5C0UA

Crystal structure of the copper-bound form of merb mutant d99s
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALSTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title Structural and Biochemical Characterization of a Copper-Binding Mutant of the Organomercurial Lyase MerB: Insight into the Key Role of the Active Site Aspartic Acid in Hg-Carbon Bond Cleavage and Metal Binding Specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase,metal binding protein
total genus 63
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5c0uA00
3FN8A 3F2HA 5C17A 3F2FA 3F0PA 5C0UA 3F0OA 5DSFA 5C0TA 3F2GA
chains in the Genus database with same CATH superfamily
1O2ZA 3BTKE 1LPKB 1HRTH 2WPDD 4IC5A 1OS8A 3TH2H 3RXDA 1O3EA 1GMCF 4BAKB 2SGFE 1O3AA 1GDUA 3F2HA 1W0JD 2FODA 1JWTA 1W0YH 2OBOA 1EAWA 3N7OA 4BOHA 1NFXA 1KDQB 2C8YB 3BEIB 3TK6A 2Z9KA 5FAHA 1C5YB 2Z3CA 3P8NA 1AI8H 2A5KA 4JYVH 1SI5H 3F2FA 2J98A 2RA3A 1BITA 1V2LT 2QYIA 2P94A 2EI7A 1BMMH 1QBVH 1ELVA 4AYYB 1PFXC 1BJUA 1GJCB 1SGPE 3RMLH 1ANEA 3ATIA 1BBRH 1DDJA 2K1QA 4D7FA 1W12U 4FUFA 1QJ6B 3TPIZ 2VVVA 3OU0A 5HKKD 2SGAA 1LTOA 2ZFPH 4J2YB 3SJKA 1K1PA 1O31A 1PQAA 4KKDA 3TLOA 3OTJE 4FVBA 4AG2A 1C5MD 1J17T 3MTYA 2J34A 3PTBA 4Y10E 2QY0B 1T8OA 1UCYE 1ZTKA 3GCTG 3NZIA 4HTCH 4ISLA 3TGKE 3UWJH 4ISIH 1KIGH 1O34A 1WYKA 1BT7A 1GCTC 2Z7FE 3WWBA 3DT0H 4X0WU 1UCYK 1NRRH 1TGTA 2OUAA 1G32B 1QHRB 3TU7H 2H9EH 4Z0KA 1O0DH 3LGTA 1UW7A 2GVFA 1GJ4H 5A0BA 1EFRD 4UEHH 1GJ8B 1DANH 2BDCA 2V6NA 1K28D 1D6RA 3ODFA 1KXBA 1UK4A 2F9NA 1W10U 3AW1A 3GCTF 4BTIB 3A7XA 4RT1A 4ABJA 2FI4E 5C2ZA 1V2WT 4GSOA 4D7GA 1EAIA 2BQWB 1W8BH 4UE7H 1TPPA 1NZQH 1Y3XA 1O5FH 2BD7A 1BRUP 4ABDA 4YT7H 5CHBA 2ANYA 2ODYB 3B23B 1DT2A 2VINA 1FJSA 4FUEA 1TMTH 5AHGH 1MABB 3RC5A 2P93A 2Q1JA 3PYHA 4ABFA 2ZHQH 5GPIB 2H1UA 1LVYA 3JZ1B 5E0GA 3UFAA 5JBBS 3GISB 5DKMA 1W14U 1TNHA 1Z8IB 4GHQA 1C1RA 3U28C 2R3UA 1XUFA 3T5FH 4R0IA 1P02A 4HZHA 1YPHE 2QF5A 3RXGA 3F6UH 4Y79A 4X8SH 3ZVAA 2JIZD 1GJ9B 6CHAB 1LDTT 2QXIA 2OC0A 4U32A 4CHAB 3O8DA 1O5GH 1KTTB 5HGGA 1C2LA 1WUNH 3SBKA 1L2EA 4U01A 1PYTD 3A7ZA 2BLVA 2BLQA 1EPTA 1ZSKA 2ZTXA 2R0LA 3A8AA 5C67A 1QRZA 2BOHB 3ZZ7A 2AHME 2GDEH 1FNIA 3FVFB 