SA 1ZHRA 1O33A 2C90B 3O8RA 1GBIA 3TH3H 4KGAA 4YLUA 2WV9A 2G5NA 2PP6A 5FBIA 4DT4A 3BF6H 2K8IA 1GJ4H 1ELCA 1NT1A 4D9RA 4Z1MD 3OY5U 1V6DA 4OS5A 1HAPH 2FLRH 5I25A 2WSSD 2JETC 1TONA 4I8JA 6GCHF 5HM2A 2STAE 2VB0A 1EP6A 2ZDAH 4ZUHA 3ZYEA 2A5IA 1YPLH 3GISB 1QJ6B 2YNAA 1J16A 1AE8H 2A2QH 1CO7E 4SGBE 1ETSH 1C5UA 1P2IA 1SB1H 1BMNH 1OP2A 2EI8A 1FV9A 4B6FA 4HFPB 3ITIA 5JDUB 4GAWA 5EJLA 3TNTA 1SFIA 2IOTA 1V2OT 2Y7ZA 1UCYH 1TLDA 2R3YA 1IQJA 2HVYB 1UO6A 1G3CA 4E05H 4ESTE 4IC6A 3H5CB 4HGCA 4O3TA 4Q7ZA 1DLKB 1XX9A 1QB1A 1TQ0B 3SNCA 3UFAA 1SGQE 1ELBA 1MUEB 2PKSC 4OGYA 1SGDE 4XRNA 5DP4A 1GL0E 2A32A 1A5IA 1WYKA 4B2BA 1GDUA 4UONA 1HUTH 3GY2A 1O38A 2BOKA 1VZQH 1PPBH 3RC6A 1V2MT 4NGAH 1MKWH 3WWBA 4NIXA 1BTYA 5EG4A 1K1IA 5E0JA 1F0RA 1EB2A 1A0LA 1B0FA 2W6JD 4B2CA 1C2LA 1ANBA 1O3NA 5EXMA 4Z0KA 3SUFA 1ZJDA 5E2PA 2J94A 3U28C 2R0KA 2XC5A 2WV5A 3RXLA 2ZFPH 5CDFE 3MYWA 3TGJE 1P3EA 2ODQA 1O3MA 4X1SU 2KX4A 1GJCB 1O30A 1W7XH 3FKSD 3QGNB 1DWDH 1AE5A 1K1MA 1XXDA 3U9AH 1J9CH 2XBYA 1P02A 4HG6A 3A84A 3ATKA 1QL9A 4ABFA 1UK4A 1GHAG 3GCHB 1EP5A 1ZRKA 2WZQA 1G30B 3SHCH 1E36B 1VITG 2ZFSA 1O2RA 2F4LA 1O37A 3HK3B 4FUFA 1MCTA 4WMFA 1A4WH 2AHME 1JOUB 1V3XA 2QXIA 4FUBA 4X2XA 4CHAC 2FOMB 1Z8RA 1KLIH 2ZDNA 1P04A 4WH8A 4BAOB 5G4BA 2STBE 1GJBB 4AFUA 4NIVA 2YMSB 3FOAA 1TGBA 4IBLH 3TJNA 1GBKA 5LH8A 1O39A 1FAKH 1AI8H 1YLNA 4AC9A 3UTUH 2GMTB 1DT2A 1W8BH 1J8AA 1S0QA 1G3BA 1VJ9U 2AGGX 2H5CA 3KN2A 4D8NA 6ESTA 1GJ6A 1HLTH 2BD3A 3ZZDA 1QBVH 3BEUA 5E2OA 1OYQA 3D65E 1GPZA 2ESTE 2ZHEH 2OTVA 2A4QA 1UTKA 1O5BB 1EB1H 3A7YA 3B9FH 3F3BA 1SGRE 1H9LB 3STJA 1GL1A 4E7RG 2GP9B 2Y82A 4YT6H 2JDID 4DVAU 1WUNH 1GHYH 3ZZ9A 1O2WA 5CHAC 1FIZA 2FYQA 1V2UT 2JETB 1GVLA 1MBQA 1O3BA 3TGIE 3SU2A 1Y5AT 1BTHH 1O31A 1EJNA 4FUHA 1N8OB 1YCPH 3D62A 5A09A 1DXWA 4JK6A 1EUFA 1QA7A 1ARCA 3A83A 5C1UA 2HWLB 1EPTB 1EASA 1GHBF 1D3PB 2FOHA 3LIWA 4X8UH 3FZZA 1ZHMA 1P11E 2BDGA 4ZMAH 1AFQC 1XMNB 2A7CA 1VGCB 1AB9B 2LPRA 5GJ4B 1RJXB 4AFZA 4X2VA 2GT8A 1YKTA 2VIQA 2P8OB 3A7XA 4IMZA 3FN8A 1WU1A 1B7XB 2IJOB 1UVSH 2DE8A 1FPHH 4ISLA 4TYDA 3RLYH 2TIOA 3M3SA 5DP7A 5A2MH 3P17H 3GCTF 2KCPA 5CMXH 4BOHA 2BLWA 1KSNA 4JZ1A 5L30H 3UQOA 2AMQA 3FAOA 3MH5A 1UTQA 2NU1E 1AQ7A 1NRSH 2ZU1A 1C5TA 2ZC9H 4A6LA 3VG8A 1SGPE 2VIOA 3DSGA 1Z71A 2I6SA 1FX0B 2FPZA 3DUXH 1OKXA 3AAVA 1C1UH 1L4ZA 3OY6U 1ARBA 3KEEA 3RXBA 4ACBA 3ZVEA 5AF9H 1SQOA 1JIRA 4KELA 2NU4E 4DJZB 3S7HB 3PMHB 3HKIB 4I7YH 1S85A 5DJ7A 1KXEA 2VIPA 4AYVB 2P93A 3KCGH 4B75A 1LHFH 1OWDA 3OTPA 4XFQA 1YPKH 4UDWH 2VNTA 5T1VA 2FTLE 1P2NA 8LPRA 1O2JA 2Y80A 2A5KA 3GDVA 5EQQA 1ELGA 3LH1A 1UTMA 4B73A 1IHSH 1HDTH 1FN8A 1Z8GA 2FOBA 4CHAB 1FY5A 2ASUB 3RDZA 