5C0UA

Crystal structure of the copper-bound form of merb mutant d99s
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
b'MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALSTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title Structural and Biochemical Characterization of a Copper-Binding Mutant of the Organomercurial Lyase MerB: Insight into the Key Role of the Active Site Aspartic Acid in Hg-Carbon Bond Cleavage and Metal Binding Specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase,metal binding protein
total genus 63
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5c0uA00
5DSFA 3F2FA 3F0PA 3F0OA 5C0UA 5C17A 3FN8A 3F2HA 5C0TA 3F2GA
chains in the Genus database with same CATH superfamily
1IQLA 2XBXA 1GHZA 1JRSA 4B76A 2K1QA 2ZPQA 5A8ZA 1EASA 1RFNA 1C9PA 1VZQH 4OGXA 4LXBH 3PMHB 1EZQA 2GTBA 1AKSB 2AEIH 4BANB 1P2KA 5GCHG 1V2VT 2BDCA 2GDEH 5KEDA 2SGFE 3RXSA 1SGEE 5DP8A 1BBRE 1GHYH 2SFAA 4A7IB 1UJ1A 4CH8B 1QNJA 2XW9A 5DN6D 2FP7B 1SR5C 2A1DB 2JDID 5EODA 3JZ1B 1GBAA 2Z3EA 3QX5H 1GI8B 1V6DA 3PRDA 1G32B 2FM2A 1KY9A 1XUIA 3LGVA 2V6NA 1GI1A 4IN2A 1C4V2 3V3MA 1MH0A 1AN1E 1NM6A 2BLOA 2VU8E 1HAYB 3FZDA 2G5VA 2OQ5A 3TJOA 4AOQA 2IOTA 2VIWA 4ZHMU 3U98H 1XKAC 1HRTH 2KCAA 1KXDA 1JWTA 1L1JA 2GJGA 3QK1A 5FCRA 1T4UH 4YLUA 1LHEH 3PO1C 5ESBA 1GL0E 2DE8A 3UQOA 4TPYA 5LPRA 3SV9A 1QL7A 1ARCA 2G00A 2VVVA 4HGCA 4E7NA 2Y7ZA 2XC4A 2FOGA 4KTUA 1IOEA 1IQIA 1P2IA 3QGNB 2A7HA 4TWYA 1O2XA 1C2JA 2VINA 4HFPB 2Y6TA 1TQ0B 1XUHA 2Z94A 3MNCA 2GZ7A 2D26C 3FVFB 1A1RA 6ESTA 1A3BH 3UTUH 1THRH 4B6FA 1FN6A 4NSYA 2WV5A 1O33A 1GDQA 1HDTH 2WPMS 4MVNA 1TPAE 4TSFD 3M7QA 2H2ZA 3ZZCA 4CH2B 1D6WA 3K6ZA 1O3KA 3PWBA 4B73A 3STJA 2SNVA 5F8XA 1VCPA 3KHVA 4A92A 1WTGH 4O03A 3QWCH 1EPTC 4I8HA 1ELGA 1O39A 3M3SA 2Z9IA 3PLBA 3FOAA 1GMCF 2PUXB 4MNWA 4ISHH 5FPSA 5C0TA 1GHAG 4AX9H 5FBEA 4NA9H 3NXPA 1TALA 4X2XA 2IPQX 2KX4A 1A46H 5TCAA 3KGPA 2WPHS 3EDXB 1V2PT 1SBWA 3VFEA 4NIXA 2ZGBH 2FLRH 2HOBA 3E0PB 1HYLA 3M3VA 3OEHD 1EB1H 4CRAA 8KME2 1G3EA 1SVPA 2CGAA 3DFLA 3NUMA 1BMAA 4XE4A 2XBYA 5F53A 1BQYA 1ZR0A 3SUFA 3ZVFA 4AN7A 4UONA 3EGKH 3MNSA 1A5IA 3MU5A 2ZO3H 2XCNA 2BD3A 3P17H 1V2JT 4SGBE 1NO9H 1CU1A 3MO3A 3KEEA 3A8BA 2NWNA 2ZNKH 2J94A 2KFWA 1KLTA 5JDUB 4GVUA 1GDUA 1TABE 3ZZ4A 4WXVA 5T6FA 2W6ID 1DSTA 3K6YA 3A8AA 1C5MD 1B0EA 2F9VA 4THNH 1OWKA 3KQBA 2L74A 4YZUA 2J98B 2EI8A 2PP6A 1NESE 3ENSB 4JYUH 5I25A 1C5QA 3RXJA 9ESTA 1ABJH 4GUXA 3F2HA 4JYTA 5C5NA 2ZPRA 1QB6A 1W3CA 2ZDKA 1XUFA 1WSSH 1ANEA 2WUCA 2OC1A 5J4SA 3MO9A 1O3IA 5A0BA 4ABEA 3UR9A 1A0HB 3TITA 1Z1JA 3CS0A 3FN8A 3WY8A 2AGEX 5C3NA 2ZHFH 4RN6A 5C2ZA 1DWEH 3F9FA 2UWOA 2SGAA 3N7EA 2QXJA 1AIXH 2R3UA 3PLPA 1CHGA 1AVGH 3DA9B 4LZ1H 3S9AA 4ACBA 2XWBI 2FXRA 1H8HD 2ZDMA 4DURA 1JRTA 1O32A 4ABAA 1TBQH 1SQAA 1TBRH 2I6SA 4WVPE 3FAOA 1RGQA 3E1XB 4JZEH 2FOAA 2F3CE 1K1LA 1ZOMA 2BY8X 2QF5A 4RI0A 1DUAA 1AB9C 3FP6E 1H1BA 2KAIB 4BAQB 4X8VH 4J2YB 1EZUC 3VXFH 3GDSA 1ESTA 1GJ6A 1FY5A 1HGTH 2VWNA 1FJSA 2VIQA 3ZZ7A 4F49A 1NRSH 4M9FA 4YT6H 3SNAA 3S9CA 1MKXK 1NS3A 2GCTC 2A0QB 1Y3UA 4ACAA 1P12E 4AGJA 1EFRD 1MU6B 1IQGA 1C5XB 1YPHC 2WPIS 3RXDA 3ZZ6A 5FPTA 4X0WU 4U30A 2ZFRH 1LVMA 2A5AA 2O9QA 1O2SA 2ESTE 1D6RA 1QTFA 4J1YA 1TAWA 3SZNA 1QB1A 5FX5A 1WBGB 2F9NA 1EOJA 3M61U 2Y81A 3GY3A 4IN1A 3KCGH 4BOHA 2ZU1A 1C4U2 3RP2A 4A6LA 4CRCA 4NZQA 5EXNA 5DP4A 5A2MH 1A7SA 1BTYA 1J17T 1MKXH 1O3FA 3A86A 4GHTA 1SOZA 4A5TS 1FDPA 3SU5A 1YPJH 1HJAB 1AZ8A 1OWHA 1KIGH 2Z6BD 4Y7BA 1AUTC 1TRNA 3VXEH 4ABGA 2VVUA 2FYRA 1G3BA 1NBME 3A85A 3RXUA 4WH8A 2Z9JA 1E1RD 1P2QA 4B74A 2KCOA 1F2SE 3SJKA 1YYY1 2PKSB 1PPZA 5DO4H 1A2CH 1FZZA 1GCDA 3MH5A 1MTUA 2JETB 2IJOB 2J9NA 2PV9B 4AZ2B 3M7TA 2RDEA 5SGAE 3UAIC 5C17A 1L2EA 3TPIZ 2ALPA 5FX6A 4I86A 1D4PB 3QDZB 3S69A 3VGCC 4U2WA 1ELCA 3QZRA 1TGTA 2QIQA 3OTJE 3SQEE 5HKKD 1CE5A 2WSSD 2UWLA 1P11E 1Y3WA 3E90B 1NROH 1C2HA 3KQCA 3AAUA 1K22H 2GCHG 5ETXA 1SLWB 1V3XA 1Z8GA 3TJVA 4ABHA 2Y80A 2OLGA 3VB7A 4X2WA 2GGVB 1HPGA 1SLUB 2ZGCA 4I8LA 2A4RA 5T6GA 4RKOB 1V2OT 3MH7A 3SU2A 1GI3A 1RS0A 2FESH 4F4OC 3GCOA 1LHGH 3LGYA 3BIVH 3PV2A 1DLKB 4K2YA 1PYTC 1O2RA 4NG9H 4OS2A 2PLXA 1FAKH 2ANKH 1HAZB 3T29A 1BTHH 3B23B 2BLQA 4Y0YE 2EC9H 1C2KA 5HM2A 3SU1A 1IAUA 3O8CA 1AVWA 2TGAA 2UUFB 2BX3A 4MNVA 5LPFA 1P8VC 3PO1B 2STBE 2PKAA 4K8BA 3NK8A 2PFEA 3T25A 1GJ8B 1ZPCA 2BY6X 1W0KD 2GV6A 4ZCNA 1Z6JH 1O2OA 3BSQA 1SI5H 3F0OA 1L1NA 1TPOA 1ZRKA 2ZI2H 1A61H 2XXLA 3QLPH 2ZIQH 3M7UA 1QFKH 2JIZD 1PPEE 4B2AA 1V2RT 3PROA 3A88A 1BB0B 2ZC9H 1VITF 1XXFA 1H9HE 4DJZB 2JKHA 2B9LA 2ZEBA 2FZZA 2GP9B 4KGAA 1MBQA 1LPGB 4NIYA 2TGDA 1HAOH 1ZJDA 1B5GH 4I32A 1P9UA 2W26A 5EW2H 1CHOG 3GYLB 2RDLA 1PPHE 1HAXB 4ABJA 1ELEE 1NC6A 1SGPE 1VKYA 1O2WA 1YCPK 1GI0A 1PQ7A 1A5GH 2OXSA 1MKWK 3F9EA 1UHBA 4XD7D 1MTSA 1TGSZ 1WTHD 1K28D 3LJOA 5AF9H 4R0IA 1ELFA 2WPDD 2FTLE 1E1QD 3BTDE 3DUXH 1GVZA 1HXFH 3CENA 1Y8TA 4ABFA 2SGEE 1GG6B 4MDSA 5T1VA 3M5MA 4MNXA 8GCHG 1MCTA 3A7ZA 1L4ZA 1QJ1B 2W7SA 1EUFA 1O3DA 5EQQA 3HKIB 2XC5A 2ODQA 1G37A 3ODDA 4UFEH 1WOFA 4AG1A 1DWBH 1DSUA 1HJ8A 5F6MA 1TB6H 1O2VA 3WWFA 2F83A 3BN9A 1V2UT 3MU4A 2AERH 4AC9A 5B6OA 1YGCH 4X6PA 3ZZ3A 2VIDA 1YCPH 4NCYA 1CQQA 2SNWA 5LGOA 1O2PA 1E79D 4E06H 1MKWH 1SSXA 2BVXH 3M5OA 1OP0A 2PSXA 3RMLH 4DGJA 1GGDC 4OGYA 2BXTH 1OHHD 1C2GA 1JXPA 2ZGXH 1ID5H 1Z6EA 2VVCA 4IMQA 1XVMA 3UNSA 3EA9A 1GPZA 1GL1A 3H09A 4KP0A 2F9OA 1KTTB 1QJ7B 2ZCHP 1O5DH 1NN6A 4ZKOU 1O34A 4FOUC 1UTOA 1YLCA 1Q2WA 1TNHA 1ZTKA 1C1PA 1ETSH 1FPCH 1CT4E 3BF6H 1T8MA 4B6EA 2P94A 2ZCLP 4B2CA 3A7WA 3U1JB 4H6TA 1GHBF 1P3EA 3RU4E 5CHAC 5G4BA 4O3UA 1ANBA 3SJ8A 1GBHA 1UTPA 3KNXA 2Z7FE 1ETTH 3LGWA 4YESB 1DICA 2PTNA 1T8NA 4IS5A 3RXIA 2ZFQH 3AW0A 1KXAA 1P06A 2P3FH 3QN7A 3RC4A 1Y3VA 3DD2H 3TIUA 2A2QH 2EI6A 1UTQA 1QRWA 2K8IA 1A3EH 2H9EH 1KXEA 1O2MA 2OC0A 3M36A 1SGIB 4WF8A 3GCNA 4K1EA 4BXWA 2AIQA 1GJCB 3A83A 3IWMA 2OC7A 3O8DA 