2ZG0H 5BRRE 1A2CH 5LH8A 5EJLA 2A5IA 3AK5A 1TGCA 2J97A 1DWCH 5FX5A 1BJVA 1YPJH 1BRCE 3UY9A 3QGJA 4FUDA 1GMHG 1ZGIA 4OS6A 4Y0YE 4Y6DA 1AD8H 4K8YA 1OWJA 1HAOH 1VGCC 3U69H 4IN2A 1O33A 2BYAX 2IN2A 3BIUH 1O32A 1NO9H 1EJMA 2AH4X 1BTPA 3E3TA 4JK5A 1C4U2 5E2PA 1N1LA 2RA0A 3HATH 1AVXA 4GHTA 1TOCB 3SNDA 4DURA 1LPZB 4YOGA 2QA9E 2XCNA 1TNGA 4CBNA 1FAKH 1GMHF 3A82A 1C5NH 5HIYA 1P2IA 2YMSB 4ZH8A 2PP6A 2Y6TA 4OS2A 4UONA 1EZUC 4THNH 5DP9A 4ZKSU 5EPYA 2FTMA 2G55A 1Y3WA 1OX1A 1ZHRA 2P59A 4NCYA 2GP9B 4INLA 5C17A 1O2YA 7KMEH 2EEKA 5DP8A 4IN1A 2FXRA 1A5GH 1OKXA 3LIWA 2RDEA 1MUEB 1MAXA 4UD9H 1O3LA 1P11E 3MU0A 3DFJA 1AWHB 4B6EA 3A88A 1YLDA 3S9BA 1OWDA 1P9UA 3D62A 3TGJE 1UTLM 4X2VA 1UVTH 1S5SA 1XUJA 1GHYH 3RXEA 3T2NA 2GZ7A 1IQNA 1GVZA 1TOMH 2NU2E 1KLTA 1GI2A 4A7IB 4A6LA 1HV7A 1TX6A 1F0RA 1MBQA 3M5OA 2ZCHP 3FKSD 1ID5H 1O36A 1GI0A 2ZCKP 5DK1A 1ZMLA 2TGDA 1C5XB 2PHBA 2JH0D 1S82A 4ISNA 2VWNA 4YM9A 5A8XA 1HAIH 3MMGA 1QTFA 3PRDA 2TIOA 4DG4A 1Y5UT 3BTME 3HKJB 3TNTA 1G9IE 2VVUA 5C94A 3H7TA 1IQLA 3LJJA 1SQRA 2P8OC 5EIYA 1G3EA 1SFQB 4Y8XA 3RXUA 5F53A 2FS9A 2KCPA 2XWBI 1O3JA 5LPEA 4HG6A 1ELBA 3LU9B 1TE0A 1COWD 2VH6A 1DLEA 1D9IA 1K1JA 3URCA 4FUJA 3SNAA 1WOFA 1P04A 1DXPA 3D49H 1DPOA 3UPEA 5DP7A 1LHGH 1XMNB 1BBRE 5KECA 3T29A 1SGFG 4JZFH 2VWOA 2LPRA 1GHWH 3PRBA 1G2LA 1THSH 3EQ0H 2XYAA 1O2TA 3IG6B 1CT0E 1Y8TA 1Y3VA 2A4OA 4F55A 1F2SE 1UVUH 1BBRK 2BY7X 2PTNA 2ZPQA 2BX3A 1V2JT 3SU2A 1ZR0A 5DJ7A 2QN5T 2BD2A 3DUXH 3NKKA 4IC6A 3EE7A 5C1UA 3JZ2B 2TPIZ 1T8MA 2OD3B 2ZDKA 2C93B 3GY4A 4YESB 2BVRH 1V2MT 3GCNA 1GBMA 2KAIA 2H9TH 1LKAA 3UOPA 2VGCC 4FOUC 4E06H 5E0JA 1VITG 1XUHA 2WPLS 1GCTB 1ZPCA 2G4UA 4DVAU 4X6PA 5FX6A 3AASA 4DT7B 2VU8E 1O5AB 1TGBA 2ULLA 4IMZA 1TMUH 4B6FA 1NRPH 2ZECA 5ABWA 1TNLA 1OWHA 1V2ST 2AMQA 4RT0A 1QJ1B 8ESTE 3RXSA 2BHGA 4B75A 2W3IA 2EQNA 1NU7B 1HCGA 4UFDH 3GY6A 1GBBA 2FEQH 1YY3A 1VITF 3K6YA 2BLWA 7LPRA 3ZVEA 1SGEE 3LPRA 5DG6A 1ELFA 2P3FH 1EUFA 1F5LA 2GTBA 2Z9IA 1C5WB 2A4QA 1V2TT 1OYTH 2CMYA 1P3EA 3NWUA 4AFUA 2A32A 7GCHG 3TGIE 2OC7A 1XUIA 4CBOA 1P2OA 2G5VA 1SGFA 3LGYA 1A0LA 1O2LA 1SGYE 1EB2A 2ZFQH 1HDTH 2A1DB 2A2XH 4WJG2 1H8IH 3KHVA 1ETSH 1LVOA 3LGVA 1KLJH 4I8JA 4U30A 3E90B 1MMJN 3KF2A 