2TGPZ 4AB9A 3TJUA 1BZXE 1C2KA 2GT7A 1F5LA 1P9SA 1W0ZU 1JRTA 5JBCS 1C1VH 1GBMA 2Z9KA 3S9AA 5BPEA 1OHHD 4CBOA 1EX3A 4Q63A 1A1RA 4U30A 1IQEA 4UFDH 5C5OA 1LVOA 2VIDA 2DE9A 1DSUA 2VINA 3D49H 1N6YA 2B5TB 3TITA 5JBAS 4RT0A 2BVXH 2EA3A 4BAHB 1F5RA 1RIWC 5DP3A 4FU7A 2HLDD 3RXUA 3PLPA 1P06A 1RTKA 1DS2E 2P94A 1NY22 3K9XB 2KAIB 3PV4A 4LOYH 5DP9A 2ZTXA 1QB6A 3MTYA 2ZU2A 2K1QA 3RXRA 2A0QB 2PGBB 1TIOA 1YGCH 2GV7A 4X6PA 3MH4A 1TPOA 3PM3A 4ZXXH 1T8NA 2O9QA 2OXSA 2XRCA 4OS6A 4Y71A 3SU3A 3TK5A 1HAHH 1NN6A 4FVBA 2V0BA 1AIXH 1G3EA 1DVAH 2H9HA 1RFNA 2FM2A 1ZTJA 4D9QA 5F8ZA 1HV7A 2KZ4A 4K60A 1CQQA 1AFQB 1GGDC 2PV9B 1T4VH 1GBEA 2BDYA 8KME2 1GVZA 2JH6D 1TMBH 2JJ1D 1TOMH 2CV3A 5FXLA 3MNCA 1O2LA 4R0IA 3MH6A 4MPVA 1W0JD 5GIBA 2R2MB 4GVUA 2AGIX 3M7TA 3GYMA 1NRQH 4BTIB 1T31A 1DICA 4J1YA 3ZZ6A 2UWOA 4WMDA 1BUIA 2HLCA 3PRBA 1SGEE 4LZ4B 2B7DH 4RKJB 5JB9S 1TMTH 1LKBA 2ZO3H 3RXVA 2ZTZA 5ETXA 1F92A 3T29A 4FUGA 1P2MA 1V2KT 2KCAA 4H6SB 1IQNA 1THRH 2HPPH 4Y0ZE 5GXPA 1UK3A 5ABWA 1NM6A 2ZNKH 1SFQB 4RI0A 1O5CB 1DOJA 3M7UA 1O3OA 2I6QA 4B2AA 3AAUA 2BLVA 3MFJA 2FI5E 2ZFTA 2KCOA 1NESE 3ZZBA 3G01A 2TPIZ 2BDCA 2GKVE 1EJMA 1J14A 1OS8A 1E38B 1O5GH 3VEQB 4FUCA 4TPIZ 6CHAB 1P12E 5A8YA 5KEDA 1F0SA 1C2HA 4I8KA 3ZZ7A 3UQVA 5C1YA 1LVBA 1QQUA 2ZGXH 2RG3A 1H8HD 1WCZA 4R8TB 1DUAA 1J15A 1MTWA 1S0RA 3EGKH 1O3JA 3SU1A 3VB7A 1ID5H 3HGPA 1QJ1B 4VGCC 1GCTC 1WAYB 1FI8A 3P8NA 4AFSA 3BTWE 3I78A 2UWLA 5GPIB 1XUIA 2BD9A 1E1QD 2OLGA 4ABDA 1Z7KA 2BXTH 1HGTH 9LPRA 1LPZB 1KIGH 1GBCA 4NA8A 1RIWB 1SGNE 1AKSB 1HYLA 1NFWA 2ZU4A 5FX5A 1TABE 2B8OH 5F03A 1C5OH 2ZI2H 4MPXA 5EW1H 2Y5FA 2J4IA 2G81E 2W3IA 1O3IA 1C4V2 3LC5A 1P2JA 4UD9H 3UAIC 3RC4A 1ELVA 1TNLA 3K2UA 5HIYA 1TGCA 4RKOB 1QZ8A 2AGEX 3UOUA 3SNEA 1YLCA 2V6NA 1C2JA 2VH6A 3LJJA 3LC3A 1UCYE 4TWYA 3TK9A 2TGTA 2Z9IA 5E0HA 1UHBB 3RU4D 3KQBA 2XCNA 1KXDA 1O2QA 1TGTA 5ESTE 3KQEA 1NFYA 1XVOA 4NIWA 2ULLA 2ZQ2A 5GWZA 2A4RA 3BIUH 2FXRA 4TY7A 4M9FA 1GGDB 1VCPA 3KYFA 1GHZA 1XUGA 2ZF0H 1GMDG 2ZIQH 3I29A 1H8ED 3F9HA 1SLVB 3UREA 3S69A 4X1QU 1MKWK 1UJ1A 2ZFRH 4X8VH 4ZROA 3A85A 1G36A 1Q3XA 5A8ZA 1YBWA 3RU4T 2IPQX 2ANMH 3DHKH 1S6FA 3M37A 1UMAH 4JCNA 3MU5A 3ZZ4A 1UVOA 3ZVBA 2J34A 1Z1IA 2C8ZB 3TNSA 3MU8A 1BBRE 3E0NB 2YOLA 2F9BH 3OEHD 1TBRH 1Y8TA 2ZGJA 1DXPA 1O3FA 2O8WA 1FMGA 3PTBA 4RT1A 3P8GA 2AIQA 5TCCA 3E1XB 1DY8A 1K1OA 4UEHH 4I86A 3KQ5A 2WPLS 3N7EA 4QT8C 4BTTB 3RMNH 5C17A 3RXEA 2F9OA 2XWAA 3Q3YA 3R3GB 2VGCB 3KF2A 2A2XH 3ZVFA 3DD2H 4B76A 3HKJB 4F49A 7LPRA 2ILNA 3ZVCA 2G51A 2WPJS 2GTBA 1ETTH 3GCNA 4FOUC 1XUJA 3OE7D 1BHXF 4I33A 3L3TA 3SQHE 1O2YA 3ZZAA 3SGQE 4NWLA 4Y6DA 8GCHF 1WTGH 1C2GA 2D26C 2ZPRA 3SNDA 1C5RA 1OPHB 