2O8MA 3GISB 3SV2H 1OWIA 3UNQA 6LPRA 4IMZA 1O2GH 1CT2E 1QRZA 1S0RA 2G8TA 4BNRA 2YMSC 3MQKC 1U6QA 1CT0E 1FY4A 4BAMB 1UTJA 3ZVGA 1FX0B 2ZFPH 5EJ1A 1AD8H 2CF9H 3KQ5A 2XC0A 1EAWA 1MAYA 1DPOA 5HIZA 2BDGA 1UTLM 1GBBA 3P6ZB 2PKAB 5HIYA 1SQTA 1UTNA 4OS5A 3ZZBA 1C4Y2 4GHQA 4HG6A 2H9HA 5IDKA 4DT4A 4NFEA 3M35A 1LDTT 2CN0H 1O37A 3NPSA 1P2NA 3RXGA 4JZIA 1H8IH 1GJ9B 1Y59T 1GI7B 2BD7A 1MTVA 3GY7A 1O3AA 1K1OA 4X1QU 3ZZDA 1N6XA 1ELBA 1RJXB 3ATMA 4YTAA 4MLFB 1LQEA 3RXEA 3TGIE 1UK4A 2STAE 3FANA 4MNYA 2YNBA 4CR9A 4FUBA 1BJVA 1FI8A 2GVFA 1KMHB 2ZHWH 3SUGA 1NBMD 2FPZA 4NZLA 3RUOA 5HYOA 4Q63A 4UFFH 1O3LA 1C9TA 4Z1MD 3SUDA 2VJ1A 2CJIA 1FXYA 1FIZA 4GCHF 4AYYB 2P3UB 3RXBA 2AH4X 1O5AB 1SB1H 1ZHRA 2GD4B 1MD8A 1CA0C 3B8JA 4Y79A 1O31A 3RXFA 2Z9KA 2YNAA 1GWAA 1SG8B 1GJ7B 1P09A 3TH4H 8GCHF 2WV4A 1AHTH 4RSPA 1DDJA 3BTME 1BT7A 5ABWA 1GBTA 1C5OH 2F4LA 5BRRE 4CBOA 4ABDA 2LELA 2IN2A 2O8WA 3SV8A 2VBCA 3SGQE 1F0UA 4U32A 3ZYEA 3TVJB 7LPRA 4Z6AH 4XBBA 3VGCB 1SGFG 1LTOA 3A89A 4B1TA 3HGPA 1AE5A 4UDWH 2QF0A 1TX8A 2V7QD 1HFDA 2FODA 3BV9B 1V2TT 3E6PH 4OS6A 4WJG2 5JB9S 3E16B 1DT2A 5JBBS 2Y82A 2P3TB 1KSNA 1FN8A 3QTOH 3BTEE 2Y5FA 1WCZA 4A1TA 1JBUH 2AGGX 1BA8B 2BY5X 1QCPA 1C2EA 1TBZH 5IK2D 5E0JA 4X1NU 1P9SA 1C1NA 4CR5A 1YWUA 1NY22 4A1VA 3VEQB 1ZTLA 3MOCA 3SJIA 1BHXB 2CXVA 2GV7A 1C5RA 1C1WH 3RM2H 1GJDB 4AFSA 4I8JA 1AUJA 1H8ED 2ZKSA 3A7XA 4ZHAA 2ZGJA 2BD8A 1GI9B 5EQSA 7GCHG 2ZTZA 1JMOH 1EOLA 2NU0E 4HZHA 1KDQB 2BDBA 3RXCA 3F1SB 2PGQB 3F68H 4YOGA 1BHXF 1GG6C 2W3KA 5E0HA 3TK5A 1HIAA 4NGAH 4YM9A 4ISIH 2D8WA 5FPYA 1BMFD 5A8XA 1DX5M 1UK3A 2A2XH 1C2LA 5AFZH 1FUJA 1XKBC 3P8OA 1K0HA 1MUEB 4Y6DA 2Z3DA 2O8UA 3OTPA 5EW1H 1LHCH 5BPEA 4AB9A 1AFEH 3AAVA 1DY8A 1T31A 1YPHE 2R3YA 1WV7H 4B71A 4NSVA 5JBTA 4YOIA 3W1EA 1SLVB 2J92A 1DE7H 4FUIA 4E05H 4X6OA 2M5TA 3E0NB 4K1TA 1C1RA 1OSSA 1EAIA 2YMSD 2ALVA 2GKVE 1O36A 3LGIA 2Z9GA 3NRLA 4ZUHA 3SZEA 1QQUA 4WY3A 3RXQA 4LOYH 4YLQH 1TPPA 1H9LB 1ELVA 1RXPA 5A09A 1QIXB 2ZZUH 1NRPH 1GVKB 1GMDG 2ZDVH 3KQDA 2BM2A 2XYAA 4X1SU 1TE0A 2G4TA 4AFZA 1QBOA 1UCYK 2ZCKP 3LDXH 1W12U 4ISNA 1NFXA 1KYNA 2FYQA 2JJ2D 1SGNE 2Q6FA 1NRQH 1ZJKA 1JIMA 1O3PB 5GCHF 1AVXA 2ZA5A 2RG3A 4Q2KA 3MU8A 3TK6A 1TNJA 1GJ4H 2Y7XA 4I31A 1BOQA 1P04A 1H4WA 1YP9A 3UB0A 1RTFB 1XVOA 2FTMA 2OC8A 4YO9A 3TNTA 4DW2U 2TRMA 5DP9A 1OOKB 4BAKB 3F9GA 4FUEA 2VNTA 1FLEE 5DKMA 1ZSLA 1GI2A 4IBLH 1GGDB 1ORFA 1YLNA 3DSGA 3FKSD 1AMHA 1A0LA 1BTWA 4FU7A 3PRBA 1LMWB 1G36A 1LHFH 1E34B 1E37B 1FPHH 1NRRH 4SGAE 3HK3B 1S6FA 1UCYH 1C5NH 1Y3YA 2V35A 5DGJA 3RU4D 1TOMH 3GDVA 4DCDA 1BTPA 1P57B 2IPHA 4AFQA 3EA7A 3P92A 1IQFA 1ELDE 2FI3E 1PJPA 3GOVB 1UVTH 1RTLA 3UIRA 2BLVA 2C8YB 1TWXB 5E8EH 2PWXA 2GZ8A 3MNBA 4JCNA 5CHAB 3BG8A 4E7RG 1C1MA 1DUEA 3UWIA 2QV1A 4ZHLU 1S82A 1HXEH 5GPIB 1PPCE 5CDFE 1P2MA 4AG2A 1P3CA 1OX1A 4ABBA 3SJOA 5FCKA 1WQVH 1TQ7B 3QTVH 3N7DA 4KELA 4ZXYH 1D3PB 1TFXA 1EQ9A 1SGRE 3U9AH 1ZGVA 2FX6A 3CP7A 4ZKNU 3HPTB 1BIOA 1KTSB 1DWDH 1BRBE 2YMSB 2D1JA 2OD3B 1ARBA 2BY9X 2FOHA 3IG6B 1AI8H 4DOQA 2LP6A 1ANCA 3NZIA 1C5WB 4O9VA 4K5ZA 2A31A 1D9IA 2XNIA 1W0ZU 5K0HA 2NU1E 3M5LA 2B5TB 4Y71A 2CV3A 1LCYA 3OU0A 1GHAF 5DP6A 1T4VH 3E8LA 2PR3A 4CRFA 1P03A 1O2JA 2VB0A 2AMPA 3GCTG 1NTPA 2JH6D 3UY9A 4IC5A 1RD3B 3SJ9A 3C27B 2UWPA 1CBWB 1EJAA 3DFJA 2SGQE 1TX7A 3UUZA 1EAUA 1UK2A 3K2UA 5TJXA 1CGIE 1ZZZA 1O2YA 2PW8H 3OY6U 1BRUP 4WH6A 3ZZ5A 4INKA 1C5UA 5C20A 4MTBA 2J95A 1Q31A 4D7FA 2QF4A 1YCPM 2F9UA 4YT7H 3K9XB 3SQHE 2HALA 1SGYE 4K1SA 1C1TA 1PQ5A 1LVYA 3GCHC 2OCVB 1F5KU 1Z71A 2FEQH 1Y3XA 1VR1H 1CO7E 2J5UA 2ZWLH 4HI3A 2GDDA 4K8YA 2F91A 3AVZA 1L0ZA 4H4FA 1GI5A 3U8RH 1KXBA 2BDHA 1SGCA 1CGJE 4VGCC 2BQ7B 9LPRA 1K1IA 2K0QA 5A0CA 1UTKA 4KTCA 1V2WT 1ZHPA 3DHKH 3LH3A 1W2KH 4BAHB 3AW1A 1HUTH 5H4IB 1CA0B 1THPB 2J34A 1O3MA 2AS9A 2THFB 3S7HB 4U01A 1A4WH 3L6PA 1GHWH 1EJMA 4AORA 4TY6A 4Y8YA 3H5CB 3U8TH 4Z0KA 1S5SA 2KCPA 3D49H 4XFQA 1BMNH 1QB9A 4Q80A 1W8BH 2JH0D 2QYIA 1QBNA 1O5EH 5F03A 1PPGE 1UMAH 1HAVA 3ZV9A 3OE7D 2BXUH 3UOUA 2ZDNA 3QZQA 2JJ1D 1O3BA 1ZMNA 2GX4A 4XBDA 2BVRH 2V0BA 4X6NA 5JYIA 3BEUA 1W7GH 3TLOA 3RU4T 1TNIA 3S9BA 2IJD1 5EXLA 4MPVA 1MAXA 1WU1A 1XXDA 2QCYA 2BB4A 5B6LA 1WUNH 2RCEA 4I8GA 1TNGA 3CS7A 2ZGHA 1LVBA 2Q6GA 1GHXH 3EYDA 5T6DA 1S6LA 1P2JA 1TONA 2BZAA 2QXHA 3VB5A 3A8CA 3L3TA 1BRAA 3BEFB 4FETA 1X7AC 2BOHB 1OYQA 2FI4E 2OQUA 4UE7H 5EIYA 2ZFSA 7ESTE 1K1MA 2ZQ2A 1RTKA 3KYGA 2FWWA 1C1SA 2D2DA 3RXPA 1ELAA 4MPUA 4X8TH 3TH2H 1TPSA 3F6UH 4K69A 1WDIA 2L6OA 5C0UA 2QN5T 1SGQE 1UVOA 2KZ4A 2QC2A 1OP2A 4CHAC 3ELAH 1V2ST 1XX9A 1EKBB 1G2MA 1SLXB 1TA2A 1MCVA 3VB6A 1O2HA 2V3OH 4ISOA 1ABIH 1C2MA 2VH0A 1IHSH 2C8WB 5FXLA 3BTWE 3GY6A 3UQVA 2WPKS 2BLWA 2QA9E 3KYFA 1O3HA 4ZH8A 1SC8U 5C94A 3RLYH 2BQ6B 3LIWA 3SV7A 2G4UA 1ETRH 2FOFA 2H5CA 2H1UA 1O2QA 3TGKE 1MD7A 3DCLA 1CGHA 1ZLRA 1Z1IA 1IQHA 1TA6A 3U28C 1DXWA 1S85A 1FAXA 1SQRA 1UVUH 1W0YH 4FUGA 1C5YB 3SORA 4RKJB 2WYJA 3PB1E 2EQNA 3GY2A 4IC6A 1CA8B 2PSYA 2HLCA 1YPEH 4AGKA 3LKWA 2C3SA 3T5FH 1F0RA 1G3DA 3ZZ8A 5JBCS 1DLEA 1S0QA 1SMFE 2BDYA 4ISLA 2FS9A 1WYKA 3UOPA 3MH4A 2TIOA 2VWLA 2C8XB 5E0GA 1HNEE 3PTNA 1O5FH 3Q77A 1HV7A 2PUQH 3F3BA 1KXCA 3FP7E 1EX3A 2XTTB 4XDEA 3W95A 3WWBA 3T62A 1GDNA 3MNXA 1HLTH 3UNRA 3UREA 3BTGE 3EE7A 4P02A 1SQOA 3JZ2B 3DSPA 1O0DH 1SOTA 4XRNA 1BZXE 1INCA 4DG4A 3A80A 6CHAC 1DOJA 3ATKA 1BITA 3UWJH 4Y10E 2FX4A 1PPBH 3T28A 1GI4A 1GHVH 3G01A 4INHA 3ATLA 2GCHF 2RA3A 1EB2A 5IYTA 4B75A 3ZVDA 1EJNA 1QA7A 5KECA 1QQ4A 3ZYDA 4D7GA 4MPXA 3RDZA 1IQEA 3URCA 1AWHB 1W13U 2GT7A 3TK9A 4QT8C 1EAXA 2P59A 1AWFH 1OWDA 3RXAA 2W7UA 5C67A 1A0JA 1ELTA 1XM1A 2LPRA 3E91A 4D8NA 3MWIU 1C5LH 1S6HA 5EGMA 2ZDAH 1UO6A 2A7JA 1NPMA 2CMYA 1TLDA 1LKAA 2SGDE 2Z3CA 4FUFA 2ASUB 4BXSA 3RMMH 2NU4E 1C1OA 4DIHH 1P02A 3QGJA 2PHBA 4XOJA 5EG4A 1OYTH 2ZU3A 1BCUH 4RT1A 1F5RA 3PYHA 1COWD 1V2MT 4KKDA 1O3GA 2R0KA 2C4FH 3RMOH 1AGJA 2TPIZ 4JMYA 2BY7X 1S83A 3RMNH 4Y8XA 