5A8XA

Crystal structure of human neutrophil elastase in complex with a dihydropyrimidone inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
215
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Neutrophil elastase
publication title Potent and Selective Human Neutrophil Elastase Inhibitors with Novel Equatorial Ring Topology: in vivo Efficacy of the Polar Pyrimidopyridazine BAY-8040 in a Pulmonary Arterial Hypertension Rat Model.
pubmed doi rcsb
total genus 41
structure length 215
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8xA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5a8xA02
1BJVA 1NRSH 4X8UH 5L2ZH 1YLCA 4NFFA 4J2YB 2FODA 3ZV9A 1RFNA 3RXLA 1XMNB 2Z3DA 2G5VA 5JYIA 3GY2A 1MKXH 2EI7A 4D9RA 5GPIB 4BANB 3P8GA 4Y76A 1HYLA 4U01A 3RXMA 4ZH8A 1K1PA 2LNCA 1SFIA 2TRMA 3ZZ6A 1FY4A 4AN7A 2PKSB 3H7OA 1ZPZA 1WTGH 1ZJDA 3BG4C 1BMLA 5DP7A 2CF8H 4OS4A 1L2EA 4FUDA 4DCDA 1UTJA 4ISHH 3SV6A 1SGRE 4JK5A 3M5OA 3ODDA 1O2JA 5FPYA 1TPOA 1RTKA 1O5DH 1GBCA 1H9LB 1TBQH 1QFKH 4INLA 4A92A 3ZZ5A 3OTJE 5EXNA 2G4TA 1O5AB 1V2JT 2PLXA 4ISLA 2H9HA 1F0TA 3TIUA 4UE7H 1GI0A 2BY7X 3MU4A 1NU9A 1QQUA 1F0RA 3P17H 3V0XA 4A6LA 2ZFSA 4K1SA 4JMYA 5E0JA 1EKBB 5T6FA 2ZNKH 1C5PA 2P8OB 1EXFA 5CHAB 1L1NA 1HAZB 1ZSJA 1LCYA 1C5NH 1PJPA 2YOLA 1QRXA 3ZZ7A 4HZHA 4CRCA 3FP6E 1OYTH 2O8MA 3EGKH 4X6PA 4NZLA 4CR5A 1SG8B 3UREA 2ZPQA 4K8YA 1T4VH 3LGYA 1WUNH 1DWEH 1VZQH 3F9HA 2XBVA 1ZMNA 3S69A 3U1IB 3ZVAA 3UY9A 3U8RH 1UCYK 1G3BA 1O0DH 1XX9A 4THNH 1O2VA 2GP9B 1C2KA 4A1TA 1SQOA 4JZIA 2F9OA 2FESH 3HATH 1XVMA 1DSUA 1FPHH 4J1YA 2FDAA 2HVXA 3UPEA 1AVWA 4WWYA 2P3TB 3T26A 4JYUH 1O3BA 1MBQA 2A32A 4U30A 1C5XB 1MH0A 5AVDA 1GHBF 1O2QA 4ABBA 5BPEA 3EYDA 4NSVA 3PMBB 5DP3A 1DWDH 2V6NA 3GY8A 3FZZA 2BX4A 4WF8A 2OQUA 3MH6A 1TNHA 2ZZUH 6ESTA 1QB6A 5I25A 3GCHC 2VB0A 1J17T 2BLQA 2UUYA 4WMDA 4YLQH 1O2KA 3E90B 5ESBA 1CHGA 3SOSA 5J4QA 2LPRA 3A8DA 1TGCA 3P8NA 1J15A 2XW9A 1GMHF 4GCHG 1GDNA 2CGAA 2JH0D 2H2ZA 1TMBH 8GCHF 1WV7H 3TLOA 1EAWA 3E1XB 6CHAC 3ZYEA 3ATKA 2FOFA 1TQ0B 4IN2A 1GCTC 2BVRH 2OINA 2WYGA 2BDBA 4AG2A 1GJ7B 3RMLH 1FUJA 1GI7B 1V3XA 2SGPE 1HIAB 1H8IH 3ZVFA 5EW2H 3TNSA 4TY6A 1O2LA 4XSKU 1QBVH 1EJNA 5EXLA 1UVPA 1FV9A 1A5HA 1V2UT 2OC8A 1DT2A 2QXIA 5A8XA 5L30H 5HGGA 1OSSA 1Z8RA 1TRNA 4B2BA 1EJAA 4Y0YE 1YYY1 4ABGA 3BF6H 2Z9GA 1IOEA 1NROH 7GCHG 2AEIH 4MTBA 2BD4A 1BJUA 4Y7BA 1NFWA 1FIWA 4TY7A 2FWWA 1HJAB 1K21H 2OCVB 2VH0A 2Y7ZA 1NT1A 1UO6A 5AFYH 2ZHDA 4F4OC 2Q6DA 2VVCA 2VWMA 1NC6A 2WV4A 1ZTJA 5FHTA 4ZXYH 1NRNH 2BZAA 1LHCH 3ZZDA 1ZPBA 2DE9A 2HWLB 1G30B 4CBNA 4H6TA 3Q3KA 4XFQA 1D4PB 2ZCKP 4YZUA 4H42U 4I31A 1GI6A 1AFQB 1OWJA 5K0HA 1FIZA 2ZGBH 3UOPA 3GY4A 2Y82A 3MO6A 4X8VH 1FQ3A 4MNXA 4UD9H 1Y3VA 3SN8A 1QY6A 4UEHH 1TBZH 4CHAB 1P11E 4FUIA 1MMJN 1CU1A 1V2TT 1CGHA 1ZMLA 2W3IA 3ITIA 3RC4A 1O39A 4IBLH 1S0RA 2PR3A 3RXOA 3UWIA 3GYMA 1O37A 4X0WU 1GBJA 5F8TA 6GCHF 2G8TA 1BBRK 5GCHG 1C2DA 5ETXA 1DE7H 1GMCF 1EX3A 1HAXB 1QJ1B 1OKXA 1EPTA 1OS8A 4AFUA 1BB0B 1MKWK 1LVBA 2A7HA 3SUFA 1FN8A 1CE5A 4NA8A 2QC2A 2BOKA 3URDA 5C3NA 3FFGA 2QYIA 3EQ0H 3U8TH 1UTNA 3OY6U 2ALVA 1QNJA 1C4U2 2A7CA 1H8DH 1AUJA 1P2OA 1LHDH 1SGPE 3LJJA 3RXPA 3EA9A 4MPWA 2TGDA 4X2VA 2XXLA 9ESTA 2OQ5A 1QBOA 2ODYB 5DP6A 1YPEH 1T31A 4DVAU 1T8OA 1YF4A 1O2UA 2UUJB 1MD7A 1IQJA 1NU7B 3ATIA 2R2MB 4ABAA 1UCYH 1LKAA 2WINI 1PPHE 1EB1H 1OP2A 1TRMA 1HCGA 1C1UH 1F5KU 2BHGA 1K2I1 2R0LA 5FCRA 1L1GA 3QGJA 1ZSLA 1NS3A 2FS8A 1GL0E 4ZKOU 4TWWA 2OP9A 1KLJH 4FUGA 2ZCLP 3JZ1B 7ESTE 3CS7A 5T6DA 1B0FA 3F6UH 4HI3A 3LC5A 2A5IA 2ZU1A 4ZXXH 1ELGA 1PPFE 5DPAA 3VB7A 4AB9A 1XXDA 2BQ6B 1XUHA 3H7TA 3ZZ9A 3U69H 1O3DA 1TNGA 4D76A 1GGDC 2BDCA 5LPFA 1O3GA 3K65B 1O5FH 4LXBH 1HGTH 4ISIH 2OBQA 1PYTD 2EEKA 4OS2A 4DGJA 2C8YB 1P2JA 1INCA 2IOTA 4O03A 4BAHB 2THFB 3GY5A 4X6MA 1GJ6A 1WQVH 1NPMA 2ANWA 1AVXA 1RRKA 2RA0A 4BTTB 4Y8YA 1G9IE 5A09A 2VIDA 4AB8A 2FM2A 3I29A 3T28A 1LKBA 2IJOB 2Z6BD 2Z9KA 3CP7A 1DWBH 3SJOA 3SV9A 1W7XH 3A7YA 1W14U 3KF2A 3AAUA 3IITA 1P2MA 4A7IB 3M37A 4X8TH 2AMDA 1CBWC 1H1BA 1P03A 1C5QA 4CRDA 2GVFA 1L1JA 1JWTA 2GKVE 1TX8A 3KCGH 3T2NA 2EI6A 1C1NA 3T5FH 3LKWA 4ISOA 2FS9A 1LQDB 1Z1JA 1C5TA 2FOHA 1BTPA 3PROA 1N6YA 2R9PA 4B73A 1SHYA 5A0AE 1JIRA 3ELAH 3E8LA 4A1VA 5TCCA 3SNCA 1JBUH 2WPJS 3I77A 1SBWA 1ABIH 3E91A 2BYAX 1BTXA 3SHCH 2CV3A 1GMDG 2SGDE 3SU3A 2WUBA 4IN1A 1GL1A 1PPCE 1UVOA 2CHAC 3MYWA 1DANH 2B0FA 2BDYA 5FX5A 1UCYE 1C2MA 1C1RA 1FAKH 3ZVGA 2VIOA 1G36A 1EUFA 4KKDA 4YESB 3F9FA 2ZGJA 1G37A 1LHFH 1OX1A 2GV7A 5DJ7A 3SW2B 4NZQA 5E0HA 4NIXA 4ZHMU 2BY5X 2GD4B 3RM0H 3AASA 1Y3YA 1HAOH 1QHRB 3DUXH 1GI9B 2BVXH 3MU0A 1ETTH 1ZMJA 1S6HA 1ELAA 1YPJH 2Y5FA 1GHWH 1AD8H 1WU1A 4KTCA 1ZPCA 2SGEE 2RDLA 4XBCA 1OWHA 1S85A 1GBBA 4YOJA 3GOVB 1C9PA 5T6GA 1V2RT 3SI4H 1A46H 1S6FA 3RXFA 2GCTB 1P2NA 1TALA 2AIPA 2F9NA 3S9AA 3V13A 3K2UA 2VGCB 1MKWH 3V12A 1EZSC 1SGFG 2ZCHP 1QL7A 4X2YA 1AE8H 3GCTF 2F91A 2ZDKA 1LHGH 1BRCE 3SU5A 1O3CA 4FUCA 3RMOH 3S9CA 1KXCA 3T25A 1EB2A 4X1RU 1O3OA 1LPKB 5DP5A 1LHEH 3RXTA 4YT6H 2NU4E 1RIWC 2W7SA 4BAQB 3U1JB 2FMJA 4LZ4B 2GZ9A 1F5RA 1C5MD 1VJAU 1SGFA 2C3SA 2FIRH 1TGSZ 1S5SA 1ZGVA 1SI5H 