4BNRA 3O8CA 1L0ZA 4TWWA 1M9UA 1SOTA 1ESTA 1XXFA 1T32A 1C1NA 7ESTE 3E91A 2CN0H 5C94A 1O5DH 1AZZA 1Y3YA 4F48B 3BEIB 5EJZA 3HATH 1S6HA 3DT0H 3M36A 1GBFA 5L6NH 3PWCA 2CGAA 4AG2A 4JK5A 2CF8H 2V35A 4MVNA 1G37A 1KY9A 1HAVB 1HJAB 1QIXB 1CBWB 2GGVB 4I8HA 3SV9A 1GCTB 4INHA 2FOFA 2BM2A 5SGAE 2G4TA 1KMHB 3VGCC 3M35A 2RDLA 3KL6A 3ZVGA 1CGJE 2CHAB 4Y76A 3UIRA 4DIIH 1ANDA 1GBLA 3P8FA 4D7FA 4OS2A 4B71A 1HJ8A 5L2ZH 1ETRH 1GI0A 2QF4A 2BX3A 3U1IB 1GI1A 1W3CA 5JB8S 4RSPA 1DANH 1O3AA 5F53A 4Q7XA 1SGYE 3RM2H 3GICB 4DW2U 1YCPK 1PFXC 2RA0A 3F2GA 7KMEH 1CHOF 3PO1B 2WPKS 2Y81A 2F9VA 1YPMH 1ZYOA 1YM0A 4O97A 4XOJA 1AY6H 2ZGBH 3EA8A 5AVDA 3L33A 2BDHA 1VITH 4Q4LA 1GCDA 3IG6B 3TVJB 3S9BA 1C1MA 1NFUA 2J2UA 4KP0A 2GX4A 2L74A 1IQKA 2QXJA 2GCHF 1C5XB 1BCUH 3DSOA 1MKXK 1W13U 3LT3A 4WWYA 1LHEH 3U8TH 1K21H 2ZDVH 1S83A 2VWOA 1JXPA 3SNBA 1COWD 3UNRA 2AS9A 1O36A 2ZA5A 1TNKA 2BD7A 4JYVH 3DSPA 1T8LA 2P59A 1O2SA 4FXGH 1BDAA 4THNH 2O8TA 1C5VA 4XBDA 5FAHA 3CP7A 3S7KB 5F6MA 1TMUH 3E16B 3T28A 4XBBA 1TQ7B 2BHGA 3N7DA 4MNVA 4CR5A 3A7VA 1NPMA 3AVZA 1ACBE 3QDZB 1HAZB 1O2HA 2H1UA 4Y8XA 3SJ9A 1OWHA 4XE4A 1BBRH 1BRAA 1AWFH 3V7TA 2WINI 3PMBB 1CT4E 1TX8A 2R2WU 1LHDH 2QA9E 2ZHDA 1FN6A 2Z9LA 4Y8YA 2PW8H 2J97A 5LPEA 3UOPA 2ZFQH 1K1NA 5T6GA 4OM9A 2SNWA 1LHGH 4GHTA 5C67A 3ATWA 1OP8A 3ELAH 1QRWA 1WDIA 3QO6A 3CS0A 1OOKB 1MABB 3KQCA 3OYPA 5FCRA 2AMPA 3KYGA 5C1XA 1H9HE 2GZ7A 2J98A 2OC8A 4YOJA 2YNBA 2C93B 2C8YB 5A0AE 1ZTKA 1LVMA 3BG4C 1YWUA 2EI7A 3RXOA 4A1TA 1AWHB 1MBMA 2WYJA 2SGDE 1ZR0A 2PTNA 4X6NA 1BMAA 2BB4A 1BJUA 2JH5D 1ELAA 2RCEA 1Z8JB 3TGKE 1CA8B 1SPJA 1BQYA 4DURA 1O35A 1T4UH 4X8SH 1HFDA 1F0TA 2ZCHP 2FP7B 1IAUA 1K1PA 1XKAC 1ZJKA 1MU6B 1EQ9A 2FEQH 2V3OH 4UFFH 1ESAA 1XUKA 2JKHA 1CT2E 1GMCG 1N6XA 3Q3XA 3A86A 1W0KD 1E37B 1TFXA 3F9GA 1O3GA 3A81A 1QB9A 2HOBA 4ABAA 3GY7A 1TWXB 4JZEH 3SGAE 5DSFA 5K7RA 2K0QA 5EPYA 1O3LA 2HVXA 1MH0A 1YLDA 2BTCE 2QAAA 3BG8A 1DFPA 1EKBB 1TB6H 2WHXA 3R0FA 3V0XA 1O5EH 3S9CA 2V3HH 3LPRA 2FX6A 1U6QA 2BXUH 1P9UA 3RMMH 3A8DA 1CT0E 1GJ9B 3PROA 1A5HA 1P8VC 4BANB 1ABIH 1ELTA 4K1EA 2Z3CA 3FP7E 1AVXA 1C2FA 1C5ZB 1SLUB 1CSOE 3N7OA 4MLFB 1MTSA 4AB8A 4XBCA 1E1RD 1KDQA 1P05A 1ZPCA 3BEFB 1GBAA 3UR6A 3MO3A 5FL7D 1DDJA 2F3CE 2W7UA 1QR3E 4U01A 3WWFA 4WH6A 2A4GA 3A7WA 2PKSB 5GCHG 4ZKRU 2ANKH 1A7SA 1Y3VA 2PKAA 2BVSH 1EJAA 1FY3A 1PPFE 3UUZA 3SN8A 3BTME 5EW2H 1FY8E 4LK4A 2BLQA 1YY3A 4CH8B 1K0HA 1VCWA 2PSYA 1GG6C 1HIAB 4XDEA 3M61U 2BDIA 3EDXB 3QTVH 2AMDA 1O3KA 2AEIH 4NIYA 2O8MA 1FY1A 3QZRA 3DA9B 2C3SA 2BOHB 1C2EA 2FLBH 2G4UA 4IN1A 2BY5X 3U8RH 4YXWD 2BD4A 1XUHA 1W7GH 1UTPA 3ZV8A 4IMQA 2C8WB 3B8JA 4MG3A 1TX7A 3SGBE 1B0EA 1WQVH 