2FTLE

Crystal structure of trypsin complexed with bpti at 100k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Rigidification of a Flexible Protease Inhibitor Variant upon Binding to Trypsin.
pubmed doi rcsb
source organism Bos taurus
total genus 58
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ftlE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ftlE02
4E7RG 1WYKA 1ARCA 2H2ZA 1Y3YA 1DLKB 4YLUA 1C5SA 2V3HH 4JZ1A 1DX5M 3MU4A 5EODA 3UNSA 1HYLA 1DWCH 2SGQE 2OC1A 1KSNA 1YPGH 1GG6C 2A31A 4UFEH 1G32B 4HTCH 3SZNA 3TVJB 1GJ6A 1HIAB 1RIWB 5EOKA 3LT3A 3UOPA 1SFQB 1Z6JH 4WWYA 3UFAA 4XBDA 3P8NA 3UNRA 5C20A 1HB0B 1Q31A 1XKAC 1H4WA 2OQ5A 4XDEA 3TGKE 1TGTA 1EXFA 1EATA 1MBMA 2WPMS 3MNXA 5F6MA 4CH2B 7KMEH 1QRXA 1W12U 1OWJA 1A5IA 1SQAA 3D62A 1F0RA 3A89A 1NRQH 1O3BA 4FUEA 3ZV8A 3W95A 1EP5A 4INHA 1CGJE 2GX4A 1AE8H 4CR5A 3RXBA 2ZQ2A 4BAKB 2QF3A 1Z8JB 1PQAA 1GL0E 4B2BA 3A88A 5A2MH 1WQVH 1F92A 2AIPA 1LVBA 4I33A 3ZZ7A 1C2DA 2XCNA 2FI4E 2EI7A 3AVZA 4NFFA 1PQ5A 1THSH 4Q2KA 1ZOMA 3ZZBA 5C1UA 1EQ9A 4ZXXH 4J1YA 5GCHG 1D3QB 2QY0B 4X2YA 4WH6A 3Q3XA 3ODDA 3P8GA 3ZZ3A 4B2AA 1FAKH 3SW2B 1OSSA 1UVUH 1PPBH 1O3OA 1BTHH 3H7OA 3U8TH 1G2LA 3BV9B 5A8YA 3JZ1B 3N7OA 3P70B 2BDYA 1EAXA 1O3AA 3E3TA 3UQOA 2NU0E 3LC5A 1YM0A 3MH4A 3ZVEA 4Y79A 4Z6AH 2BD7A 1O3IA 2A0QB 1P9UA 2Y5HA 1C2JA 2ZFQH 1TB6H 1CVWH 1GJAB 1MD7A 1FY4A 1ZMNA 2QF0A 5DGJA 1OYTH 2QA9E 3SO3A 6GCHF 1SL3A 2RG3A 2Z9KA 4F4OC 2QIQA 2BYAX 1EOJA 2SGAA 4JYTA 8GCHG 3WY8A 1UO6A 1C5PA 3ZZAA 3ATWA 4BXWA 5C5NA 3RM0H 2GDEH 3SN8A 1CA8B 1L4ZA 1V2VT 1BRBE 3FVFB 5TCAA 2F9NA 1S83A 4JK6A 2BY7X 1ELCA 4Y0ZE 2ZGCA 1QNJA 4IC6A 1TONA 1C5VA 3PYHA 2FLBH 1AU8A 5DPAA 4D7FA 4X6NA 1EZXC 3VB5A 4LK4A 5EU8A 2FYQA 3GICB 5CMXH 1K1NA 2BD8A 5EXMA 1Y5AT 3LH1A 1GBEA 4CHAC 1T7CA 2VVUA 5G4BA 1FPCH 1BTPA 2CHAB 2VIVA 1P2IA 1GJ7B 3ITIA 1C5LH 1KLJH 4KTSA 4D76A 1GDNA 1UHBB 5E2PA 2CXVA 4UFDH 1K9OE 1GJ4H 2OP9A 1O2QA 1QRZA 5HM9A 4IBLH 1CA0C 2UWLA 3SUEA 1SGQE 2O8TA 5F03A 2HGTH 2ODYB 4MNWA 2PLXA 1B0EA 1C5NH 1NS3A 4DURA 1UTOA 2NU4E 4AGKA 5L2ZH 2OC8A 1TBQH 1XX9A 1SGPE 1IOEA 1THPB 3RU4T 4NA7A 1GBTA 1SHYA 2XC4A 2GZ9A 3OU0A 1FN6A 3E16B 3VGCB 4K1SA 3K9XB 5GWZA 3HKIB 2EC9H 2J34A 4IC5A 3O8RA 5EXNA 3CP7A 1H8DH 2BXTH 3A8AA 1DVAH 1GMDF 4R0IA 1O31A 5E0JA 8ESTE 5TJXA 3A7WA 1K1PA 4B73A 1UVSH 2ZHWH 1OX1A 4YTAA 1J15A 1ARBA 1G3CA 1RRKA 4BAOB 1O2PA 1QFKH 2XRCA 4GCHG 2FESH 3T26A 1A5GH 1FDPA 2ANMH 3T27A 5C1YA 3L3TA 1ZPBA 1LQDB 2ZU3A 1GJDB 2IPHA 2JETC 4NSVA 1GI8B 2ZFTA 1LHCH 2J4IA 4B2CA 3B9FH 5FAHA 4Y0YE 4GHQA 1EJAA 1HFDA 2GCHG 1Y3WA 1NN6A 4OS5A 1O3EA 5EPNA 1TNLA 1TRYA 3KF2A 1TMUH 4DCDA 4THNH 1W7XH 3U69H 1LVOA 2SGDE 2UUKB 1MUEB 1O2IA 1YLCA 4KGAA 1NRPH 2WINI 5L30H 1RGQA 2VWOA 1GI2A 3DHKH 1Y5UT 1QR3E 1TNJA 1QBNA 1D3PB 2H9EH 1IQGA 4Q7XA 2JH0D 3RXVA 1V2QT 5DKMA 2ZZUH 1BOQA 1ABIH 3KQCA 5JB9S 1C2IA 3OSYA 4X8VH 3E6PH 3T28A 1C2KA 3NKKA 2A5KA 2I6QA 2NWNA 2VIOA 1C1VH 4DJZB 1C9TA 2O9QA 3BTGE 3E90B 1DITH 4ZROA 2FPZA 3T25A 2BDHA 2JKHA 1E34B 2BDBA 2WV4A 3D23A 2NU3E 4GSOA 3QDZB 1GI7B 2A5IA 2Y7ZA 1CGHA 1DFPA 3A81A 1WSSH 1ZTJA 3KL6A 2TGAA 3BIUH 1O2ZA 1DPOA 3S69A 1PPZA 3F9GA 2XWBI 4K2YA 2PKAB 2ZU2A 3ATMA 3M5MA 2JH5D 3SV6A 4YT7H 5GCHF 4BTIB 3NXPA 4Y7BA 5BPEA 1O2JA 2ZPRA 4XE4A 1BTWA 5EGMA 4AFQA 4ZUHA 2A2XH 3GDUA 1O3NA 4MPVA 2R0LA 1QHRB 1ABJH 2OINA 1BIOA 3MH7A 2RCEA 1GMCG 3AAUA 2V6NA 1MKWH 2F9OA 4SGAE 4KKDA 5EW2H 1MKXK 5EQSA 5GIBA 1FPHH 1VZQH 1QA7A 2ZU4A 1B0FA 3SNDA 1LHGH 1TPAE 3LKWA 4ABDA 1WV7H 2BOKA 3VPKA 3VB3A 5T6FA 1V2UT 1N8OC 8GCHF 4CREA 1HGTH 4GLYA 1TAWA 3PTNA 3PWBA 1EAWA 2OXSA 1AI8H 1MU6B 1Z8RA 4IMQA 2ZHFH 4FU9A 4CRDA 3D65E 2ESTE 1MAYA 5EG4A 4LZ1H 1TWXB 1RD3B 2BY9X 5DO4H 1HAHH 1YCPH 1P03A 2CF9H 1L1JA 1MCTA 2GMTB 4BTTB 3UNQA 3MH6A 3E0PB 3DA9B 3E0NB 4LXBH 2WPLS 5F8TA 4FUHA 1K1LA 4MNYA 4WH8A 1SGDE 3TK6A 1JOUB 1HAYB 5T6GA 1S5SA 1ZZZA 2WYJA 1RXPA 1ZHRA 4ZKNU 4VGCC 1AQ7A 1WAYB 2Q1JA 4Y76A 4YZUA 2ILNA 1ZJKA 5T3HA 1DDJA 1LMWB 1A3EH 1SSXA 1YPJH 5I46H 5FXLA 3P92A 4JK5A 2ZHDA 3LGUA 1A61H 1LPZB 2TPIZ 2KAIA 1NFUA 3GCHC 4DW2U 4J2YB 3RXKA 2VINA 8LPRA 4K1EA 1MZDA 2A45B 2A32A 3D49H 3S0NA 3V12A 1GMHG 3A8DA 1LPGB 3BG8A 4TY6A 3UY9A 4BAMB 1V2NT 1SLUB 3GCOA 1O36A 1J8AA 2GCTB 2G5VA 5GJ4B 2W7SA 1HAVA 2ZFFH 3L33A 4AZ2B 3EAJA 1VJAU 1YPEH 1PPEE 1AUJA 1GHBG 3A7VA 2GV6A 2Z9IA 1SGFG 1TGBA 1N8OB 1GI9B 2ANYA 1AFQB 1TRNA 4K1TA 1AFEH 3MO6A 2FX6A 2A7CA 1C1SA 2G52A 1DSUA 1AB9C 1DANH 2Z9JA 1LHFH 4JCNA 1TPOA 2EA3A 1HAZB 1QY6A 3SV7A 1KTTB 1MKWK 1O3MA 1Z71A 2HLCA 4IS5A 2GCHF 5FHTA 3TJVA 3NUMA 2PSYA 1CSOE 1QB6A 1P01A 2AYWA 3BTME 4ABBA 3ZZ9A 2WPJS 1YLDA 4UEHH 1TX6A 3MTYA 1P10A 4YT6H 1JXPA 1T4UH 2OC7A 1SLWB 2ZF0H 3DT0H 1TE0A 1Y8TA 3LGYA 1D9IA 1GHAG 1HIAA 3SOSA 1GBBA 3ZZCA 1EJNA 1P11E 1XUHA 4VGCB 1HJ8A 1EPTC 1TABE 5K0HA 4ZMAH 3BG4B 3F9EA 3TPIZ 4AORA 1G3EA 3MYWA 4AFSA 1O35A 1B7XB 1O2WA 1ZMLA 4MVNA 2CF8H 4UFGH 5DP8A 2LPRA 3PO1B 3LPRA 3S9AA 2ZG0H 3NZIA 5CHAB 1O5DH 2F9VA 4AB8A 2OBQA 1ESAA 5AVDA 1O2SA 2ZNKH 3P8OA 1A3BH 4ISOA 2BX4A 1ELFA 1O2HA 2ZA5A 1M9UA 5C3NA 4MNXA 2GZ7A 1V2TT 2KAIB 1JMOH 3ZVAA 3K6YA 1F5KU 1IQLA 