5JBTA 1SL3A 3EA8A 1YGCH 3ATMA 2BD7A 2NWNA 2Z9IA 1OP8A 4MQAA 1AB9C 2J9NA 4UFEH 3QDZB 1AZZA 2AGIX 3LONA 1C1TA 3P8FA 1GVKB 1UTPA 2ZFQH 2O8UA 3UQOA 4X6OA 3TU7H 2HGTH 2FOEA 1NESE 3KQEA 1GG6B 4CRAA 1O2NA 3FVFB 1KLIH 3BTHE 1O2RA 2CJIA 2GCHG 3P92A 3OY5U 3RM2H 1YPKH 5K7RA 1V2ST 2W26A 1N8OB 2WPHS 2Z7FE 3SJ8A 1D3PB 1P2IA 5AF9H 1AZ8A 3SU6A 3LH3A 2VVUA 3OU0A 2F9BH 3PO1C 1P04A 2TGPZ 4ZHAA 3U98H 2GMTC 4K1TA 1SC8U 3BSQA 2ZHQH 2ULLA 2GZ7A 1GBDA 4B71A 3L33A 4MNWA 1TX7A 5DO4H 3RLYH 2QY0B 1KIGH 2FP7B 3GY6A 3A8BA 2O8TA 2Y5HA 4NIVA 2H9EH 1UTOA 1DS2E 3O8RA 1K28D 1BRAA 3UNSA 2O9QA 1XVOA 2GT8A 1CSOE 1GHZA 5E0GA 3I78A 2Y81A 4YOIA 3RXUA 1S0QA 2OC7A 1BBRE 1GBIA 3MFJA 4R0IA 1MUEB 3Q3YA 1ZGIA 2WPKS 1J9CH 4LK4A 1D9IA 2H5CA 3VB3A 4ZAEA 4UFFH 2OTVA 1JRSA 1UVSH 4ZHLU 3S7HB 1Q31A 2J34A 1CO7E 1IQKA 1GJ4H 1TFXA 1CHOG 2PTNA 2VU8E 1CQQA 1XUKA 1O2OA 2GX4A 3LPRA 1Z8IB 3A7VA 4KTUA 3ZYDA 5JBCS 3ZZ4A 3SV2H 1BTZA 3EA7A 1O35A 4R8TB 2ZQ2A 3SU1A 5GCHF 5GDSH 2V35A 1BA8B 4Q7ZA 5C1XA 3LIWA 4Y8XA 1C1OA 4Y0ZE 1P0SH 5EU8A 2ZDLA 2ZHEH 1T4UH 3VB6A 3MOCA 2ZDAH 2ZFTA 3O8BA 2TBSA 1O5GH 1ELFA 2QAAA 1TGTA 4OS6A 5GIBA 3TJUA 1C2LA 1ELCA 1NZQH 1O2IA 2Y80A 4FVDA 3STIA 3SUEA 1SGIB 4IC5A 1C2GA 2BB4A 1C4Y2 1HJ9A 1UMAH 2SNVA 4X1PU 1ZLRA 4BXWA 1SQAA 1OXGA 4FXGH 8ESTE 4ABIA 4RN6A 1KTTB 1K1NA 3GDVA 1W3CA 2H5DA 4B74A 2OUAA 3LGWA 4DIHH 1LVMA 2G4UA 1GHAG 5GWZA 3SNBA 2Z94A 1JRTA 2V3OH 5DGJA 5F6MA 4LZ1H 1QURH 5L2YH 1MZAA 1VGCB 4WH6A 3NWUA 1HNEE 1GBAA 1Q2WA 4Y7AA 3A87A 3MNBA 1C5OH 2XNIA 2W3KA 3DT0H 1DM4B 2AIQA 1O3FA 1SGNE 1NRRH 4H6SB 1GBTA 1KTSB 1H4WA 1DY8A 1W7GH 1IQLA 1YBWA 2AH4X 2C8XB 1OWDA 1NO9H 4AFQA 3MTYA 3TPIZ 1E36B 2P3UB 1TNJA 4DY7B 1NN6A 4O3TA 2GZ8A 4XE4A 4Y79A 2V3HH 2BVSH 5I46H 2P59A 2XC5A 3QTVH 2O8LA 1YPGH 4ABHA 1RGQA 1ESAA 3U8OH 2G52A 3HKJB 2F83A 3ENSB 2J38A 2ZDMA 1O5BB 2FZZA 3D62A 5FBEA 4A5TS 4NG9H 2GT7A 2R3YA 2VJ1A 3W95A 3BEIB 4IS5A 4GAWA 1AUTC 1C2FA 4YT7H 1KYNA 1CA0B 4JZ1A 5EQSA 1UVUH 2ZHWH 1SOZA 2VWLA 4UFGH 2BOHB 3PTBA 1CBWB 1BT7A 2XWBI 1EOLA 4TYDA 1TGNA 5FXLA 4WMFA 4FU7A 1KXAA 1NRQH 5SGAE 4O9VA 4E7NA 3NUMA 2BY6X 5E8EH 1AKSB 2AMPA 3SV7A 2NU1E 1MD8A 3LGTA 3OSYA 3VGCC 1W8BH 1V6DA 2ZEBA 5LGOA 1UJ1A 1O38A 1D6WA 2FYQA 1QB9A 4MLFB 1V2NT 2HNTE 3GY7A 2ZPRA 3A80A 3N7OA 2XBWA 2BDGA 4JK6A 4YO9A 1V2MT 3B23B 3AVZA 2CHAB 4E06H 4GVUA 3LJOA 2J95A 2D1JA 2Z9LA 3DFLA 1E37B 4RKOB 3RMNH 2FEQH 1FMGA 3P8OA 1O2MA 3B8JA 5E2PA 4VGCB 1MTNC 3BTKE 2NU3E 3MO9A 4ZMAH 1Z8JB 1D6RA 1WBGB 1AHTH 1KSNA 2AFQB 4FUBA 3ATLA 2JETC 5CMXH 1FNIA 1QQ4A 2FLRH 1FONA 1V2KT 2UWLA 5HM9A 1VCWA 1CGJE 3VEQB 3A83A 5F8ZA 3QLPH 2VIQA 3RDZA 1Z71A 3E0PB 4UFDH 2FI4E 1IHTH 4XDEA 3SI3H 1EP6A 1FAXA 1EQ9A 5C5OA 1QB1A 3FP8E 1FPCH 3LGUA 1EOJA 2BQWB 3SHAH 1JIMA 1YPHE 5AHGH 3RUOA 2PKSC 1MCVA 5EPNA 1T8MA 4JYVH 3M3VA 4E7RG 1PFXC 1PQ8A 3NKKA 1ANDA 1GWAA 4CRGA 4CRFA 1GJAB 1BIOA 4KGAA 4ABDA 5HXFA 2PSXA 4WMEA 3RU4D 3PLPA 1VR1H 1TYNA 3PMHB 1NY22 4NA9H 1SR5C 4K8BA 1HJ8A 1S81A 1PPZA 4Q7YA 2ODQA 1EAIA 1TAWA 2XBXA 3A84A 4YM9A 1ETSH 3R0FA 3RP2A 3PWBA 2VH6A 3QUMP 3KHVA 4KP0A 3F68H 1OWKA 3ZVBA 1LPZB 1BMAA 3QZQA 5JB9S 1EAXA 1UHBB 5T3HA 4Z0KA 2FX6A 2P8OC 5CHAC 5EQRA 4TWYA 3A7ZA 2QN5T 3DHKH 1E0FD 3RXAA 3T27A 1RTLA 4KTSA 3ZZ3A 3M7UA 1SOTA 2GDDA 3D49H 1TGBA 3U9AH 3KN2A 4O3UA 3F9EA 2GCHF 2ZQ1A 4GHTA 1XUFA 1QCPA 4Y10E 1K1IA 3SGBE 1IQGA 1BOQA 2G00A 3ZV8A 2ZU2A 1O3AA 2D26C 2UWPA 1DOJA 1UVTH 3ZZAA 4K69A 1HV7A 4OS7A 3LH1A 1EP5A 3BV9B 1MZDA 2BD9A 4JZEH 4QT8C 1ETRH 1W0YH 1SB1H 1DWCH 1GBFA 2GMTB 3A86A 4I8GA 3PM3A 1TMTH 1FY8E 2WV5A 3CS0A 3MH7A 2XTTB 4DW2U 2FX4A 3PLKA 4DG4A 1MQ6A 1FI8A 1Q3XA 4IC6A 1GHBG 1SGYE 4CR9A 4X8SH 2Q1JA 1A7SA 4U2WA 1QL8A 1O2GH 1QL9A 1TNLA 5IDKA 2QF0A 1N6XA 1DX5M 3F1SB 1G32B 1AIXH 1P8VC 3TH4H 1YP9A 1W12U 3Q3XA 3MO3A 1ZRKA 1F92A 1ID5H 2F9PA 3QWCH 1OP0A 1CVWH 5FBIA 5EQQA 2I6QA 1RJXB 3ZVCA 1TBRH 1AGJA 1AO5A 1GMHG 2FOGA 4PROA 1P06A 2ZU3A 8GCHG 1E38B 1P9UA 3HPTB 1QRZA 1C1QA 1E34B 1O2HA 2TIOA 2C90B 3K6ZA 3PYHA 1FDPA 2BD2A 5G4BA 1IQIA 1BTUA 4Y71A 2QF3A 3BG4B 1UTMA 3VB5A 4B75A 1S83A 1ELBA 3KQCA 1GDUA 2ZA5A 5DP8A 1ARCA 1TX6A 4FUJA 2FOAA 3WY8A 1TOCB 5LPEA 4NGAH 1O2WA 1ZZZA 2FI5E 4I32A 1WOFA 3RXDA 4OGXA 1TMUH 3UIRA 7LPRA 1QJ7B 3TJNA 1AY6H 1HAYB 1WYKA 1BITA 4AX9H 1O5CB 1W13U 4TPYA 4YTAA 3BTDE 1HJAC 1LDTT 4D9QA 3SJIA 3LT3A 4Z6AH 1O36A 1GBLA 4AZ2B 2K1QA 1HAGE 1HXFH 2RA3A 1TA2A 2BQ7B 2SGFE 1A2CH 4CREA 1DY9A 1O3KA 3D23A 2J2UA 1MAYA 1FY5A 3SJKA 2QXHA 3TJOA 5C2ZA 1T7CA 1XKBC 5FPTA 4XBDA 5A2MH 3W94A 4OS5A 1W11U 4AGJA 1XM1A 3GICB 4HTCH 3B9FH 2ANYA 8KME2 2ZDNA 1FXYA 1AFQC 2Z3EA 3A7XA 5C67A 1TABE 1GI5A 3SUGA 4FUHA 5FCKA 3RXBA 3NZIA 1GJBB 3SNEA 5F8XA 3RXQA 2Z9JA 1BBRH 1FY1A 4WJG2 4I33A 2HLCA 1IQFA 2A4QA 2BLVA 2BMGB 2PKAB 3A7TA 1Y5BT 3T29A 1C5ZB 4AGKA 1SFQB 1K22H 2Y7XA 3BIVH 2QXGA 4CHAC 1V2VT 3HGPA 3A8AA 3M35A 5EODA 1FLEE 1BTYA 4GSOA 1TIOA 2XYAA 1SLXB 2BY8X 2VIWA 4ISNA 5A8YA 3MWIU 1TNKA 2HPQH 1K1LA 2AGGX 1Z6EA 1Y5UT 5PTPA 4GPGA 2H9TH 1AN1E 3LDXH 4MPXA 2BTCE 1QRWA 5GXPA 2HPPH 1DSTA 1HAHH 5CE1A 1BUIA 6GCHG 1ANEA 1AKSA 3M5MA 1GMCG 9LPRA 3GYLB 2A5KA 4OGYA 3TH2H 1MCTA 1LPGB 1C5RA 3E6PH 2A7JA 2FOCA 1ZJKA 3GCHB 