2CF9H 2P95A 1GI9B 1SSXA 4CRFA 3Q77A 1O2KA 2ALPA 1J17T 4O03A 1LMWB 1QBNA 1AD8H 2ZU3A 1V2ST 2FOCA 1F0UA 4WF8A 1FZZA 2JIZD 2BX4A 2XOKD 3MOCA 1Y5BT 2QE7D 1MTNC 5PTPA 3VB4A 3VXFH 3P70B 3BG4B 1LPGB 1GVKB 1O2GH 3LGVA 3K6YA 2A45B 1BIOA 3QK1A 1DWCH 2BY6X 1V2TT 5AFZH 2CJIA 3RXIA 3RXGA 1G32B 3OEED 1KXCA 3Q76A 2EY4C 3FZDA 1K1JA 1C1OA 2BYAX 4CH2B 1FLEE 4MDSA 2GD4B 1CU1A 2FOGA 1C2IA 3H09A 2J95A 3MHWU 4DG4A 5CHAB 2ZZUH 2Z3DA 3DFLA 3RUOA 2ODYB 2OINA 3V3MA 3SU4A 2AYWA 2ZPSA 1EAIA 2FS9A 3RXTA 4JMYA 3PLKA 5T6FA 3PMAB 4A1VA 5TCAA 1EATA 3UWIA 8GCHG 4YM9A 4MNXA 1BTWA 3ZYDA 3AASA 3KNXA 1D3QB 1O5AB 1V2WT 1ELEE 4RN6A 3BV9B 4GSOA 1GWAA 2TBSA 2XBXA 1W11U 4TSFD 3OFND 2GZ9A 2C8XB 1SI5H 4NSYA 5DO4H 3SUGA 3SUEA 1L2EA 2LELA 2VWLA 4BXWA 1EZXC 3RM0H 2UUYA 1DLEA 2GV6A 2SFAA 3RXAA 1FUJA 1SGIB 3U1JB 3JZ2B 3OU0A 3Q00A 2P16A 3AW1A 3EA9A 1C5YB 3GYLB 4ZHMU 2FIRH 3HPTB 1VITF 4Q2KA 4Y7AA 3PTNA 3V12A 3BTTE 3GDSA 3KQDA 3NXPA 1PPZA 1P2QA 2G5VA 4K5ZA 5E0GA 4YO9A 1MZDA 2QCYA 4GUXA 1S82A 5DP5A 6GCHG 1DWBH 2FX4A 2G8TA 1OX1A 3ZZ3A 5IK2D 1ZOMA 1BRBE 2PGQB 1CHOG 3SZNA 3F9FA 2P3UB 1D9IA 7GCHF 2PUQH 1A3BH 2Q6GA 1K1LA 1HAYB 1WSSH 1QCPA 4CRGA 1EPTA 1L1JA 2VWNA 3NCLA 4Q80A 1FIWA 3EQ0H 2R3UA 1C4U2 4MPWA 5A0CA 2GCHG 3QX5H 4AFQA 3QTOH 1Z1JA 2GVFA 1HRTH 2ODPA 3SBKA 4E7NA 3RMLH 3F9EA 4J2YB 4BAMB 2SGAA 1AU8A 4NFFA 4ZCNA 1V2JT 4FU8A 4X2YA 3TU7H 1H9IE 1OWKA 1GI4A 4OS1A 1VKYA 1O2ZA 3FFGA 4DY7B 3QUMP 3VB5A 5LGOA 1AVGH 3W95A 1GI5A 4UFEH 4CREA 1WQSA 3WY8A 3NPSA 1TNIA 3VB3A 4ABJA 2UUJB 4JYUH 1BA8B 1H8DH 2Z6BD 2PHBA 5A8XA 1XM1A 1TNGA 1AMHA 1G3DA 3M5OA 4WVPE 1SGCA 2ZCKP 4Y11E 1UTJA 3VPKA 4K8YA 1HAOH 4OS4A 1QQ4A 3LOXA 2BQWB 2OQUA 4A7IB 4AGJA 1GMHF 2HNTF 1Q2WA 4H4FA 5HXFA 2UUKB 5A0BA 1C2MA 2ZHFH 1DX5M 1KXAA 2HALA 1GJ5H 3RXSA 2XBVA 2ZFFH 1FAXA 4B74A 1TBQH 3TK6A 4B6EA 3SW2B 3U69H 1QJ7B 4U2WA 2KCYA 1LVYA 3SORA 3O8DA 1T8OA 2A5AA 3NKKA 1H4WA 4YOIA 3N99A 1H1BA 3M5NA 3QGJA 1Z6EA 1AGJA 1HB0B 4GPGA 1C5LH 1Y5UT 3I77A 1Z6JH 4ZXYH 2VBCA 1C1TA 4I32A 3WW7A 1ANEA 1IQLA 1UCYK 1O2PA 3FANA 1FXYA 1GDQA 1OP0A 5KGOA 2FMJA 3TH4H 1RRKA 1CGHA 3T62A 1KLTA 2J38A 3UR9A 1YYY1 1ZSKA 5LPFA 1KTSB 3SO3A 2A7JA 2RDEA 5F8TA 1HJ9A 1IHTH 3MO6A 1NRPH 3ATIA 2BLOA 2EI6A 2GZ8A 2VH0A 2NU0E 1QGFA 2WUBA 1NBMD 1G2MA 3GOVB 2A31A 4IW4E 2QGRA 5C20A 5B6OA 1X7AC 5FPYA 1LQEA 4X6OA 1A46H 2UUFB 2TGAA 5K0HA 2OK5A 2LP6A 2ZDLA 3O8BA 5B6LA 5ESBA 3U98H 1UVUH 1P57B 3F2HA 4AYYB 3DCLA 3UNQA 2XC4A 4JZIA 3FP8E 4CRDA 3CNRA 3P8OA 5EJ1A 1MMJN 1C5PA 3SJIA 1TGNA 4Q7YA 2KAIA 5EIYA 1JMOH 1THSH 2JJ2D 1SLXB 4UFGH 5CHBA 1GI8B 1MAXA 5DP8A 2NWNA 1UVTH 3M3TA 2SNVA 1GJ7B 2ZTYA 2VJ1A 1H8IH 3RU4E 3A82A 4MTBA 2Q6FA 4A5TS 