3SGBE 2A7CA 1SL3A 1HAGE 1PYTD 1CBWC 1YPGH 1QL9A 1XUKA 2WUBA 2WYGA 1MZDA 4ZAEA 1FY3A 2ZTXA 1YPMH 1KLIH 2BTCE 4XBCA 4RT0A 3LGTA 2BDIA 3TGJE 1CHOF 3VB4A 2GZ9A 1WAYB 1T8LA 1VCQA 2EY4C 5L2YH 2TBSA 3O8RA 1F0SA 5I46H 1NFUA 1SFIA 4GLYA 1UHBB 5F8ZA 4AFUA 1AO5A 3ZVCA 3RXRA 3E3TA 5EJZA 1TMUH 4DIIH 5CMXH 3GYMA 1PPFE 2W5EA 3ZZAA 1K1NA 4Q7YA 4Y11E 3BG4C 3V0XA 3I78A 1VGCC 5DG6A 4X1PU 1S81A 4MG3A 1KLJH 3SV6A 1GBIA 1XMNB 1HAIH 1ZSKA 1AE8H 2H5DA 2P16A 2UUKB 5EU8A 5L6NH 1O2ZA 2WZQA 4JZFH 1FONA 3RXMA 1K21H 1O5BB 2FOBA 2HNTC 1UVSH 1VCWA 1DS2E 1E36B 3TU7H 3QO6A 1SGFA 3HKJB 2WHXA 3Q3XA 3K65B 1QGFA 1UCYE 3PV4A 3BIUH 5AFYH 2ZPSA 3NKKA 1JIRA 2UUJB 3Q3YA 1O3OA 1O3CA 1C5ZB 2ZHDA 3PM3A 4JK5A 1NU7B 3IITA 3GCHB 1MZAA 2KR7A 2XNDD 1C2DA 3PTBA 5AHGH 1MTNC 4Y7AA 2Y5HA 2AMDA 4AB8A 4IGDA 2KAIA 5FHTA 3LT3A 4CRBA 4ABIA 1J15A 4OS1A 4D9RA 1W14U 4LK4A 2SGPE 1G2LA 4KTSA 1Y5AT 4VGCB 4WMEA 1TGCA 3U8OH 1AFQC 1GJBB 4I8KA 4Q7XA 4UEHH 3ZVEA 1GJAB 3F2GA 4NFFA 3GY5A 3KN2A 2QE7D 4AYVB 1GMHG 3AK5A 2W3IA 2WINI 1YC0A 1TRYA 4GSOA 2ZQ1A 2ZU2A 2QGRA 2A4OA 2A5KA 1XUJA 2BOKA 2ODYB 3ZV8A 1SPJA 3PMJA 1TOCB 2BD2A 1DWCH 1LKBA 2AMQA 1FIWA 4FUHA 4H42U 5E2OA 4X1RU 5CE1A 1YF4A 2C93B 5FAHA 2F9PA 2HWLB 1NFYA 2ZHQH 3LC5A 1GBJA 2VIPA 1GBFA 1HAPH 6GCHG 1JOUB 5HGGA 2XBVA 2M2AA 1B7XB 1TMBH 2A45B 5EQRA 2P8OC 1BTUA 1YPLH 2FOMB 3RXTA 1MQ6A 1Q3XA 3UPEA 1MBMA 2VIOA 1YM0A 3ATWA 4FVBA 8LPRA 3MO6A 5C1YA 2A32A 3M5NA 1DVAH 1V2LT 3OFND 2ANMH 4ZKRU 2FI5E 3MI4A 4F48B 2OBQA 1BMLA 1ZHMA 3EE0B 4ZKSU 1HCGA 2KM0A 4Y0ZE 2J97A 1RRKA 1IQKA 1EP6A 1VITH 4FUJA 4X2YA 4DY7B 1XUGA 3D62A 4FXGH 5GDSH 2VH6A 3FZZA 4B2BA 2G81E 2RA0A 2ZU5A 1BBRK 1EP5A 1GJ5H 4TPIZ 4ASUD 1LO6A 1SHYA 5DPAA 3LPRA 3GICB 4CHAB 2AGIX 1K9OE 3PLKA 2B8OH 5CHBA 2BD5A 1BTZA 5KGOA 1F92A 2A4GA 1OKXA 2CHAC 2NU3E 5L2ZH 2VGCC 3SO3A 5C1UA 3UR6A 1W11U 3LC3A 3P8GA 4O3TA 1O2NA 3CNRA 1QRXA 3AASA 3KL6A 1P2OA 2OBOA 2ZFTA 2OUAA 2ZG0H 3BTTE 2QAAA 2W6JD 2ZTYA 3EA8A 3SNBA 2B7DH 2O8TA 4ZROA 1ZTJA 4FUCA 3SU0A 4CRDA 3SI3H 1LPKB 3P70B 4BTTB 1QR3E 1YLDA 1BBRH 4DT7B 1O2LA 2ZP0H 3LGUA 2BZ6H 3LONA 3ZZ9A 2QF3A 4A1XA 1AU8A 1TIOA 3HATH 3R3GB 1QY6A 2AYWA 2BX4A 3OX7U 4CBNA 2EEKA 3Q76A 1L1GA 1OPHB 1ZYOA 1SGTA 1UTMA 3O8BA 1IQNA 3SU3A 4ESTE 1BMMH 3RXOA 3MU1A 1PQAA 4LZ4B 4GPGA 5HXFA 1QHRB 3V7TA 1MMJN 6CHAB 1VITG 1WQSA 2FS8A 5FBIA 1G30B 3PMAB 5GJ4B 3SUEA 1W10U 3OY5U 2ZECA 1BTXA 1RIWC 2BQWB 1K1JA 2XOKD 2ZF0H 5GNDA 1K1PA 1MQ5A 3ATIA 4GAWA 2FO9A 3T27A 1SHHB 3TH3H 2BD4A 4YOJA 2WPLS 1H8DH 1J8AA 3A82A 3C1KA 2Y5GA 3A87A 1GMHF 3BTFE 4NWKA 1J16A 1FV9A 1GCTC 4O97A 1EPTA 2CK3D 2QY0B 2Z9LA 5DP7A 1B0FA 8ESTE 2EA3A 3GDUA 2GMTC 2HVYB 2WV9A 1ACBE 2QXGA 5EOKA 2C90B 1TGBA 2DE9A 1SKYE 3T26A 3HK6B 1DXPA 5ESTE 4D9QA 2OINA 4JZDH 7KMEH 3SNCA 3LOXA 3MH6A 4H6SB 1C1VH 3VB3A 3H7TA 2FIRH 3SU4A 2XWAA 2R2MB 7GCHF 3RC6A 1HBTH 1Y5BT 2A4QA 1A5HA 5TCCA 2QXIA 4X8SH 5LH8A 1HIAB 1DY9A 6GCHF 2R2WU 2H6MA 1IHTH 3URDA 2KCYA 3SNEA 5EXMA 1DITH 4I33A 2FMJA 2GT8A 3RXHA 3DT0H 3TJUA 4NIWA 5JPMH 1O38A 4WMFA 1J9CH 3LJJA 1LQDB 1UVPA 4JK6A 3BEIB 3KF2A 2I6QA 1D3TB 3EAJA 1W7XH 1TYNA 1N8OB 2P95A 1GBDA 3KQEA 3ITIA 5DP5A 3N7OA 1PFXC 3ODFA 3A7YA 2AHME 2WPJS 3WW7A 1C5SA 3Q3KA 1T8OA 3P95A 1T7CA 1Y5UT 3A81A 1CVWH 2OK5A 1HB0B 1O2KA 3MTYA 4TWWA 4NA7A 1FQ3A 5T3HA 1HJ9A 1T32A 1BRCE 2ZDLA 5F8TA 4D76A 1LPZB 2R9PA 1MABB 2HRVA 1GHBG 3PWCA 1YBWA 1EZSC 3BG4B 1YKTA 5DSFA 5L30H 1VGCB 4FU8A 5GXPA 5EJLA 1AZZA 1J14A 1GMDF 1OP8A 2BDAA 3SNDA 2G52A 1ESBA 1NFWA 1O5GH 1GBKA 3RM0H 5A8YA 1FMGA 1GBCA 1V2KT 4UD9H 3SU6A 1QURH 4OS7A 1FNIA 2P93A 3MYWA 1EXFA 1O2UA 1ZSJA 3W94A 1LHDH 1IQJA 3PMBB 1MU8B 4X6MA 1OS8A 3RXVA 1NRNH 3RXKA 3B9FH 2O8LA 2HLDD 1F5LA 1DFPA 4OM9A 1P05A 3MFJA 4BTUB 4DVAU 3F9HA 1ZMJA 2HNTF 1HAHH 3LU9B 4JYVH 4TY7A 3FFGA 2ANWA 1FY8E 1MTNB 3KIDU 4WWYA 1TGNA 1EZXC 3GS9A 3SHCH 3ZIAD 4CRGA 2FOCA 5C5OA 4X8UH 3HGNA 2J2UA 2H9TH 4PROA 3ZVBA 1TMTH 1UW7A 5A0AE 3OEED 1AFQB 3QUMP 3TNSA 5EPYA 5DP3A 5GWZA 2XBWA 2RFKC 1SGDE 5JB8S 4M7GA 1YY3A 1KXFA 4MQAA 1ZMLA 4K60A 3RXLA 1SFQB 2ODPA 1Z8RA 2PGBB 1GBLA 3SOSA 2BVSH 4IW4E 1O3NA 1OXGA 2ILNA 2VIVA 4FU9A 4TYDA 2ZFFH 4UFGH 1GBEA 2V3MA 4ZXXH 3GY4A 4I7YH 2Q1JA 5C1XA 1N1LA 1VJ9U 3NCLA 1BDAA 2VWOA 2YOLA 3SBKA 3STIA 1O2IA 5JBAS 2LNCA 3I77A 3D65E 3SN8A 1D3DB 1D3QB 2VWMA 1AKSA 3MMGA 4Y76A 1TRMA 5HM9A 3FP8E 1WXRA 1CSOE 4JZ1A 1ZPZA 3T2NA 2P8OB 4FUDA 1EPTB 1TX6A 1QA0A 3NWUA 5E2PA 4NIVA 3VPKA 4GCHG 1OWEA 1QZ8A 1BJUA 1DM4B 2HPQH 1C5TA 4Y8ZA 1MTWA 2BMGB 2F43B 1ESAA 2JH5D 2J38A 3BTQE 1G3CA 4X2VA 3TJNA 1F7ZA 3N99A 3LH1A 2HGTH 3P8NA 3P8FA 1ANDA 3OAAD 4INLA 5EPNA 1QBVH 1TNKA 5HMAA 1V2NT 1O2TA 2CF8H 3H7OA 2R0LA 3S7KB 3A7TA 3DSOA 1AQ7A 3A7VA 1EATA 3SGAE 3GCTF 5LPEA 4ASHA 3SHAH 1E35B 1Z7KA 1F0TA 2AFQB 5K7RA 3D23A 3BTHE 2OP9A 2C8ZB 3BTKE 4Q4LA 1V2QT 4MPWA 1O30A 1Z8IB 4ZMAH 1OWJA 2FLBH 3V12A 5PTPA 3EQ0H 3R0FA 5DK1A 3SW2B 3ESTA 1C2IA 1ZGIA 1NU9A 1G9IE 2PTCE 5DJ7A 2BD9A 1C2FA 1YPKH 2CHAB 2VGCB 1NT1A 3SYJA 1VJAU 1M9UA 2OTVA 1K2I1 2XCFA 2EI7A 3U1IB 4CREA 4WXIA 4UFDH 2UUYA 3PV5A 1BUIA 1L4DA 2G5NA 2TGTA 3S0NA 3RC5A 1GI6A 3U69H 5FL7D 1GVLA 2ZHEH 1TNLA 2ANYA 1O3JA 3GY8A 4FVDA 3SI4H 2V3HH 3UFAA 3FO8D 3MHWU 2FDAA 1O35A 2HNTE 3I29A 1P01A 4NA8A 1C1UH 3A8DA 3OSYA 3OYPA 4WMDA 1QJ6B 5J4QA 2G51A 1GBMA 1LVOA 3VG8A 1GMCG 1PQ8A 2TGPZ 4R8TB 4F55A 4P00A 1FY1A 2Q6DA 2ZU4A 4YXWD 5AVDA 1AY6H 1KDQA 1C5PA 1HAVB 4K3JA 2F9BH 2HPPH 2B0FA 3RLWH 4BAOB 4OS4A 1THSH 2BYAX 3Q00A 3MU0A 2FOEA 2NU2E 2DUCA 1E38B 3ZVAA 4TT3D 1W0JD 2AIPA 1Z8JB 1AB9B 1H9IE 3V13A 2BHGA 1HJAC 1RIWB 1P0SH 3L33A 1E0FD 3M3TA 2A5IA 1ZPBA 3M37A 4HTCH 1ZRBA 1N6YA 2GCTB 2J4IA 3F2FA 2XRCA 3A84A 2G55A 1C1QA 1N8OC 1O3EA 1QL8A 2ULLA 2PKSC 1P10A 1NZQH 2HVXA 5GIBA 1GCTB 1DANH 4NWLA 4XSKU 2JETC 1S84A 1C5VA 3F0PA 1O5CB 2J98A 4BTIB 2GMTB 4Q7ZA 1IQMA
chains in the Genus database with same CATH topology