1BQYA 1ZYOA 1ORFA 4MNVA 3TGIE 4GCHF 2D2DA 1JOUB 1P57B 1SHHB 3GISB 4Q80A 5EW1H 2DE8A 1UTLM 1HAIH 1OOKB 3V7TA 3MH4A 4ZKNU 2A2QH 3SU2A 3G01A 6CHAB 2WPLS 4BTIB 3LGVA 1RXPA 2H1UA 1GCTB 2PUQH 4AFZA 1SLVB 3BTME 1DICA 1HRTH 2OXSA 3UTUH 5A8ZA 3HGNA 5JBAS 4I8KA 3VFEA 1CA8B 1MTUA 3JZ2B 1Z6JH 1PPEE 2OC1A 2NU2E 3ZVDA 1O3LA 1HAPH 2JKHA 3A7WA 2CMYA 2IPHA 2FTMA 1GBKA 4DURA 2H6MA 4BAOB 1P2QA 1MBMA 2Q6GA 7GCHF 2PGBB 5B6OA 1O3MA 1P9SA 2QIQA 2ZGXH 4NIWA 5A0CA 2ASUB 2M5TA 3D65E 3TGKE 1YKTA 3VGCB 2OBOA 4ABFA 2QGRA 3MH5A 4ZROA 2FYRA 2J94A 2ZTZA 3M3TA 5ESTE 3RXCA 1THSH 1EZXC 2Z3CA 2BXUH 1YM0A 1FY3A 4INHA 1KDQA 4HFPB 4CRBA 4D7FA 1S84A 1GJ9B 2A4OA 4BXSA 4ZKSU 1G3CA 1UK2A 1O3PB 2ZFRH 3BIUH 3A89A 1P01A 3A82A 3BG8A 3TK9A 4GLYA 1GBMA 1KXFA 3V3MA 1C9TA 3TH3H 5EG4A 3H5CB 2G51A 1UTKA 1ZHPA 1D3TB 1QTFA 2RG3A 3M7QA 1ELVA 1MTVA 5DP4A 3A88A 2BDHA 2STAE 2C4FH 2J92A 1GPZA 2GV6A 4NA7A 5FX6A 2JETB 3NK8A 3OYPA 4D8NA 1CT4E 3SV8A 1LO6A 1UHBA 3RC5A 2VWOA 1P10A 1C4V2 3E0NB 1HBTH 1Z7KA 2G81E 1C2HA 3KL6A 4JZDH 4BNRA 3VB4A 1DLEA 2BX3A 2TGAA 3QX5H 3LGIA 1VCQA 4FVBA 3M7TA 1SGDE 1O34A 2PSYA 2XC0A 1TQ7B 1BDAA 1GDQA 1HUTH 1SSXA 3ODFA 1T8NA 1K1JA 1SLWB 1EZQA 2BD3A 2QCYA 1VJ9U 2ODPA 1O3JA 3AAVA 1HFDA 4AYYB 3RXGA 3BTTE 4B76A 4DOQA 3KNXA 3CENA 2A4GA 3STJA 4I8LA 3S0NA 3BTGE 2Q6FA 4OS1A 1WCZA 1AU8A 1BRUP 1ELDE 2BXTH 1BHXF 2A2XH 3LOXA 4YOGA 1EASA 1QGFA 1G3DA 1WTHD 5IYTA 1VITH 2PGQB 3BTFE 1EJMA 3MMGA 3KIDU 1KLTA 1D3QB 4UONA 5E2OA 2JH5D 2GGVB 1YLDA 1TOMH 1F7ZA 1A0LA 2ZP0H 2C8ZB 3DD2H 1L4DA 1W10U 2ZKSA 3A8CA 2B7DH 2VNTA 2HNTC 3MHWU 4WXIA 1GI8B 3TVJB 3IG6B 2HALA 3ESTA 1KY9A 1DITH 1GHXH 3VXFH 2OC0A 1V2LT 2CF9H 3KQDA 4B2AA 3MU5A 1ZHMA 4A1XA 1NFUA 3VPKA 1LQEA 5FPSA 1TRYA 2ZO3H 2WYJA 1SGEE 1OWEA 5A0BA 1HDTH 3SGQE 3T62A 2VVVA 4FU8A 2GCTC 8LPRA 2OLGA 2OD3B 4HGCA 3OX7U 1C1MA 4Q2KA 5JBBS 2VGCC 1C5VA 4K2YA 2BDIA 3UFAA 3UR6A 1GGDB 1GI2A 4SGAE 1YC0A 5DK1A 3K9XB 2XBYA 3TGJE 1GHYH 3UOUA 2R0KA 1O2SA 1DLKB 2ZF0H 3GCTG 5DG6A 1T8LA 1NM6A 1XUGA 1HLTH 5HYOA 1YPHC 1NFYA 2P93A 1P05A 2FTLE 2DUCA 1THRH 1GI1A 1ACBE 2R2WU 2XWAA 1ZTKA 2VWNA 3L6PA 1VITG 3QGNB 1Y3WA 3C27B 1W2KH 2VINA 1SLUB 1GI4A 3EE0B 1C5LH 3RLWH 1XUIA 1K9OE 3BTQE 3KQBA 4WY3A 3SQEE 1BRBE 5H4IB 5EXMA 4CH2B 3GCOA 2BY9X 4Y6DA 4NSYA 3SU4A 3SUDA 6LPRA 5JB8S 2G5NA 4K5ZA 2XRCA 3MNCA 1GG6C 1O5EH 1EPTC 1U6QA 5GJ4B 1AVGH 1L0ZA 2WPIS 3DFJA 4SGBE 2ZU5A 4BAMB 2TPIZ 4Q7XA 1ZTLA 2ZDVH 1GJDB 1N8OC 3RXSA 4TPIZ 4FUFA 1DUAA 1OYQA 1TE0A 2W5EA 2AERH 1MAXA 1V2QT 1IAUA 1GMDF 3QN7A 4Y8ZA 1TNIA 1GHVH 2FOBA 3QK1A 1QR3E 2KAIB 2D8WA 1GCDA 3HK6B 2PKAA 1W0ZU 4JZFH 2YNBA 3MNXA 3RXJA 1P12E 1MU6B 4NWLA 3HK3B 2C8WB 3P6ZB 3S7KB 4NCYA 2AYWA 2V0BA 5DKMA 3P70B 1BMMH 1WQSA 1Y3UA 1AWHB 1HB0B 3RXKA 4MVNA 1FZZA 1O32A 4MG3A 1FJSA 3E16B 2CN0H 1MU8B 3NXPA 2QA9E 1O2TA 3L3TA 1YCPK 2BD5A 1NTPA 3RXIA 1C5YB 3HKIB 2ZFFH 1AFEH 1JXPA 1ZHRA 3SZNA 5JPMH 1M9UA 3AW1A 1DPOA 1HAVA 4UDWH 1ABJH 1CT2E 4WH8A 1HXEH 1CGIE 2P95A 1GVLA 1KDQB 1B5GH 2ZC9H 1F0UA 1O3NA 1UK4A 1TA6A 2A45B 3O8DA 1H9HE 2P94A 3UWJH 2WUCA 4Y11E 1H9IE 3SJ9A 1ANCA 4DIIH 3ZVEA 1PPBH 1WSSH 1BMNH 2SGAA 4NIYA 2HOBA 1WAYB 2PWXA 1MQ5A 2ESTE 2XCFA 3TNTA 2ZTYA 1F5LA 1F0SA 1LMWB 3S9BA 1RIWB 1C1SA 4RSPA 4H4FA 1P3CA 2GTBA 1AMHA 1A3EH 1F2SE 1TPPA 5EGMA 2W7UA 1PQ5A 1O3HA 1EAUA 1ZOMA 3PMJA 5TJXA 2AGEX 3FP7E 2STBE 1AB9B 3URCA 1K1OA 5L6NH 1SGTA 1IQNA 4X1QU 1IHSH 1GI3A 1EZUC 3IWMA 3PLBA 2BDAA 3M3SA 3DA9B 1E35B 2SGQE 2P16A 1O2YA 2ZFPH 2ANKH 3BN9A 2HRVA 1C1VH 1DDJA 4X1SU 1EATA 3RU4T 1G2MA 1VGCC 4DJZB 4FU9A 3ATWA 2F9VA 2EC9H 1QJ6B 3UR9A 2SFAA 1Y3XA 4I8HA 1Y59T 4O97A 3PO1B 2PFEA 4ABEA 2UUKB 4IMZA 1DUEA 1MTWA 1CT0E 1TLDA 2PHBA 1J8AA 2A31A 3PMAB 4F49A 3RMMH 3TITA 3PV4A 1TWXB 1AQ7A 3EAJA 4XOJA 4MPVA 1P2KA 1PQ7A 3SNDA 1GJ8B 2AS9A 1SMFE 1C2IA 2ZHFH 3MU1A 1O3IA 2QXJA 1DVAH 5TCAA 2B5TB 2BM2A 5HMAA 1PYTC 1A0HB 1RTFB 4CBOA 2I6SA 2UWOA 1QA0A 4MPUA 3FAOA 1A5GH 1T32A 1LVOA 1O2XA 2XCNA 2SNWA 1KXBA 1ESTA 1A4WH 1AI8H 3AW0A 4BAKB 1XXFA 1IQEA 3QTOH 4K60A 3UUZA 1DXWA 2GDEH 3FANA 4IW4E 4MNYA 2FO9A 2YNAA 3VXEH 4B2CA 3QO6A 4I8JA 3Q76A 2UUFB 3RXVA 3M5NA 3MI4A 1J14A 1CA0C 4AG1A 1RS0A 1V2WT 2ANMH 4FUEA 5C20A 4X6NA 5EPYA 1B7XB 4BOHA 1Z8GA 1PPGE 3BEUA 5F03A 1XKAC 1CHOF 1O30A 2FXRA 2P3FH 3RU4E 3BEFB 2TGTA 4NFEA 3A81A 1ARBA 2QV1A 4X2WA 4E05H 1O33A 1MKXK 2JH6D 3MNSA 3BTWE 1BTWA 1KXEA 1C2EA 4JYTA 3UNQA 1G2LA 1QA7A 2C93B 7KMEH 2Y5GA 1AE5A 5BRRE 2PW8H 2ZU4A 1YCPM 2VIVA 2ZG0H 3TJVA 3M5LA 3TK6A 4AYVB 1SVPA 3NCLA 3F9GA 3PTNA 3GDUA 1YPMH 1UTQA 1AWFH 1KXDA 1O2PA 4XBBA 1G3EA 4JCNA 1A5IA 4ESTE 1V2PT 1GVZA 3GCNA 1BTHH 1ESBA 1QBNA 4WXVA 4U32A 4IMQA 2F9UA 2BD8A 3SNAA 4X1NU 1GHAF 1O2ZA 4VGCC 1YCPH 4ABJA 2Y6TA 2ZGCA 3UQVA 1B0EA 3E3TA 1GBEA 4ZKRU 3RXRA 3LC3A 1FN6A 2NU0E 4IGDA 3SO3A 1YPLH 3ZZ8A 4K1EA 3TK5A 3M61U 5J4SA 3PB1E 3KGPA 3RC6A 1SPJA 1IQHA 1IQMA 2PTCE 1P3EA 4X2XA 3GY3A 1VCPA 2BZ6H 1C1PA 3RXHA 1DFPA 1ZRBA 2ALPA 4LOYH 1THPB 2O8WA 5C5NA 2B9LA 1TB6H 5ABWA 1C5UA 1RD3B 2BLOA 2ZI2H 2A1DB 1MTSA 4GHQA 3O8CA 2ZPSA 3ZZBA 2A4RA 1C5SA 1ANBA 2A0QB 5C1UA 1A3BH 2ZECA 1N1LA 2ZGHA 4K3JA 1TPAE 2AMQA 1S82A 1HIAA 4CH8B 4AOQA 1DXPA 5JDUB 