1Y3VA 3FFGA 3RP2A 1UCYE 4SGBE 1K1IA 4KTUA 2V3OH 2J38A 2VNTA 4AOQA 1VR1H 1ID5H 1SFIA 3HPTB 3SU0A 4LOYH 5E8EH 1C4U2 3PMJA 2G5NA 4X1SU 1LDTT 3UWJH 1O2NA 3ATKA 2CGAA 1GMCF 3UOUA 1EAUA 1O3KA 1G9IE 4KP0A 2O8WA 3FP7E 2VB0A 2QCYA 3TK5A 3MU5A 3GY7A 1GI3A 3HGNA 2ALPA 1BRUP 3LJJA 1C1PA 1OP2A 4UD9H 2DE9A 1AHTH 2BDAA 4ABFA 1IQKA 4U32A 4CRAA 1P2JA 3GY5A 1O2TA 1BHXF 1D4PB 1F0UA 3QK1A 3GDVA 1KYNA 2AH4X 1P2NA 2A2QH 2FP7B 3ATIA 1JBUH 1O2MA 1ZLRA 3KQDA 2AEIH 3SU3A 1BTXA 4FU7A 3VB6A 1BBRK 3S7KB 1SOZA 3VEQB 2P59A 3QZRA 1A46H 1GBAA 1ZHMA 2WPIS 1ZRBA 4NZLA 3A7TA 1MD8A 3RXSA 1CT0E 5E0HA 3U9AH 4A1TA 3QTOH 2HVXA 4I32A 2XCFA 4NIVA 3GY4A 1IQNA 1RS0A 1MTUA 1YPMH 3K2UA 3GY8A 3UQVA 4JZDH 3MNBA 2O8UA 1S6HA 4GVUA 2P3FH 7LPRA 1BBRE 1O2UA 3F6UH 4MPWA 1BHXB 2PKSC 3AW0A 2ZTXA 2FXRA 5FBIA 1NFXA 4O3UA 3SJKA 1UMAH 4NIXA 3TNTA 1P3EA 1V3XA 5A0BA 4O97A 2OUAA 2FOBA 1AVWA 1DY8A 1GHYH 1EZSC 1UHBA 2TGDA 1C9PA 5AFZH 4O03A 3T62A 1LKBA 3L6PA 1NRRH 5DP3A 4CBNA 1BUIA 1C2LA 3CS7A 1O3JA 3KN2A 2FOFA 5LPEA 1GDUA 3KNXA 1RFNA 1GMHF 1SB1H 4ZHLU 1P09A 1V2WT 3MMGA 4H4FA 2ZU5A 2B7DH 3ATLA 1FAXA 1OOKB 1MTWA 2WPKS 1OXGA 1HJ9A 1GCTC 1HRTH 2Y81A 2RA0A 1AKSA 1TX8A 1GHBF 1K1OA 2Y6TA 3E1XB 3RLYH 5ESBA 2UUYA 4BTUB 4TY7A 1SI5H 3TU7H 1AZZA 1J14A 2ZTZA 3SU6A 1QBVH 1LVYA 1D3TB 1ELTA 2BQ7B 5EQQA 3VB4A 3UR6A 3A84A 4IGDA 1FY1A 4WJG2 2G8TA 1GG6B 4M7GA 3BN9A 1QJ6B 3GYLB 5ABWA 2ZGJA 1GBDA 2ZDAH 1C5MD 4RKJB 3DD2H 4UFFH 3MNSA 2H1UA 1HJAC 2A4GA 4WF8A 5JBBS 4ZKRU 2BD5A 1TIOA 3QWCH 5J4SA 1CO7E 1O33A 1TGCA 2O8MA 3EDXB 1GHAF 3O8BA 1C5UA 5DP6A 2B9LA 2G4TA 1O5FH 3HK3B 1THRH 3M5NA 4JYVH 4CRFA 5K7RA 2NU2E 5JBAS 2GDDA 1C1NA 3A7XA 2G55A 2IOTA 3EYDA 4O3TA 5IYTA 4ZH8A 2XWAA 1KY9A 4A5TS 1AGJA 1BTUA 1P04A 2XTTB 3HGPA 2O8LA 1ZTLA 3TNSA 3T29A 4B75A 1V6DA 4MPXA 1MU8B 4X2WA 1SR5C 4ISHH 1INCA 2A4RA 3QGNB 1EASA 3M5OA 2P94A 1P9SA 3FZZA 1CHGA 4Y11E 1HBTH 3GCNA 4DOQA 3ZZ8A 1LHEH 3SU4A 4X8SH 3TJUA 5AF9H 4GAWA 3GY2A 1GCTB 1O5EH 4Y8XA 2GT7A 2ZDVH 3IITA 5FCKA 2QV1A 1VCWA 3A8CA 3HATH 2P95A 1GVKB 1GI4A 3SHCH 2PKAA 3QGJA 2IN2A 1AZ8A 2UWPA 5DG6A 1WU1A 1NRNH 2HNTC 1DXPA 2QXIA 1NO9H 1GPZA 1RTKA 3F9HA 1EZQA 3M5LA 1Z8IB 5ETXA 1AKSB 1OP0A 3IG6B 1ZPZA 1MAXA 3RXEA 1YGCH 2P8OC 4ABGA 2Z3EA 1TGSZ 1V2JT 1N1LA 1N6YA 1FQ3A 4I31A 5JB8S 1O30A 1QA0A 3F68H 3UREA 1NM6A 1QURH 2F9BH 3SJ8A 1X7AC 3V0XA 1IQJA 2C90B 2GKVE 4JZFH 2ZGHA 3NCLA 1TPSA 1D6WA 2A4QA 4I8GA 2VGCC 2XBYA 2VJ1A 5J4QA 1O2GH 1XUKA 4FUFA 4DGJA 1UTNA 4WMFA 2ZI2H 2ZFPH 2XBXA 3RXAA 6ESTA 1TQ7B 1NY22 3UUZA 3PB1E 1MH0A 4Q7YA 4CHAB 1WBGB 1ETRH 3GY6A 3MO9A 1TMBH 3TH3H 3SHAH 4XSKU 5FBEA 3TGJE 3O8CA 4BAQB 4D9RA 3M36A 1C5ZB 1W14U 3U8OH 1KTSB 1ZSLA 1DUAA 2FEQH 1PPGE 4OS4A 1FV9A 1TGNA 1CA0B 1QQUA 2Q6FA 1UVTH 1UTPA 3RXIA 2FM2A 1ZGIA 1SQTA 4U2WA 1W2KH 1GHXH 2FOEA 4NWKA 4X1PU 3M37A 4ISNA 1P2OA 1BMAA 3GISB 2EI6A 1JRSA 1UK4A 2RDLA 4GUXA 2ZEBA 1XVOA 2ZCKP 5L6NH 3VFEA 1KXDA 2ANKH 3RXJA 1FMGA 5JYIA 4MG3A 3QLPH 3SUFA 3P8FA 5TCCA 1TX7A 3RXRA 3A80A 2J2UA 3ZVFA 2BY6X 1XUJA 3LGVA 4X0WU 4IMZA 2BZ6H 2ALVA 1MQ5A 4NCYA 2CN0H 3LOXA 2ZQ1A 3LJOA 3M61U 3SJOA 3MWIU 2XBWA 1TNGA 2BMGB 4OS7A 1LCYA 3SGAE 1BT7A 2VH0A 1UTKA 2BOHB 4CRGA 4JMYA 4Y8ZA 3UR9A 4ABEA 5JPMH 1OP8A 3OY5U 1GI6A 1B5GH 1T31A 2JETB 4A1VA 2SNWA 2Z3DA 1NFYA 3P95A 1DUEA 5DP4A 1FUJA 3MO3A 4NSYA 3NK8A 3OTJE 4RSPA 3ZYEA 1JIRA 1TQ0B 4KELA 3C27B 1QB9A 2ZKSA 1P12E 2BD2A 2BHGA 3M7QA 2AMQA 3RXFA 1ZHPA 1O34A 4FVBA 4Y71A 3V3MA 1ESBA 1O38A 5FPTA 1ELBA 5LH8A 5C5OA 2STBE 3BTFE 1TOCB 4FXGH 2AMDA 3TIUA 1HUTH 1O3FA 1O2VA 3EQ0H 3R3GB 4HI3A 1C1MA 3DFLA 2ZTYA 8KME2 1YPHC 2PUXB 2ZHQH 1AVXA 1CBWC 3SJIA 3RXOA 1ANBA 1P2KA 2F83A 1GJBB 2PHBA 3Q00A 5FPSA 2G00A 1L4DA 1F5LA 2ZDKA 4WVPE 3SV2H 2FWWA 1O3GA 2Q6GA 3RC6A 1ELAA 2QGRA 3U98H 2TBSA 3A82A 2XC0A 3RXTA 4FU8A 3M3VA 5I25A 3KGPA 4H6TA 2F91A 1GWAA 1GJ5H 4BXSA 3SQEE 1FNIA 2B0FA 4UDWH 1YPHE 4XBCA 5DJ7A 3LGIA 2BDIA 3SNCA 1P0SH 2Y5FA 2FYRA 3EA8A 3MU0A 1SGEE 1K1JA 3EE0B 4QT8C 2FLRH 1PFXC 4X1RU 1MTNC 4OS6A 2W5EA 3IWMA 1NU7B 1SGRE 1VITG 3BF6H 1ZPCA 1TMTH 2XXLA 3BEIB 1EKBB 1QRWA 1ORFA 2Y7XA 3HK6B 1GGDC 3H5CB 1BCUH 2ANWA 1W10U 2UUJB 2SNVA 4DVAU 2ZGXH 4YLQH 4AB9A 1BDAA 1YCPM 2R0KA 1RJXB 4FUGA 4JZIA 2P16A 2BVRH 1A4WH 3ESTA 1TBZH 3KQBA 2C8YB 4CRCA 4ISIH 2BD9A 1L1GA 2K1QA 1EOLA 1LQEA 1YBWA 1HDTH 1SLXB 1OKXA 1GHZA 4XFQA 4D9QA 1OWKA 1UTJA 1JWTA 1AVGH 1C4Y2 1GJ9B 4I8JA 5EPYA 4Z0KA 1C5XB 2SGPE 5JDUB 1V2PT 3BIVH 2TRMA 4R8TB 1AE5A 1P2MA 2CMYA 1P05A 2R3UA 1SGIB 3BTEE 1C1WH 3RXHA 1HV7A 1AUTC 1MMJN 3EA7A 4OS1A 1BITA 4AGJA 4A6LA 1K21H 3TK9A 1MTSA 4Y7AA 4ZHAA 2EI8A 2G4UA 1EPTA 3A83A 1T8MA 1VGCC 4X2XA 1BTZA 2ZFRH 5GDSH 1Q3XA 4NZQA 2SGEE 3QTVH 3RMLH 2TIOA 3RU4E 2A5AA 1TNHA 2H9HA 4OGXA 3LU9B 5DK1A 4DIHH 1YKTA 3NWUA 3SNBA 5L2YH 1ACBE 2BTCE 3EGKH 4NA8A 4WXVA 4DG4A 1XM1A 1JIMA 1OWIA 2AS9A 1YCPK 3RMNH 1O3DA 1GBJA 3RXQA 3PTBA 1W0YH 4ZKOU 1CE5A 2B5TB 4I8LA 2YNAA 4NFEA 1QL7A 4ABHA 3ZZ4A 2BZAA 1UTLM 1ELEE 3PMAB 3GCHB 2ZP0H 3MFJA 3ZVCA 2C93B 2BVXH 1WQSA 1PYTD 1OWHA 1FY8E 4X6MA 3RXUA 2D8WA 4FUCA 1OWEA 3BTQE 2FO9A 2P93A 2ODQA 2AGEX 1HNEE 1SHHB 3CENA 3M35A 1Y59T 3BTDE 