4B75A 2JJ2D 4Q4LA 4OM9A 1RGQA 2WSSD 5HKKD 4NWKA 2WHXA 4B76A 2K1QA 2QF5A 2CK3D 3E90B 3M5MA 4RI0A 5T1VA 3FOAA 2WV9A 4I31A 2P59A 4ASUD 5ETXA 5FPSA 3UB0A 5C0TA 2OC8A 1SKYE 5IDKA 4A1TA 5EQQA 3GS9A 2L6OA 3SYJA 3U1IB 1DXPA 3ZIAD 4DT4A 2XCFA 2GGVB 4M9FA 2OINA 4WH6A 5C0UA 3LOXA 2KR7A 3PV5A 2XNDD 1NS3A 5IK2D 5CHBA 2A4RA 2KZ4A 3RC5A 5FL7D 3WWFA 3FKSD 2A4GA 3SU4A 3OEED 2QF4A 3SU2A 3OEHD 1EFRD 5DN6D 4A1VA 2FP7B 2F9UA 3RC6A 5EPYA 2JDID 2A4QA 3PRBA 5FPTA 3PV2A 5F53A 3SUFA 1DY9A 1E79D 1COWD 3M5OA 2KCYA 2OBOA 1H8ED 3FO8D 3PRDA 4I33A 2FM2A 2J5UA 1OHHD 2W6JD 5EQSA 2XCNA 4JMYA 1JXPA 3F2GA 3SV7A 1CU1A 3KEEA 3SU1A 3KN2A 2QE7D 3OYPA 3O8CA 3DCLA 3AK5A 4TYDA 2GVFA 3H09A 1KMHB 2KFWA 3SU0A 2K0QA 3SUGA 1DXWA 1NBMD 3KF2A 4A92A 4KTCA 3VG8A 1N1LA 2W6ID 4K8BA 4Q63A 2F9VA 5FPYA 1BMFD 1RTLA 4R8TB 4F55A 2YOLA 5H4IB 4Z1MD 2KCAA 1W0KD 3SUDA 4YXWD 3LONA 3P8OA 4B6EA 4ZCNA 2AHME 4U01A 3LKWA 4A1XA 3L6PA 3OTPA 5ESBA 2QV1A 3F0OA 3WW7A 1WXRA 3U1JB 1DY8A 3SV9A 3F2HA 5GPIB 5CDFE 2KCPA 2OK5A 4B71A 1W3CA 2JIZD 3SU5A 3W1EA 3KNXA 3O8BA 4TT3D 1W0JD 1NBME 4WH8A 3F3BA 2OC1A 4FETA 2M2AA 1MABB 3OE7D 3RC4A 3N7DA 1E1RD 3SU3A 3O8RA 1BT7A 5EQRA 3WWBA 2JJ1D 4B74A 2KCOA 2F4LA 5DSFA 2K8IA 2LELA 2YMSD 4I32A 2OC0A 2F43B 2FOMB 3SV8A 2VBCA 3FN8A 2IJD1 4WF8A 3NRLA 1A1RA 3SZEA 2YMSB 3N99A 3DSPA 3F2FA 3P8NA 4B6FA 5B6LA 2IJOB 2OC7A 3O8DA 2O8MA 3M5NA 3OAAD 5GJ4B 5EPNA 3SU6A 3SUEA 3N7EA 3OFND 2XOKD 3DSOA 5GNDA 3SV6A 3EYDA 5C17A 4XD7D 1S6LA 2OBQA 4TSFD 2YMSC 1H8HD 2XNIA 4NWLA 2WZQA 4B73A 2KM0A 3F0PA 1FX0B 2WPDD 1E1QD 3M5LA 2V7QD 2HLDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DSF A;  3F2F A;  3F0P A;  3F0O A;  5C0U A;  5C17 A;  3FN8 A;  3F2H A;  5C0T A;  3F2G A; 
#chains in the Genus database with same CATH topology
 1IQL A;  2XBX A;  1GHZ A;  1JRS A;  4B76 A;  2K1Q A;  2ZPQ A;  5A8Z A;  1EAS A;  1RFN A;  1C9P A;  1VZQ H;  4OGX A;  4LXB H;  3PMH B;  1EZQ A;  2GTB A;  1AKS B;  2AEI H;  4BAN B;  1P2K A;  5GCH G;  1V2V T;  2BDC A;  2GDE H;  5KED A;  2SGF E;  3RXS A;  1SGE E;  5DP8 A;  1BBR E;  1GHY H;  2SFA A;  4A7I B;  1UJ1 A;  4CH8 B;  1QNJ A;  2XW9 A;  5DN6 D;  2FP7 B;  1SR5 C;  2A1D B;  2JDI D;  5EOD A;  3JZ1 B;  1GBA A;  2Z3E A;  3QX5 H;  1GI8 B;  1V6D A;  3PRD A;  1G32 B;  2FM2 A;  1KY9 A;  1XUI A;  3LGV A;  2V6N A;  1GI1 A;  4IN2 A;  1C4V 2;  3V3M A;  1MH0 A;  1AN1 E;  1NM6 A;  2BLO A;  2VU8 E;  1HAY B;  3FZD A;  2G5V A;  2OQ5 A;  3TJO A;  4AOQ A;  2IOT A;  2VIW A;  4ZHM U;  3U98 H;  1XKA C;  1HRT H;  2KCA A;  1KXD A;  1JWT A;  1L1J A;  2GJG A;  3QK1 A;  5FCR A;  1T4U H;  4YLU A;  1LHE H;  3PO1 C;  5ESB A;  1GL0 E;  2DE8 A;  3UQO A;  4TPY A;  5LPR A;  3SV9 A;  1QL7 A;  1ARC A;  2G00 A;  2VVV A;  4HGC A;  4E7N A;  2Y7Z A;  2XC4 A;  2FOG A;  4KTU A;  1IOE A;  1IQI A;  1P2I A;  3QGN B;  2A7H A;  4TWY A;  1O2X A;  1C2J A;  2VIN A;  4HFP B;  2Y6T A;  1TQ0 B;  1XUH A;  2Z94 A;  3MNC A;  2GZ7 A;  2D26 C;  3FVF B;  1A1R A;  6EST A;  1A3B H;  3UTU H;  1THR H;  4B6F A;  1FN6 A;  4NSY A;  2WV5 A;  1O33 A;  1GDQ A;  1HDT H;  2WPM S;  4MVN A;  1TPA E;  4TSF D;  3M7Q A;  2H2Z A;  3ZZC A;  4CH2 B;  1D6W A;  3K6Z A;  1O3K A;  3PWB A;  4B73 A;  3STJ A;  2SNV A;  5F8X A;  1VCP A;  3KHV A;  4A92 A;  1WTG H;  4O03 A;  3QWC H;  1EPT C;  4I8H A;  1ELG A;  1O39 A;  3M3S A;  2Z9I A;  3PLB A;  3FOA A;  1GMC F;  2PUX B;  4MNW A;  4ISH H;  5FPS A;  5C0T A;  1GHA G;  4AX9 H;  5FBE A;  4NA9 H;  3NXP A;  1TAL A;  4X2X A;  2IPQ X;  2KX4 A;  1A46 H;  5TCA A;  3KGP A;  2WPH S;  3EDX B;  1V2P T;  1SBW A;  3VFE A;  4NIX A;  2ZGB H;  2FLR H;  2HOB A;  3E0P B;  1HYL A;  3M3V A;  3OEH D;  1EB1 H;  4CRA A;  8KME 2;  1G3E A;  1SVP A;  2CGA A;  3DFL A;  3NUM A;  1BMA A;  4XE4 A;  2XBY A;  5F53 A;  1BQY A;  1ZR0 A;  3SUF A;  3ZVF A;  4AN7 A;  4UON A;  3EGK H;  3MNS A;  1A5I A;  3MU5 A;  2ZO3 H;  2XCN A;  2BD3 A;  3P17 H;  1V2J T;  4SGB E;  1NO9 H;  1CU1 A;  3MO3 A;  3KEE A;  3A8B A;  2NWN A;  2ZNK H;  2J94 A;  2KFW A;  1KLT A;  5JDU B;  4GVU A;  1GDU A;  1TAB E;  3ZZ4 A;  4WXV A;  5T6F A;  2W6I D;  1DST A;  3K6Y A;  3A8A A;  1C5M D;  1B0E A;  2F9V A;  4THN H;  1OWK A;  3KQB A;  2L74 A;  4YZU A;  2J98 B;  2EI8 A;  2PP6 A;  1NES E;  3ENS B;  4JYU H;  5I25 A;  1C5Q A;  3RXJ A;  9EST A;  1ABJ H;  4GUX A;  3F2H A;  4JYT A;  5C5N A;  2ZPR A;  1QB6 A;  1W3C A;  2ZDK A;  1XUF A;  1WSS H;  1ANE A;  2WUC A;  2OC1 A;  5J4S A;  3MO9 A;  1O3I A;  5A0B A;  4ABE A;  3UR9 A;  1A0H B;  3TIT A;  1Z1J A;  3CS0 A;  3FN8 A;  3WY8 A;  2AGE X;  5C3N A;  2ZHF H;  4RN6 A;  5C2Z A;  1DWE H;  3F9F A;  2UWO A;  2SGA A;  3N7E A;  2QXJ A;  1AIX H;  2R3U A;  3PLP A;  1CHG A;  1AVG H;  3DA9 B;  4LZ1 H;  3S9A A;  4ACB A;  2XWB I;  2FXR A;  1H8H D;  2ZDM A;  4DUR A;  1JRT A;  1O32 A;  4ABA A;  1TBQ H;  1SQA A;  1TBR H;  2I6S A;  4WVP E;  3FAO A;  1RGQ A;  3E1X B;  4JZE H;  2FOA A;  2F3C E;  1K1L A;  1ZOM A;  2BY8 X;  2QF5 A;  4RI0 A;  1DUA A;  1AB9 C;  3FP6 E;  1H1B A;  2KAI B;  4BAQ B;  4X8V H;  4J2Y B;  1EZU C;  3VXF H;  3GDS A;  1EST A;  1GJ6 A;  1FY5 A;  1HGT H;  2VWN A;  1FJS A;  2VIQ A;  3ZZ7 A;  4F49 A;  1NRS H;  4M9F A;  4YT6 H;  3SNA A;  3S9C A;  1MKX K;  1NS3 A;  2GCT C;  2A0Q B;  1Y3U A;  4ACA A;  1P12 E;  4AGJ A;  1EFR D;  1MU6 B;  1IQG A;  1C5X B;  1YPH C;  2WPI S;  3RXD A;  3ZZ6 A;  5FPT A;  4X0W U;  4U30 A;  2ZFR H;  1LVM A;  2A5A A;  2O9Q A;  1O2S A;  2EST E;  1D6R A;  1QTF A;  4J1Y A;  1TAW A;  3SZN A;  1QB1 A;  5FX5 A;  1WBG B;  2F9N A;  1EOJ A;  3M61 U;  2Y81 A;  3GY3 A;  4IN1 A;  3KCG H;  4BOH A;  2ZU1 A;  1C4U 2;  3RP2 A;  4A6L A;  4CRC A;  4NZQ A;  5EXN A;  5DP4 A;  5A2M H;  1A7S A;  1BTY A;  1J17 T;  1MKX H;  1O3F A;  3A86 A;  4GHT A;  1SOZ A;  4A5T S;  1FDP A;  3SU5 A;  1YPJ H;  1HJA B;  1AZ8 A;  1OWH A;  1KIG H;  2Z6B D;  4Y7B A;  1AUT C;  1TRN A;  3VXE H;  4ABG A;  