4KELA 2VIPA 4DT7B 5HM2A 3KEEA 3R3GB 3SORA 5LH8A 2ZWLH 5LPRA 2HNTF 3C1KA 4B1TA 1BCUH 2KAIA 1VITF 2PUXB 1GBHA 3Q77A 1O3EA 3Q00A 1HAVB 2BLWA 3SQHE 1X7AC 1C5WB 1K1MA 3K6YA 5EOKA 1Y8TA 5DP9A 3ZZCA 4M7GA 1ZSKA 1A1RA 1OPHB 1TPSA 2A5AA 1LVYA 2PV9B 1Y5AT 1SQTA 1LTOA 3GDSA 1SGCA 4MDSA 4WVPE 1P02A 1J16A 2G55A 1ELTA 2R3UA 1P09A 4GUXA 1L4ZA 2FPZA 1QIXB 3SU0A 1EPTB 3SGAE 1ZR0A 1A61H 2ZIQH 3A85A 1BZXE 5AFZH 1O31A 2ILNA 4AFSA 1UK3A 2XC4A 3RXEA 1XUJA 1NFXA 1HPGA 5C1YA 2EA3A 3FZDA 1GJ5H 1JMOH 1TONA 2FLBH 2ZTXA 3NPSA 2FOMB 1Z1IA 2F3CE 3QZRA 1D3DB 5FAHA 3MU8A 2RCEA 2WPMS 3UNRA 2CXVA 4RKJB 3PWCA 2EI8A 1C2JA 4BTUB 4ZUHA 1C1WH 2IN2A 1ELEE 3BTEE 2J4IA 1NRPH 3P95A 1PQAA 4I7YH 3SBKA 4YLUA 3M36A 4D7GA 1OWIA 3EDXB 4INKA 1MTNB 4AORA 1A0JA 4ASHA 2B8OH 1GJCB 2FI3E 4NWKA 1SGQE 1V2OT 1BHXB 3LU9B
chains in the Genus database with same CATH superfamily
1BJVA 5FL7D 1NRSH 4X8UH 5L2ZH 1YLCA 4NFFA 4J2YB 2FODA 3ZV9A 1RFNA 3RXLA 1XMNB 2Z3DA 2G5VA 5JYIA 3GY2A 1MKXH 2EI7A 4D9RA 5GPIB 4BANB 2KM0A 3P8GA 4Y76A 1HYLA 2AHME 4U01A 3RXMA 4ZH8A 1K1PA 2LNCA 1SFIA 2TRMA 3ZZ6A 1FY4A 4AN7A 3W1EA 3FO8D 2PKSB 2GJGA 3H7OA 1ZPZA 1WTGH 4ASUD 1ZJDA 3BG4C 1BMLA 5DP7A 2J5UA 2CF8H 4OS4A 1L2EA 4FUDA 4DCDA 1UTJA 4ISHH 3SV6A 1SGRE 4JK5A 3M5OA 3ODDA 1O2JA 5FPYA 1TPOA 1RTKA 1O5DH 1GBCA 1H9LB 1TBQH 1QFKH 4INLA 3WWBA 4A92A 3ZZ5A 3OTJE 5EXNA 2G4TA 1O5AB 1V2JT 2PLXA 4ISLA 2H9HA 1F0TA 3TIUA 4UE7H 1GI0A 2JIZD 2BY7X 2OK5A 3MU4A 1NU9A 1QQUA 1F0RA 3P17H 3V0XA 3F2FA 4A6LA 2ZFSA 4K1SA 4JMYA 5E0JA 1EKBB 5T6FA 2ZNKH 1C5PA 2P8OB 1EXFA 5CHAB 1L1NA 1HAZB 1ZSJA 1LCYA 2KX4A 3F2GA 1C5NH 1PJPA 2YOLA 1QRXA 3ZZ7A 4HZHA 4CRCA 3FP6E 1OYTH 2O8MA 3EGKH 4X6PA 4NZLA 4CR5A 1SG8B 3UREA 2ZPQA 4K8YA 1T4VH 3LGYA 1WUNH 1DWEH 1VZQH 3F9HA 2XBVA 1ZMNA 3S69A 2K0QA 3U1IB 3ZVAA 3UY9A 3U8RH 1UCYK 1G3BA 3GS9A 1O0DH 1XX9A 4THNH 1O2VA 2GP9B 1C2KA 4A1TA 1SQOA 4JZIA 2F9OA 2FESH 3HATH 1XVMA 5HIZA 1DSUA 1FPHH 4J1YA 2FDAA 2HVXA 3UPEA 1AVWA 4WWYA 2P3TB 3T26A 4JYUH 1O3BA 1MBQA 2A32A 4U30A 1C5XB 1MH0A 5AVDA 1GHBF 1O2QA 4ABBA 5BPEA 3EYDA 4NSVA 3PMBB 5DP3A 1DWDH 2V6NA 3GY8A 3FZZA 2BX4A 4WF8A 2OQUA 2XOKD 3MH6A 1TNHA 2ZZUH 6ESTA 1QB6A 5I25A 3GCHC 2VB0A 1J17T 2BLQA 2UUYA 4WMDA 4YLQH 1O2KA 3E90B 5ESBA 1CHGA 3SOSA 2WHXA 2LPRA 3A8DA 1TGCA 3P8NA 5J4QA 1J15A 2XW9A 5B6LA 1GMHF 4GCHG 1GDNA 2CGAA 2JH0D 2H2ZA 1TMBH 8GCHF 1WV7H 1MABB 1EAWA 3E1XB 3TLOA 6CHAC 3ZYEA 3ATKA 2FOFA 1TQ0B 4IN2A 1GCTC 2BVRH 2OINA 2WYGA 2BDBA 4AG2A 1GJ7B 3RMLH 1FUJA 1GI7B 1V3XA 2SGPE 1HIAB 1H8IH 1WDIA 3ZVFA 5EW2H 3TNSA 4TY6A 1O2LA 4XSKU 1QBVH 1EJNA 5EXLA 1UVPA 1FV9A 1A5HA 1V2UT 2OC8A 1DT2A 2QXIA 5A8XA 5L30H 5HGGA 1OSSA 1Z8RA 1TRNA 4B2BA 1EJAA 1H8ED 4Y0YE 2V3MA 1YYY1 4ABGA 3BF6H 2Z9GA 1IOEA 1NROH 7GCHG 2AEIH 4MTBA 3F3BA 2BD4A 1BJUA 4XD7D 4Y7BA 1NFWA 1FIWA 4TY7A 3WW7A 3WWFA 2FWWA 1HJAB 1K21H 2OCVB 2VH0A 2Y7ZA 1NT1A 1UO6A 4B6EA 5AFYH 2ZHDA 4F4OC 2Q6DA 2VVCA 2VWMA 1NC6A 2WV4A 1ZTJA 5FHTA 4ZXYH 1NRNH 2BZAA 1LHCH 3ZZDA 1ZPBA 2DE9A 2HWLB 1G30B 4CBNA 4H6TA 3Q3KA 4XFQA 1D4PB 2ZCKP 4YZUA 5EIYA 4H42U 4I31A 1GI6A 1AFQB 1OWJA 5K0HA 1FIZA 2ZGBH 3UOPA 3GY4A 2Y82A 3MO6A 4X8VH 1FQ3A 4MNXA 4UD9H 1Y3VA 2YMSC 3SN8A 1QY6A 4UEHH 2KCYA 3KQ5A 1TBZH 4CHAB 1P11E 4FUIA 5IK2D 1MMJN 1CU1A 1V2TT 1CGHA 1ZMLA 2W3IA 3ITIA 3RC4A 1O39A 4IBLH 1S0RA 2PR3A 3RXOA 3UWIA 3GYMA 1O37A 4X0WU 1GBJA 5F8TA 6GCHF 2G8TA 1BBRK 5GCHG 1C2DA 5ETXA 1DE7H 1GMCF 1EX3A 1HAXB 1QJ1B 1OKXA 1EPTA 1OS8A 4AFUA 4ACAA 1BB0B 1MKWK 1LVBA 2A7HA 3SUFA 1FN8A 1CE5A 4NA8A 2QC2A 2BOKA 3OTPA 3URDA 5C3NA 4XRNA 3FFGA 2QYIA 3EQ0H 3U8TH 3SYJA 1UTNA 3OY6U 2ALVA 2IJD1 1QNJA 1C4U2 2A7CA 1H8DH 1AUJA 1P2OA 1LHDH 2M2AA 1SGPE 3LJJA 3RXPA 3EA9A 4MPWA 2TGDA 4X2VA 2XXLA 9ESTA 2OQ5A 1QBOA 2ODYB 5DP6A 1YPEH 1T31A 4DVAU 1T8OA 1YF4A 1O2UA 2UUJB 1MD7A 1IQJA 1NU7B 3ATIA 2R2MB 4ABAA 1UCYH 1LKAA 2WINI 1PPHE 1EB1H 1OP2A 1S6LA 1TRMA 1HCGA 1C1UH 1F5KU 2BHGA 1K2I1 2R0LA 5FCRA 1L1GA 3QGJA 1ZSLA 1NS3A 3OEHD 2FS8A 1GL0E 4ZKOU 4TWWA 2OP9A 1KLJH 4FUGA 2ZCLP 3JZ1B 7ESTE 3CS7A 5T6DA 1B0FA 3F6UH 4HI3A 3LC5A 2A5IA 2ZU1A 4ZXXH 2HLDD 2L6OA 1ELGA 1PPFE 5DPAA 3VB7A 4AB9A 1XXDA 2BQ6B 1XUHA 3H7TA 3ZZ9A 3U69H 4I86A 1O3DA 1TNGA 4D76A 1GGDC 5EJZA 2BDCA 5LPFA 1O3GA 3K65B 1O5FH 4LXBH 1HGTH 4ISIH 2OBQA 1PYTD 2EEKA 4OS2A 4DGJA 2C8YB 4TT3D 1P2JA 1INCA 2IOTA 4O03A 4BAHB 2THFB 3GY5A 4X6MA 1GJ6A 1WQVH 1NPMA 2ANWA 1AVXA 1RRKA 2RA0A 4BTTB 4Y8YA 1G9IE 5A09A 2VIDA 4AB8A 2FM2A 3I29A 2XNDD 3T28A 1LKBA 2IJOB 2Z6BD 2Z9KA 3CP7A 1DWBH 3SJOA 3SV9A 1W7XH 3A7YA 1W14U 3KF2A 3AAUA 3IITA 1P2MA 4A7IB 3M37A 4X8TH 2AMDA 1CBWC 1H1BA 1P03A 1C5QA 4CRDA 2GVFA 1L1JA 1JWTA 2GKVE 1TX8A 3KCGH 3T2NA 2EI6A 1C1NA 3T5FH 3LKWA 4ISOA 2FS9A 1LQDB 1Z1JA 1C5TA 2FOHA 1BTPA 3PROA 1N6YA 2R9PA 4B73A 1SHYA 5A0AE 1JIRA 3ELAH 3E8LA 4A1VA 5TCCA 3SNCA 1JBUH 2WPJS 3I77A 1SBWA 1ABIH 3E91A 2BYAX 1BTXA 3SHCH 2CV3A 1GMDG 2SGDE 3SU3A 2WUBA 4IN1A 1GL1A 1PPCE 1UVOA 2CHAC 3MYWA 1DANH 2B0FA 2BDYA 5FX5A 1UCYE 2WV9A 1C2MA 1C1RA 1FAKH 3ZVGA 2VIOA 1G36A 1EUFA 4KKDA 4YESB 3F9FA 2ZGJA 1G37A 1LHFH 1OX1A 2GV7A 5DJ7A 3SW2B 5C0TA 4NZQA 5E0HA 4NIXA 4ZHMU 2BY5X 2GD4B 3RM0H 3AASA 1Y3YA 1HAOH 