1TLDA 1RIWC 5DP9A 5AFYH 3OYPA 4A92A 1TNIA 1HAXB 1MTVA 4E05H 1NZQH 1WOFA 2ULLA 4AFZA 3C1KA 4YOJA 2Z7FE 1GJ8B 3UTUH 3U1IB 2ZGBH 4D7GA 3VXEH 3RMOH 1H8IH 1O32A 1XUGA 3BSQA 1AB9B 2SFAA 4ZAEA 3ELAH 3LONA 3R0FA 1V2LT 3AASA 1FONA 5CE1A 2WYGA 2PFEA 1J9CH 3TH4H 2R3YA 4B76A 2AGIX 1E35B 5GPIB 1ELDE 1RTFB 2C4FH 3HKJB 1IQMA 2BQ6B 2XNIA 1WTGH 1E0FD 3RXPA 2ZECA 1TA2A 1ZGVA 1O3PB 2BLVA 3DFJA 3MH5A 1XKBC 1P02A 5HGGA 3GCTG 1NT1A 1KDQB 1UK2A 2ZIQH 2A1DB 2ZFSA 4TWYA 1HAGE 1G30B 2W3IA 1F7ZA 2VIPA 3RM2H 1CHOG 3PMBB 2GTBA 1EPTB 1SQOA 4TYDA 1SGFA 4JYUH 3PMHB 3V7TA 2HOBA 2HRVA 3LIWA 1KXCA 2UWOA 1DS2E 1GI0A 4AX9H 4BOHA 3I78A 2BDGA 1E36B 1YF4A 5HM2A 3BTTE 1IHSH 1O5CB 1O5GH 4ABJA 2VVCA 1Z7KA 1DE7H 2PTCE 1NTPA 1CQQA 4Y8YA 1VCPA 1FIZA 4YOGA 1OPHB 4FUIA 1U6QA 2OLGA 3M3SA 2HALA 1NROH 3QO6A 4X8UH 3B8JA 3RXLA 1HAPH 4ISLA 3ZZ5A 1VITF 2FMJA 1D6RA 2FOMB 1N6XA 2B8OH 1SPJA 1TPPA 2AFQB 1ANCA 3I77A 5A8XA 3ZV9A 5H4IB 4NWLA 1GBHA 3KCGH 3STIA 2M5TA 1QJ1B 2TGTA 1P2QA 2FX4A 1V2ST 1ZRKA 1O3HA 3Q3YA 1PYTC 3OY6U 3Q3KA 1C1OA 4IN2A 1HAIH 1O2XA 1TFXA 4GHTA 1Z1IA 1A0JA 1C5OH 1AMHA 1ZSJA 4PROA 4INKA 1ELGA 2CHAC 2FZZA 2QYIA 3RLWH 4X6PA 1Z1JA 1FY3A 1UTQA 3DUXH 2PGQB 4K5ZA 2WPHS 3TGIE 2F9UA 3FAOA 1EJMA 1DICA 1GHWH 1TYNA 4Q7ZA 3RDZA 4HFPB 4FVDA 2OTVA 2XYAA 4FUJA 1C2HA 5B6OA 1WTHD 1NESE 1GHVH 3MOCA 1BQYA 2GVFA 3KIDU 1H1BA 1MQ6A 4B74A 1T8OA 2Y82A 1L0ZA 1V2OT 2BY5X 4DY7B 1QJ7B 1F0TA 3P17H 2R2WU 3VGCC 2VVVA 2VWMA 1BMNH 4X6OA 1LO6A 5C67A 1QL8A 1GBLA 2PKSB 1KLIH 4U01A 5FX6A 4DIIH 4KTCA 1SGYE 1O5AB 3FZDA 3T2NA 3SV9A 1KXBA 2I6SA 3SGBE 3M7UA 1LKAA 1D3DB 3S9BA 2FI3E 4FUDA 1SOTA 4A1XA 2VWLA 3NPSA 3RXMA 3FANA 1O37A 3BTWE 2FDAA 1EP6A 3QX5H 4JZEH 3V13A 2PGBB 2Q6DA 3SU5A 2Z6BD 3E91A 4FUBA 4INLA 2JH6D 1O0DH 1T8LA 3SQHE 3STJA 1SGNE 1VJ9U 1ZTKA 1A0HB 3URCA 1IAUA 2FI5E 2EEKA 3ZZ6A 1HAOH 1S0RA 1SVPA 3M7TA 4RN6A 2AMPA 1LVMA 2BLOA 3BEUA 4B1TA 3A8BA 1ZJDA 1CT4E 4AG1A 1DXWA 2FOAA 2FTLE 6LPRA 3BTKE 3EA9A 1O3CA 4K60A 4WXIA 4Y6DA 3SI4H 1H9LB 3SBKA 5E0GA 2OBOA 2AGGX 4ASHA 5FCRA 2ZO3H 4I7YH 1EX3A 9LPRA 1XMNB 1XVMA 5A09A 3BEFB 1YYY1 2HPQH 4OS2A 2QXHA 1G37A 2C8XB 2CJIA 3PLKA 1FJSA 1DT2A 3MU8A 3SU1A 5GXPA 2FOGA 2BX3A 1W0ZU 4OGYA 1F5RA 1BJUA 1FXYA 1QGFA 2W3KA 3U8RH 4CR9A 3GOVB 1HJAB 1MCVA 3GCTF 5F8ZA 2HNTE 1MKXH 2W26A 2THFB 1T32A 2ZPQA 3RMMH 2ZWLH 1CHOF 1OYQA 2ZCLP 2BXUH 2D1JA 1SG8B 3A87A 1A1RA 1CT2E 2W7UA 3RC5A 3KQEA 1BMLA 1K2I1 1EAIA 1L2EA 5E2OA 3TITA 1W11U 1S6FA 4LZ4B 1UVPA 1GJCB 4ZXYH 3RXDA 2RA3A 3URDA 4ABIA 1C2GA 1IQHA 2QXJA 2HNTF 4WY3A 5C2ZA 5DP5A 1OS8A 7GCHG 4BAHB 2DUCA 2ZHEH 1YPLH 5FPYA 1IQIA 4TPIZ 4TWWA 3ZYDA 3VB7A 1C1TA 5AHGH 2ZPSA 4K3JA 1G3BA 1P57B 1C1UH 3PROA 1FIWA 1WCZA 1ANEA 3PWCA 1DM4B 1AIXH 4X2VA 3E8LA 1BMMH 1Y5BT 2QXGA 4Y10E 1C4V2 2J92A 1BZXE 1C1RA 2YOLA 3SU2A 4TPYA 5ESTE 4IW4E 2UUFB 4H42U 3CS0A 1ANDA 5F8XA 5PTPA 3SNAA 2XW9A 2ZC9H 2C8ZB 2GMTC 5JBTA 2OQUA 1PQ7A 4K69A 2A7JA 2P8OB 4X1QU 6CHAC 1YC0A 3M3TA 1TOMH 1KXFA 3SV8A 3S7HB 3S9CA 1FZZA 2PTNA 1TRMA 4MTBA 3OX7U 4E06H 1DSTA 1L1NA 3RU4D 1HXEH 3SJ9A 1ZSKA 3T5FH 3W94A 1ZYOA 1P3CA 1T8NA 2Y80A 1V2KT 2BQWB 1BJVA 1WUNH 1GVZA 1TALA 1GBFA 1O3LA 1KIGH 1KXAA 2QAAA 2V35A 3G01A 2ODPA 4MDSA 3UWIA 4A7IB 2GP9B 2GZ8A 1EB2A 2QC2A 5DP7A 2C3SA 2ZCHP 2D2DA 1AWFH 2VGCB 2J9NA 1Z6EA 4H6SB 4MLFB 4HZHA 1P06A 3GY3A 1A0LA 3A7YA 4IN1A 3TJOA 1G36A 2BLQA 1V2MT 1PQ8A 4MNVA 1UTMA 4XBBA 1Z8GA 3RC4A 1C2FA 1H9HE 1QQ4A 4GPGA 4NG9H 4XOJA 1AO5A 1Y3XA 4ABAA 4YESB 1O2KA 1GBCA 3K65B 1J17T 2VIDA 1SC8U 4UONA 4F49A 1H9IE 3FP8E 1DWBH 2GCTC 2LNCA 1ESTA 2F3CE 1NU9A 1E37B 5BRRE 4I8KA 2STAE 1IQFA 1ZMJA 1PPCE 2ASUB 3MU1A 3AAVA 2NU1E 3PV4A 1A5HA 1YP9A 1AFQC 1ETTH 1MZAA 2OCVB 2WUCA 1QBOA 4NIWA 1QIXB 2AERH 2HWLB 2CV3A 1EUFA 3MNCA 1XUIA 5EXLA 1NRSH 1O2RA 2V0BA 3LGTA 4AYVB 3RXGA 1XUFA 1AD8H 3KEEA 3BTHE 1CGIE 3UIRA 4Q80A 1PJPA 3RUOA 5C1XA 1MBQA 3ZVGA 1C5YB 1HLTH 1GI5A 1HCGA 4UE7H 5HXFA 2FIRH 1J16A 2BVSH 4HGCA 1EB1H 4AG2A 1UK3A 3SNEA 4MPUA 6CHAB 2PWXA 1BB0B 1C2EA 1UCYH 1W8BH 1KXEA 3H7TA 2ZDNA 1UJ1A 3FP6E 1S85A 3P6ZB 3ZVBA 5JBCS 1DWEH 4ZKSU 2AIQA 1GCDA 1HXFH 1NPMA 3A85A 4D8NA 2A7HA 2BY8X 1NFWA 1ETSH 1SMFE 3PLBA 2J94A 1TBRH 5A0AE 2BM2A 3SORA 1AY6H 4K8YA 4ESTE 1KLTA 2J95A 1DOJA 1FI8A 1OWDA 4YO9A 2BB4A 2VIWA 2FOCA 5LPFA 1CU1A 4AN7A 3BG4C 1K22H 1YPKH 3LGWA 4I8HA 1FY5A 1PPHE 2VIQA 1EZUC 1BTYA 1T4VH 2H9TH 4MQAA 1Q2WA 1S82A 3ENSB 1BRCE 3PO1C 1GBMA 5CHAC 1K28D 1LPKB 1DY9A 1ZR0A 3VXFH 4YM9A 4WMEA 2TGPZ 2VWNA 5SGAE 1SGCA 3GDSA 1TNKA 1NC6A 5HMAA 3QZQA 1GI1A 4U30A 1C1QA 3ODFA 2BDCA 1O2YA 4NGAH 4NIYA 1VCQA 2GT8A 3TLOA 1TA6A 1O2OA 1PPFE 4ZHMU 1G3DA 1QL9A 2G51A 3ZVDA 1CBWB 4AYYB 2OC0A 1SLVB 1KDQA 1F2SE 4E7NA 2Z3CA 2WUBA 4B71A 1XXDA 2C8WB 1AWHB 4GCHF 1F0SA 4K8BA 1W13U 1G2MA 1C5TA 2Z9LA 3AW1A 3A86A 1BBRH 1C5QA 2PW8H 1S81A 5LPRA 1VITH 2PSXA 1Y3UA 2GV7A 3Q76A 7GCHF 1DWDH 5FX5A 4DT7B 3GYMA 2A4OA 2BD4A 9ESTA 5EW1H 2ZDMA 1K1MA 1BRAA 5EQRA 1GVLA 7ESTE 1HPGA 6GCHG 3TH2H 1P8VC 2XBVA 1E38B 1LHDH 1QCPA 1GBKA 3Q77A 2BD3A 1MTNB 2G81E 2D26C 3UPEA 1UVOA 4WMDA 4NA9H 5A8ZA 2YNBA 2FTMA 3SGQE 5IDKA 1V2RT 1LTOA 3K6ZA 3LC3A 3SUGA 4BNRA 2Z9GA 1GGDB 2GD4B 2F9PA 1XXFA 2FS9A 3F9FA 3RXCA 1C2MA 3PLPA 3PM3A 4X1NU 2WV5A 5LGOA 4CBOA 1O5BB 1UCYK 1DLEA 2PV9B 2QN5T 2ZDLA 2FOHA 1QB1A 3B23B 3QN7A 1W3CA 5HYOA 1S0QA 3F1SB 5A0CA 2GGVB 1S84A 1O39A 3I29A 3LH3A 3A7ZA 1AN1E 2R9PA 1JRTA 1FN8A 2VU8E 3SI3H 1ELVA 3KHVA 4AFUA 4O9VA 2IJOB 1GBIA 4CRBA 2PUQH 1C5RA 1GL1A 1SGTA 2DE8A 1O2LA 2H5DA 4X8TH 4CH8B 5T6DA 1A7SA 2Y5GA 2FS8A 3QUMP 1FLEE 1W7GH 3O8DA 3TJNA 1C5WB 3JZ2B 1VGCB 2H6MA 3MI4A 2SGFE 1HAVB 2R2MB 1IQEA 1A2CH 2Z94A 2OD3B 2H5CA 3LDXH 2P3TB 2HPPH 1BA8B 2PR3A 3SUDA 3ZZDA 4RKOB 1IHTH 1QTFA 4YOIA 2VH6A 4BANB 1GMDG 2ZU1A 1GDQA 1SBWA 2P3UB 2XC5A 1RTLA 2FODA 3MHWU 3U1JB 2BLWA