3UB0A 4OS5A 2BOKA 1HIAB 2G00A 4NIWA 4LZ4B 1BRAA 2PKAA 5DO4H 5JB9S 1MQ6A 3HGNA 1K2I1 2Y7ZA 3SZEA 3R3GB 4AZ2B 2RFKC 2GGVB 1P57B 1XKAC 2DUCA 1SLUB 3C27B 4UFFH 1FDPA 1DXWA 3F9EA 1MTVA 1RGQA 4ZUHA 2BDBA 1ELAA 1GJAB 3PMBB 1DSUA 2BZAA 4DOQA 5EXMA 2WPKS 1QRWA 1BTWA 2BD4A 3QK1A 1VGCB 3M35A 4MPXA 1T32A 4TPYA 1LHFH 1AFEH 1ZMNA 3CS0A 5BPEA 3MOCA 3KN2A 5F8XA 1ZTJA 2B9LA 2KX4A 4AB8A 2ANKH 1W13U 3L33A 2OCVB 5B6OA 2FOMB 5GCHF 4K5ZA 1EP6A 4NFFA 2STAE 5E0HA 1P05A 1C1MA 4J1YA 4ASUD 2OTVA 3SV8A 1IQIA 3ZYEA 1OPHB 3RXMA 2ZQ2A 1UO6A 2KCOA 1UVPA 2B0FA 1ZHPA 4U2WA 1LHDH 3SQEE 4Z6AH 5JBAS 5AFZH 1AQ7A 1ARBA 2BXTH 3SU3A 1SOZA 1RS0A 1TBRH 3OFND 3N7DA 2BDIA 2FOAA 1CHOF 4YLQH 1OP2A 2HLCA 2D1JA 2BD3A 2D8WA 1C9PA 3RM2H 1GI9B 3P92A 1ZPZA 1YPHC 1C1WH 2ANMH 4ASHA 2KR7A 4E7RG 2JDID 1ELTA 1G37A 1V2QT 2C3SA 3SQHE 1MCTA 1AUJA 3RXLA 2XC0A 1FAXA 1FY8E 1HAHH 1O5BB 2FX4A 3ZV8A 3Q77A 5EW1H 2HNTE 1SGDE 1J15A 1D4PB 4ZAEA 1WXRA 3RXBA 3K6ZA 2PUXB 4Q7XA 1EATA 3HK6B 3FP8E 3SU1A 5FBEA 3D23A 1BIOA 1GJ5H 3SYJA 1C1TA 1TNIA 4CR5A 1RRKA 3BTEE 1HAPH 4XSKU 1TBQH 4KTCA 1BMFD 2Y7XA 1EZQA 5DP5A 4WXVA 1QB1A 2GJGA 2HGTH 1GI7B 2OK5A 3RXIA 3SJ9A 1O3FA 1QA0A 2HPPH 1B5GH 4OS7A 2QXJA 3GS9A 1K22H 1O5EH 3MQKC 2ZEBA 1O2VA 3BTQE 4CRFA 2P8OB 4AC9A 1VJAU 2GDDA 3U1JB 2WZQA 5E8EH 5CHAC 2YMSC 2Y5GA 4Y0ZE 2Y5HA 2NU3E 2Q6GA 4RKOB 3FZDA 4F48B 1AUTC 1F0UA 2W5EA 2FYQA 2VVCA 2FOCA 4CH8B 5L30H 5EJZA 2LP6A 3STIA 1EX3A 2GZ9A 3TJVA 2CJIA 1MQ5A 4IW4E 1TQ0B 1F0SA 2QXGA 2HALA 2CV3A 2XC4A 1BB0B 1JOUB 2ESTE 5LPFA 1O2RA 4LZ1H 1OWEA 3O8BA 3FP6E 4DY7B 1IQGA 1UJ1A 4DW2U 2ZDMA 5ESTE 3W94A 4CRAA 1MTUA 4UFGH 3PM3A 4JZ1A 1GJ7B 2G8TA 4X8TH 2ZU5A 1EAUA 1ANCA 4MQAA 1SMFE 4WMDA 4IMQA 5JBCS 2ZU1A 4NA7A 2XBWA 3GDSA 1GMCG 1YLNA 1T8NA 1G3BA 1GL1A 1HPGA 3IWMA 3FO8D 3K65B 4A5TS 5C5NA 3T62A 5JBTA 2ZFTA 4CH2B 2VGCB 3KQBA 1XVMA 2CF8H 1NN6A 1Q31A 3MNXA 2BY9X 1GBDA 3A80A 3GY2A 3VB5A 2D2DA 3E6PH 4B2AA 1C4Y2 3BTWE 3TJOA 1IQMA 1EOLA 2ODQA 4GUXA 1DSTA 1JXPA 4JYTA 3RUOA 3SI4H 3ZIAD 4ABIA 3VFEA 3I77A 3A7VA 1ZLRA 1AZZA 1YC0A 4YZUA 1HAXB 1O5DH 3PWCA 3QUMP 3P6ZB 1C2IA 1ORFA 2GX4A 3U8OH 4X1RU 2JH5D 2QF4A 1SHYA 2HOBA 2GCHG 3CNRA 4RSPA 5F03A 3M3SA 1TFXA 6GCHG 4NFEA 3EYDA 1NT1A 2FLRH 