1QHRB 3DUXH 1GI9B 2BVXH 3MU0A 1ETTH 1E1RD 3PV2A 2LP6A 1ZMJA 1S6HA 1ELAA 1YPJH 2Y5FA 1YWUA 1GHWH 1AD8H 1QZ8A 1WU1A 4KTCA 1ZPCA 2SGEE 2RDLA 4XBCA 1OWHA 1S85A 1GBBA 4YOJA 3GOVB 1C9PA 5T6GA 1V2RT 3SI4H 1A46H 1S6FA 3RXFA 2GCTB 1P2NA 1TALA 2AIPA 1YY3A 2F9NA 3S9AA 2LELA 3V13A 3K2UA 2VGCB 1MKWH 3V12A 1SQRA 1EZSC 1SGFG 2ZCHP 1QL7A 4X2YA 1AE8H 3GCTF 2F91A 2ZDKA 1LHGH 1BRCE 3SU5A 1O3CA 4FUCA 3RMOH 3S9CA 1KXCA 3T25A 1EB2A 4X1RU 1O3OA 1LPKB 5DP5A 1LHEH 3RXTA 4YT6H 2NU4E 1RIWC 2W7SA 4BAQB 3U1JB 2FMJA 4LZ4B 2GZ9A 1F5RA 1C5MD 1VJAU 1SGFA 2C3SA 2FIRH 1TGSZ 1S5SA 1ZGVA 1SI5H 1NBMD 5JBTA 1SL3A 3EA8A 1YGCH 3ATMA 2BD7A 2NWNA 2Z9IA 1OP8A 4MQAA 1AB9C 2J9NA 4UFEH 3QDZB 1AZZA 2AGIX 3LONA 1C1TA 3P8FA 1GVKB 1UTPA 2ZFQH 2O8UA 3UQOA 2HVYB 4X6OA 3TU7H 2HGTH 2FOEA 1NESE 3KQEA 1GG6B 2J98A 4CRAA 1O2NA 3FVFB 1KLIH 3BTHE 1O2RA 2CJIA 2GCHG 2K8IA 3OY5U 3P92A 3RM2H 1YPKH 2QF4A 5K7RA 1V2ST 2W26A 1N8OB 2WPHS 2Z7FE 4HG6A 3SJ8A 1D3PB 1P2IA 5AF9H 1AZ8A 3OFND 3LH3A 3SU6A 2VVUA 5CHBA 3OU0A 2F9BH 3PO1C 1P04A 2TGPZ 4ZHAA 3U98H 2GMTC 4K1TA 2PP6A 1SC8U 3BSQA 2ZHQH 2ULLA 2GZ7A 1GBDA 4B71A 3L33A 4MNWA 1TX7A 5DO4H 3RLYH 2QY0B 1KIGH 2FP7B 3GY6A 1E79D 3A8BA 2O8TA 2Y5HA 4NIVA 2H9EH 1UTOA 1DS2E 3O8RA 1K28D 1BRAA 3UNSA 2O9QA 1XVOA 2GT8A 1CSOE 1GHZA 5E0GA 3I78A 2Y81A 4YOIA 3RXUA 1S0QA 2OC7A 1BBRE 1GBIA 3MFJA 4R0IA 1MUEB 3Q3YA 1ZGIA 2WPKS 1J9CH 4LK4A 1D9IA 2H5CA 3VB3A 4ZAEA 4UFFH 2OTVA 1JRSA 1UVSH 4ZHLU 3S7HB 1Q31A 2J34A 1CO7E 1IQKA 1GJ4H 1TFXA 1CHOG 2PTNA 2VU8E 3DCLA 1CQQA 1XUKA 1O2OA 2GX4A 3LPRA 1Z8IB 3A7VA 4KTUA 3ZYDA 5JBCS 3ZZ4A 3SV2H 1BTZA 3EA7A 1O35A 4R8TB 2ZQ2A 3SU1A 5GCHF 3DSPA 5GDSH 2V35A 1BA8B 4Q7ZA 5C1XA 3LIWA 4Y8XA 1C1OA 4Y0ZE 1P0SH 5EU8A 2ZDLA 2ZHEH 1T4UH 3VB6A 3MOCA 2ZDAH 2ZFTA 3O8BA 2TBSA 1O5GH 1ELFA 2QAAA 1TGTA 4OS6A 5GIBA 3TJUA 1C2LA 1ELCA 1NZQH 1O2IA 2Y80A 4FVDA 3STIA 3SUEA 3F0OA 1SGIB 4IC5A 1C2GA 2BB4A 1C4Y2 1HJ9A 1UMAH 2SNVA 4X1PU 1ZLRA 4BXWA 1SQAA 4AC9A 4Z1MD 1OXGA 4FXGH 8ESTE 4ABIA 4RN6A 1KTTB 1K1NA 3GDVA 1W3CA 2H5DA 4B74A 2OUAA 3LGWA 4DIHH 1LVMA 2G4UA 4RI0A 1GHAG 5GWZA 3SNBA 2Z94A 1JRTA 2V3OH 5DGJA 4ZCNA 5F6MA 4LZ1H 1QURH 5L2YH 1MZAA 1VGCB 4WH6A 3NWUA 1HNEE 1GBAA 1Q2WA 4Y7AA 3A87A 3MNBA 1C5OH 4B6FA 2XNIA 2W3KA 3DT0H 1DM4B 2AIQA 1O3FA 1SGNE 1NRRH 4H6SB 1GBTA 1KTSB 1H4WA 1DY8A 1W7GH 1IQLA 1YBWA 2AH4X 2C8XB 1OWDA 1NO9H 4AFQA 3MTYA 3TPIZ 1E36B 1TNJA 2P3UB 4DY7B 1NN6A 4O3TA 2GZ8A 4XE4A 4Y79A 2V3HH 2BVSH 5T1VA 2P59A 5I46H 2XC5A 3QTVH 2O8LA 1YPGH 4ABHA 1RGQA 1ESAA 3U8OH 2G52A 3HKJB 2F83A 3ENSB 2WPDD 2J38A 2ZDMA 1O5BB 2FZZA 3D62A 3OEED 5FBEA 4NG9H 2GT7A 4A5TS 2R3YA 2VJ1A 3W95A 3BEIB 4IS5A 4GAWA 1AUTC 1C2FA 4YT7H 1KYNA 1CA0B 4JZ1A 5EQSA 1UVUH 2ZHWH 1SOZA 2VWLA 4UFGH 2BOHB 3PTBA 1CBWB 1BT7A 2XWBI 1EOLA 4TYDA 1TGNA 5FXLA 4WMFA 4FU7A 1KXAA 1NRQH 5SGAE 4O9VA 4E7NA 3NUMA 3N99A 2BY6X 5E8EH 1AKSB 2AMPA 3SV7A 2NU1E 1MD8A 3LGTA 2WZQA 2J97A 3OSYA 3VGCC 1W8BH 1V6DA 2ZEBA 5LGOA 1UJ1A 1O38A 4FOUC 1D6WA 2FYQA 1QB9A 4MLFB 1V2NT 2HNTE 2W6JD 3GY7A 2ZPRA 3A80A 3N7OA 2XBWA 2BDGA 3PV5A 4JK6A 4YO9A 1V2MT 3B23B 3AVZA 2CHAB 5C17A 2J98B 4E06H 4GVUA 5F53A 3LJOA 2J95A 2D1JA 2Z9LA 3DFLA 1E37B 4RKOB 3RMNH 2FEQH 1FMGA 3P8OA 1O2MA 3B8JA 5E2PA 4VGCB 1MTNC 3BTKE 2NU3E 3MO9A 4ZMAH 1Z8JB 1D6RA 1WBGB 1AHTH 1KSNA 2AFQB 4FUBA 3ATLA 2JETC 5CMXH 1FNIA 1KMHB 1QQ4A 2FLRH 1COWD 1FONA 1V2KT 2UWLA 5HM9A 1VCWA 1CGJE 3VEQB 3A83A 5F8ZA 3QLPH 2VIQA 3RDZA 1Z71A 2YMSD 3E0PB 4UFDH 2FI4E 1IHTH 4TSFD 4XDEA 3SI3H 1EP6A 1FAXA 1EQ9A 5C5OA 1QB1A 3FP8E 1FPCH 3LGUA 1EOJA 2BQWB 3SHAH 1JIMA 1YPHE 5AHGH 3RUOA 2PKSC 1MCVA 5EPNA 1T8MA 2CK3D 4Q4LA 4JYVH 3M3VA 4E7RG 1PFXC 1PQ8A 3NKKA 1ANDA 1GWAA 4CRGA 4CRFA 1GJAB 1BIOA 4KGAA 4ABDA 5EJ1A 5HXFA 2PSXA 4WMEA 3RU4D 3PLPA 1VR1H 1TYNA 5KECA 3PMHB 1NY22 4NA9H 1SR5C 4K8BA 1HJ8A 1S81A 1PPZA 4Q7YA 2ODQA 1EAIA 1TAWA 2XBXA 3A84A 4YM9A 3U28C 1ETSH 3R0FA 3RP2A 3PWBA 2VH6A 3QUMP 3KHVA 4KP0A 3F68H 1OWKA 3ZVBA 1LPZB 1BMAA 3QZQA 5JB9S 1EAXA 1UHBB 5T3HA 4Z0KA 2FX6A 2P8OC 5CHAC 5EQRA 4TWYA 3A7ZA 3SZEA 2QN5T 3DHKH 1E0FD 3RXAA 3T27A 1RTLA 4KTSA 5DSFA 3ZZ3A 3M7UA 1SOTA 2GDDA 3D49H 1TGBA 3U9AH 3KN2A 4O3UA 3F9EA 2GCHF 2ZQ1A 4GHTA 1XUFA 1QCPA 4Y10E 1K1IA 3SGBE 1IQGA 1BOQA 2G00A 3ZV8A 2ZU2A 1O3AA 2D26C 2UWPA 1DOJA 1UVTH 3ZZAA 4K69A 1HV7A 4OS7A 3LH1A 1EP5A 3BV9B 1MZDA 2BD9A 4JZEH 4QT8C 1ETRH 1W0YH 1SB1H 1DWCH 1GBFA 2GMTB 3A86A 4I8GA 3PM3A 1TMTH 1FY8E 2WV5A 3CS0A 3MH7A 2XTTB 4DW2U 2FX4A 3PLKA 4DG4A 1MQ6A 1FI8A 1Q3XA 4IC6A 1GHBG 1SGYE 4CR9A 4X8SH 2Q1JA 1A7SA 4U2WA 1QL8A 1O2GH 1QL9A 1TNLA 5IDKA 2QF0A 1N6XA 1DX5M 3F1SB 1G32B 1AIXH 1P8VC 3TH4H 1YP9A 1W12U 3Q3XA 3MO3A 1ZRKA 1F92A 1ID5H 2F9PA 2JDID 3QWCH 1OP0A 1CVWH 5FBIA 3AK5A 5EQQA 2I6QA 1FX0B 1RJXB 3ZVCA 1TBRH 1AGJA 1AO5A 1GMHG 2FOGA 4PROA 1P06A 2ZU3A 8GCHG 1E38B 1P9UA 3HPTB 1QRZA 1C1QA 1E34B 1O2HA 2TIOA 2C90B 3K6ZA 3PYHA 1FDPA 2BD2A 5G4BA 1IQIA 1BTUA 4Y71A 2QF3A 3BG4B 1UTMA 3VB5A 4B75A 1S83A 1ELBA 3KQCA 1GDUA 2ZA5A 5DP8A 1ARCA 1TX6A 4FUJA 2FOAA 3WY8A 1TOCB 1SKYE 5LPEA 4NGAH 1O2WA 1ZZZA 2FI5E 4I32A 1WOFA 3RXDA 4OGXA 1TMUH 3UIRA 7LPRA 1QJ7B 3TJNA 1AY6H 1HAYB 1WYKA 1BITA 4AX9H 1O5CB 