chains in the Genus database with same CATH superfamily
4E7RG 4XRNA 1WYKA 1ARCA 2H2ZA 1Y3YA 3H09A 1DLKB 4YLUA 1C5SA 2YMSD 2V3HH 4JZ1A 1DX5M 3MU4A 5EODA 3UNSA 1HYLA 1DWCH 2SGQE 2OC1A 1KSNA 1YPGH 1GG6C 2A31A 4UFEH 1G32B 4HTCH 3SZNA 2EQNA 3TVJB 1GJ6A 1HIAB 1RIWB 5EOKA 3LT3A 3UOPA 1SFQB 1Z6JH 4WWYA 3UFAA 3PRBA 4XBDA 3P8NA 3UNRA 5C20A 1HB0B 1Q31A 1XKAC 1H4WA 2OQ5A 4XDEA 3TGKE 1TGTA 1EXFA 1EATA 1MBMA 2WPMS 3UB0A 3MNXA 5F6MA 4CH2B 3OEED 7KMEH 1QRXA 1W12U 1OWJA 1A5IA 1SQAA 3D62A 1F0RA 3A89A 1NRQH 1O3BA 4FUEA 3ZV8A 3W95A 1EP5A 4INHA 1CGJE 3F0PA 2GX4A 1AE8H 3UAIC 4CR5A 3RXBA 2ZQ2A 4BAKB 2QF3A 1Z8JB 1PQAA 1GL0E 4B2BA 3A88A 5A2MH 1WQVH 1F92A 2AIPA 1LVBA 4I33A 3ZZ7A 1C2DA 2XCNA 2FI4E 2EI7A 3AVZA 4NFFA 1PQ5A 1THSH 4Q2KA 1ZOMA 3N99A 3ZZBA 5C1UA 1EQ9A 4ZXXH 4J1YA 5GCHG 1D3QB 2QY0B 4X2YA 4WH6A 3Q3XA 3ODDA 3P8GA 3ZZ3A 4B2AA 1FAKH 3SW2B 1OSSA 1UVUH 1PPBH 1O3OA 1BTHH 3H7OA 3U8TH 1G2LA 4Z1MD 3BV9B 5A8YA 3JZ1B 2KCAA 3N7OA 3P70B 2BDYA 1EAXA 1O3AA 3E3TA 3UQOA 2NU0E 3LC5A 1YM0A 3MH4A 1NBME 3ZVEA 4Y79A 4ACAA 4Z6AH 2BD7A 1O3IA 2A0QB 1P9UA 2Y5HA 1C2JA 2ZFQH 1OHHD 1TB6H 1CVWH 1GJAB 1MD7A 1FY4A 1ZMNA 2QF0A 5DGJA 1OYTH 2QA9E 3SO3A 6GCHF 1SL3A 2RG3A 2Z9KA 4F4OC 2QIQA 2BYAX 1EOJA 2LELA 2SGAA 4JYTA 8GCHG 3WY8A 1UO6A 1C5PA 3ZZAA 4FOUC 3ATWA 4BXWA 5C5NA 3RM0H 2GDEH 3SN8A 1CA8B 1L4ZA 1V2VT 2QE7D 1BRBE 3FVFB 5TCAA 2F9NA 1S83A 4JK6A 2BY7X 1ELCA 4Y0ZE 2ZGCA 1QNJA 2YMSC 4IC6A 1TONA 1C5VA 3PYHA 2FLBH 1AU8A 5DPAA 4D7FA 4X6NA 3N7EA 1EZXC 3VB5A 4LK4A 1FX0B 5EU8A 2FYQA 3GICB 5CMXH 1K1NA 2BD8A 3KYFA 5EXMA 1Y5AT 3LH1A 1GBEA 4CHAC 1T7CA 2VVUA 5G4BA 1FPCH 5EJLA 1BTPA 2CHAB 2VIVA 1P2IA 1GJ7B 3F2HA 3ITIA 1C5LH 1KLJH 4KTSA 4D76A 1GDNA 1UHBB 5E2PA 2CXVA 4UFDH 1K9OE 1GJ4H 2OP9A 5F53A 1O2QA 1QRZA 5HM9A 4IBLH 1CA0C 2UWLA 3SUEA 1SGQE 2O8TA 5F03A 2HGTH 2ODYB 4MNWA 2PLXA 1B0EA 1C5NH 1NS3A 4DURA 1UTOA 2NU4E 4AGKA 5L2ZH 2OC8A 1TBQH 1XX9A 1SGPE 3WWFA 1IOEA 1THPB 3RU4T 4NA7A 1GBTA 1SHYA 2XC4A 2GZ9A 3OU0A 1FN6A 3E16B 3VGCB 4K1SA 3K9XB 2HLDD 5GWZA 3HKIB 2EC9H 2J34A 4IC5A 3O8RA 5EXNA 3CP7A 1H8DH 2BXTH 3A8AA 1DVAH 1GMDF 4R0IA 1O31A 5E0JA 8ESTE 5TJXA 3A7WA 1K1PA 4B73A 1UVSH 2ZHWH 1OX1A 4YTAA 1J15A 1ARBA 1G3CA 1RRKA 4BAOB 1O2PA 1QFKH 2XRCA 4GCHG 2FESH 3T26A 1A5GH 1FDPA 2ANMH 3T27A 5C1YA 3L3TA 1ZPBA 1LQDB 4Q63A 2ZU3A 1GJDB 2IPHA 2JETC 4NSVA 1GI8B 2ZFTA 1LHCH 2J4IA 4B2CA 3B9FH 5FAHA 4Y0YE 4GHQA 1EJAA 1HFDA 2GCHG 1Y3WA 1NN6A 4OS5A 1O3EA 5EPNA 1TNLA 1TRYA 3KF2A 1TMUH 4DCDA 4THNH 1W7XH 3U69H 1LVOA 2SGDE 2UUKB 1MUEB 1O2IA 1YLCA 4KGAA 1NRPH 2WINI 5L30H 1RGQA 2VWOA 1GI2A 3DHKH 1Y5UT 1QR3E 1TNJA 1QBNA 1D3PB 2H9EH 1IQGA 4Q7XA 2JH0D 3RXVA 1V2QT 5DKMA 2ZZUH 1BOQA 1ABIH 3KQCA 5JB9S 1YY3A 1C2IA 3OSYA 4X8VH 3E6PH 3T28A 1C2KA 3NKKA 2A5KA 2I6QA 2NWNA 2V7QD 2VIOA 1C1VH 4DJZB 1E1QD 1C9TA 2O9QA 3BTGE 3E90B 1DITH 4TSFD 2FPZA 4ZROA 3T25A 2BDHA 2JKHA 1E34B 2BDBA 3PV2A 2WV4A 3D23A 2NU3E 4GSOA 3QDZB 1GI7B 2A5IA 2Y7ZA 1CGHA 1DFPA 3A81A 1WSSH 1ZTJA 3KL6A 2TGAA 3BIUH 1O2ZA 1DPOA 3S69A 1PPZA 3F9GA 2XWBI 4K2YA 2PKAB 2ZU2A 3ATMA 3M5MA 2JH5D 3SV6A 4YT7H 5GCHF 4BTIB 3NXPA 4Y7BA 5BPEA 1O2JA 2ZPRA 4XE4A 1BTWA 5EGMA 4AFQA 5C0TA 4ZUHA 2A2XH 3GDUA 1O3NA 4MPVA 2R0LA 1QHRB 1ABJH 2OINA 3W1EA 1BIOA 3MH7A 2RCEA 1GMCG 3AAUA 2V6NA 1MKWH 2F9OA 4SGAE 4KKDA 5EW2H 1MKXK 5EQSA 5GIBA 1FPHH 1VZQH 1QA7A 2ZU4A 1B0FA 3SNDA 1LHGH 1TPAE 3LKWA 2LP6A 4ABDA 1WV7H 2BOKA 3VPKA 3VB3A 5T6FA 1V2UT 1N8OC 8GCHF 4CREA 1HGTH 4GLYA 1TAWA 3PTNA 3PWBA 1EAWA 2OXSA 1AI8H 1MU6B 1Z8RA 4IMQA 2ZHFH 4FU9A 4CRDA 3D65E 2ESTE 1MAYA 5EG4A 4LZ1H 1TWXB 1RD3B 2BY9X 5DO4H 1HAHH 1YCPH 1P03A 2CF9H 1L1JA 1MCTA 2GMTB 4BTTB 3UNQA 3MH6A 3E0PB 3DA9B 3E0NB 4LXBH 2WPLS 5F8TA 4FUHA 1K1LA 4MNYA 4WH8A 1SGDE 3TK6A 1JOUB 1HAYB 5T6GA 1S5SA 1ZZZA 2WYJA 1RXPA 1ZHRA 5CHBA 4ZKNU 4VGCC 1AQ7A 5KEDA 3OTPA 1WAYB 2JJ2D 2Q1JA 4Y76A 4YZUA 2ILNA 1ZJKA 5T3HA 1DDJA 1LMWB 1A3EH 1SSXA 1YPJH 5I46H 5FXLA 3P92A 4JK5A 2ZHDA 3LGUA 1A61H 1LPZB 2TPIZ 2KAIA 1NFUA 3GCHC 4DW2U 4J2YB 3RXKA 2VINA 8LPRA 4K1EA 1MZDA 2A45B 2A32A 3D49H 3S0NA 3V12A 1GMHG 3A8DA 1LPGB 3BG8A 4TY6A 3UY9A 4BAMB 1V2NT 1SLUB 3GCOA 1O36A 1J8AA 2GCTB 2G5VA 1W0KD 5GJ4B 2W7SA 1HAVA 2ZFFH 3L33A 4AZ2B 3EAJA 1VJAU 1YPEH 1PPEE 1AUJA 3DSGA 1GHBG 3A7VA 2GV6A 2Z9IA 1SGFG 1TGBA 1N8OB 1GI9B 2ANYA 1AFQB 1TRNA 4K1TA 4B6FA 1AFEH 3MO6A 2FX6A 2A7CA 1C1SA 2G52A 4F48B 1DSUA 1AB9C 1DANH 2Z9JA 1LHFH 4JCNA 1TPOA 2EA3A 1HAZB 1QY6A 3SV7A 1KTTB 