1YYY1 1RTLA 3MHWU 6ESTA 4AG1A 1Q3XA 1TQ7B 3AAVA 1G2MA 3PLBA 4CRDA 3SJ8A 3UIRA 1VR1H 1K21H 3RXFA 2GCHF 1O5CB 4CRCA 3DA9B 4OGXA 3ESTA 1C5VA 1MTWA 2BDGA 2NU1E 3T28A 4ZXYH 6GCHF 4E05H 1ELCA 5F6MA 1C5QA 1HUTH 3PTNA 5L6NH 3A7WA 3SUEA 4XFQA 3PO1C 5HMAA 1Q2WA 4BAMB 5HIZA 3QN7A 1SGNE 1INCA 1IQJA 1GG6C 1JMOH 2F3CE 2ZCLP 3E1XB 1TRYA 1EZXC 1C2HA 3KNXA 4K69A 5JDUB 3OEED 1KMHB 1U6QA 3R0FA 1IAUA 4UFEH 4X1QU 1LKBA 2EY4C 1FIZA 2ZF0H 1UVSH 1DY9A 1NY22 2FX6A 1AO5A 1VJ9U 1IHSH 4VGCC 3QZRA 2SFAA 3RMOH 2YNBA 1AKSB 2FESH 2C90B 1AN1E 2UWPA 1FZZA 2J94A 4FU7A 2A45B 1ZOMA 4Q7YA 1C5TA 3ODDA 1D3PB 1WU1A 1VITH 3ZZBA 1SG8B 2BD8A 3GY8A 1E36B 3A83A 4I8KA 1OHHD 5A8YA 4IS5A 4ABGA 2ODPA 1ELGA 1UTMA 1GJDB 1QB9A 1GI5A 1GBIA 3S9AA 1GBKA 1LQEA 3P8FA 2HVXA 2PLXA 5AFYH 3O8RA 3HKIB 4BNRA 3SGQE 1AFQC 1QCPA 3SV2H 4WH6A 4OM9A 1GHXH 2R2WU 2ZU3A 1SQAA 1A46H 2K0QA 1K1IA 2GT8A 3SJOA 5T6FA 2R3YA 1ZSJA 3IITA 1THRH 3SZNA 2W26A 2L6OA 5GNDA 1D6WA 4F4OC 3ATLA 2ZWLH 1ZJKA 1S0RA 2ZPRA 1M9UA 1B0FA 2AFQB 3BTFE 3RMNH 3S7HB 1GBEA 1JIRA 1QL8A 2WHXA 2XC5A 2BY5X 1HNEE 4NWKA 4O3UA 1P01A 1ZSLA 2SGDE 3VGCC 5FCRA 1C2DA 1A4WH 3Q00A 4KGAA 1UVOA 4X2YA 1XUGA 1HJ8A 1O2OA 1GI8B 2FI3E 1Z1IA 2FOHA 4DGJA 6LPRA 4YOJA 5FPYA 2BDYA 4D8NA 2A4RA 2F9OA 2WV5A 1RD3B 2XRCA 3QTVH 2A7JA 4GCHF 2WV9A 4LOYH 3WW7A 4BTUB 1SGTA 1OXGA 1DM4B 5IYTA 5CHAB 1K1OA 3DD2H 1NROH 3F9GA 4WWYA 2V3OH 2B8OH 2AMPA 4X6MA 3OSYA 1EB1H 3A7YA 1HYLA 1QJ7B 2RG3A 3U98H 1DUAA 2GZ8A 4I8GA 1S6FA 3L6PA 2UUJB 5KGOA 2OC1A 1PPFE 2Z9GA 5DP3A 3GY7A 2UUKB 4I7YH 1YGCH 4ESTE 2XW9A 3UR6A 2EC9H 2BTCE 1F0TA 2ZFFH 4YLUA 4Y76A 3OYPA 3L3TA 2WYGA 1SVPA 3M7UA 1C2MA 3AVZA 5CE1A 2EI8A 1A5HA 1Z8JB 3AW0A 2YOLA 2ZIQH 1G36A 1LVMA 1NBMD 1HGTH 1P10A 5FL7D 4NG9H 2I6QA 1ESAA 1BA8B 3A87A 1VCQA 2HNTC 1Z8RA 3UTUH 1VZQH 3B8JA 4PROA 3OEHD 1GI4A 2VH0A 2BDAA 2FTLE 1LVBA 1ZZZA 1BDAA 3LJOA 3RP2A 1WCZA 1ZRBA 4TY7A 5DP4A 5L2ZH 1QZ8A 1UHBB 2KM0A 1TWXB 3TH4H 1CA0C 1MKWK 2V3MA 3S69A 3GCOA 1W2KH 4A1VA 2QV1A 1NRQH 3Q3XA 3RDZA 2G5NA 1IQKA 3NCLA 1TGSZ 2TGAA 3P17H 1IOEA 1C2GA 2WUCA 5EQQA 2BY8X 2ZC9H 4KP0A 3A8DA 1FN8A 2BQ7B 4A1XA 1WQSA 1FUJA 1QGFA 3FP7E 2ASUB 2A2QH 4O97A 3EA8A 1E34B 5T6DA 2PGBB 3LGWA 1S83A 2O8UA 1SLVB 3QO6A 