3BN9A 1W0YH 3RLWH 1WXRA 1GHBG 1RXPA 1G9IE 1V2VT 2IPHA 3PWBA 1GDNA 3V13A 3QLPH 1C5SA 2A1DB 4GCHF 5I46H 2XWBI 1F7ZA 2CMYA 2BY7X 4YLQH 4TPYA 1BTXA 1SQAA 2J5UA 2SGQE 2VVUA 5EODA 1MZAA 1ZPZA 5IDKA 2F9NA 4CRBA 1SGFA 1HAXB 4Y8ZA 1ZPBA 1BITA 4NG9H 1MQ6A 1WV7H 3GCHC 3OTJE 4K69A 3TJVA 2BDAA 2W6ID 3EYDA 3H7TA 2QY0B 3GCTG 3M5MA 3F6UH 2GCTC 2ZPQA 2V7QD 4ZKOU 3ATLA 4ACAA 4U32A 4X8TH 4ZH8A 2FI4E 3PV2A 1PYTC 5DG6A 1C5QA 1E0FD 1Q31A 4ASHA 2C4FH 3RXHA 3EE0B 2BD5A 4VGCB 1HNEE 2ZDMA 1Y3XA 3GY5A 1CVWH 1TPPA 4JYTA 1SVPA 1MU8B 1C9PA 1DSTA 3ZZ5A 3SV6A 5AHGH 3E3TA 4HTCH 1FDPA 4X6MA 3URDA 1SGFG 4FU9A 1ZTLA 3FP6E 1QNJA 4WXVA 3MO9A 2UWPA 4Z6AH 2ANYA 4JZFH 3SV2H 3TPIZ 2PKAB 1TA2A 4WY3A 2BVRH 3RP2A 3T5FH 1RS0A 1TNHA 1QBOA 2PFEA 3F1SB 3P6ZB 4HI3A 2AFQB 5FCKA 3UY9A 2BD2A 1OWJA 1OWIA 2EC9H 5F8XA 4ISNA 1O2XA 1YP9A 3SI3H 1EOLA 1MTVA 4O3UA 3LKWA 1E34B 4YT7H 1BOQA 1DM4B 1HXEH 5KECA 1ZSJA 5JBBS 2H5DA 2QF0A 3T27A 3ZZCA 3ENSB 2AERH 3PRDA 2VIWA 5TJXA 2FESH 1EOJA 3A8AA 1N8OC 5JBTA 1F5KU 5J4QA 4DIHH 2FODA 1EPTC 1OXGA 2OQ5A 2OC0A 1CE5A 1AN1E 3TH2H 1MQ5A 2QYIA 1SL3A 5EOKA 1VGCC 1FQ3A 2PWXA 1AB9C 1O2NA 1JWTA 3FO8D 3VFEA 2P8OC 3MQKC 1LPKB 4CR9A 4DCDA 4FVDA 2BD8A 3UNSA 3LGUA 2QC2A 1AKSA 3MH7A 3SNAA 1SBWA 3BTDE 4AGKA 2R0LA 1LCYA 2FZZA 1PQ7A 3P95A 3BSQA 1O32A 1D3TB 2R9PA 1PYTD 1O2MA 1YC0A 4Y0YE 1AO5A 2YMSD 3MI4A 2TGDA 1KXBA 5HIZA 2GDDA 1BHXB 1DE7H 2VWMA 4D7GA 8ESTE 4ZHLU 5HKKD 1YF4A 2FS8A 1IQHA 1ABJH 2WPHS 4TT3D 1ELFA 4AZ2B 1DPOA 2VVCA 4NZLA 5GDSH 1LHCH 4IN2A 5HM9A 1O3PB 2RFKC 1UHBA 5EQSA 3URCA 3C27B 2XXLA 1A5GH 1KLJH 1SQRA 3LJOA 3M5LA 3HK6B 5HGGA 2XNIA 3F0OA 4ABHA 1RTLA 4OS7A 2W26A 1A3EH 3LDXH 2M2AA 4KTCA 3PLBA 1JRSA 2ZDKA 3ATMA 1ZRBA 2F9UA 1GJ8B 3ODDA 1SLWB 2GCTB 1TGSZ 2B9LA 4Y7BA 4O9VA 1BTZA 2Q6DA 1LKAA 3UWJH 1UK2A 1O3HA 1QA0A 3NZIA 4X1NU 4ZHAA 5FPTA 3LH3A 3RXDA 3A89A 1QFKH 1GBBA 2V3MA 4YOGA 2XBWA 3VGCB 2D2DA 1MTUA 1C5WB 2HPQH 4INKA 1TE0A 5C3NA 2TRMA 1JIMA 4YESB 5CE1A 3AK5A 1Z8IB 2ZWLH 1LDTT 2BQ7B 1RTFB 3GY8A 1QRZA 1ANCA 4X1RU 1GMDF 3LONA 1SR5C 1NU7B 1FNIA 1HCGA 3A8CA 7GCHG 2ZG0H 3SHAH 4NFEA 4X2WA 1XVMA 3MWIU 1GBDA 3SJ8A 3ESTA 1W14U 1INCA 2BMGB 4Y10E 4ZKSU 1QURH 2Y7XA 4AX9H 1K22H 3C1KA 4WJG2 2ZQ1A 4HZHA 1O2IA 1SHYA 1SQTA 3LGYA 3T26A 2ALVA 2PTCE 3BTHE 4B1TA 5DK1A 2OBQA 1BMMH 5EGMA 1ORFA 1O2OA 1T7CA 2Z94A 4P02A 4AOQA 2BY8X 1O2UA 1N1LA 2AH4X 3EE7A 3SQEE 1SOZA 1UTLM 4NSVA 3SV7A 1HAVA 5C2ZA 5DPAA 3MU1A 1PJPA 3BTEE 1S6LA 2OD3B 4CBNA 1D4PB 1QL8A 1SKYE 1IOEA 3Q3KA 4NZQA 2XYAA 4H42U 2G00A 3GDUA 4YTAA 1F2SE 1GMHG 2WYGA 2W3KA 1BRCE 1IQMA 2PLXA 1MD8A 5HMAA 1XKBC 1MKXH 1Y3UA 1TYNA 2ZEBA 3CENA 1GI2A 2FWWA 1QL7A 2GJGA