1MKWK 1O3MA 1Z71A 2HLCA 4IS5A 2GCHF 5FHTA 2J5UA 3TJVA 3NUMA 2PSYA 1CSOE 1QB6A 1P01A 2AYWA 3BTME 4ABBA 3ZZ9A 2WPJS 1YLDA 4UEHH 1TX6A 3MTYA 1P10A 4YT6H 1JXPA 1T4UH 2OC7A 1SLWB 2ZF0H 3DT0H 3FOAA 1TE0A 2F4LA 1Y8TA 3LGYA 1K0HA 1D9IA 4RT0A 1GHAG 1HIAA 3SOSA 1GBBA 3ZZCA 1EJNA 1P11E 1XUHA 4VGCB 1HJ8A 1EPTC 1TABE 5K0HA 4ZMAH 5C94A 3BG4B 3F9EA 3TPIZ 4AORA 1G3EA 3MYWA 4AFSA 1O35A 1B7XB 1O2WA 1ZMLA 4MVNA 2CF8H 4UFGH 5DP8A 2LPRA 3PO1B 3LPRA 3S9AA 2ZG0H 3NZIA 5CHAB 1O5DH 2F9VA 4AB8A 2OBQA 1ESAA 5AVDA 1O2SA 2ZNKH 3P8OA 1A3BH 4ISOA 2BX4A 1ELFA 1O2HA 2ZA5A 5IK2D 1M9UA 5C3NA 4MNXA 2GZ7A 1V2TT 2KAIB 1JMOH 3ZVAA 3K6YA 1F5KU 1IQLA 1Y3VA 3FFGA 3RP2A 1UCYE 4SGBE 1K1IA 4KTUA 2V3OH 2J38A 2VNTA 4AOQA 1VR1H 1ID5H 1SFIA 3HPTB 3SU0A 4LOYH 5E8EH 1C4U2 3PMJA 2G5NA 4X1SU 1LDTT 3UWJH 1O2NA 3ATKA 2CGAA 1GMCF 3UOUA 1EAUA 1O3KA 1G9IE 4KP0A 2O8WA 3FP7E 2VB0A 2QCYA 3TK5A 3MU5A 3GY7A 2VBCA 1GI3A 3HGNA 2ALPA 1BRUP 3LJJA 1C1PA 1OP2A 4UD9H 2DE9A 1AHTH 2BDAA 4ABFA 1IQKA 4U32A 4CRAA 1P2JA 3GY5A 1O2TA 1BHXF 1D4PB 1F0UA 4FETA 3QK1A 3GDVA 1KYNA 2AH4X 1P2NA 2A2QH 2FP7B 3ATIA 1JBUH 1O2MA 1ZLRA 3KQDA 2AEIH 3SU3A 1BTXA 4FU7A 3VB6A 1BBRK 3S7KB 1SOZA 3VEQB 2P59A 3QZRA 2GJGA 1A46H 1GBAA 1ZHMA 2WPIS 4HG6A 1ZRBA 4NZLA 3A7TA 1MD8A 3RXSA 1CT0E 5E0HA 3U9AH 4A1TA 3QTOH 2HVXA 4I32A 2XCFA 4NIVA 3GY4A 1IQNA 1RS0A 1MTUA 1YPMH 3K2UA 3GY8A 3UQVA 4JZDH 3VG8A 3MNBA 2O8UA 1S6HA 4GVUA 2P3FH 7LPRA 1BBRE 1O2UA 3F6UH 4MPWA 1BHXB 2PKSC 3AW0A 2ZTXA 2FXRA 5FBIA 1NFXA 4O3UA 5GNDA 3SJKA 1UMAH 4NIXA 3TNTA 1P3EA 1V3XA 5A0BA 4O97A 2OUAA 2FOBA 1AVWA 1DY8A 1GHYH 1EZSC 1UHBA 2TGDA 2QF5A 1C9PA 5AFZH 4O03A 3T62A 2IJD1 1LKBA 3L6PA 1NRRH 5DP3A 4CBNA 1BUIA 1C2LA 3CS7A 1O3JA 3KN2A 2FOFA 5LPEA 1GDUA 3KNXA 1RFNA 1GMHF 1SB1H 4ZHLU 1P09A 1V2WT 3MMGA 4H4FA 2ZU5A 2RFKC 2B7DH 3ATLA 1FAXA 1OOKB 1MTWA 2WPKS 1OXGA 1HJ9A 1GCTC 1HRTH 2Y81A 2RA0A 1AKSA 1TX8A 1GHBF 1K1OA 2Y6TA 3E1XB 3U28C 3RLYH 5ESBA 2UUYA 4BTUB 4TY7A 1SI5H 3TU7H 1AZZA 1J14A 2ZTZA 3SU6A 1QBVH 1LVYA 1D3TB 1ELTA 2BQ7B 5EQQA 3VB4A 3UR6A 3A84A 4IGDA 1FY1A 4WJG2 2G8TA 1GG6B 4M7GA 3BN9A 1QJ6B 3GYLB 2JDID 5ABWA 2ZGJA 1GBDA 2ZDAH 1C5MD 4Q4LA 4RKJB 3DD2H 4UFFH 3MNSA 2H1UA 1HJAC 2A4GA 4WF8A 5JBBS 4ZKRU 2BD5A 1TIOA 3QWCH 5J4SA 1CO7E 1O33A 1TGCA 2O8MA 3EDXB 1GHAF 3O8BA 1C5UA 5DP6A 2B9LA 2G4TA 1O5FH 3HK3B 1THRH 3M5NA 4JYVH 4CRFA 5K7RA 2NU2E 5JBAS 2GDDA 1C1NA 3A7XA 2G55A 2IOTA 3EYDA 4O3TA 5IYTA 4ZH8A 2XWAA 1KY9A 4A5TS 1AGJA 1BTUA 1P04A 2XTTB 3HGPA 2O8LA 1ZTLA 3TNSA 3T29A 4B75A 1V6DA 4MPXA 1MU8B 3F3BA 4X2WA 1SR5C 4ISHH 1INCA 2A4RA 3QGNB 1EASA 3M5OA 2P94A 1P9SA 3FZZA 1CHGA 4Y11E 1HBTH 3GCNA 4DOQA 3ZZ8A 1LHEH 3SU4A 4X8SH 3TJUA 5AF9H 4GAWA 3GY2A 1GCTB 1O5EH 4Y8XA 2GT7A 2ZDVH 3IITA 5FCKA 2QV1A 1VCWA 3A8CA 3HATH 1GVKB 2P95A 1GI4A 3SHCH 2PKAA 3QGJA 2IN2A 1AZ8A 2UWPA 3DCLA 5DG6A 1WU1A 1NRNH 2HNTC 1DXPA 2QXIA 1NO9H 1GPZA 2WSSD 1RTKA 3F9HA 1EZQA 3M5LA 1Z8IB 5ETXA 1AKSB 1OP0A 3IG6B 1ZPZA 1MAXA 3RXEA 1YGCH 2P8OC 3N7DA 4ABGA 2Z3EA 1TGSZ 1V2JT 1N1LA 1H8ED 1N6YA 1EFRD 1FQ3A 4I31A 5JB8S 1O30A 1QA0A 3F68H 2KFWA 3UREA 1NM6A 1QURH 2F9BH 3SZEA 3ZIAD 3SJ8A 1X7AC 3V0XA 1IQJA 2C90B 2GKVE 4JZFH 2ZGHA 3NCLA 1TPSA 1D6WA 2A4QA 4I8GA 2VGCC 2XBYA 2VJ1A 2YMSB 5J4QA 1O2GH 1XUKA 4FUFA 4DGJA 1UTNA 4WMFA 2ZI2H 3PV5A 2ZFPH 2XBXA 3RXAA 6ESTA 1TQ7B 1NY22 3FKSD 3UUZA 3PB1E 1MH0A 4Q7YA 4CHAB 1WBGB 1ETRH 3GY6A 3MO9A 1TMBH 3TH3H 3SHAH 4XSKU 5FBEA 3TGJE 3O8CA 4BAQB 4D9RA 3M36A 1C5ZB 1W14U 2J98B 3U8OH 1KTSB 1ZSLA 1DUAA 2FEQH 1PPGE 4OS4A 1FV9A 1TGNA 1CA0B 1QQUA 2Q6FA 1UVTH 1UTPA 3RXIA 2FM2A 3AK5A 1ZGIA 1SQTA 4U2WA 1W2KH 1GHXH 2FOEA 4NWKA 4X1PU 3M37A 4ISNA 1P2OA 1BMAA 3GISB 2EI6A 1JRSA 1UK4A 2RDLA 4GUXA 2ZEBA 1XVOA 2ZCKP 5L6NH 2WV9A 3VFEA 1KXDA 2ANKH 3RXJA 1FMGA 5JYIA 4MG3A 3QLPH 3SUFA 3P8FA 5TCCA 2L6OA 1TX7A 3RXRA 3A80A 2J2UA 3ZVFA 2BY6X 1XUJA 3LGVA 4X0WU 4IMZA 2BZ6H 2ALVA 1MQ5A 4NCYA 2CN0H 3F2GA 3LOXA 2ZQ1A 3LJOA 3M61U 3SJOA 3MWIU 2XBWA 1TNGA 2BMGB 4OS7A 1LCYA 3SGAE 4I86A 1BT7A 2VH0A 1UTKA 4TT3D 2BOHB 4CRGA 4JMYA 4Y8ZA 3UR9A 4ABEA 5JPMH 1OP8A 3OY5U 1GI6A 1B5GH 1T31A 2JETB 4A1VA 2SNWA 2Z3DA 1NFYA 3P95A 5EJZA 1E1RD 1DUEA 5DP4A 1FUJA 3MO3A 4NSYA 3NK8A 3OTJE 4RSPA 3ZYEA 1JIRA 1TQ0B 4KELA 3C27B 2M2AA 1QB9A 2ZKSA 1P12E 2BD2A 2BHGA 3M7QA 2AMQA 3RXFA 1ZHPA 1O34A 4FVBA 4Y71A 3V3MA 1ESBA 1O38A 5FPTA 1ELBA 5LH8A 5HIYA 5C5OA 2STBE 3BTFE 2KCPA 1TOCB 4FXGH 2AMDA 3TIUA 1HUTH 1O3FA 1O2VA 2JJ1D 3EQ0H 3R3GB 4HI3A 1C1MA 3DFLA 2ZTYA 8KME2 4P00A 1YPHC 2PUXB 2ZHQH 1AVXA 1CBWC 3SJIA 3RXOA 1ANBA 5C0UA 1P2KA 2F83A 1GJBB 2PHBA 3Q00A 5FPSA 2G00A 1L4DA 1F5LA 2ZDKA 4WVPE 3SV2H 2FWWA 1O3GA 2Q6GA 3RC6A 1ELAA 2QGRA 3U98H 2TBSA 3A82A 2XC0A 3RXTA 4FU8A 3M3VA 5I25A 3KGPA 4H6TA 2F91A 1GWAA 1GJ5H 4BXSA 3SQEE 1FNIA 2B0FA 5DSFA 4UDWH 1YPHE 4XBCA 5DJ7A 2WHXA 3LGIA 2BDIA 3SNCA 1P0SH 2Y5FA 2FYRA 3EA8A 3MU0A 1SGEE 1K1JA 3EE0B 4QT8C 2FLRH 1PFXC 4X1RU 1MTNC 3OE7D 4OS6A 2W5EA 3IWMA 1NU7B 1SGRE 1VITG 3BF6H 1ZPCA 1TMTH 2XXLA 3BEIB 1EKBB 1QRWA 1ORFA 2Y7XA 3HK6B 1GGDC 3H5CB 1BCUH 2ANWA 1W10U 2UUJB 2SNVA 4DVAU 2ZGXH 4YLQH 4AB9A 1BDAA 1YCPM 2R0KA 1RJXB 