1HAZB 2DE9A 5CMXH 1Y3YA 5EW2H 2HWLB 1FONA 4KTSA 1O2NA 5F8ZA 1TNJA 5DN6D 1HLTH 2OP9A 3LOXA 3SNEA 4BAHB 1Y59T 1O2UA 1WTGH 1H9LB 2FOFA 3E91A 3RC6A 4BAQB 3M3VA 1V3XA 1TAWA 3SV6A 1P09A 4CR9A 2CN0H 1TALA 1J14A 1G3CA 4ABAA 5T6GA 2R2MB 1MZDA 2ZU2A 1W7GH 1Z6EA 2IOTA 3PO1B 1T4UH 2AERH 2F9UA 1H4WA 1V2KT 2VBCA 3QTOH 1ELDE 3WY8A 5F8TA 3RXRA 1NRSH 3U9AH 4INKA 1GG6B 5IDKA 3D65E 4TPIZ 3B9FH 3NRLA 1AY6H 1H9HE 3OX7U 5SGAE 1FY5A 2XBYA 3KQEA 2FLBH 3P70B 4P02A 4B71A 1NPMA 5JYIA 5GXPA 1KTSB 1D3QB 1OWIA 3ZVDA 1MZAA 3KL6A 3RMMH 1PQ8A 1SGCA 4JK6A 4VGCB 3BG8A 3M5LA 4ACAA 4FUHA 5ETXA 3V3MA 1F92A 1SGQE 1C1QA 4I8LA 1WTHD 1BTXA 1SQOA 3H7OA 1CT4E 1TBZH 2XBVA 2ZDVH 3VEQB 1PPCE 1TRNA 2VNTA 2J38A 1TPAE 2VB0A 1L1JA 3KCGH 1BTZA 1WDIA 1FV9A 1IQFA 3MYWA 5DSFA 4CRBA 2P3TB 1K0HA 2OLGA 2WPHS 3LGUA 4M7GA 2G4TA 2Y5FA 3ELAH 1VCPA 3ZZ9A 1KXFA 1S84A 4ZKRU 2GV6A 4K1SA 1TGNA 5K0HA 5DPAA 1BHXB 1RFNA 2SGPE 1TPOA 2ZGHA 1AFQB 1J16A 4YO9A 1O38A 1E38B 2PGQB 1TMBH 3KQ5A 1T8LA 4Q2KA 4XBBA 3UNQA 2QXHA 4I31A 5TCAA 1GBAA 1C1OA 1DE7H 1ABJH 2VIVA 2WV4A 2FPZA 1HJAC 2ZO3H 3F1SB 2O9QA 3BEUA 2B5TB 1BHXF 2FS8A 3F68H 4NA9H 1GPZA 1N6YA 3M7TA 4NZQA 8GCHG 2J9NA 1IHTH 1T31A 3P8GA 4X8UH 3UOUA 1P8VC 5FBIA 1AVWA 4Y11E 1AMHA 2W6ID 4JMYA 1PYTC 1YM0A 2J4IA 1C1UH 4DIIH 5GCHG 1CO7E 1O2JA 1O35A 4AYVB 3ATKA 1BOQA 5HYOA 3LKWA 3VGCB 1O2WA 1EPTC 1DUEA 4MNYA 3HPTB 8GCHF 1C5OH 4M9FA 1O2SA 3SU0A 3LONA 3V12A 1LHCH 1TABE 1DY8A 2Z9JA 3RLYH 1EQ9A 3I78A 3UQVA 1CHOG 1C5RA 5EGMA 1OOKB 2F9VA 4I8HA 1KSNA 2FO9A 1KXDA 5A8ZA 2PSXA 2KCYA 4ZKOU 1K1MA 2P3UB 2H6MA 2NU0E 1XUKA 3MI4A 5DP6A 1CA8B 3KQDA 4DCDA 3E0PB 3BTHE 3UREA 3S0NA 4MPUA 3V13A 1MAYA 1WBGB 1YBWA 1QQ4A 5EPNA 4WMFA 4Y7AA 4OS1A 3KQCA 4BXSA 1CSOE 2G81E 2SNVA 1QA7A 3A8BA 3U1IB 2FOEA 3DCLA 1BUIA 4Z1MD 1ABIH 3WWFA 4MVNA 1NM6A 1EXFA 1A0HB 2GD4B 1KY9A 1XM1A 3UUZA 2JJ2D 1FLEE 1AIXH 1LPGB 1H1BA 1BTUA 4JCNA 1A0JA 1C5SA 1HAVA 2C8ZB 1HIAA 2K8IA 3KEEA 3SORA 2FOGA 4X2WA 4WY3A 3AAUA 4INHA 3PV4A 1V2PT 1DOJA 3UWIA 4H4FA 1QURH 1TIOA 4AOQA 1GHBG 4MPWA 5C1YA 4BTTB 1CBWC 1KXCA 4I32A 3N99A 1C9TA 4ZHAA 1XKBC 1FY4A 2J92A 1C1PA 5DGJA 1BMNH 2HLDD 2QAAA 2W7SA 1P03A 2ZGJA 1SLXB 1Z8GA 1MU6B 4X8VH 4XBCA 4Y8YA 1CA0B 1ANDA 