2VVU A;  2FYR A;  1G3B A;  1NBM E;  3A85 A;  3RXU A;  4WH8 A;  2Z9J A;  1E1R D;  1P2Q A;  4B74 A;  2KCO A;  1F2S E;  3SJK A;  1YYY 1;  2PKS B;  1PPZ A;  5DO4 H;  1A2C H;  1FZZ A;  1GCD A;  3MH5 A;  1MTU A;  2JET B;  2IJO B;  2J9N A;  2PV9 B;  4AZ2 B;  3M7T A;  2RDE A;  5SGA E;  3UAI C;  5C17 A;  1L2E A;  3TPI Z;  2ALP A;  5FX6 A;  4I86 A;  1D4P B;  3QDZ B;  3S69 A;  3VGC C;  4U2W A;  1ELC A;  3QZR A;  1TGT A;  2QIQ A;  3OTJ E;  3SQE E;  5HKK D;  1CE5 A;  2WSS D;  2UWL A;  1P11 E;  1Y3W A;  3E90 B;  1NRO H;  1C2H A;  3KQC A;  3AAU A;  1K22 H;  2GCH G;  5ETX A;  1SLW B;  1V3X A;  1Z8G A;  3TJV A;  4ABH A;  2Y80 A;  2OLG A;  3VB7 A;  4X2W A;  2GGV B;  1HPG A;  1SLU B;  2ZGC A;  4I8L A;  2A4R A;  5T6G A;  4RKO B;  1V2O T;  3MH7 A;  3SU2 A;  1GI3 A;  1RS0 A;  2FES H;  4F4O C;  3GCO A;  1LHG H;  3LGY A;  3BIV H;  3PV2 A;  1DLK B;  4K2Y A;  1PYT C;  1O2R A;  4NG9 H;  4OS2 A;  2PLX A;  1FAK H;  2ANK H;  1HAZ B;  3T29 A;  1BTH H;  3B23 B;  2BLQ A;  4Y0Y E;  2EC9 H;  1C2K A;  5HM2 A;  3SU1 A;  1IAU A;  3O8C A;  1AVW A;  2TGA A;  2UUF B;  2BX3 A;  4MNV A;  5LPF A;  1P8V C;  3PO1 B;  2STB E;  2PKA A;  4K8B A;  3NK8 A;  2PFE A;  3T25 A;  1GJ8 B;  1ZPC A;  2BY6 X;  1W0K D;  2GV6 A;  4ZCN A;  1Z6J H;  1O2O A;  3BSQ A;  1SI5 H;  3F0O A;  1L1N A;  1TPO A;  1ZRK A;  2ZI2 H;  1A61 H;  2XXL A;  3QLP H;  2ZIQ H;  3M7U A;  1QFK H;  2JIZ D;  1PPE E;  4B2A A;  1V2R T;  3PRO A;  3A88 A;  1BB0 B;  2ZC9 H;  1VIT F;  1XXF A;  1H9H E;  4DJZ B;  2JKH A;  2B9L A;  2ZEB A;  2FZZ A;  2GP9 B;  4KGA A;  1MBQ A;  1LPG B;  4NIY A;  2TGD A;  1HAO H;  1ZJD A;  1B5G H;  4I32 A;  1P9U A;  2W26 A;  5EW2 H;  1CHO G;  3GYL B;  2RDL A;  1PPH E;  1HAX B;  4ABJ A;  1ELE E;  1NC6 A;  1SGP E;  1VKY A;  1O2W A;  1YCP K;  1GI0 A;  1PQ7 A;  1A5G H;  2OXS A;  1MKW K;  3F9E A;  1UHB A;  4XD7 D;  1MTS A;  1TGS Z;  1WTH D;  1K28 D;  3LJO A;  5AF9 H;  4R0I A;  1ELF A;  2WPD D;  2FTL E;  1E1Q D;  3BTD E;  3DUX H;  1GVZ A;  1HXF H;  3CEN A;  1Y8T A;  4ABF A;  2SGE E;  1GG6 B;  4MDS A;  5T1V A;  3M5M A;  4MNX A;  8GCH G;  1MCT A;  3A7Z A;  1L4Z A;  1QJ1 B;  2W7S A;  1EUF A;  1O3D A;  5EQQ A;  3HKI B;  2XC5 A;  2ODQ A;  1G37 A;  3ODD A;  4UFE H;  1WOF A;  4AG1 A;  1DWB H;  1DSU A;  1HJ8 A;  5F6M A;  1TB6 H;  1O2V A;  3WWF A;  2F83 A;  3BN9 A;  1V2U T;  3MU4 A;  2AER H;  4AC9 A;  5B6O A;  1YGC H;  4X6P A;  3ZZ3 A;  2VID A;  1YCP H;  4NCY A;  1CQQ A;  2SNW A;  5LGO A;  1O2P A;  1E79 D;  4E06 H;  1MKW H;  1SSX A;  2BVX H;  3M5O A;  1OP0 A;  2PSX A;  3RML H;  4DGJ A;  1GGD C;  4OGY A;  2BXT H;  1OHH D;  1C2G A;  1JXP A;  2ZGX H;  1ID5 H;  1Z6E A;  2VVC A;  4IMQ A;  1XVM A;  3UNS A;  3EA9 A;  1GPZ A;  1GL1 A;  3H09 A;  4KP0 A;  2F9O A;  1KTT B;  1QJ7 B;  2ZCH P;  1O5D H;  1NN6 A;  4ZKO U;  1O34 A;  4FOU C;  1UTO A;  1YLC A;  1Q2W A;  1TNH A;  1ZTK A;  1C1P A;  1ETS H;  1FPC H;  1CT4 E;  3BF6 H;  1T8M A;  4B6E A;  2P94 A;  2ZCL P;  4B2C A;  3A7W A;  3U1J B;  4H6T A;  1GHB F;  1P3E A;  3RU4 E;  5CHA C;  5G4B A;  4O3U A;  1ANB A;  3SJ8 A;  1GBH A;  1UTP A;  3KNX A;  2Z7F E;  1ETT H;  3LGW A;  4YES B;  1DIC A;  2PTN A;  1T8N A;  4IS5 A;  3RXI A;  2ZFQ H;  3AW0 A;  1KXA A;  1P06 A;  2P3F H;  3QN7 A;  3RC4 A;  1Y3V A;  3DD2 H;  3TIU A;  2A2Q H;  2EI6 A;  1UTQ A;  1QRW A;  2K8I A;  1A3E H;  2H9E H;  1KXE A;  1O2M A;  2OC0 A;  3M36 A;  1SGI B;  4WF8 A;  3GCN A;  4K1E A;  4BXW A;  2AIQ A;  1GJC B;  3A83 A;  3IWM A;  2OC7 A;  3O8D A;  2O8M A;  3GIS B;  3SV2 H;  1OWI A;  3UNQ A;  6LPR A;  4IMZ A;  1O2G H;  1CT2 E;  1QRZ A;  1S0R A;  2G8T A;  4BNR A;  2YMS C;  3MQK C;  1U6Q A;  1CT0 E;  1FY4 A;  4BAM B;  1UTJ A;  3ZVG A;  1FX0 B;  2ZFP H;  5EJ1 A;  1AD8 H;  2CF9 H;  3KQ5 A;  2XC0 A;  1EAW A;  1MAY A;  1DPO A;  5HIZ A;  2BDG A;  1UTL M;  1GBB A;  3P6Z B;  2PKA B;  5HIY A;  1SQT A;  1UTN A;  4OS5 A;  3ZZB A;  1C4Y 2;  4GHQ A;  4HG6 A;  2H9H A;  5IDK A;  4DT4 A;  4NFE A;  3M35 A;  1LDT T;  2CN0 H;  1O37 A;  3NPS A;  1P2N A;  3RXG A;  4JZI A;  1H8I H;  1GJ9 B;  1Y59 T;  1GI7 B;  2BD7 A;  1MTV A;  3GY7 A;  1O3A A;  1K1O A;  4X1Q U;  3ZZD A;  1N6X A;  1ELB A;  1RJX B;  3ATM A;  4YTA A;  4MLF B;  1LQE A;  3RXE A;  3TGI E;  1UK4 A;  2STA E;  3FAN A;  4MNY A;  2YNB A;  4CR9 A;  4FUB A;  1BJV A;  1FI8 A;  2GVF A;  1KMH B;  2ZHW H;  3SUG A;  1NBM D;  2FPZ A;  4NZL A;  3RUO A;  5HYO A;  4Q63 A;  4UFF H;  1O3L A;  1C9T A;  4Z1M D;  3SUD A;  2VJ1 A;  2CJI A;  1FXY A;  1FIZ A;  4GCH F;  4AYY B;  2P3U B;  3RXB A;  2AH4 X;  1O5A B;  1SB1 H;  1ZHR A;  2GD4 B;  1MD8 A;  1CA0 C;  3B8J A;  4Y79 A;  1O31 A;  3RXF A;  2Z9K A;  2YNA A;  1GWA A;  1SG8 B;  1GJ7 B;  1P09 A;  3TH4 H;  8GCH F;  2WV4 A;  1AHT H;  4RSP A;  1DDJ A;  3BTM E;  1BT7 A;  5ABW A;  1GBT A;  1C5O H;  2F4L A;  5BRR E;  4CBO A;  4ABD A;  2LEL A;  2IN2 A;  2O8W A;  3SV8 A;  2VBC A;  3SGQ E;  1F0U A;  4U32 A;  3ZYE A;  3TVJ B;  7LPR A;  4Z6A H;  4XBB A;  3VGC B;  1SGF G;  1LTO A;  3A89 A;  4B1T A;  3HGP A;  1AE5 A;  4UDW H;  2QF0 A;  1TX8 A;  2V7Q D;  1HFD A;  2FOD A;  3BV9 B;  1V2T T;  3E6P H;  4OS6 A;  4WJG 2;  5JB9 S;  3E16 B;  1DT2 A;  5JBB S;  2Y82 A;  2P3T B;  1KSN A;  1FN8 A;  3QTO H;  3BTE E;  2Y5F A;  1WCZ A;  4A1T A;  1JBU H;  2AGG X;  1BA8 B;  2BY5 X;  1QCP A;  1C2E A;  1TBZ H;  5IK2 D;  5E0J A;  4X1N U;  1P9S A;  1C1N A;  4CR5 A;  1YWU A;  1NY2 2;  4A1V A;  3VEQ B;  1ZTL A;  3MOC A;  3SJI A;  1BHX B;  2CXV A;  2GV7 A;  1C5R A;  1C1W H;  3RM2 H;  1GJD B;  4AFS A;  4I8J A;  1AUJ A;  1H8E D;  2ZKS A;  3A7X A;  4ZHA A;  2ZGJ A;  2BD8 A;  1GI9 B;  5EQS A;  7GCH G;  2ZTZ A;  1JMO H;  1EOL A;  2NU0 E;  4HZH A;  1KDQ B;  2BDB A;  3RXC A;  3F1S B;  2PGQ B;  3F68 H;  4YOG A;  1BHX F;  1GG6 C;  2W3K A;  5E0H A;  3TK5 A;  1HIA A;  4NGA H;  4YM9 A;  4ISI H;  2D8W