4FUGA 4JZIA 2P16A 2BVRH 1A4WH 3ESTA 1TBZH 5CDFE 3KQBA 2C8YB 4CRCA 4ISIH 2BD9A 1L1GA 2K1QA 1EOLA 1LQEA 1YBWA 5FL7D 1HDTH 1SLXB 1OKXA 1GHZA 4XFQA 4D9QA 1OWKA 1UTJA 1JWTA 1AVGH 1C4Y2 1GJ9B 4I8JA 5EPYA 4Z0KA 1C5XB 2SGPE 5JDUB 1V2PT 3BIVH 2TRMA 4R8TB 3KQ5A 1AE5A 1P2MA 2CMYA 1P05A 2R3UA 1SGIB 3BTEE 1C1WH 2KM0A 3RXHA 1HV7A 1VKYA 1AUTC 1MMJN 3EA7A 4OS1A 1BITA 4AGJA 4A6LA 1K21H 3TK9A 1MTSA 2K8IA 4Y7AA 4ZHAA 2EI8A 2G4UA 1EPTA 2J97A 1T8MA 1VGCC 3A83A 4X2XA 1BTZA 2ZFRH 5GDSH 1Q3XA 4NZQA 1COWD 2SGEE 3QTVH 3RMLH 2TIOA 3RU4E 2A5AA 1TNHA 2H9HA 4OGXA 3LU9B 5DK1A 4DIHH 1YKTA 3NWUA 5EJ1A 3SNBA 5L2YH 1ACBE 2BTCE 3EGKH 4NA8A 4WXVA 4DG4A 1XM1A 1JIMA 1OWIA 2AS9A 1YCPK 3RMNH 1O3DA 1SQRA 2IPQX 1GBJA 3RXQA 3PTBA 1W0YH 4ZKOU 1CE5A 2B5TB 4I8LA 2YNAA 4NFEA 1QL7A 4ABHA 3ZZ4A 2BZAA 1UTLM 1ELEE 3PMAB 3GCHB 2ZP0H 3MFJA 3ZVCA 2C93B 2BVXH 1WQSA 1PYTD 1OWHA 4B6EA 1FY8E 4X6MA 3RXUA 2D8WA 3WWBA 4FUCA 1OWEA 3BTQE 2FO9A 2P93A 2ODQA 2AGEX 1HNEE 1SHHB 3CENA 3M35A 3F2FA 1Y59T 3BTDE 1TLDA 1RIWC 5DP9A 5AFYH 3OYPA 4A92A 1TNIA 1HAXB 1MTVA 4E05H 1NZQH 1WOFA 2ULLA 4AFZA 3C1KA 4YOJA 2Z7FE 1GJ8B 3UTUH 3U1IB 2ZGBH 4D7GA 3VXEH 3RMOH 1H8IH 1O32A 1XUGA 3BSQA 1AB9B 2SFAA 4ZAEA 3ELAH 3LONA 3R0FA 1V2LT 3AASA 1FONA 5CE1A 2WYGA 2PFEA 5C17A 1J9CH 3TH4H 2R3YA 4B76A 2AGIX 1E35B 5GPIB 1ELDE 1RTFB 2C4FH 3HKJB 1IQMA 2BQ6B 2XNIA 1WTGH 1E0FD 3RXPA 2ZECA 1TA2A 1ZGVA 1O3PB 2BLVA 3DFJA 3CNRA 3MH5A 1XKBC 1P02A 5HGGA 3GCTG 1NT1A 1KDQB 1UK2A 2KCYA 2KZ4A 2ZIQH 2A1DB 2ZFSA 3OEHD 4TWYA 1HAGE 1G30B 2W3IA 1F7ZA 2VIPA 3RM2H 1CHOG 3PMBB 2GTBA 1EPTB 1SQOA 4TYDA 1SGFA 4JYUH 3PMHB 3V7TA 2HOBA 2HRVA 3LIWA 1KXCA 2UWOA 1DS2E 1GI0A 4AX9H 4BOHA 3I78A 2BDGA 1E36B 1YF4A 5HM2A 1QZ8A 3BTTE 1IHSH 1O5CB 1O5GH 3OFND 4ABJA 2VVCA 1Z7KA 1DE7H 2PTCE 1NTPA 1CQQA 4Y8YA 1VCPA 3OAAD 3NRLA 1FIZA 4YOGA 1OPHB 4FUIA 1U6QA 2OLGA 3M3SA 2HALA 1NROH 3QO6A 4X8UH 3B8JA 3RXLA 1HAPH 4ISLA 3ZZ5A 1VITF 2FMJA 1D6RA 2FOMB 1N6XA 5KECA 2B8OH 1SPJA 1TPPA 2AFQB 1ANCA 3I77A 5A8XA 3ZV9A 3DSOA 4NWLA 1GBHA 3KCGH 5H4IB 3STIA 2M5TA 1QJ1B 2TGTA 1P2QA 2FX4A 1V2ST 1ZRKA 3F0OA 1O3HA 5HKKD 3Q3YA 1PYTC 3OY6U 3Q3KA 1C1OA 4IN2A 1HAIH 1O2XA 1TFXA 4GHTA 1Z1IA 1A0JA 1C5OH 1AMHA 1ZSJA 4PROA 4INKA 1ELGA 2CHAC 2FZZA 2QYIA 3RLWH 4X6PA 1Z1JA 1FY3A 1UTQA 3DUXH 2PGQB 4K5ZA 2WPHS 3TGIE 2F9UA 3FAOA 1EJMA 1DICA 1GHWH 1TYNA 4Q7ZA 3RDZA 4HFPB 4FVDA 2OTVA 2XYAA 4FUJA 5HIZA 2PP6A 1C2HA 5B6OA 1WTHD 1NESE 1GHVH 3MOCA 1BQYA 2GVFA 3KIDU 1H1BA 1MQ6A 4B74A 1T8OA 2Y82A 1L0ZA 2V3MA 1V2OT 2BY5X 4DY7B 1QJ7B 1F0TA 3P17H 2R2WU 3VGCC 2VVVA 2VWMA 1BMNH 4X6OA 1LO6A 5C67A 1QL8A 1GBLA 2PKSB 1KLIH 4U01A 2HVYB 5FX6A 4DIIH 4KTCA 1SGYE 1O5AB 3FZDA 3T2NA 3SV9A 1KXBA 2I6SA 3SGBE 3M7UA 1LKAA 1D3DB 3S9BA 1E79D 2FI3E 4FUDA 1SOTA 4A1XA 2VWLA 3NPSA 3RXMA 3FANA 1O37A 3BTWE 5EIYA 2J98A 2FDAA 1EP6A 3QX5H 4JZEH 3V13A 2PGBB 1UW7A 2Q6DA 3SU5A 2Z6BD 3E91A 4FUBA 4INLA 4ACBA 2JH6D 1O0DH 1T8LA 3SQHE 3STJA 1SGNE 1VJ9U 1ZTKA 3SYJA 5DN6D 1A0HB 3URCA 1IAUA 2FI5E 2EEKA 1YWUA 3ZZ6A 1HAOH 1S0RA 1SVPA 3M7TA 4RN6A 2AMPA 1LVMA 2BLOA 3BEUA 4B1TA 3A8BA 1ZJDA 1MABB 1CT4E 4AG1A 1DXWA 2FOAA 2FTLE 6LPRA 3BTKE 3EA9A 1O3CA 4K60A 4WXIA 4Y6DA 3SI4H 1H9LB 3SBKA 4M9FA 5E0GA 2OBOA 2AGGX 4ASHA 5FCRA 2ZO3H 4I7YH 1EX3A 9LPRA 1XMNB 1XVMA 5A09A 3BEFB 1H8HD 1YYY1 2HPQH 4OS2A 2QXHA 1G37A 2C8XB 2CJIA 2AHME 1FJSA 3PLKA 1DT2A 3MU8A 3SU1A 5GXPA 2FOGA 2BX3A 1W0ZU 4OGYA 1F5RA 1BJUA 1FXYA 1QGFA 2W3KA 3U8RH 4CR9A 3GOVB 2EY4C 3KYGA 1HJAB 1MCVA 3GCTF 5F8ZA 2WZQA 3MQKC 2HNTE 1MKXH 2W26A 2THFB 1T32A 2ZPQA 3RMMH 2ZWLH 1CHOF 1OYQA 2ZCLP 2BXUH 2D1JA 1SG8B 3A87A 1A1RA 1CT2E 2W7UA 3RC5A 3KQEA 1BMLA 1K2I1 1EAIA 1L2EA 5E2OA 3TITA 1W11U 1S6FA 4LZ4B 1UVPA 1GJCB 4ZXYH 3RXDA 2RA3A 3URDA 4ABIA 1C2GA 1IQHA 2QXJA 2HNTF 4WY3A 5C2ZA 5DP5A 1OS8A 7GCHG 4BAHB 2DUCA 2ZHEH 1YPLH 5FPYA 1IQIA 4TPIZ 4TWWA 3ZYDA 3VB7A 1C1TA 5AHGH 2ZPSA 4K3JA 1G3BA 1P57B 1C1UH 3PROA 1FIWA 1WCZA 1ANEA 3PWCA 1DM4B 1AIXH 1SKYE 4X2VA 3E8LA 1BMMH 2WPDD 1Y5BT 2QXGA 4Y10E 1C4V2 2KR7A 2J92A 1BZXE 1C1RA 2YOLA 2XNDD 4TPYA 3SU2A 5ESTE 4IW4E 2UUFB 4H42U 3CS0A 1ANDA 5F8XA 5PTPA 3SNAA 2XW9A 2ZC9H 2C8ZB 2GMTC 4P02A 5JBTA 2OQUA 1PQ7A 4K69A 2A7JA 2P8OB 4X1QU 6CHAC 1YC0A 3M3TA 1TOMH 1KXFA 3SV8A 3S7HB 3S9CA 1FZZA 2PTNA 1TRMA 4MTBA 3OX7U 4E06H 1DSTA 1L1NA 4ASUD 3RU4D 1HXEH 3SJ9A 1ZSKA 3T5FH 3W94A 1ZYOA 1P3CA 1T8NA 2Y80A 1V2KT 2BQWB 1BJVA 1WUNH 4YXWD 1GVZA 1TALA 1GBFA 1O3LA 1KIGH 1KXAA 2QAAA 2V35A 3G01A 2ODPA 4MDSA 3UWIA 4A7IB 2GP9B 2GZ8A 1EB2A 2QC2A 4OM9A 5DP7A 2C3SA 2ZCHP 2D2DA 1AWFH 2VGCB 2J9NA 1Z6EA 4H6SB 4MLFB 4HZHA 1P06A 3GY3A 1A0LA 3A7YA 4IN1A 3TJOA 1G36A 2BLQA 1V2MT 1PQ8A 4MNVA 1UTMA 4XBBA 1Z8GA 3RC4A 1C2FA 1H9HE 1QQ4A 4GPGA 4NG9H 4XOJA 2RDEA 1AO5A 1Y3XA 4ABAA 2F43B 4YESB 1O2KA 1BMFD 1GBCA 3K65B 1J17T 2VIDA 1SC8U 4UONA 4F49A 1H9IE 3FP8E 1DWBH 2GCTC 2LNCA 1ESTA 2F3CE 1S6LA 1NU9A 1E37B 5BRRE 4I8KA 2STAE 1IQFA 1ZMJA 1PPCE 2ASUB 2OK5A 3MU1A 3AAVA 2NU1E 3PV4A 1A5HA 1YP9A 1AFQC 1ETTH 1MZAA 2OCVB 2WUCA 1QBOA 4NIWA 1QIXB 2AERH 2HWLB 2CV3A 1EUFA 3MNCA 1XUIA 5EXLA 1NRSH 1O2RA 2V0BA 3LGTA 4AYVB 3RXGA 1XUFA 