1O3KA 2WPMS 2PUQH 1DS2E 1O30A 1GHBF 3RXVA 2XOKD 1RIWC 1HXEH 2BMGB 3N7EA 4MTBA 1EAXA 2HNTF 1DITH 3MU1A 1LCYA 4MNVA 1UTPA 2SGQE 2PFEA 1GI3A 2B7DH 1CU1A 2R9PA 5C1XA 2JH6D 1HB0B 2V7QD 4ZMAH 3G01A 2FOBA 1ELEE 3ENSB 3OY6U 2C4FH 1O2QA 1E35B 3V0XA 2FI5E 1O3DA 1L4DA 1YCPM 1O2PA 1ESBA 1TNKA 1ESTA 1SPJA 3SJIA 3EA9A 1K1LA 9ESTA 3GOVB 2Z9LA 4X6OA 5A0AE 1AE8H 4B2BA 1JRSA 4MLFB 1W0ZU 2I6SA 3SOSA 3KGPA 1PQ5A 4WVPE 2CK3D 2J98B 2JETC 3F3BA 3RU4T 4AFQA 2ANWA 2QF0A 1QFKH 4H42U 1O3HA 2Z6BD 4BXWA 2BX4A 5C5OA 1GHVH 1W3CA 3RXAA 3ZZ8A 3SV9A 5FXLA 4KTUA 4IGDA 4B2CA 4B76A 1YCPH 1D3TB 3SU6A 1T4VH 2SNWA 5C0UA 1BRBE 1UMAH 4NSYA 2H5CA 4ZROA 1P9SA 1BMLA 4RI0A 2A0QB 4FUBA 3OTPA 2A4GA 5EJ1A 1RJXB 5I46H 3M5NA 3SHCH 2BB4A 3EA7A 3SN8A 2ILNA 1HJ9A 1Y5AT 1CQQA 1GBHA 2F9PA 3MH6A 2BD5A 1AU8A 2CHAC 1E37B 1F5RA 1HAGE 1S6LA 1ETTH 1O2MA 1SHHB 4MNWA 1LMWB 5A09A 2Z94A 3PROA 2WUBA 3DSGA 4X2XA 2LELA 1WSSH 1O39A 2WPIS 2QC2A 1C4V2 4K3JA 2P95A 4B1TA 1C2FA 1N8OC 2D26C 2ZTZA 5EQRA 4ABBA 4AGKA 1MD7A 1A61H 3NUMA 1FIWA 2BXUH 1SKYE 2BZ6H 1LHEH 4AX9H 5EOKA 2CF9H 1E1QD 1P2KA 1ZHMA 1QQUA 4ABEA 3FZZA 1GI6A 2H9HA 2M2AA 1NFWA 2C8WB 1WAYB 1UK2A 1GJBB 2QIQA 2AYWA 2PW8H 4D76A 5AF9H 2ALPA 3PWBA 1CGJE 4ZXXH 1THPB 1YKTA 1ZTLA 1MH0A 2OINA 1BQYA 2FP7B 2QGRA 2L74A 2QE7D 1C1SA 4FUCA 1K1NA 1HJAB 1O2HA 3BTDE 3ZYDA 5GWZA 2HRVA 2VWMA 1YPLH 4JZIA 5GJ4B 3RXKA 4YXWD 2GCTC 1O3GA 1VKYA 1Y3UA 3O8CA 1E79D 1GBJA 4CREA 5ESBA 1LQDB 2AIPA 5JPMH 1QL9A 3BEFB 2A7CA 1TLDA 3ITIA 3DFLA 1TB6H 3BTTE 2XWAA 1W11U 2ZI2H 5EODA 1BMAA 2AEIH 4RN6A 5T1VA 4FETA 3SGAE 2AMDA 1GI1A 1TYNA 1JRTA 1FXYA 1EPTB 3E8LA 2VIPA 3QDZB 4ZKNU 5C0TA 1KDQA 3M61U 1CHGA 1Z1JA 1C5ZB 4Q4LA 1YPEH 2CGAA 3MO6A 4TSFD 2JKHA 4P00A 3ZZDA 3EE0B 1GDQA 1DWDH 1YPKH 1EJNA 3VB3A 2EA3A 1RXPA 1C5LH 3MH5A 3A84A 3MU4A 4Y71A 2XNDD 5HM2A 4MNXA 1TA6A 3I29A 1UK3A 1C5PA 2PV9B 3SUGA 3ZVFA 1SC8U 2V3HH 2DE8A 2CXVA 2HVYB 2VJ1A 3C1KA 4NA8A 1ANBA 2F9BH 3W95A 3CS7A 1SL3A 4R8TB 3ZVCA 3F2GA 2BQ6B 1UTQA 3GY3A 1PJPA 1UTJA 3GDUA 4DJZB 2FMJA 1C2KA 2VIWA 2AS9A 1TONA 4WXIA 3MH4A 3UQOA 2FIRH 2A31A 2J95A 2GT7A 1NESE 1QB6A 3FN8A 1YLCA 2GMTC 3RXOA 4ACBA 1NBME 1C1NA 5FHTA 1CBWB 4GCHG 1H8ED 2VIDA 4BAOB 5L2YH 1X7AC 2IJOB 3DSOA 