4RT0A 1W13U 4TPYA 4YTAA 3BTDE 1E1QD 1HJAC 1LDTT 4D9QA 3SJIA 3LT3A 4Z6AH 1O36A 1GBLA 4AZ2B 2K1QA 3CNRA 1HAGE 1HXFH 2RA3A 1TA2A 5C0UA 2BQ7B 2SGFE 1A2CH 4CREA 1DY9A 1O3KA 3D23A 2J2UA 1MAYA 1FY5A 3SJKA 2QXHA 3TJOA 5C2ZA 1T7CA 1XKBC 5FPTA 4XBDA 5A2MH 3W94A 4OS5A 5CDFE 1W11U 4AGJA 1XM1A 3GICB 4HTCH 3B9FH 2ANYA 8KME2 2ZDNA 1FXYA 1AFQC 2Z3EA 3A7XA 5C67A 1TABE 1GI5A 3SUGA 4FUHA 5FCKA 3RXBA 3NZIA 1GJBB 3SNEA 5F8XA 3RXQA 2Z9JA 1BBRH 1FY1A 4WJG2 4I33A 2V7QD 4F55A 2HLCA 1BMFD 1IQFA 2A4QA 2BLVA 2BMGB 2PKAB 3A7TA 1Y5BT 3F2HA 1C5ZB 3T29A 1SFQB 1K22H 2Y7XA 1W0KD 2QXGA 3BIVH 4CHAC 1V2VT 3HGPA 3A8AA 3M35A 5EODA 1FLEE 1BTYA 4GSOA 1TIOA 2XYAA 1SLXB 2BY8X 2VIWA 4ISNA 5A8YA 3MWIU 1TNKA 2HPQH 1K1LA 2AGGX 1Z6EA 1Y5UT 5PTPA 4GPGA 4M9FA 2H9TH 1AN1E 3LDXH 4MPXA 2BTCE 1QRWA 5GXPA 2HPPH 1DSTA 1HAHH 5CE1A 1BUIA 6GCHG 1ANEA 1AKSA 3M5MA 1GMCG 9LPRA 3GYLB 2A5KA 4OGYA 1K0HA 3TH2H 1MCTA 1LPGB 1C5RA 3E6PH 2A7JA 2FOCA 1ZJKA 3GCHB 1BQYA 1ZYOA 1ORFA 4MNVA 3TGIE 4GCHF 2D2DA 1JOUB 1P57B 1SHHB 3GISB 4Q80A 5EW1H 3UAIC 2DE8A 1UTLM 1HAIH 1OOKB 3V7TA 3MH4A 4ZKNU 2A2QH 3SU2A 3G01A 2KFWA 2WPLS 4BTIB 6CHAB 3LGVA 1RXPA 2H1UA 1GCTB 1UW7A 2PUQH 3FN8A 4AFZA 1SLVB 4ACBA 3BTME 1DICA 1HRTH 2OXSA 3UTUH 5A8ZA 3HGNA 5JBAS 4I8KA 3VFEA 1CA8B 1MTUA 3JZ2B 1Z6JH 1PPEE 2OC1A 2NU2E 3ZVDA 1O3LA 1HAPH 2JKHA 3A7WA 2CMYA 2IPHA 2JJ2D 2FTMA 1GBKA 4DURA 2H6MA 4BAOB 1P2QA 1MBMA 4FETA 2Q6GA 7GCHF 2PGBB 5B6OA 1O3MA 1P9SA 2QIQA 2ZGXH 4NIWA 5A0CA 2ASUB 2M5TA 3D65E 3TGKE 1YKTA 3VGCB 2OBOA 4ABFA 2QGRA 3MH5A 4ZROA 2FYRA 4P00A 2VBCA 2J94A 2ZTZA 3M3TA 5ESTE 3RXCA 1THSH 1EZXC 2Z3CA 2BXUH 1YM0A 1FY3A 4INHA 1KDQA 4HFPB 4CRBA 4D7FA 1S84A 1GJ9B 2A4OA 4BXSA 4ZKSU 1G3CA 1UK2A 1O3PB 2ZFRH 3BIUH 3A89A 1P01A 3A82A 3BG8A 1EFRD 3TK9A 4GLYA 1GBMA 1KXFA 3V3MA 1C9TA 3TH3H 5EG4A 3H5CB 2EY4C 2G51A 1UTKA 1ZHPA 1D3TB 1QTFA 2RG3A 3M7QA 1ELVA 3OE7D 1MTVA 5GNDA 5DP4A 3A88A 2BDHA 2STAE 2C4FH 2J92A 1GPZA 2GV6A 4NA7A 5FX6A 2JETB 3N7EA 3NK8A 3OYPA 4D8NA 1CT4E 3SV8A 1LO6A 1UHBA 3RC5A 2VWOA 1P10A 1C4V2 3E0NB 2YMSB 1HBTH 1Z7KA 2G81E 1C2HA 3KL6A 4JZDH 4BNRA 3VB4A 1DLEA 2BX3A 2TGAA 3QX5H 4AGKA 3LGIA 1VCQA 4FVBA 3M7TA 1SGDE 1O34A 2PSYA 2XC0A 1TQ7B 1BDAA 1GDQA 1HUTH 1SSXA 3N7DA 1H8HD 3ODFA 1T8NA 1NBME 1K1JA 1SLWB 1EZQA 2BD3A 2QCYA 1VJ9U 2ODPA 1O3JA 3AAVA 1HFDA 4AYYB 3RXGA 3BTTE 4B76A 4DOQA 3KNXA 3CENA 2A4GA 3STJA 4I8LA 3DSGA 3S0NA 3BTGE 2Q6FA 4OS1A 1WCZA 1AU8A 1BRUP 1ELDE 2BXTH 1BHXF 2A2XH 3LOXA 4YOGA 1EASA 1QGFA 1G3DA 1WTHD 5IYTA 1VITH 2PGQB 3BTFE 1EJMA 3MMGA 3KIDU 1KLTA 1D3QB 4UONA 5E2OA 2JH5D 2GGVB 1YLDA 1TOMH 1F7ZA 1A0LA 2ZP0H 2C8ZB 2L74A 3DD2H 1L4DA 1W10U 2ZKSA 3A8CA 2B7DH 2VNTA 2HNTC 3MHWU 4WXIA 1GI8B 3TVJB 3IG6B 2HALA 3ESTA 3KYFA 1KY9A 1DITH 1GHXH 3VXFH 2OC0A 1V2LT 2CF9H 3KQDA 4B2AA 3MU5A 1ZHMA 4A1XA 1NFUA 3VPKA 1LQEA 5FPSA 1TRYA 2ZO3H 2WYJA 1SGEE 1OWEA 5A0BA 3OAAD 1HDTH 3SGQE 3KYGA 2VVVA 3T62A 4FU8A 3NRLA 2GCTC 8LPRA 2OLGA 2OD3B 4HGCA 3OX7U 1C1MA 4Q2KA 5JBBS 2VGCC 1C5VA 4K2YA 2BDIA 3UFAA 3UR6A 1GGDB 1GI2A 4SGAE 2RFKC 1YC0A 5DK1A 3K9XB 2XBYA 3TGJE 1GHYH 3UOUA 2R0KA 1O2SA 1DLKB 2ZF0H 3GCTG 5DG6A 1T8LA 2W6ID 1NM6A 1XUGA 1HLTH 5HYOA 1YPHC 1NFYA 2P93A 1P05A 2FTLE 2DUCA 1THRH 1GI1A 1ACBE 2R2WU 2XWAA 1ZTKA 2VWNA 3L6PA 1VITG 3QGNB 3VG8A 1Y3WA 3C27B 1W2KH 4RT1A 2VINA 5HIYA 1SLUB 1GI4A 3EE0B 1C5LH 3RLWH 1XUIA 1K9OE 3BTQE 3KQBA 4WY3A 3SQEE 1BRBE 5H4IB 5EXMA 4CH2B 3GCOA 2BY9X 3PRDA 4Y6DA 4NSYA 3SU4A 3SUDA 6LPRA 5KEDA 5JB8S 2G5NA 4K5ZA 2XRCA 3MNCA 1GG6C 1O5EH 1EPTC 1U6QA 5GJ4B 1AVGH 1L0ZA 2WPIS 3DFJA 4SGBE 2ZU5A 4BAMB 2TPIZ 4Q7XA 1ZTLA 2ZDVH 1GJDB 1N8OC 3RXSA 4TPIZ 4FUFA 1DUAA 1OYQA 1TE0A 2W5EA 2AERH 1MAXA 3H09A 1V2QT 1IAUA 1GMDF 3QN7A 4Y8ZA 1TNIA 1GHVH 2FOBA 3QK1A 1QR3E 2KAIB 2D8WA 1GCDA 3HK6B 2PKAA 1W0ZU 4JZFH 2YNBA 3MNXA 3RXJA 1P12E 1MU6B 4NWLA 3HK3B 2C8WB 3P6ZB 4F48B 3S7KB 4NCYA 2AYWA 2V0BA 5DKMA 1VKYA 3P70B 1BMMH 1WQSA 1Y3UA 1AWHB 1HB0B 3RXKA 2KZ4A 4MVNA 1FZZA 1O32A 4MG3A 1FJSA 3E16B 3EE7A 2CN0H 1MU8B 3NXPA 2QA9E 1O2TA 3L3TA 1YCPK 2BD5A 1NTPA 3RXIA 1C5YB 3PRBA 3HKIB 2ZFFH 1AFEH 1JXPA 1ZHRA 3SZNA 5JPMH 1M9UA 3AW1A 1DPOA 1HAVA 4UDWH 1ABJH 1CT2E 4WH8A 1HXEH 1CGIE 2P95A 1GVLA 1KDQB 1B5GH 2ZC9H 2QE7D 1F0UA 1O3NA 1UK4A 1TA6A 2A45B 3O8DA 1H9HE 2P94A 3UWJH 2WUCA 4Y11E 1H9IE 3SJ9A 1ANCA 4DIIH 3ZVEA 1PPBH 1WSSH 1BMNH 3DSOA 2SGAA 4NIYA 2HOBA 1WAYB 2JJ1D 2PWXA 1MQ5A 2ESTE 2XCFA 3TNTA 2ZTYA 1F5LA 1F0SA 2KCOA 1LMWB 3S9BA 1RIWB 1C1SA 4RSPA 4H4FA 1P3CA 2GTBA 1AMHA 1A3EH 1F2SE 1TPPA 5EGMA 2W7UA 1PQ5A 1O3HA 1EAUA 1ZOMA 3PMJA 5TJXA 2AGEX 3FP7E 2STBE 1AB9B 3URCA 1K1OA 5L6NH 1SGTA 1IQNA 4YXWD 4X1QU 3UB0A 1IHSH 1GI3A 1EZUC 3IWMA 3PLBA 2BDAA 3M3SA 3DA9B 1E35B 1YLNA 2SGQE 2P16A 1O2YA 2ZFPH 2ANKH 3BN9A 2HRVA 1C1VH 1DDJA 4X1SU 1EATA 3RU4T 1G2MA 1VGCC 4DJZB 4FU9A 3ATWA 2F9VA 2EC9H 1QJ6B 3UR9A 2SFAA 1Y3XA 4I8HA 1Y59T 4O97A 3PO1B 2PFEA 4ABEA 2UUKB 4IMZA 1DUEA 1MTWA 1CT0E 1TLDA 2PHBA 3F0PA 1J8AA 2QF5A 2A31A 3PMAB 4F49A 3RMMH 3TITA 3PV4A 1TWXB 1AQ7A 3EAJA 4XOJA 4MPVA 1P2KA 1PQ7A 3SNDA 1GJ8B 2AS9A 1SMFE 1C2IA 2ZHFH 3MU1A 1O3IA 2QXJA 1DVAH 5TCAA 2B5TB 2BM2A 5HMAA 1PYTC 1A0HB 1RTFB 4CBOA 