1AD8H 3KEEA 3BTHE 1CGIE 1W0JD 3UIRA 4Q80A 1PJPA 3RUOA 5C1XA 1MBQA 3ZVGA 1C5YB 1HLTH 1GI5A 1HCGA 4UE7H 5HXFA 2FIRH 1J16A 2BVSH 4HGCA 1EB1H 4AG2A 1UK3A 3SNEA 4MPUA 4RI0A 2PWXA 6CHAB 1BB0B 1C2EA 1UCYH 1W8BH 1KXEA 3H7TA 2ZDNA 1UJ1A 3FP6E 1S85A 3P6ZB 2W6ID 3ZVBA 5JBCS 1DWEH 4ZKSU 2AIQA 1GCDA 1HXFH 1NPMA 3A85A 4D8NA 2A7HA 2BY8X 1NFWA 1ETSH 1SMFE 3PLBA 2J94A 1TBRH 5A0AE 2BM2A 3SORA 1AY6H 3EE7A 2QF4A 4K8YA 4ESTE 1KLTA 2J95A 2XOKD 1DOJA 1FI8A 1OWDA 4YO9A 2BB4A 2VIWA 2FOCA 3WW7A 5LPFA 1CU1A 4AN7A 3BG4C 1K22H 1YPKH 3LGWA 4I8HA 1FY5A 1PPHE 2VIQA 1EZUC 1BTYA 1T4VH 2H9TH 4MQAA 1Q2WA 1S82A 2JIZD 1BRCE 3ENSB 1GBMA 3PO1C 5CHAC 1K28D 1LPKB 1DY9A 1ZR0A 3VXFH 4YM9A 4WMEA 2TGPZ 2VWNA 5SGAE 1SGCA 3GDSA 1TNKA 1NC6A 3FN8A 2K0QA 5HMAA 3QZQA 1GI1A 1KMHB 4U30A 1C1QA 3ODFA 2BDCA 1O2YA 4AC9A 4NGAH 4NIYA 1VCQA 2GT8A 3TLOA 1TA6A 1O2OA 1PPFE 4ZHMU 1G3DA 1QL9A 2G51A 3ZVDA 1CBWB 4AYYB 2OC0A 1SLVB 1KDQA 1F2SE 4E7NA 2Z3CA 2WUBA 4B71A 1XXDA 2C8WB 5T1VA 1AWHB 4GCHF 1F0SA 4K8BA 1W13U 1G2MA 1C5TA 2Z9LA 3AW1A 3A86A 1BBRH 1C5QA 2PW8H 1S81A 5LPRA 1VITH 2PSXA 1Y3UA 2GV7A 3Q76A 7GCHF 1DWDH 5FX5A 4DT7B 3GYMA 2A4OA 2BD4A 9ESTA 2KX4A 5EW1H 2ZDMA 1K1MA 3PRDA 1BRAA 5EQRA 1GVLA 7ESTE 1HPGA 6GCHG 3TH2H 1P8VC 2XBVA 3FO8D 1E38B 1LHDH 1QCPA 1GBKA 3Q77A 2BD3A 1MTNB 2G81E 2D26C 3UPEA 1UVOA 4WMDA 4ZCNA 4NA9H 5A8ZA 2YNBA 2FTMA 3SGQE 5IDKA 1V2RT 1LTOA 3K6ZA 3LC3A 3SUGA 4BNRA 2Z9GA 1GGDB 5B6LA 2GD4B 2F9PA 4RT1A 1XXFA 2FS9A 3F9FA 2CK3D 3RXCA 1C2MA 3PLPA 3PM3A 4X1NU 2WV5A 5LGOA 1YLNA 4CBOA 1O5BB 1UCYK 1DLEA 2PV9B 2QN5T 2ZDLA 2L74A 2FOHA 1QB1A 3B23B 3QN7A 1W3CA 5HYOA 1S0QA 3F1SB 1NBMD 5A0CA 2GGVB 1S84A 1O39A 3I29A 2W6JD 3LH3A 3A7ZA 1AN1E 2R9PA 1JRTA 1FN8A 2VU8E 3SI3H 1ELVA 3KHVA 4AFUA 4O9VA 2IJOB 1WXRA 1GBIA 4CRBA 2PUQH 1C5RA 1GL1A 1SGTA 2DE8A 1O2LA 2H5DA 4X8TH 4XD7D 5T6DA 4CH8B 1A7SA 2Y5GA 2FS8A 3QUMP 1FLEE 1W7GH 2KCOA 3O8DA 3TJNA 1C5WB 3JZ2B 1VGCB 2H6MA 3MI4A 2SGFE 1HAVB 2R2MB 1IQEA 1A2CH 2Z94A 2OD3B 2H5CA 3LDXH 2P3TB 2HPPH 1BA8B 2PR3A 3GS9A 3SUDA 4F55A 3ZZDA 4RKOB 1IHTH 1QTFA 4YOIA 2VH6A 4BANB 1GMDG 2ZU1A 4DT4A 3DSPA 1GDQA 1SBWA 2P3UB 5KGOA 2XC5A 1RTLA 2FODA 3MHWU 1WDIA 3U1JB 2BLWA
chains in the Genus database with same CATH topology
4E7RG 1WYKA 1ARCA 2H2ZA 1Y3YA 1DLKB 4YLUA 1C5SA 2V3HH 4JZ1A 1DX5M 3MU4A 5EODA 3UNSA 1HYLA 1DWCH 2SGQE 2OC1A 1KSNA 1YPGH 1GG6C 2A31A 4UFEH 1G32B 4HTCH 3SZNA 3TVJB 1GJ6A 1HIAB 1RIWB 5EOKA 3LT3A 3UOPA 1SFQB 1Z6JH 4WWYA 3UFAA 4XBDA 3P8NA 3UNRA 5C20A 1HB0B 1Q31A 1XKAC 1H4WA 2OQ5A 4XDEA 3TGKE 1TGTA 1EXFA 1EATA 1MBMA 2WPMS 3MNXA 5F6MA 4CH2B 7KMEH 1QRXA 1W12U 1OWJA 1A5IA 1SQAA 3D62A 1F0RA 3A89A 1NRQH 1O3BA 4FUEA 3ZV8A 3W95A 1EP5A 4INHA 1CGJE 2GX4A 1AE8H 4CR5A 3RXBA 2ZQ2A 4BAKB 2QF3A 1Z8JB 1PQAA 1GL0E 4B2BA 3A88A 5A2MH 1WQVH 1F92A 2AIPA 1LVBA 4I33A 3ZZ7A 1C2DA 2XCNA 2FI4E 2EI7A 3AVZA 4NFFA 1PQ5A 1THSH 4Q2KA 1ZOMA 3ZZBA 5C1UA 1EQ9A 4ZXXH 4J1YA 5GCHG 1D3QB 2QY0B 4X2YA 4WH6A 3Q3XA 3ODDA 3P8GA 3ZZ3A 4B2AA 1FAKH 3SW2B 1OSSA 1UVUH 1PPBH 1O3OA 1BTHH 3H7OA 3U8TH 1G2LA 3BV9B 5A8YA 3JZ1B 3N7OA 3P70B 2BDYA 1EAXA 1O3AA 3E3TA 3UQOA 2NU0E 3LC5A 1YM0A 3MH4A 3ZVEA 4Y79A 4Z6AH 2BD7A 1O3IA 2A0QB 1P9UA 2Y5HA 1C2JA 2ZFQH 1TB6H 1CVWH 1GJAB 1MD7A 1FY4A 1ZMNA 2QF0A 5DGJA 1OYTH 2QA9E 3SO3A 6GCHF 1SL3A 2RG3A 2Z9KA 4F4OC 2QIQA 2BYAX 1EOJA 2SGAA 4JYTA 8GCHG 3WY8A 1UO6A 1C5PA 3ZZAA 3ATWA 4BXWA 5C5NA 3RM0H 2GDEH 3SN8A 1CA8B 1L4ZA 1V2VT 1BRBE 3FVFB 5TCAA 2F9NA 1S83A 4JK6A 2BY7X 1ELCA 4Y0ZE 2ZGCA 1QNJA 4IC6A 1TONA 1C5VA 3PYHA 2FLBH 1AU8A 5DPAA 4D7FA 4X6NA 1EZXC 3VB5A 4LK4A 5EU8A 2FYQA 3GICB 5CMXH 1K1NA 2BD8A 5EXMA 1Y5AT 3LH1A 1GBEA 4CHAC 1T7CA 2VVUA 5G4BA 1FPCH 1BTPA 2CHAB 2VIVA 1P2IA 1GJ7B 3ITIA 1C5LH 1KLJH 4KTSA 4D76A 1GDNA 1UHBB 5E2PA 2CXVA 4UFDH 1K9OE 1GJ4H 2OP9A 1O2QA 1QRZA 5HM9A 4IBLH 1CA0C 2UWLA 3SUEA 1SGQE 2O8TA 5F03A 2HGTH 2ODYB 4MNWA 2PLXA 1B0EA 1C5NH 1NS3A 4DURA 1UTOA 2NU4E 4AGKA 5L2ZH 2OC8A 1TBQH 1XX9A 1SGPE 1IOEA 1THPB 3RU4T 4NA7A 1GBTA 1SHYA 2XC4A 2GZ9A 3OU0A 1FN6A 3E16B 3VGCB 4K1SA 3K9XB 5GWZA 3HKIB 2EC9H 2J34A 4IC5A 3O8RA 5EXNA 3CP7A 1H8DH 2BXTH 3A8AA 1DVAH 1GMDF 4R0IA 1O31A 5E0JA 8ESTE 5TJXA 3A7WA 1K1PA 4B73A 1UVSH 2ZHWH 1OX1A 4YTAA 1J15A 1ARBA 1G3CA 1RRKA 4BAOB 1O2PA 1QFKH 2XRCA 4GCHG 2FESH 3T26A 1A5GH 1FDPA 2ANMH 3T27A 5C1YA 3L3TA 1ZPBA 1LQDB 2ZU3A 1GJDB 2IPHA 2JETC 4NSVA 1GI8B 2ZFTA 1LHCH 2J4IA 4B2CA 3B9FH 5FAHA 4Y0YE 4GHQA 1EJAA 1HFDA 2GCHG 1Y3WA 1NN6A 4OS5A 1O3EA 5EPNA 1TNLA 1TRYA 3KF2A 1TMUH 4DCDA 4THNH 1W7XH 3U69H 1LVOA 2SGDE 2UUKB 1MUEB 1O2IA 1YLCA 4KGAA 1NRPH 2WINI 5L30H 1RGQA 2VWOA 1GI2A 3DHKH 1Y5UT 1QR3E 1TNJA 1QBNA 1D3PB 2H9EH 1IQGA 4Q7XA 2JH0D 3RXVA 1V2QT 5DKMA 2ZZUH 1BOQA 1ABIH 3KQCA 5JB9S 1C2IA 3OSYA 4X8VH 3E6PH 3T28A 1C2KA 3NKKA 2A5KA 2I6QA 2NWNA 2VIOA 1C1VH 4DJZB 1C9TA 2O9QA 3BTGE 3E90B 1DITH 4ZROA 2FPZA 3T25A 2BDHA 2JKHA 1E34B 2BDBA 2WV4A 3D23A 2NU3E 4GSOA 3QDZB 1GI7B 2A5IA 2Y7ZA 1CGHA 1DFPA 3A81A 1WSSH 1ZTJA 3KL6A 2TGAA 3BIUH 1O2ZA 1DPOA 3S69A 1PPZA 3F9GA 2XWBI 4K2YA 2PKAB 2ZU2A 3ATMA 3M5MA 2JH5D 3SV6A 4YT7H 5GCHF 4BTIB 3NXPA 4Y7BA 5BPEA 1O2JA 2ZPRA 