A;  5FPY A;  1BMF D;  5A8X A;  1DX5 M;  1UK3 A;  2A2X H;  1C2L A;  5AFZ H;  1FUJ A;  1XKB C;  3P8O A;  1K0H A;  1MUE B;  4Y6D A;  2Z3D A;  2O8U A;  3OTP A;  5EW1 H;  1LHC H;  5BPE A;  4AB9 A;  1AFE H;  3AAV A;  1DY8 A;  1T31 A;  1YPH E;  2R3Y A;  1WV7 H;  4B71 A;  4NSV A;  5JBT A;  4YOI A;  3W1E A;  1SLV B;  2J92 A;  1DE7 H;  4FUI A;  4E05 H;  4X6O A;  2M5T A;  3E0N B;  4K1T A;  1C1R A;  1OSS A;  1EAI A;  2YMS D;  2ALV A;  2GKV E;  1O36 A;  3LGI A;  2Z9G A;  3NRL A;  4ZUH A;  3SZE A;  1QQU A;  4WY3 A;  3RXQ A;  4LOY H;  4YLQ H;  1TPP A;  1H9L B;  1ELV A;  1RXP A;  5A09 A;  1QIX B;  2ZZU H;  1NRP H;  1GVK B;  1GMD G;  2ZDV H;  3KQD A;  2BM2 A;  2XYA A;  4X1S U;  1TE0 A;  2G4T A;  4AFZ A;  1QBO A;  1UCY K;  2ZCK P;  3LDX H;  1W12 U;  4ISN A;  1NFX A;  1KYN A;  2FYQ A;  2JJ2 D;  1SGN E;  2Q6F A;  1NRQ H;  1ZJK A;  1JIM A;  1O3P B;  5GCH F;  1AVX A;  2ZA5 A;  2RG3 A;  4Q2K A;  3MU8 A;  3TK6 A;  1TNJ A;  1GJ4 H;  2Y7X A;  4I31 A;  1BOQ A;  1P04 A;  1H4W A;  1YP9 A;  3UB0 A;  1RTF B;  1XVO A;  2FTM A;  2OC8 A;  4YO9 A;  3TNT A;  4DW2 U;  2TRM A;  5DP9 A;  1OOK B;  4BAK B;  3F9G A;  4FUE A;  2VNT A;  1FLE E;  5DKM A;  1ZSL A;  1GI2 A;  4IBL H;  1GGD B;  1ORF A;  1YLN A;  3DSG A;  3FKS D;  1AMH A;  1A0L A;  1BTW A;  4FU7 A;  3PRB A;  1LMW B;  1G36 A;  1LHF H;  1E34 B;  1E37 B;  1FPH H;  1NRR H;  4SGA E;  3HK3 B;  1S6F A;  1UCY H;  1C5N H;  1Y3Y A;  2V35 A;  5DGJ A;  3RU4 D;  1TOM H;  3GDV A;  4DCD A;  1BTP A;  1P57 B;  2IPH A;  4AFQ A;  3EA7 A;  3P92 A;  1IQF A;  1ELD E;  2FI3 E;  1PJP A;  3GOV B;  1UVT H;  1RTL A;  3UIR A;  2BLV A;  2C8Y B;  1TWX B;  5E8E H;  2PWX A;  2GZ8 A;  3MNB A;  4JCN A;  5CHA B;  3BG8 A;  4E7R G;  1C1M A;  1DUE A;  3UWI A;  2QV1 A;  4ZHL U;  1S82 A;  1HXE H;  5GPI B;  1PPC E;  5CDF E;  1P2M A;  4AG2 A;  1P3C A;  1OX1 A;  4ABB A;  3SJO A;  5FCK A;  1WQV H;  1TQ7 B;  3QTV H;  3N7D A;  4KEL A;  4ZXY H;  1D3P B;  1TFX A;  1EQ9 A;  1SGR E;  3U9A H;  1ZGV A;  2FX6 A;  3CP7 A;  4ZKN U;  3HPT B;  1BIO A;  1KTS B;  1DWD H;  1BRB E;  2YMS B;  2D1J A;  2OD3 B;  1ARB A;  2BY9 X;  2FOH A;  3IG6 B;  1AI8 H;  4DOQ A;  2LP6 A;  1ANC A;  3NZI A;  1C5W B;  4O9V A;  4K5Z A;  2A31 A;  1D9I A;  2XNI A;  1W0Z U;  5K0H A;  2NU1 E;  3M5L A;  2B5T B;  4Y71 A;  2CV3 A;  1LCY A;  3OU0 A;  1GHA F;  5DP6 A;  1T4V H;  3E8L A;  2PR3 A;  4CRF A;  1P03 A;  1O2J A;  2VB0 A;  2AMP A;  3GCT G;  1NTP A;  2JH6 D;  3UY9 A;  4IC5 A;  1RD3 B;  3SJ9 A;  3C27 B;  2UWP A;  1CBW B;  1EJA A;  3DFJ A;  2SGQ E;  1TX7 A;  3UUZ A;  1EAU A;  1UK2 A;  3K2U A;  5TJX A;  1CGI E;  1ZZZ A;  1O2Y A;  2PW8 H;  3OY6 U;  1BRU P;  4WH6 A;  3ZZ5 A;  4INK A;  1C5U A;  5C20 A;  4MTB A;  2J95 A;  1Q31 A;  4D7F A;  2QF4 A;  1YCP M;  2F9U A;  4YT7 H;  3K9X B;  3SQH E;  2HAL A;  1SGY E;  4K1S A;  1C1T A;  1PQ5 A;  1LVY A;  3GCH C;  2OCV B;  1F5K U;  1Z71 A;  2FEQ H;  1Y3X A;  1VR1 H;  1CO7 E;  2J5U A;  2ZWL H;  4HI3 A;  2GDD A;  4K8Y A;  2F91 A;  3AVZ A;  1L0Z A;  4H4F A;  1GI5 A;  3U8R H;  1KXB A;  2BDH A;  1SGC A;  1CGJ E;  4VGC C;  2BQ7 B;  9LPR A;  1K1I A;  2K0Q A;  5A0C A;  1UTK A;  4KTC A;  1V2W T;  1ZHP A;  3DHK H;  3LH3 A;  1W2K H;  4BAH B;  3AW1 A;  1HUT H;  5H4I B;  1CA0 B;  1THP B;  2J34 A;  1O3M A;  2AS9 A;  2THF B;  3S7H B;  4U01 A;  1A4W H;  3L6P A;  1GHW H;  1EJM A;  4AOR A;  4TY6 A;  4Y8Y A;  3H5C B;  3U8T H;  4Z0K A;  1S5S A;  2KCP A;  3D49 H;  4XFQ A;  1BMN H;  1QB9 A;  4Q80 A;  1W8B H;  2JH0 D;  2QYI A;  1QBN A;  1O5E H;  5F03 A;  1PPG E;  1UMA H;  1HAV A;  3ZV9 A;  3OE7 D;  2BXU H;  3UOU A;  2ZDN A;  3QZQ A;  2JJ1 D;  1O3B A;  1ZMN A;  2GX4 A;  4XBD A;  2BVR H;  2V0B A;  4X6N A;  5JYI A;  3BEU A;  1W7G H;  3TLO A;  3RU4 T;  1TNI A;  3S9B A;  2IJD 1;  5EXL A;  4MPV A;  1MAX A;  1WU1 A;  1XXD A;  2QCY A;  2BB4 A;  5B6L A;  1WUN H;  2RCE A;  4I8G A;  1TNG A;  3CS7 A;  2ZGH A;  1LVB A;  2Q6G A;  1GHX H;  3EYD A;  5T6D A;  1S6L A;  1P2J A;  1TON A;  2BZA A;  2QXH A;  3VB5 A;  3A8C A;  3L3T A;  1BRA A;  3BEF B;  4FET A;  1X7A C;  2BOH B;  1OYQ A;  2FI4 E;  2OQU A;  4UE7 H;  5EIY A;  2ZFS A;  7EST E;  1K1M A;  2ZQ2 A;  1RTK A;  3KYG A;  2FWW A;  1C1S A;  2D2D A;  3RXP A;  1ELA A;  4MPU A;  4X8T H;  3TH2 H;  1TPS A;  3F6U H;  4K69 A;  1WDI A;  2L6O A;  5C0U A;  2QN5 T;  1SGQ E;  1UVO A;  2KZ4 A;  2QC2 A;  1OP2 A;  4CHA C;  3ELA H;  1V2S T;  1XX9 A;  1EKB B;  1G2M A;  1SLX B;  1TA2 A;  1MCV A;  3VB6 A;  1O2H A;  2V3O H;  4ISO A;  1ABI H;  1C2M A;  2VH0 A;  1IHS H;  2C8W B;  5FXL A;  3BTW E;  3GY6 A;  3UQV A;  2WPK S;  2BLW A;  2QA9 E;  3KYF A;  1O3H A;  4ZH8 A;  1SC8 U;  5C94 A;  3RLY H;  2BQ6 B;  3LIW A;  3SV7 A;  2G4U A;  1ETR H;  2FOF A;  2H5C A;  2H1U A;  1O2Q A;  3TGK E;  1MD7 A;  3DCL A;  1CGH A;  1ZLR A;  1Z1I A;  1IQH A;  1TA6 A;  3U28 C;  1DXW A;  1S85 A;  1FAX A;  1SQR A;  1UVU H;  1W0Y H;  4FUG A;  1C5Y B;  3SOR A;  4RKJ B;  2WYJ A;  3PB1 E;  2EQN A;  3GY2 A;  4IC6 A;  1CA8 B;  2PSY A;  2HLC A;  1YPE H;  4AGK A;  3LKW A;  2C3S A;  3T5F H;  1F0R A;  1G3D A;  3ZZ8 A;  5JBC S;  1DLE A;  1S0Q A;  1SMF E;  2BDY A;  4ISL A;  2FS9 A;  1WYK A;  3UOP A;  3MH4 A;  2TIO A;  2VWL A;  2C8X B;  5E0G A;  1HNE E;  3PTN A;  1O5F H;  3Q77 A;  1HV7 A;  2PUQ H;  3F3B A;  1KXC A;  3FP7 E;  1EX3 A;  2XTT B;  4XDE A;  3W95 A;  3WWB A;  3T62 A;  1GDN A;  3MNX A;  1HLT H;  3UNR A;  3URE A;  3BTG E;  3EE7 A;  4P02 A;  1SQO A;  3JZ2 B;  3DSP A;  1O0D H;  1SOT A;  4XRN A;  1BZX E;  1INC A;  4DG4 A;  3A80 A;  6CHA C;  1DOJ A;  3ATK A;  1BIT A;  3UWJ H;  4Y10 E;  2FX4 A;  1PPB H;  3T28 A;  1GI4 A;  1GHV H;  3G01 A;  4INH A;  3ATL A;  2GCH F;  2RA3 A;  1EB2 A;  5IYT A;  4B75 A;  3ZVD A;  1EJN A;  1QA7 A;  5KEC A;  1QQ4 A;  3ZYD A;  4D7G A;  4MPX A;  3RDZ A;  1IQE A;  3URC A;  1AWH B;  