2I6SA 2UWOA 1QA0A 4MPUA 3FAOA 1A5GH 1T32A 1LVOA 1O2XA 2XCNA 2SNWA 2WSSD 1KXBA 1ESTA 1A4WH 1AI8H 3AW0A 4BAKB 1XXFA 1IQEA 3QTOH 4K60A 3UUZA 1DXWA 2GDEH 3FANA 4IW4E 4MNYA 2FO9A 2YNAA 3VXEH 4B2CA 3QO6A 4I8JA 2RDEA 3Q76A 2UUFB 3RXVA 3M5NA 3MI4A 1J14A 1CA0C 4AG1A 1RS0A 1V2WT 2ANMH 4FUEA 5C20A 4X6NA 5EPYA 1B7XB 4BOHA 1Z8GA 1PPGE 3BEUA 5F03A 1XKAC 1CHOF 1O30A 2FXRA 2P3FH 3RU4E 2KR7A 2TGTA 3BEFB 5C94A 4NFEA 3A81A 1ARBA 2QV1A 4X2WA 4E05H 1O33A 1MKXK 2JH6D 3MNSA 3BTWE 1BTWA 1KXEA 1C2EA 3FOAA 4JYTA 3UNQA 1G2LA 1QA7A 2C93B 7KMEH 1OHHD 2Y5GA 1AE5A 5BRRE 1WXRA 2PW8H 2ZU4A 1YCPM 4DT4A 2VIVA 2ZG0H 3TJVA 3M5LA 3TK6A 4AYVB 1SVPA 3NCLA 3F9GA 3PTNA 3GDUA 1YPMH 1UTQA 2KCAA 1AWFH 1KXDA 1O2PA 4XBBA 1G3EA 4JCNA 1A5IA 4ESTE 1V2PT 3ZIAD 1GVZA 3GCNA 1BTHH 1ESBA 1QBNA 4WXVA 4U32A 4IMQA 2F9UA 2BD8A 3SNAA 5DN6D 4X1NU 1GHAF 1O2ZA 4VGCC 1YCPH 4ABJA 2F4LA 2Y6TA 2ZGCA 1B0EA 3E3TA 3UQVA 1GBEA 4ZKRU 3RXRA 3LC3A 1FN6A 2NU0E 4IGDA 3SO3A 1YPLH 3ZZ8A 3FKSD 4K1EA 3TK5A 3M61U 5J4SA 3PB1E 3KGPA 3RC6A 1SPJA 3MQKC 1IQHA 1IQMA 2PTCE 1P3EA 4X2XA 3GY3A 1VCPA 2BZ6H 1C1PA 3RXHA 1DFPA 1ZRBA 2ALPA 4LOYH 1THPB 2O8WA 5C5NA 1W0JD 2B9LA 1TB6H 5ABWA 1C5UA 1RD3B 2BLOA 2ZI2H 2A1DB 1MTSA 4GHQA 3O8CA 2ZPSA 3ZZBA 2A4RA 1C5SA 1ANBA 2A0QB 5C1UA 1A3BH 2ZECA 1N1LA 2ZGHA 4K3JA 1TPAE 2AMQA 1S82A 1HIAA 4CH8B 4AOQA 1DXPA 5JDUB 4KELA 2VIPA 4DT7B 5HM2A 3KEEA 4OM9A 3R3GB 3SORA 5LH8A 2ZWLH 5LPRA 2HNTF 3C1KA 4B1TA 1BCUH 2KAIA 1VITF 2PUXB 1GBHA 3Q77A 1O3EA 3Q00A 1HAVB 2BLWA 5KGOA 3SQHE 1X7AC 1C5WB 1K1MA 3K6YA 5EOKA 1Y8TA 5DP9A 3ZZCA 4M7GA 1ZSKA 1A1RA 1OPHB 1TPSA 2A5AA 1LVYA 2PV9B 1Y5AT 2IPQX 1SQTA 1LTOA 3GDSA 1SGCA 4MDSA 4WVPE 1P02A 1J16A 2G55A 1ELTA 2R3UA 1P09A 4GUXA 1L4ZA 2FPZA 1QIXB 4Q63A 3SU0A 1EPTB 3SGAE 1ZR0A 1A61H 2ZIQH 3A85A 1BZXE 5AFZH 1O31A 2F43B 2ILNA 4AFSA 1UK3A 2XC4A 3RXEA 4P02A 1XUJA 5EJLA 1NFXA 1HPGA 5C1YA 2EA3A 3FZDA 1GJ5H 1JMOH 1TONA 2FLBH 2ZTXA 3NPSA 2FOMB 1Z1IA 2F3CE 3QZRA 2EQNA 2KCPA 1D3DB 5FAHA 3MU8A 5HKKD 2RCEA 2WPMS 3UNRA 2CXVA 4RKJB 3PWCA 2EI8A 1C2JA 4BTUB 4ZUHA 1C1WH 2IN2A 1ELEE 3BTEE 2J4IA 1NRPH 3P95A 1PQAA 4I7YH 3SBKA 4YLUA 3M36A 4D7GA 1OWIA 3EDXB 4INKA 1MTNB 4AORA 1A0JA 4ASHA 2B8OH 1GJCB 2FI3E 4NWKA 1SGQE 1V2OT 1BHXB 3LU9B
chains in the Genus database with same CATH topology
1BJVA 1NRSH 4X8UH 5L2ZH 1YLCA 4NFFA 4J2YB 2FODA 3ZV9A 1RFNA 3RXLA 1XMNB 2Z3DA 2G5VA 5JYIA 3GY2A 1MKXH 2EI7A 4D9RA 5GPIB 4BANB 3P8GA 4Y76A 1HYLA 4U01A 3RXMA 4ZH8A 1K1PA 2LNCA 1SFIA 2TRMA 3ZZ6A 1FY4A 4AN7A 2PKSB 3H7OA 1ZPZA 1WTGH 1ZJDA 3BG4C 1BMLA 5DP7A 2CF8H 4OS4A 1L2EA 4FUDA 4DCDA 1UTJA 4ISHH 3SV6A 1SGRE 4JK5A 3M5OA 3ODDA 1O2JA 5FPYA 1TPOA 1RTKA 1O5DH 1GBCA 1H9LB 1TBQH 1QFKH 4INLA 4A92A 3ZZ5A 3OTJE 5EXNA 2G4TA 1O5AB 1V2JT 2PLXA 4ISLA 2H9HA 1F0TA 3TIUA 4UE7H 1GI0A 2BY7X 3MU4A 1NU9A 1QQUA 1F0RA 3P17H 3V0XA 4A6LA 2ZFSA 4K1SA 4JMYA 5E0JA 1EKBB 5T6FA 2ZNKH 1C5PA 2P8OB 1EXFA 5CHAB 1L1NA 1HAZB 1ZSJA 1LCYA 1C5NH 1PJPA 2YOLA 1QRXA 3ZZ7A 4HZHA 4CRCA 3FP6E 1OYTH 2O8MA 3EGKH 4X6PA 4NZLA 4CR5A 1SG8B 3UREA 2ZPQA 4K8YA 1T4VH 3LGYA 1WUNH 1DWEH 1VZQH 3F9HA 2XBVA 1ZMNA 3S69A 3U1IB 3ZVAA 3UY9A 3U8RH 1UCYK 1G3BA 1O0DH 1XX9A 4THNH 1O2VA 2GP9B 1C2KA 4A1TA 1SQOA 4JZIA 2F9OA 2FESH 3HATH 1XVMA 1DSUA 1FPHH 4J1YA 2FDAA 2HVXA 3UPEA 1AVWA 4WWYA 2P3TB 3T26A 4JYUH 1O3BA 1MBQA 2A32A 4U30A 1C5XB 1MH0A 5AVDA 1GHBF 1O2QA 4ABBA 5BPEA 3EYDA 4NSVA 3PMBB 5DP3A 1DWDH 2V6NA 3GY8A 3FZZA 2BX4A 4WF8A 2OQUA 3MH6A 1TNHA 2ZZUH 6ESTA 1QB6A 5I25A 3GCHC 2VB0A 1J17T 2BLQA 2UUYA 4WMDA 4YLQH 1O2KA 3E90B 5ESBA 1CHGA 3SOSA 5J4QA 2LPRA 3A8DA 1TGCA 3P8NA 1J15A 2XW9A 1GMHF 4GCHG 1GDNA 2CGAA 2JH0D 2H2ZA 1TMBH 8GCHF 1WV7H 3TLOA 1EAWA 3E1XB 6CHAC 3ZYEA 3ATKA 2FOFA 1TQ0B 4IN2A 1GCTC 2BVRH 2OINA 2WYGA 2BDBA 4AG2A 1GJ7B 3RMLH 1FUJA 1GI7B 1V3XA 2SGPE 1HIAB 1H8IH 3ZVFA 5EW2H 3TNSA 4TY6A 1O2LA 4XSKU 1QBVH 1EJNA 5EXLA 1UVPA 1FV9A 1A5HA 1V2UT 2OC8A 1DT2A 2QXIA 5A8XA 5L30H 5HGGA 1OSSA 1Z8RA 1TRNA 4B2BA 1EJAA 4Y0YE 1YYY1 4ABGA 3BF6H 2Z9GA 1IOEA 1NROH 7GCHG 2AEIH 4MTBA 2BD4A 1BJUA 4Y7BA 1NFWA 1FIWA 4TY7A 2FWWA 1HJAB 1K21H 2OCVB 2VH0A 2Y7ZA 1NT1A 1UO6A 5AFYH 2ZHDA 4F4OC 2Q6DA 2VVCA 2VWMA 1NC6A 2WV4A 1ZTJA 5FHTA 4ZXYH 1NRNH 2BZAA 1LHCH 3ZZDA 1ZPBA 2DE9A 2HWLB 1G30B 4CBNA 4H6TA 3Q3KA 4XFQA 1D4PB 2ZCKP 4YZUA 4H42U 4I31A 1GI6A 1AFQB 1OWJA 5K0HA 1FIZA 2ZGBH 3UOPA 3GY4A 2Y82A 3MO6A 4X8VH 1FQ3A 4MNXA 4UD9H 1Y3VA 3SN8A 1QY6A 4UEHH 1TBZH 4CHAB 1P11E 4FUIA 1MMJN 1CU1A 1V2TT 1CGHA 1ZMLA 2W3IA 3ITIA 3RC4A 1O39A 4IBLH 1S0RA 2PR3A 3RXOA 3UWIA 3GYMA 1O37A 4X0WU 1GBJA 5F8TA 6GCHF 2G8TA 1BBRK 5GCHG 1C2DA 5ETXA 1DE7H 1GMCF 1EX3A 1HAXB 1QJ1B 1OKXA 1EPTA 1OS8A 4AFUA 1BB0B 1MKWK 1LVBA 2A7HA 3SUFA 1FN8A 1CE5A 4NA8A 2QC2A 2BOKA 3URDA 5C3NA 3FFGA 2QYIA 3EQ0H 3U8TH 1UTNA 3OY6U 2ALVA 1QNJA 1C4U2 2A7CA 1H8DH 1AUJA 1P2OA 1LHDH 1SGPE 3LJJA 3RXPA 3EA9A 4MPWA 2TGDA 4X2VA 2XXLA 9ESTA 2OQ5A 1QBOA 2ODYB 5DP6A 1YPEH 1T31A 4DVAU 1T8OA 1YF4A 1O2UA 2UUJB 1MD7A 1IQJA 1NU7B 3ATIA 2R2MB 4ABAA 1UCYH 1LKAA 2WINI 1PPHE 1EB1H 1OP2A 1TRMA 1HCGA 1C1UH 1F5KU 2BHGA 1K2I1 2R0LA 5FCRA 1L1GA 3QGJA 1ZSLA 1NS3A 2FS8A 1GL0E 4ZKOU 4TWWA 2OP9A 1KLJH 