chains in the Genus database with same CATH topology
1JBUH 3E8LA 1BT7A 2WV4A 2W5EA 3MNBA 1A0JA 1ZMLA 1GHVH 1NU9A 1P2OA 3RXMA 3STIA 4OGXA 2FI3E 4IGDA 4DOQA 1ZHPA 1GHXH 1ZMJA 1V2LT 2D8WA 2OC7A 4K1TA 1QY6A 1PQ5A 3NUMA 3QZQA 3MNSA 4ABGA 2F83A 2H9EH 4K8BA 4NA9H 4IS5A 2H2ZA 3LU9B 1D3DB 2P3FH 3OSYA 3UPEA 1C4Y2 2ZCLP 1YCPM 1NROH 1V2RT 4FUEA 2ANWA 4NWKA 1TBZH 3W94A 1PPCE 1D6RA 3RC5A 4ZAEA 4DT7B 3GCOA 4K2YA 1P0SH 2FDAA 1WOFA 4X0WU 2VVVA 2XTTB 2Z7FE 3SV8A 3A80A 1TRNA 2ZKSA 3LGWA 2SGFE 3BTFE 4GLYA 1UVPA 4FUJA 5E8EH 6CHAC 4WMEA 1HAIH 1NRNH 1EZUC 2F91A 1ZMNA 4I8LA 2Q1JA 4Y79A 2A4OA 4ZKNU 1C5NH 1QTFA 1YPHC 1EAXA 2IN2A 4I31A 4MNYA 1W10U 1O0DH 2B0FA 1GBJA 1KXFA 3SJOA 4F4OC 3QN7A 1GHWH 1NO9H 1SC8U 1FONA 2OUAA 3MU4A 1ZLRA 1PPGE 4IC5A 4X1PU 2W7SA 3JZ1B 3KHVA 1ESBA 3CS7A 4LZ1H 1C9TA 1QRXA 3EA7A 2Z9GA 2PUXB 4GCHG 1A2CH 3F68H 1FPCH 1GI6A 3OX7U 1BTPA 5H4IB 1AHTH 3RXCA 1IQGA 2ZP0H 1K2I1 1E35B 1L1NA 1G2LA 1K9OE 2FOAA 3E90B 1MD7A 2P3TB 3L6PA 1SGTA 4ABEA 1Y3WA 5DP6A 2QIQA 4FUIA 2XCFA 3K65B 1P2KA 1NTPA 1UTNA 4DGJA 2OC1A 5EXLA 2XC0A 1THPB 3K6ZA 5FBEA 5BRRE 2F9PA 2ZU5A 1TOCB 1KYNA 1TPSA 1AUTC 1EAWA 3BTKE 3FVFB 3IITA 1GJDB 5L2YH 1CHGA 1SMFE 1DWEH 3NWUA 5EQRA 3A88A 1DUEA 1GHAF 1EZQA 2FO9A 3TIUA 2ZGCA 1NFXA 1C2DA 2NU3E 2OP9A 2Z9JA 2O8LA 2AIPA 2RA3A 1VJAU 3TLOA 3A8BA 3E6PH 3RXJA 4YZUA 5IYTA 1GG6B 2Y5GA 1O2VA 1TALA 5DKMA 1EZSC 3MMGA 3ZVDA 2QN5T 3SU5A 3KIDU 4MPUA 4KTSA 3HGNA 2ZHWH 1S5SA 3B23B 5T3HA 5DGJA 2JH0D 1HAGE 2Y5HA 1EAUA 3EAJA 3BTQE 1ZZZA 3BIVH 3T2NA 5EU8A 1OWEA 1GMCF 2OCVB 2FTMA 1PQAA 4ABBA 5JPMH 1XUFA 5C5NA 1W2KH 3RXFA 3P92A 2WUCA 1W12U 2HRVA 3ZV9A 2A7HA 4ISOA 1UTOA 2BZAA 3T25A 5LPRA 2Y6TA 9ESTA 1L4DA 1P01A 2VGCC 3M7QA 1YPGH 1VR1H 3SU6A 1K28D 3RMOH 5AFYH 1MTNB 2HNTC 2BY9X 2THFB 3GY6A 4BAKB 4INLA 3LGTA 4K1SA 1OYTH 1C1QA 3U8OH 2QXGA 2H6MA 4I8GA 1MCVA 2QXHA 1YPEH 2Z3EA 3H7OA 3NK8A 1PPEE 1HIAA 2PSXA 1V2PT 1LQDB 4UE7H 4CRAA 2BQ6B 1CA0C 3GY4A 5FX6A 6LPRA 1C5MD 4AG1A 1HJAC 5EPNA 1YPHE 1CBWC 3AW0A 2D1JA 5HYOA 3VB6A 2QV1A 5GCHF 1O5FH 3D23A 2CHAC 3DFJA 3A87A 1NRRH 1P09A 1QHRB 1NS3A 1BMLA 1C1RA 1O3EA 1PQ8A 1FJSA 3ODFA 1TX6A 4JZDH 1T8MA 1TAWA 4GHQA 3PMJA 1BJVA 2VU8E 2NU2E 1O34A 1NZQH 1P3CA 2DUCA 4ABIA 3PO1C 1C1PA 3RXKA 1ZSLA 4XSKU 1S81A 1EXFA 2FOEA 2G52A 5JYIA 1HBTH 4BXSA 2J9NA 1HPGA 1SG8B 1KTTB 2FYRA 1O3DA 4LXBH 3SOSA 2GDEH 2SGPE 1TRMA 4M7GA 1C1WH 1DY9A 1AUJA 3GY3A 1D6WA 4KKDA 4KTUA 2PR3A 4BAQB 3IWMA 1WTHD 1PPHE 2ZGHA 4A1XA 1ZGVA 2WPIS 5FPSA 4AN7A 4D76A 2ZECA 4TY6A 1BBRK 1CGIE 2QF3A 1DITH 2HGTH 3MU0A 1TNJA 2LNCA 1GI7B 3SJKA 1WBGB 4FUDA 5FHTA 1Y59T 1AZ8A 2SGEE 1P10A 3VXEH 1OSSA 3SI4H 3RXQA 5T6DA 1AFEH 1BB0B 2H9TH 1NC6A 