1W13 U;  2GT7 A;  3TK9 A;  4QT8 C;  1EAX A;  2P59 A;  1AWF H;  1OWD A;  3RXA A;  2W7U A;  5C67 A;  1A0J A;  1ELT A;  1XM1 A;  2LPR A;  3E91 A;  4D8N A;  3MWI U;  1C5L H;  1S6H A;  5EGM A;  2ZDA H;  1UO6 A;  2A7J A;  1NPM A;  2CMY A;  1TLD A;  1LKA A;  2SGD E;  2Z3C A;  4FUF A;  2ASU B;  4BXS A;  3RMM H;  2NU4 E;  1C1O A;  4DIH H;  1P02 A;  3QGJ A;  2PHB A;  4XOJ A;  5EG4 A;  1OYT H;  2ZU3 A;  1BCU H;  4RT1 A;  1F5R A;  3PYH A;  1COW D;  1V2M T;  4KKD A;  1O3G A;  2R0K A;  2C4F H;  3RMO H;  1AGJ A;  2TPI Z;  4JMY A;  2BY7 X;  1S83 A;  3RMN H;  4Y8X A;  3SGB E;  2A7C A;  1SL3 A;  1HAG E;  1PYT D;  1CBW C;  1YPG H;  1QL9 A;  1XUK A;  2WUB A;  2WYG A;  1MZD A;  4ZAE A;  1FY3 A;  2ZTX A;  1YPM H;  1KLI H;  2BTC E;  4XBC A;  4RT0 A;  3LGT A;  2BDI A;  3TGJ E;  1CHO F;  3VB4 A;  2GZ9 A;  1WAY B;  1T8L A;  1VCQ A;  2EY4 C;  5L2Y H;  2TBS A;  3O8R A;  1F0S A;  5I46 H;  1NFU A;  1SFI A;  4GLY A;  1UHB B;  5F8Z A;  4AFU A;  1AO5 A;  3ZVC A;  3RXR A;  3E3T A;  5EJZ A;  1TMU H;  4DII H;  5CMX H;  3GYM A;  1PPF E;  2W5E A;  3ZZA A;  1K1N A;  4Q7Y A;  4Y11 E;  3BG4 C;  3V0X A;  3I78 A;  1VGC C;  5DG6 A;  4X1P U;  1S81 A;  4MG3 A;  1KLJ H;  3SV6 A;  1GBI A;  1XMN B;  1HAI H;  1ZSK A;  1AE8 H;  2H5D A;  2P16 A;  2UUK B;  5EU8 A;  5L6N H;  1O2Z A;  2WZQ A;  4JZF H;  1FON A;  3RXM A;  1K21 H;  1O5B B;  2FOB A;  2HNT C;  1UVS H;  1VCW A;  1DS2 E;  1E36 B;  3TU7 H;  3QO6 A;  1SGF A;  3HKJ B;  2WHX A;  3Q3X A;  3K65 B;  1QGF A;  1UCY E;  3PV4 A;  3BIU H;  5AFY H;  2ZPS A;  3NKK A;  1JIR A;  2UUJ B;  3Q3Y A;  1O3O A;  1O3C A;  1C5Z B;  2ZHD A;  3PM3 A;  4JK5 A;  1NU7 B;  3IIT A;  3GCH B;  1MZA A;  2KR7 A;  2XND D;  1C2D A;  3PTB A;  5AHG H;  1MTN C;  4Y7A A;  2Y5H A;  2AMD A;  4AB8 A;  4IGD A;  2KAI A;  5FHT A;  3LT3 A;  4CRB A;  4ABI A;  1J15 A;  4OS1 A;  4D9R A;  1W14 U;  4LK4 A;  2SGP E;  1G2L A;  4KTS A;  1Y5A T;  4VGC B;  4WME A;  1TGC A;  3U8O H;  1AFQ C;  1GJB B;  4I8K A;  4Q7X A;  4UEH H;  3ZVE A;  1GJA B;  3F2G A;  4NFF A;  3GY5 A;  3KN2 A;  2QE7 D;  4AYV B;  1GMH G;  3AK5 A;  2W3I A;  2WIN I;  1YC0 A;  1TRY A;  4GSO A;  2ZQ1 A;  2ZU2 A;  2QGR A;  2A4O A;  2A5K A;  1XUJ A;  2BOK A;  2ODY B;  3ZV8 A;  1SPJ A;  3PMJ A;  1TOC B;  2BD2 A;  1DWC H;  1LKB A;  2AMQ A;  1FIW A;  4FUH A;  4H42 U;  5E2O A;  4X1R U;  5CE1 A;  1YF4 A;  2C93 B;  5FAH A;  2F9P A;  2HWL B;  1NFY A;  2ZHQ H;  3LC5 A;  1GBJ A;  2VIP A;  1GBF A;  1HAP H;  6GCH G;  1JOU B;  5HGG A;  2XBV A;  2M2A A;  1B7X B;  1TMB H;  2A45 B;  5EQR A;  2P8O C;  1BTU A;  1YPL H;  2FOM B;  3RXT A;  1MQ6 A;  1Q3X A;  3UPE A;  1MBM A;  2VIO A;  1YM0 A;  3ATW A;  4FVB A;  8LPR A;  3MO6 A;  5C1Y A;  2A32 A;  3M5N A;  1DVA H;  1V2L T;  3OFN D;  2ANM H;  4ZKR U;  2FI5 E;  3MI4 A;  4F48 B;  2OBQ A;  1BML A;  1ZHM A;  3EE0 B;  4ZKS U;  1HCG A;  2KM0 A;  4Y0Z E;  2J97 A;  1RRK A;  1IQK A;  1EP6 A;  1VIT H;  4FUJ A;  4X2Y A;  4DY7 B;  1XUG A;  3D62 A;  4FXG H;  5GDS H;  2VH6 A;  3FZZ A;  4B2B A;  2G81 E;  2RA0 A;  2ZU5 A;  1BBR K;  1EP5 A;  1GJ5 H;  4TPI Z;  4ASU D;  1LO6 A;  1SHY A;  5DPA A;  3LPR A;  3GIC B;  4CHA B;  2AGI X;  1K9O E;  3PLK A;  2B8O H;  5CHB A;  2BD5 A;  1BTZ A;  5KGO A;  1F92 A;  2A4G A;  1OKX A;  2CHA C;  2NU3 E;  5L2Z H;  2VGC C;  3SO3 A;  5C1U A;  3UR6 A;  1W11 U;  3LC3 A;  3P8G A;  4O3T A;  1O2N A;  3CNR A;  1QRX A;  3AAS A;  3KL6 A;  1P2O A;  2OBO A;  2ZFT A;  2OUA A;  2ZG0 H;  3BTT E;  2QAA A;  2W6J D;  2ZTY A;  3EA8 A;  3SNB A;  2B7D H;  2O8T A;  4ZRO A;  1ZTJ A;  4FUC A;  3SU0 A;  4CRD A;  3SI3 H;  1LPK B;  3P70 B;  4BTT B;  1QR3 E;  1YLD A;  1BBR H;  4DT7 B;  1O2L A;  2ZP0 H;  3LGU A;  2BZ6 H;  3LON A;  3ZZ9 A;  2QF3 A;  4A1X A;  1AU8 A;  1TIO A;  3HAT H;  3R3G B;  1QY6 A;  2AYW A;  2BX4 A;  3OX7 U;  4CBN A;  2EEK A;  3Q76 A;  1L1G A;  1OPH B;  1ZYO A;  1SGT A;  1UTM A;  3O8B A;  1IQN A;  3SU3 A;  4EST E;  1BMM H;  3RXO A;  3MU1 A;  1PQA A;  4LZ4 B;  4GPG A;  5HXF A;  1QHR B;  3V7T A;  1MMJ N;  6CHA B;  1VIT G;  1WQS A;  2FS8 A;  5FBI A;  1G30 B;  3PMA B;  5GJ4 B;  3SUE A;  1W10 U;  3OY5 U;  2ZEC A;  1BTX A;  1RIW C;  2BQW B;  1K1J A;  2XOK D;  2ZF0 H;  5GND A;  1K1P A;  1MQ5 A;  3ATI A;  4GAW A;  2FO9 A;  3T27 A;  1SHH B;  3TH3 H;  2BD4 A;  4YOJ A;  2WPL S;  1H8D H;  1J8A A;  3A82 A;  3C1K A;  2Y5G A;  3A87 A;  1GMH F;  3BTF E;  4NWK A;  1J16 A;  1FV9 A;  1GCT C;  4O97 A;  1EPT A;  2CK3 D;  2QY0 B;  2Z9L A;  5DP7 A;  1B0F A;  8EST E;  2EA3 A;  3GDU A;  2GMT C;  2HVY B;  2WV9 A;  1ACB E;  2QXG A;  5EOK A;  2C90 B;  1TGB A;  2DE9 A;  1SKY E;  3T26 A;  3HK6 B;  1DXP A;  5EST E;  4D9Q A;  2OIN A;  4JZD H;  7KME H;  3SNC A;  3LOX A;  3MH6 A;  4H6S B;  1C1V H;  3VB3 A;  3H7T A;  2FIR H;  3SU4 A;  2XWA A;  2R2M B;  7GCH F;  3RC6 A;  1HBT H;  1Y5B T;  2A4Q A;  1A5H A;  5TCC A;  2QXI A;  4X8S H;  5LH8 A;  1HIA B;  1DY9 A;  6GCH F;  2R2W U;  2H6M A;  1IHT H;  3URD A;  2KCY A;  3SNE A;  5EXM A;  1DIT H;  4I33 A;  2FMJ A;  2GT8 A;  3RXH A;  3DT0 H;  3TJU A;  4NIW A;  5JPM H;  1O38 A;  4WMF A;  1J9C H;  3LJJ A;  1LQD B;  1UVP A;  4JK6 A;  3BEI B;  3KF2 A;  2I6Q A;  1D3T B;  3EAJ A;  1W7X H;  1TYN A;  1N8O B;  2P95 A;  1GBD A;  3KQE A;  3ITI A;  5DP5 A;  3N7O A;  1PFX C;  3ODF A;  3A7Y A;  2AHM E;  2WPJ S;  3WW7 A;  1C5S A;  3Q3K A;  1T8O A;  3P95 A;  1T7C A;  1Y5U T;  3A81 A;  1CVW H;  2OK5 A;  1HB0 B;  1O2K A;  3MTY A;  4TWW A;  4NA7 A;  1FQ3 A;  5T3H A;  1HJ9 A;  1T32 A;  1BRC E;  2ZDL A;  5F8T A;  4D76 A;  1LPZ B;  2R9P A;  1MAB B;  2HRV A;  1GHB G;  3PWC A;  1YBW A;  1EZS C;  3BG4 B;  1YKT A;  5DSF A;  5L30 H;  1VGC B;  4FU8 A;  5GXP A;  5EJL A;  1AZZ A;  1J14 A;  1GMD F;  1OP8 A;  2BDA A;  3SND A;  2G52 A;  1ESB A;  1NFW A;  1O5G H;  1GBK A;  3RM0 H;  5A8Y A;  1FMG A;  1GBC A;  1V2K