4FUGA 2ZCLP 3JZ1B 7ESTE 3CS7A 5T6DA 1B0FA 3F6UH 4HI3A 3LC5A 2A5IA 2ZU1A 4ZXXH 1ELGA 1PPFE 5DPAA 3VB7A 4AB9A 1XXDA 2BQ6B 1XUHA 3H7TA 3ZZ9A 3U69H 1O3DA 1TNGA 4D76A 1GGDC 2BDCA 5LPFA 1O3GA 3K65B 1O5FH 4LXBH 1HGTH 4ISIH 2OBQA 1PYTD 2EEKA 4OS2A 4DGJA 2C8YB 1P2JA 1INCA 2IOTA 4O03A 4BAHB 2THFB 3GY5A 4X6MA 1GJ6A 1WQVH 1NPMA 2ANWA 1AVXA 1RRKA 2RA0A 4BTTB 4Y8YA 1G9IE 5A09A 2VIDA 4AB8A 2FM2A 3I29A 3T28A 1LKBA 2IJOB 2Z6BD 2Z9KA 3CP7A 1DWBH 3SJOA 3SV9A 1W7XH 3A7YA 1W14U 3KF2A 3AAUA 3IITA 1P2MA 4A7IB 3M37A 4X8TH 2AMDA 1CBWC 1H1BA 1P03A 1C5QA 4CRDA 2GVFA 1L1JA 1JWTA 2GKVE 1TX8A 3KCGH 3T2NA 2EI6A 1C1NA 3T5FH 3LKWA 4ISOA 2FS9A 1LQDB 1Z1JA 1C5TA 2FOHA 1BTPA 3PROA 1N6YA 2R9PA 4B73A 1SHYA 5A0AE 1JIRA 3ELAH 3E8LA 4A1VA 5TCCA 3SNCA 1JBUH 2WPJS 3I77A 1SBWA 1ABIH 3E91A 2BYAX 1BTXA 3SHCH 2CV3A 1GMDG 2SGDE 3SU3A 2WUBA 4IN1A 1GL1A 1PPCE 1UVOA 2CHAC 3MYWA 1DANH 2B0FA 2BDYA 5FX5A 1UCYE 1C2MA 1C1RA 1FAKH 3ZVGA 2VIOA 1G36A 1EUFA 4KKDA 4YESB 3F9FA 2ZGJA 1G37A 1LHFH 1OX1A 2GV7A 5DJ7A 3SW2B 4NZQA 5E0HA 4NIXA 4ZHMU 2BY5X 2GD4B 3RM0H 3AASA 1Y3YA 1HAOH 1QHRB 3DUXH 1GI9B 2BVXH 3MU0A 1ETTH 1ZMJA 1S6HA 1ELAA 1YPJH 2Y5FA 1GHWH 1AD8H 1WU1A 4KTCA 1ZPCA 2SGEE 2RDLA 4XBCA 1OWHA 1S85A 1GBBA 4YOJA 3GOVB 1C9PA 5T6GA 1V2RT 3SI4H 1A46H 1S6FA 3RXFA 2GCTB 1P2NA 1TALA 2AIPA 2F9NA 3S9AA 3V13A 3K2UA 2VGCB 1MKWH 3V12A 1EZSC 1SGFG 2ZCHP 1QL7A 4X2YA 1AE8H 3GCTF 2F91A 2ZDKA 1LHGH 1BRCE 3SU5A 1O3CA 4FUCA 3RMOH 3S9CA 1KXCA 3T25A 1EB2A 4X1RU 1O3OA 1LPKB 5DP5A 1LHEH 3RXTA 4YT6H 2NU4E 1RIWC 2W7SA 4BAQB 3U1JB 2FMJA 4LZ4B 2GZ9A 1F5RA 1C5MD 1VJAU 1SGFA 2C3SA 2FIRH 1TGSZ 1S5SA 1ZGVA 1SI5H 5JBTA 1SL3A 3EA8A 1YGCH 3ATMA 2BD7A 2NWNA 2Z9IA 1OP8A 4MQAA 1AB9C 2J9NA 4UFEH 3QDZB 1AZZA 2AGIX 3LONA 1C1TA 3P8FA 1GVKB 1UTPA 2ZFQH 2O8UA 3UQOA 4X6OA 3TU7H 2HGTH 2FOEA 1NESE 3KQEA 1GG6B 4CRAA 1O2NA 3FVFB 1KLIH 3BTHE 1O2RA 2CJIA 2GCHG 3P92A 3OY5U 3RM2H 1YPKH 5K7RA 1V2ST 2W26A 1N8OB 2WPHS 2Z7FE 3SJ8A 1D3PB 1P2IA 5AF9H 1AZ8A 3SU6A 3LH3A 2VVUA 3OU0A 2F9BH 3PO1C 1P04A 2TGPZ 4ZHAA 3U98H 2GMTC 4K1TA 1SC8U 3BSQA 2ZHQH 2ULLA 2GZ7A 1GBDA 4B71A 3L33A 4MNWA 1TX7A 5DO4H 3RLYH 2QY0B 1KIGH 2FP7B 3GY6A 3A8BA 2O8TA 2Y5HA 4NIVA 2H9EH 1UTOA 1DS2E 3O8RA 1K28D 1BRAA 3UNSA 2O9QA 1XVOA 2GT8A 1CSOE 1GHZA 5E0GA 3I78A 2Y81A 4YOIA 3RXUA 1S0QA 2OC7A 1BBRE 1GBIA 3MFJA 4R0IA 1MUEB 3Q3YA 1ZGIA 2WPKS 1J9CH 4LK4A 1D9IA 2H5CA 3VB3A 4ZAEA 4UFFH 2OTVA 1JRSA 1UVSH 4ZHLU 3S7HB 1Q31A 2J34A 1CO7E 1IQKA 1GJ4H 1TFXA 1CHOG 2PTNA 2VU8E 1CQQA 1XUKA 1O2OA 2GX4A 3LPRA 1Z8IB 3A7VA 4KTUA 3ZYDA 5JBCS 3ZZ4A 3SV2H 1BTZA 3EA7A 1O35A 4R8TB 2ZQ2A 3SU1A 5GCHF 5GDSH 2V35A 1BA8B 4Q7ZA 5C1XA 3LIWA 4Y8XA 1C1OA 4Y0ZE 1P0SH 5EU8A 2ZDLA 2ZHEH 1T4UH 3VB6A 3MOCA 2ZDAH 2ZFTA 3O8BA 2TBSA 1O5GH 1ELFA 2QAAA 1TGTA 4OS6A 5GIBA 3TJUA 1C2LA 1ELCA 1NZQH 1O2IA 2Y80A 4FVDA 3STIA 3SUEA 1SGIB 4IC5A 1C2GA 2BB4A 1C4Y2 1HJ9A 1UMAH 2SNVA 4X1PU 1ZLRA 4BXWA 1SQAA 1OXGA 4FXGH 8ESTE 4ABIA 4RN6A 1KTTB 1K1NA 3GDVA 1W3CA 2H5DA 4B74A 2OUAA 3LGWA 4DIHH 1LVMA 2G4UA 1GHAG 5GWZA 3SNBA 2Z94A 1JRTA 2V3OH 5DGJA 5F6MA 4LZ1H 1QURH 5L2YH 1MZAA 1VGCB 4WH6A 3NWUA 1HNEE 1GBAA 1Q2WA 4Y7AA 3A87A 3MNBA 1C5OH 2XNIA 2W3KA 3DT0H 1DM4B 2AIQA 1O3FA 1SGNE 1NRRH 4H6SB 1GBTA 1KTSB 1H4WA 1DY8A 1W7GH 1IQLA 1YBWA 2AH4X 2C8XB 1OWDA 1NO9H 4AFQA 3MTYA 3TPIZ 1E36B 2P3UB 1TNJA 4DY7B 1NN6A 4O3TA 2GZ8A 4XE4A 4Y79A 2V3HH 2BVSH 5I46H 2P59A 2XC5A 3QTVH 2O8LA 1YPGH 4ABHA 1RGQA 1ESAA 3U8OH 2G52A 3HKJB 2F83A 3ENSB 2J38A 2ZDMA 1O5BB 2FZZA 3D62A 5FBEA 4A5TS 4NG9H 2GT7A 2R3YA 2VJ1A 3W95A 3BEIB 4IS5A 4GAWA 1AUTC 1C2FA 4YT7H 1KYNA 1CA0B 4JZ1A 5EQSA 1UVUH 2ZHWH 1SOZA 2VWLA 4UFGH 2BOHB 3PTBA 1CBWB 1BT7A 2XWBI 1EOLA 4TYDA 1TGNA 5FXLA 4WMFA 4FU7A 1KXAA 1NRQH 5SGAE 4O9VA 4E7NA 3NUMA 2BY6X 5E8EH 1AKSB 2AMPA 3SV7A 2NU1E 1MD8A 3LGTA 3OSYA 3VGCC 1W8BH 1V6DA 2ZEBA 5LGOA 1UJ1A 1O38A 1D6WA 2FYQA 1QB9A 4MLFB 1V2NT 2HNTE 3GY7A 2ZPRA 3A80A 3N7OA 2XBWA 2BDGA 4JK6A 4YO9A 1V2MT 3B23B 3AVZA 2CHAB 4E06H 4GVUA 3LJOA 2J95A 2D1JA 2Z9LA 3DFLA 1E37B 4RKOB 3RMNH 2FEQH 1FMGA 3P8OA 1O2MA 3B8JA 5E2PA 4VGCB 1MTNC 3BTKE 2NU3E 3MO9A 4ZMAH 1Z8JB 1D6RA 1WBGB 1AHTH 1KSNA 2AFQB 4FUBA 3ATLA 2JETC 5CMXH 1FNIA 1QQ4A 2FLRH 1FONA 1V2KT 2UWLA 5HM9A 1VCWA 1CGJE 3VEQB 3A83A 5F8ZA 3QLPH 2VIQA 3RDZA 1Z71A 3E0PB 4UFDH 2FI4E 1IHTH 4XDEA 3SI3H 1EP6A 1FAXA 1EQ9A 5C5OA 1QB1A 3FP8E 1FPCH 3LGUA 1EOJA 2BQWB 3SHAH 1JIMA 1YPHE 5AHGH 3RUOA 2PKSC 1MCVA 5EPNA 1T8MA 4JYVH 3M3VA 4E7RG 1PFXC 1PQ8A 3NKKA 1ANDA 1GWAA 4CRGA 4CRFA 1GJAB 1BIOA 4KGAA 4ABDA 5HXFA 2PSXA 4WMEA 3RU4D 3PLPA 1VR1H 1TYNA 3PMHB 1NY22 4NA9H 1SR5C 4K8BA 1HJ8A 1S81A 1PPZA 4Q7YA 2ODQA 1EAIA 1TAWA 2XBXA 3A84A 4YM9A 1ETSH 3R0FA 3RP2A 3PWBA 2VH6A 3QUMP 3KHVA 4KP0A 3F68H 1OWKA 3ZVBA 1LPZB 1BMAA 3QZQA 5JB9S 1EAXA 1UHBB 5T3HA 4Z0KA 2FX6A 2P8OC 5CHAC 5EQRA 4TWYA 3A7ZA 2QN5T 3DHKH 1E0FD 3RXAA 3T27A 1RTLA 4KTSA 3ZZ3A 3M7UA 1SOTA 2GDDA 3D49H 1TGBA 3U9AH 3KN2A 4O3UA 3F9EA 2GCHF 2ZQ1A 4GHTA 1XUFA 1QCPA 4Y10E 1K1IA 3SGBE 1IQGA 1BOQA 2G00A 3ZV8A 2ZU2A 1O3AA 2D26C 2UWPA 1DOJA 1UVTH 3ZZAA 4K69A 1HV7A 4OS7A 3LH1A 1EP5A 3BV9B 1MZDA 2BD9A 4JZEH 4QT8C 1ETRH 1W0YH 1SB1H