4ZHMU 3PB1E 1O3OA 2ZPSA 3VB7A 3QX5H 4XOJA 2AGEX 4SGAE 1NS3A 2VWLA 1AKSA 1AB9C 2ZGBH 1MD8A 1BZXE 1GCDA 1EOJA 1ZGVA 4FXGH 1IQHA 3HGPA 3UAIC 4WF8A 3ZVGA 5LGOA 1KYNA 2Y80A 1RIWB 4GAWA 4BANB 2HPQH 3MH7A 3STJA 4E7NA 1UTNA 5GIBA 1V2UT 3E16B 3E0NB 4RKJB 5J4QA 1GBCA 3H5CB 3RC4A 1AGJA 2V35A 4WMEA 1B0EA 4YT6H 5C3NA 3A8CA 2OXSA 2TGTA 3PMAB 4YOIA 4XDEA 4F49A 2PTCE 3PV5A 1NFUA 3RU4E 1V2NT 1C1VH 8KME2 1AZ8A 1Z71A 3GICB 1E1RD 1Z7KA 1MKXH 3UNSA 3H09A 2F4LA 1GMDG 3TK5A 1G30B 1ETRH 1PPHE 1V2OT 3V7TA 3RXQA 4K2YA 3MO9A 3F9FA 5FCKA 3SNCA 5JB8S 1ZJDA 1SQTA 3MO3A 1A5IA 1L1NA 2JETB 4JYUH 5A0CA 2UWLA 1EJAA 3M5MA 1VCWA 2ZHDA 3A89A 1YF4A 1HFDA 3MWIU 1GBLA 1SGIB 2XTTB 3Q76A 5G4BA 3MNBA 1TPSA 3RXPA 5EG4A 2ZU4A 1GMDF 5EU8A 2OQ5A 4Q7ZA 1LO6A 2QCYA 4XE4A 1YCPK 1GBTA 2ALVA 1P2MA 3BG4C 1B7XB 2Y82A 2LNCA 1TRMA 2WPJS 3TNSA 3VXEH 1UTOA 4MPVA 2THFB 1A3BH 3NPSA 3QWCH 3URDA 1CVWH 4B74A 2ZTYA 4X1PU 2RDLA 1YPMH 1TA2A 4FUIA 2KAIB 2CHAB 3RLWH 1GGDC 3K2UA 2ZGCA 2TRMA 1XVOA 3PLPA 1FY3A 3SU4A 3F9HA 2EI6A 2FWWA 1PPZA 1V2RT 1NTPA 9LPRA 3CENA 1GVLA 3GCHC 1RTFB 3TVJB 4SGBE 3LC3A 1S81A 2O8LA 4FU9A 5J4SA 1FY1A 2W3KA 1T7CA 2ZKSA 2PKSC 3BSQA 2XXLA 1EKBB 4NIYA 4O03A 5EXLA 3RU4D 2YMSD 1N8OB 3TIUA 4ZCNA 1FN6A 1ZPBA 2G51A 2ZFRH 1PQ7A 1AE5A 3QZQA 2Y81A 2C8XB 2SGEE 1FMGA 3MFJA 2W6JD 1W0KD 1EZSC 2J5UA 4XRNA 4ISHH 3U8TH 4NZLA 1P2NA 5TJXA 1BCUH 4XD7D 3ZZCA 2XCFA 1DFPA 3TJUA 4HGCA 3VXFH 2F91A 2OQUA 8LPRA 2GKVE 5HXFA 3VB4A 1Z6JH 3TITA 4AB9A 1NFYA 3FANA 3ATWA 3A86A 4FUGA 3SU5A 2GCTB 4QT8C 4AFZA 3BIVH 1FPHH 3SUDA 4LXBH 1W7XH 4I33A 3BN9A 3PLKA 3VPKA 1O3IA 3RXJA 3ZZ4A 1UHBA 3A7TA 2A7HA 1GBFA 4CRGA 1QR3E 1A1RA 5GDSH 1OSSA 1GWAA 1PPEE 1OP8A 5AVDA 1L1GA 1H8HD 4GVUA 1MTNC 3BF6H 1CGIE 1DWEH 3ZVBA 3DHKH 1OYQA 2PKAB 1D3DB 5EXNA 1V6DA 5B6LA 1AHTH 4TY6A 3MU5A 1XXDA 3ZZ6A 1AWFH 4D9RA 2PR3A 3FOAA 1S85A 1H9IE 1CE5A 1GDNA 2TBSA 3GYLB 2KCAA 1CGHA 1P2JA 1QBNA 4ABHA 1GJ6A 1TX7A 5K7RA 4X6NA 3VB6A 5LPRA 3M36A 1P06A 3PV2A 2O8MA 3QLPH 3GY5A 5TCCA 1FI8A 3LH3A 4NIXA 5CDFE 4TT3D 3TH3H 1TX8A 2O8TA 1ZMJA 3PMHB 4O3TA 5I25A 3SV7A 3SW2B 3A81A 2BY6X 2KZ4A 3DSPA 2IPQX 2A5AA 4AORA 5A2MH 1NRNH 1GL0E 4HFPB 1CT2E 5PTPA 3VG8A 2WSSD 3M37A 1WV7H 3ZZAA 1P0SH 