3SUDA 3QWCH 3RXPA 3PB1E 4SGAE 2XW9A 2ZHQH 1LTOA 1YPJH 3A7TA 1GJAB 4ISHH 2G55A 1A61H 1TPAE 1L1GA 1SHHB 2VIVA 1S84A 4MQAA 4WXIA 3BTGE 2J92A 3SU0A 1O2TA 3M3VA 1B5GH 2WPMS 2OBOA 3A7ZA 3E0PB 2BDBA 4PROA 1FY4A 1A0HB 1ELDE 1TA6A 1V2NT 2CXVA 2HNTE 3TJOA 3KGPA 1P03A 4ISIH 4NCYA 4H6TA 1RGQA 3LGIA 1LO6A 3ZZ8A 3ZVAA 1IQFA 4K3JA 1HXFH 1KDQB 2BZ6H 1O3CA 4NA7A 1BRUP 1TRYA 2GMTC 1GI3A 5J4SA 3MNXA 1GBTA 2EEKA 3S0NA 1GBHA 4E06H 1AVWA 1V2QT 2O8UA 1CA0B 3PYHA 1RD3B 4BTUB 4AORA 4A92A 1IQIA 1MAYA 1VCQA 1ZGIA 2M5TA 4MNWA 4CRCA 5EXNA 1BTUA 1C1SA 1ZHRA 1O33A 2C90B 3O8RA 1GBIA 3TH3H 4KGAA 4YLUA 2G5NA 5FBIA 3BF6H 1GJ4H 1ELCA 1NT1A 4D9RA 3OY5U 1V6DA 4OS5A 1HAPH 2FLRH 5I25A 2JETC 1TONA 4I8JA 6GCHF 5HM2A 2STAE 2VB0A 1EP6A 2ZDAH 4ZUHA 3ZYEA 2A5IA 1YPLH 3GISB 1QJ6B 2YNAA 1J16A 1AE8H 2A2QH 1CO7E 4SGBE 1ETSH 1C5UA 1P2IA 1SB1H 1BMNH 1OP2A 2EI8A 1FV9A 4HFPB 3ITIA 5JDUB 4GAWA 3TNTA 1SFIA 2IOTA 1V2OT 2Y7ZA 1UCYH 1TLDA 2R3YA 1IQJA 1UO6A 1G3CA 4E05H 4ESTE 4IC6A 3H5CB 4HGCA 4O3TA 4Q7ZA 1DLKB 1XX9A 1QB1A 1TQ0B 3SNCA 3UFAA 1SGQE 1ELBA 1MUEB 2PKSC 4OGYA 1SGDE 5DP4A 1GL0E 2A32A 1A5IA 1WYKA 4B2BA 1GDUA 4UONA 1HUTH 3GY2A 1O38A 2BOKA 1VZQH 1PPBH 3RC6A 1V2MT 4NGAH 1MKWH 4NIXA 1BTYA 5EG4A 1K1IA 5E0JA 1F0RA 1EB2A 1A0LA 1B0FA 4B2CA 1C2LA 1ANBA 1O3NA 5EXMA 4Z0KA 3SUFA 1ZJDA 5E2PA 2J94A 2R0KA 2XC5A 2WV5A 3RXLA 2ZFPH 3TGJE 3MYWA 1P3EA 2ODQA 1O3MA 4X1SU 1GJCB 1O30A 1W7XH 3QGNB 1DWDH 1AE5A 1K1MA 1XXDA 3U9AH 1J9CH 2XBYA 1P02A 3A84A 3ATKA 1QL9A 4ABFA 1UK4A 1GHAG 3GCHB 1EP5A 1ZRKA 1G30B 3SHCH 1E36B 1VITG 2ZFSA 1O2RA 1O37A 3HK3B 4FUFA 1MCTA 4WMFA 1A4WH 1JOUB 1V3XA 2QXIA 4FUBA 4X2XA 4CHAC 2FOMB 1Z8RA 1KLIH 2ZDNA 1P04A 4WH8A 4BAOB 5G4BA 2STBE 1GJBB 4AFUA 4NIVA 1TGBA 4IBLH 3TJNA 1GBKA 5LH8A 1O39A 1FAKH 1AI8H 3UTUH 2GMTB 1DT2A 1W8BH 1J8AA 1S0QA 1G3BA 1VJ9U 2AGGX 2H5CA 3KN2A 4D8NA 6ESTA 1GJ6A 1HLTH 2BD3A 3ZZDA 1QBVH 3BEUA 5E2OA 1OYQA 3D65E 1GPZA 2ESTE 2ZHEH 2OTVA 2A4QA 1UTKA 1O5BB 1EB1H 3A7YA 3B9FH 3STJA 1SGRE 1H9LB 4E7RG 1GL1A 2GP9B 2Y82A 4YT6H 4DVAU 1WUNH 1GHYH 3ZZ9A 1O2WA 5CHAC 1FIZA 2FYQA 1V2UT 2JETB 1GVLA 1MBQA 1O3BA 3TGIE 3SU2A 1Y5AT 1BTHH 1O31A 1EJNA 4FUHA 1N8OB 1YCPH 3D62A 5A09A 1DXWA 4JK6A 1EUFA 1QA7A 1ARCA 3A83A 5C1UA 2HWLB 1EPTB 1EASA 1GHBF 1D3PB 2FOHA 3LIWA 4X8UH 3FZZA 1ZHMA 1P11E 2BDGA 4ZMAH 1AFQC 1XMNB 2A7CA 1VGCB 1AB9B 2LPRA 5GJ4B 1RJXB 4AFZA 4X2VA 2GT8A 1YKTA 2VIQA 2P8OB 3A7XA 4IMZA 1WU1A 1B7XB 2IJOB 1UVSH 2DE8A 1FPHH 4ISLA 4TYDA 3RLYH 2TIOA 3M3SA 5DP7A 5A2MH 3P17H 3GCTF 5CMXH 4BOHA 2BLWA 1KSNA 4JZ1A 5L30H 3UQOA 2AMQA 3FAOA 3MH5A 1UTQA 2NU1E 1AQ7A 1NRSH 2ZU1A 1C5TA 2ZC9H 4A6LA 1SGPE 2VIOA 1Z71A 2I6SA 2FPZA 3DUXH 