T;  4UD9 H;  3SU6 A;  1QUR H;  4OS7 A;  1FNI A;  2P93 A;  3MYW A;  1EXF A;  1O2U A;  1ZSJ A;  3W94 A;  1LHD H;  1IQJ A;  3PMB B;  1MU8 B;  4X6M A;  1OS8 A;  3RXV A;  1NRN H;  3RXK A;  3B9F H;  2O8L A;  2HLD D;  1F5L A;  1DFP A;  4OM9 A;  1P05 A;  3MFJ A;  4BTU B;  4DVA U;  3F9H A;  1ZMJ A;  2HNT F;  1HAH H;  3LU9 B;  4JYV H;  4TY7 A;  3FFG A;  2ANW A;  1FY8 E;  1MTN B;  3KID U;  4WWY A;  1TGN A;  1EZX C;  3GS9 A;  3SHC H;  3ZIA D;  4CRG A;  2FOC A;  5C5O A;  4X8U H;  3HGN A;  2J2U A;  2H9T H;  4PRO A;  3ZVB A;  1TMT H;  1UW7 A;  5A0A E;  3OEE D;  1AFQ B;  3QUM P;  3TNS A;  5EPY A;  5DP3 A;  5GWZ A;  2XBW A;  2RFK C;  1SGD E;  5JB8 S;  4M7G A;  1YY3 A;  1KXF A;  4MQA A;  1ZML A;  4K60 A;  3RXL A;  1SFQ B;  2ODP A;  1Z8R A;  2PGB B;  1GBL A;  3SOS A;  2BVS H;  4IW4 E;  1O3N A;  1OXG A;  2ILN A;  2VIV A;  4FU9 A;  4TYD A;  2ZFF H;  4UFG H;  1GBE A;  2V3M A;  4ZXX H;  3GY4 A;  4I7Y H;  2Q1J A;  5C1X A;  1N1L A;  1VJ9 U;  3NCL A;  1BDA A;  2VWO A;  2YOL A;  3SBK A;  3STI A;  1O2I A;  5JBA S;  2LNC A;  3I77 A;  3D65 E;  3SN8 A;  1D3D B;  1D3Q B;  2VWM A;  1AKS A;  3MMG A;  4Y76 A;  1TRM A;  5HM9 A;  3FP8 E;  1WXR A;  1CSO E;  4JZ1 A;  1ZPZ A;  3T2N A;  2P8O B;  4FUD A;  1EPT B;  1TX6 A;  1QA0 A;  3NWU A;  5E2P A;  4NIV A;  3VPK A;  4GCH G;  1OWE A;  1QZ8 A;  1BJU A;  1DM4 B;  2HPQ H;  1C5T A;  4Y8Z A;  1MTW A;  2BMG B;  2F43 B;  1ESA A;  2JH5 D;  2J38 A;  3BTQ E;  1G3C A;  4X2V A;  3TJN A;  1F7Z A;  3N99 A;  3LH1 A;  2HGT H;  3P8N A;  3P8F A;  1AND A;  3OAA D;  4INL A;  5EPN A;  1QBV H;  1TNK A;  5HMA A;  1V2N T;  1O2T A;  2CF8 H;  3H7O A;  2R0L A;  3S7K B;  3A7T A;  3DSO A;  1AQ7 A;  3A7V A;  1EAT A;  3SGA E;  3GCT F;  5LPE A;  4ASH A;  3SHA H;  1E35 B;  1Z7K A;  1F0T A;  2AFQ B;  5K7R A;  3D23 A;  3BTH E;  2OP9 A;  2C8Z B;  3BTK E;  4Q4L A;  1V2Q T;  4MPW A;  1O30 A;  1Z8I B;  4ZMA H;  1OWJ A;  2FLB H;  3V12 A;  5PTP A;  3EQ0 H;  3R0F A;  5DK1 A;  3SW2 B;  3EST A;  1C2I A;  1ZGI A;  1NU9 A;  1G9I E;  2PTC E;  5DJ7 A;  2BD9 A;  1C2F A;  1YPK H;  2CHA B;  2VGC B;  1NT1 A;  3SYJ A;  1VJA U;  1M9U A;  2OTV A;  1K2I 1;  2XCF A;  2EI7 A;  3U1I B;  4CRE A;  4WXI A;  4UFD H;  2UUY A;  3PV5 A;  1BUI A;  1L4D A;  2G5N A;  2TGT A;  3S0N A;  3RC5 A;  1GI6 A;  3U69 H;  5FL7 D;  1GVL A;  2ZHE H;  1TNL A;  2ANY A;  1O3J A;  3GY8 A;  4FVD A;  3SI4 H;  2V3H H;  3UFA A;  3FO8 D;  3MHW U;  2FDA A;  1O35 A;  2HNT E;  3I29 A;  1P01 A;  4NA8 A;  1C1U H;  3A8D A;  3OSY A;  3OYP A;  4WMD A;  1QJ6 B;  5J4Q A;  2G51 A;  1GBM A;  1LVO A;  3VG8 A;  1GMC G;  1PQ8 A;  2TGP Z;  4R8T B;  4F55 A;  4P00 A;  1FY1 A;  2Q6D A;  2ZU4 A;  4YXW D;  5AVD A;  1AY6 H;  1KDQ A;  1C5P A;  1HAV B;  4K3J A;  2F9B H;  2HPP H;  2B0F A;  3RLW H;  4BAO B;  4OS4 A;  1THS H;  2BYA X;  3Q00 A;  3MU0 A;  2FOE A;  2NU2 E;  2DUC A;  1E38 B;  3ZVA A;  4TT3 D;  1W0J D;  2AIP A;  1Z8J B;  1AB9 B;  1H9I E;  3V13 A;  2BHG A;  1HJA C;  1RIW B;  1P0S H;  3L33 A;  1E0F D;  3M3T A;  2A5I A;  1ZPB A;  3M37 A;  4HTC H;  1ZRB A;  1N6Y A;  2GCT B;  2J4I A;  3F2F A;  2XRC A;  3A84 A;  2G55 A;  1C1Q A;  1N8O C;  1O3E A;  1QL8 A;  2ULL A;  2PKS C;  1P10 A;  1NZQ H;  2HVX A;  5GIB A;  1GCT B;  1DAN H;  4NWL A;  4XSK U;  2JET C;  1S84 A;  1C5V A;  3F0P A;  1O5C B;  2J98 A;  4BTI B;  2GMT B;  4Q7Z A;  1IQM A; 
#chains in the Genus database with same CATH homology
 4B75 A;  2JJ2 D;  4Q4L A;  4OM9 A;  1RGQ A;  2WSS D;  5HKK D;  4NWK A;  2WHX A;  4B76 A;  2K1Q A;  2QF5 A;  2CK3 D;  3E90 B;  3M5M A;  4RI0 A;  5T1V A;  3FOA A;  2WV9 A;  4I31 A;  2P59 A;  4ASU D;  5ETX A;  5FPS A;  3UB0 A;  5C0T A;  2OC8 A;  1SKY E;  5IDK A;  4A1T A;  5EQQ A;  3GS9 A;  2L6O A;  3SYJ A;  3U1I B;  1DXP A;  3ZIA D;  4DT4 A;  2XCF A;  2GGV B;  4M9F A;  2OIN A;  4WH6 A;  5C0U A;  3LOX A;  2KR7 A;  3PV5 A;  2XND D;  1NS3 A;  5IK2 D;  5CHB A;  2A4R A;  2KZ4 A;  3RC5 A;  5FL7 D;  3WWF A;  3FKS D;  2A4G A;  3SU4 A;  3OEE D;  2QF4 A;  3SU2 A;  3OEH D;  1EFR D;  5DN6 D;  4A1V A;  2FP7 B;  2F9U A;  3RC6 A;  5EPY A;  2JDI D;  2A4Q A;  3PRB A;  5FPT A;  3PV2 A;  5F53 A;  3SUF A;  1DY9 A;  1E79 D;  1COW D;  3M5O A;  2KCY A;  2OBO A;  1H8E D;  3FO8 D;  3PRD A;  4I33 A;  2FM2 A;  2J5U A;  1OHH D;  2W6J D;  5EQS A;  2XCN A;  4JMY A;  1JXP A;  3F2G A;  3SV7 A;  1CU1 A;  3KEE A;  3SU1 A;  3KN2 A;  2QE7 D;  3OYP A;  3O8C A;  3DCL A;  3AK5 A;  4TYD A;  2GVF A;  3H09 A;  1KMH B;  2KFW A;  3SU0 A;  2K0Q A;  3SUG A;  1DXW A;  1NBM D;  3KF2 A;  4A92 A;  4KTC A;  3VG8 A;  1N1L A;  2W6I D;  4K8B A;  4Q63 A;  2F9V A;  5FPY A;  1BMF D;  1RTL A;  4R8T B;  4F55 A;  2YOL A;  5H4I B;  4Z1M D;  2KCA A;  1W0K D;  3SUD A;  4YXW D;  3LON A;  3P8O A;  4B6E A;  4ZCN A;  2AHM E;  4U01 A;  3LKW A;  4A1X A;  3L6P A;  3OTP A;  5ESB A;  2QV1 A;  3F0O A;  3WW7 A;  1WXR A;  3U1J B;  1DY8 A;  3SV9 A;  3F2H A;  5GPI B;  5CDF E;  2KCP A;  2OK5 A;  4B71 A;  1W3C A;  2JIZ D;  3SU5 A;  3W1E A;  3KNX A;  3O8B A;  4TT3 D;  1W0J D;  1NBM E;  4WH8 A;  3F3B A;  2OC1 A;  4FET A;  2M2A A;  1MAB B;  3OE7 D;  3RC4 A;  3N7D A;  1E1R D;  3SU3 A;  3O8R A;  1BT7 A;  5EQR A;  3WWB A;  2JJ1 D;  4B74 A;  2KCO A;  2F4L A;  5DSF A;  2K8I A;  2LEL A;  2YMS D;  4I32 A;  2OC0 A;  2F43 B;  2FOM B;  3SV8 A;  2VBC A;  3FN8 A;  2IJD 1;  4WF8 A;  3NRL A;  1A1R A;  3SZE A;  2YMS B;  3N99 A;  3DSP A;  3F2F A;  3P8N A;  4B6F A;  5B6L A;  2IJO B;  2OC7 A;  3O8D A;  2O8M A;  3M5N A;  3OAA D;  5GJ4 B;  5EPN A;  3SU6 A;  3SUE A;  3N7E A;  3OFN D;  2XOK D;  3DSO A;  5GND A;  3SV6 A;  3EYD A;  5C17 A;  4XD7 D;  1S6L A;  2OBQ A;  4TSF D;  2YMS C;  1H8H D;  2XNI A;  4NWL A;  2WZQ A;  4B73 A;  2KM0 A;  3F0P A;  1FX0 B;  2WPD D;  1E1Q D;  3M5L A;  2V7Q D;  2HLD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...