4XE4A 1BTWA 5EGMA 4AFQA 4ZUHA 2A2XH 3GDUA 1O3NA 4MPVA 2R0LA 1QHRB 1ABJH 2OINA 1BIOA 3MH7A 2RCEA 1GMCG 3AAUA 2V6NA 1MKWH 2F9OA 4SGAE 4KKDA 5EW2H 1MKXK 5EQSA 5GIBA 1FPHH 1VZQH 1QA7A 2ZU4A 1B0FA 3SNDA 1LHGH 1TPAE 3LKWA 4ABDA 1WV7H 2BOKA 3VPKA 3VB3A 5T6FA 1V2UT 1N8OC 8GCHF 4CREA 1HGTH 4GLYA 1TAWA 3PTNA 3PWBA 1EAWA 2OXSA 1AI8H 1MU6B 1Z8RA 4IMQA 2ZHFH 4FU9A 4CRDA 3D65E 2ESTE 1MAYA 5EG4A 4LZ1H 1TWXB 1RD3B 2BY9X 5DO4H 1HAHH 1YCPH 1P03A 2CF9H 1L1JA 1MCTA 2GMTB 4BTTB 3UNQA 3MH6A 3E0PB 3DA9B 3E0NB 4LXBH 2WPLS 5F8TA 4FUHA 1K1LA 4MNYA 4WH8A 1SGDE 3TK6A 1JOUB 1HAYB 5T6GA 1S5SA 1ZZZA 2WYJA 1RXPA 1ZHRA 4ZKNU 4VGCC 1AQ7A 1WAYB 2Q1JA 4Y76A 4YZUA 2ILNA 1ZJKA 5T3HA 1DDJA 1LMWB 1A3EH 1SSXA 1YPJH 5I46H 5FXLA 3P92A 4JK5A 2ZHDA 3LGUA 1A61H 1LPZB 2TPIZ 2KAIA 1NFUA 3GCHC 4DW2U 4J2YB 3RXKA 2VINA 8LPRA 4K1EA 1MZDA 2A45B 2A32A 3D49H 3S0NA 3V12A 1GMHG 3A8DA 1LPGB 3BG8A 4TY6A 3UY9A 4BAMB 1V2NT 1SLUB 3GCOA 1O36A 1J8AA 2GCTB 2G5VA 5GJ4B 2W7SA 1HAVA 2ZFFH 3L33A 4AZ2B 3EAJA 1VJAU 1YPEH 1PPEE 1AUJA 1GHBG 3A7VA 2GV6A 2Z9IA 1SGFG 1TGBA 1N8OB 1GI9B 2ANYA 1AFQB 1TRNA 4K1TA 1AFEH 3MO6A 2FX6A 2A7CA 1C1SA 2G52A 1DSUA 1AB9C 1DANH 2Z9JA 1LHFH 4JCNA 1TPOA 2EA3A 1HAZB 1QY6A 3SV7A 1KTTB 1MKWK 1O3MA 1Z71A 2HLCA 4IS5A 2GCHF 5FHTA 3TJVA 3NUMA 2PSYA 1CSOE 1QB6A 1P01A 2AYWA 3BTME 4ABBA 3ZZ9A 2WPJS 1YLDA 4UEHH 1TX6A 3MTYA 1P10A 4YT6H 1JXPA 1T4UH 2OC7A 1SLWB 2ZF0H 3DT0H 1TE0A 1Y8TA 3LGYA 1D9IA 1GHAG 1HIAA 3SOSA 1GBBA 3ZZCA 1EJNA 1P11E 1XUHA 4VGCB 1HJ8A 1EPTC 1TABE 5K0HA 4ZMAH 3BG4B 3F9EA 3TPIZ 4AORA 1G3EA 3MYWA 4AFSA 1O35A 1B7XB 1O2WA 1ZMLA 4MVNA 2CF8H 4UFGH 5DP8A 2LPRA 3PO1B 3LPRA 3S9AA 2ZG0H 3NZIA 5CHAB 1O5DH 2F9VA 4AB8A 2OBQA 1ESAA 5AVDA 1O2SA 2ZNKH 3P8OA 1A3BH 4ISOA 2BX4A 1ELFA 1O2HA 2ZA5A 1M9UA 5C3NA 4MNXA 2GZ7A 1V2TT 2KAIB 1JMOH 3ZVAA 3K6YA 1F5KU 1IQLA 1Y3VA 3FFGA 3RP2A 1UCYE 4SGBE 1K1IA 4KTUA 2V3OH 2J38A 2VNTA 4AOQA 1VR1H 1ID5H 1SFIA 3HPTB 3SU0A 4LOYH 5E8EH 1C4U2 3PMJA 2G5NA 4X1SU 1LDTT 3UWJH 1O2NA 3ATKA 2CGAA 1GMCF 3UOUA 1EAUA 1O3KA 1G9IE 4KP0A 2O8WA 3FP7E 2VB0A 2QCYA 3TK5A 3MU5A 3GY7A 1GI3A 3HGNA 2ALPA 1BRUP 3LJJA 1C1PA 1OP2A 4UD9H 2DE9A 1AHTH 2BDAA 4ABFA 1IQKA 4U32A 4CRAA 1P2JA 3GY5A 1O2TA 1BHXF 1D4PB 1F0UA 3QK1A 3GDVA 1KYNA 2AH4X 1P2NA 2A2QH 2FP7B 3ATIA 1JBUH 1O2MA 1ZLRA 3KQDA 2AEIH 3SU3A 1BTXA 4FU7A 3VB6A 1BBRK 3S7KB 1SOZA 3VEQB 2P59A 3QZRA 1A46H 1GBAA 1ZHMA 2WPIS 1ZRBA 4NZLA 3A7TA 1MD8A 3RXSA 1CT0E 5E0HA 3U9AH 4A1TA 3QTOH 2HVXA 4I32A 2XCFA 4NIVA 3GY4A 1IQNA 1RS0A 1MTUA 1YPMH 3K2UA 3GY8A 3UQVA 4JZDH 3MNBA 2O8UA 1S6HA 4GVUA 2P3FH 7LPRA 1BBRE 1O2UA 3F6UH 4MPWA 1BHXB 2PKSC 3AW0A 2ZTXA 2FXRA 5FBIA 1NFXA 4O3UA 3SJKA 1UMAH 4NIXA 3TNTA 1P3EA 1V3XA 5A0BA 4O97A 2OUAA 2FOBA 1AVWA 1DY8A 1GHYH 1EZSC 1UHBA 2TGDA 1C9PA 5AFZH 4O03A 3T62A 1LKBA 3L6PA 1NRRH 5DP3A 4CBNA 1BUIA 1C2LA 3CS7A 1O3JA 3KN2A 2FOFA 5LPEA 1GDUA 3KNXA 1RFNA 1GMHF 1SB1H 4ZHLU 1P09A 1V2WT 3MMGA 4H4FA 2ZU5A 2B7DH 3ATLA 1FAXA 1OOKB 1MTWA 2WPKS 1OXGA 1HJ9A 1GCTC 1HRTH 2Y81A 2RA0A 1AKSA 1TX8A 1GHBF 1K1OA 2Y6TA 3E1XB 3RLYH 5ESBA 2UUYA 4BTUB 4TY7A 1SI5H 3TU7H 1AZZA 1J14A 2ZTZA 3SU6A 1QBVH 1LVYA 1D3TB 1ELTA 2BQ7B 5EQQA 3VB4A 3UR6A 3A84A 4IGDA 1FY1A 4WJG2 2G8TA 1GG6B 4M7GA 3BN9A 1QJ6B 3GYLB 5ABWA 2ZGJA 1GBDA 2ZDAH 1C5MD 4RKJB 3DD2H 4UFFH 3MNSA 2H1UA 1HJAC 2A4GA 4WF8A 5JBBS 4ZKRU 2BD5A 1TIOA 3QWCH 5J4SA 1CO7E 1O33A 1TGCA 2O8MA 3EDXB 1GHAF 3O8BA 1C5UA 5DP6A 2B9LA 2G4TA 1O5FH 3HK3B 1THRH 3M5NA 4JYVH 4CRFA 5K7RA 2NU2E 5JBAS 2GDDA 1C1NA 3A7XA 2G55A 2IOTA 3EYDA 4O3TA 5IYTA 4ZH8A 2XWAA 1KY9A 4A5TS 1AGJA 1BTUA 1P04A 2XTTB 3HGPA 2O8LA 1ZTLA 3TNSA 3T29A 4B75A 1V6DA 4MPXA 1MU8B 4X2WA 1SR5C 4ISHH 1INCA 2A4RA 3QGNB 1EASA 3M5OA 2P94A 1P9SA 3FZZA 1CHGA 4Y11E 1HBTH 3GCNA 4DOQA 3ZZ8A 1LHEH 3SU4A 4X8SH 3TJUA 5AF9H 4GAWA 3GY2A 1GCTB 1O5EH 4Y8XA 2GT7A 2ZDVH 3IITA 5FCKA 2QV1A 1VCWA 3A8CA 3HATH 2P95A 1GVKB 1GI4A 3SHCH 2PKAA 3QGJA 2IN2A 1AZ8A 2UWPA 5DG6A 1WU1A 1NRNH 2HNTC 1DXPA 2QXIA 1NO9H 1GPZA 1RTKA 3F9HA 1EZQA 3M5LA 1Z8IB 5ETXA 1AKSB 1OP0A 3IG6B 1ZPZA 1MAXA 3RXEA 1YGCH 2P8OC 4ABGA 2Z3EA 1TGSZ 1V2JT 1N1LA 1N6YA 1FQ3A 4I31A 5JB8S 1O30A 1QA0A 3F68H 3UREA 1NM6A 1QURH 2F9BH 3SJ8A 1X7AC 3V0XA 1IQJA 2C90B 2GKVE 4JZFH 2ZGHA 3NCLA 1TPSA 1D6WA 2A4QA 4I8GA 2VGCC 2XBYA 2VJ1A 5J4QA 1O2GH 1XUKA 4FUFA 4DGJA 1UTNA 4WMFA 2ZI2H 2ZFPH 2XBXA 3RXAA 6ESTA 1TQ7B 1NY22 3UUZA 3PB1E 1MH0A 4Q7YA 4CHAB 1WBGB 1ETRH 3GY6A 3MO9A 1TMBH 3TH3H 3SHAH 4XSKU 5FBEA 3TGJE 3O8CA 4BAQB 4D9RA 3M36A 1C5ZB 1W14U 3U8OH 1KTSB 1ZSLA 1DUAA 2FEQH 1PPGE 4OS4A 1FV9A 1TGNA 1CA0B 1QQUA 2Q6FA 1UVTH 1UTPA 3RXIA 2FM2A 1ZGIA 1SQTA 4U2WA 1W2KH 1GHXH 2FOEA 4NWKA 4X1PU 3M37A 4ISNA 1P2OA 1BMAA 3GISB 2EI6A 1JRSA 1UK4A 2RDLA 4GUXA 2ZEBA 1XVOA 2ZCKP 5L6NH 3VFEA 1KXDA 2ANKH 3RXJA 1FMGA 5JYIA 4MG3A 3QLPH 3SUFA 3P8FA 5TCCA 1TX7A 3RXRA 3A80A 2J2UA 3ZVFA 2BY6X 1XUJA 3LGVA 4X0WU 4IMZA 2BZ6H 2ALVA 1MQ5A 4NCYA 2CN0H 3LOXA 2ZQ1A 3LJOA 3M61U 3SJOA 3MWIU 2XBWA 1TNGA 2BMGB 4OS7A 1LCYA 3SGAE 1BT7A 2VH0A 1UTKA 2BOHB 4CRGA 4JMYA 4Y8ZA 3UR9A 4ABEA 5JPMH 1OP8A 3OY5U 1GI6A 1B5GH 1T31A 2JETB 4A1VA 2SNWA 2Z3D