1OKXA 3AAVA 1C1UH 1L4ZA 3OY6U 1ARBA 3KEEA 3RXBA 3ZVEA 5AF9H 1SQOA 1JIRA 4KELA 2NU4E 4DJZB 3S7HB 3PMHB 3HKIB 4I7YH 1S85A 5DJ7A 1KXEA 2VIPA 4AYVB 2P93A 3KCGH 4B75A 1LHFH 1OWDA 4XFQA 1YPKH 4UDWH 2VNTA 2FTLE 1P2NA 8LPRA 1O2JA 2Y80A 2A5KA 3GDVA 5EQQA 1ELGA 3LH1A 1UTMA 4B73A 1IHSH 1HDTH 1FN8A 1Z8GA 2FOBA 4CHAB 1FY5A 2ASUB 3RDZA 2TGPZ 4AB9A 3TJUA 1BZXE 1C2KA 2GT7A 1F5LA 1P9SA 1W0ZU 1JRTA 5JBCS 1C1VH 1GBMA 2Z9KA 3S9AA 5BPEA 4CBOA 1EX3A 1A1RA 4U30A 1IQEA 4UFDH 5C5OA 1LVOA 2VIDA 2DE9A 1DSUA 2VINA 3D49H 1N6YA 2B5TB 3TITA 5JBAS 2BVXH 2EA3A 4BAHB 1F5RA 1RIWC 5DP3A 4FU7A 3RXUA 3PLPA 1P06A 1RTKA 1DS2E 2P94A 1NY22 3K9XB 2KAIB 3PV4A 4LOYH 5DP9A 2ZTXA 1QB6A 3MTYA 2ZU2A 2K1QA 3RXRA 2A0QB 2PGBB 1TIOA 1YGCH 2GV7A 4X6PA 3MH4A 1TPOA 3PM3A 4ZXXH 1T8NA 2O9QA 2OXSA 2XRCA 4OS6A 4Y71A 3SU3A 3TK5A 1HAHH 1NN6A 4FVBA 2V0BA 1AIXH 1G3EA 1DVAH 2H9HA 1RFNA 2FM2A 1ZTJA 4D9QA 5F8ZA 1HV7A 4K60A 1CQQA 1AFQB 1GGDC 2PV9B 1T4VH 1GBEA 2BDYA 8KME2 1GVZA 2JH6D 1TMBH 1TOMH 2CV3A 5FXLA 3MNCA 1O2LA 4R0IA 3MH6A 4MPVA 5GIBA 2R2MB 4GVUA 2AGIX 3M7TA 3GYMA 1NRQH 4BTIB 1T31A 1DICA 4J1YA 3ZZ6A 2UWOA 4WMDA 1BUIA 2HLCA 1SGEE 4LZ4B 2B7DH 4RKJB 5JB9S 1TMTH 1LKBA 2ZO3H 3RXVA 2ZTZA 5ETXA 1F92A 3T29A 4FUGA 1P2MA 1V2KT 4H6SB 1IQNA 1THRH 2HPPH 4Y0ZE 5GXPA 1UK3A 5ABWA 1NM6A 2ZNKH 1SFQB 1O5CB 1DOJA 3M7UA 1O3OA 2I6QA 4B2AA 3AAUA 2BLVA 3MFJA 2FI5E 2ZFTA 1NESE 3ZZBA 3G01A 2TPIZ 2BDCA 2GKVE 1EJMA 1J14A 1OS8A 1E38B 1O5GH 3VEQB 4FUCA 4TPIZ 6CHAB 1P12E 5A8YA 1F0SA 1C2HA 4I8KA 3ZZ7A 3UQVA 5C1YA 1LVBA 1QQUA 2ZGXH 2RG3A 1WCZA 4R8TB 1DUAA 1J15A 1MTWA 1S0RA 3EGKH 1O3JA 3SU1A 3VB7A 1ID5H 3HGPA 1QJ1B 4VGCC 1GCTC 1WAYB 1FI8A 3P8NA 4AFSA 3BTWE 3I78A 2UWLA 5GPIB 1XUIA 2BD9A 2OLGA 4ABDA 1Z7KA 2BXTH 1HGTH 9LPRA 1LPZB 1KIGH 1GBCA 4NA8A 1RIWB 1SGNE 1AKSB 1HYLA 1NFWA 2ZU4A 5FX5A 1TABE 2B8OH 5F03A 1C5OH 2ZI2H 4MPXA 5EW1H 2Y5FA 2J4IA 2G81E 2W3IA 1O3IA 1C4V2 3LC5A 1P2JA 4UD9H 3RC4A 1ELVA 1TNLA 3K2UA 3UOUA 1TGCA 4RKOB 2AGEX 3SNEA 1YLCA 2V6NA 1C2JA 2VH6A 3LJJA 3LC3A 1UCYE 4TWYA 3TK9A 2TGTA 2Z9IA 5E0HA 1UHBB 3RU4D 3KQBA 2XCNA 1KXDA 1O2QA 1TGTA 5ESTE 3KQEA 1NFYA 1XVOA 4NIWA 2ULLA 2ZQ2A 5GWZA 2A4RA 3BIUH 2FXRA 4TY7A 1GGDB 1VCPA 1GHZA 1XUGA 2ZF0H 1GMDG 2ZIQH 3I29A 3F9HA 1SLVB 3UREA 3S69A 4X1QU 1MKWK 1UJ1A 2ZFRH 4X8VH 4ZROA 3A85A 1G36A 1Q3XA 5A8ZA 1YBWA 3RU4T 2ANMH 3DHKH 1S6FA 3M37A 1UMAH 4JCNA 3MU5A 3ZZ4A 1UVOA 3ZVBA 2J34A 1Z1IA 2C8ZB 3TNSA 3MU8A 1BBRE 3E0NB 2YOLA 2F9BH 1TBRH 1Y8TA 2ZGJA 1DXPA 1O3FA 2O8WA 1FMGA 3PTBA 3P8GA 2AIQA 5TCCA 3E1XB 1DY8A 1K1OA 4UEHH 2WPLS 4QT8C 4BTTB 3RMNH 3RXEA 2F9OA 2XWAA 3Q3YA 3R3GB 2VGCB 3KF2A 2A2XH 3ZVFA 3DD2H 4B76A 3HKJB 4F49A 7LPRA