4A1TA 3LT3A 4MDSA 4X1NU 4GLYA 1EASA 1QRXA 1BTHH 3Q3YA 3FAOA 4WH8A 4D9QA 2XNIA 1QL7A 1SFIA 5T3HA 4TWWA 4OS4A 1PPBH 1DX5M 1P3CA 1QBOA 2GMTB 2RCEA 4Q80A 3W1EA 2ZZUH 2YNAA 4NGAH 1K9OE 3RXCA 3CP7A 3LH1A 3NXPA 4OGYA 3LC5A 3T25A 7GCHF 1HAVB 3OAAD 2O8WA 4UDWH 1O3CA 3M3TA 1A7SA 1C2JA 1NU9A 2XBXA 1O3MA 3BTGE 3ZZ3A 1AB9B 3F0OA 4HI3A 1S0QA 3S9CA 1NC6A 3PMJA 5IK2D 1UCYH 1FPCH 3F0PA 2QF3A 2ZA5A 2H5DA 4Q63A 2ZP0H 1SSXA 4H6SB 5FPSA 3MNCA 2BLOA 3TJNA 1C5UA 4K60A 2BVXH 1P12E 4IBLH 1MCVA 5E2OA 1F5KU 3MNSA 3UNRA 2UUYA 1G3DA 1DLKB 1XXFA 4KELA 2WYJA 3EGKH 2STBE 2IJD1 1E0FD 1SBWA 1KXAA 3RM0H 2PWXA 2ZHEH 3ZV9A 2TGPZ 1HAYB 1MKXK 1QIXB 2GV7A 3T27A 1JIMA 4FVDA 2G52A 1O3NA 3A85A 2ZDNA 3KYFA 3LGIA 3M7QA 4YTAA 3TK9A 4A92A 1HBTH 3ATMA 1KXEA 1IQEA 1OP0A 4DIHH 3ZZ5A 3KYGA 1O2KA 3EDXB 4NIVA 2ZQ1A 3NK8A 6CHAC 3P8OA 4K1EA 1FQ3A 3Q3KA 2J2UA 1SB1H 3LDXH 1DICA 2ZHWH 4CHAC 3UR9A 1J8AA 3S7KB 1OWKA 1GHAG 4NSVA 4AGJA 3QGNB 1WQVH 3BG4B 1O2GH 2BM2A 3BV9B 3GYMA 2Q6FA 2VIQA 1O3BA 2FDAA 3SGBE 1MU8B 4AN7A 2OC8A 1FX0B 2ZDAH 1ARCA 2NU4E 4I86A 3MU8A 1MTSA 2W7UA 2KFWA 1QNJA 1SLWB 1BTYA 1GHAF 1C2EA 3SUFA 1GVKB 1F7ZA 1GGDB 1JBUH 1O37A 2OBQA 1O2IA 4Y7BA 1ZRKA 2ZDLA 2Z3DA 3GCHB 4O9VA 1GHZA 2UWOA 1AVGH 3OE7D 1PPGE 3U8RH 2PKSB 4GPGA 7ESTE 4JZDH 5FPTA 4ZHLU 3HK3B 1QY6A 2M5TA 1SOTA 4NWLA 1O2XA 1V2VT 1DWBH 2BDHA 5EQSA 3FFGA 2ZNKH 1RTKA 4LK4A 4DT4A 3SI3H 3SO3A 2AIQA 4FU8A 4TWYA 2WINI 2FZZA 1XX9A 3GDVA 1HXFH 2P16A 1L4ZA 2UUFB 2Q6DA 2BVSH 1N6XA 2F83A 2ZFSA 2VIOA 3P95A 2FM2A 4K1TA 4JZEH 1S6HA 1YPGH 4Y8ZA 2F43B 2AGIX 4MG3A 1EP5A 1P2QA 4X1SU 2H2ZA 1SR5C 3OY5U 3SNBA 3SHAH 4ISOA 3T26A 2ZHFH 1A3EH 3K9XB 5HM9A 3RXTA 2IPHA 4TYDA 4B73A 1ZYOA 3EAJA 1MBMA 1DVAH 4H6TA 1KLIH 1SGRE 4XBDA 1H8DH 1UTKA 3RXHA 1YWUA 4K8BA 1MTNB 5KEDA 3KIDU 1L0ZA 2NWNA 1J9CH 2R0KA 1Y5BT 2ZGXH 2AGGX 2PSYA 2JJ1D 1ACBE 2Z3EA 4AFSA 5H4IB 1O3PB 5C20A 2FYRA 2V0BA 1YP9A 2BD9A 1MKWH
chains in the Genus database with same CATH topology
1CU1A 2OINA 1MABB 3RC5A 3LKWA 3VG8A 2WSSD 2V7QD 2KCOA 4B6FA 2FP7B 2QE7D 2WPDD 5GPIB 4A1TA 2YMSD 1NS3A 4ZCNA 2OC8A 1FX0B 4M9FA 3F2HA 2F9UA 3SU3A 1W0JD 3SU0A 5GJ4B 3L6PA 4B75A 4YXWD 3LONA 2OBOA 2OC1A 2VBCA 3OFND 3N7DA 4WH8A 2QF5A 4WF8A 1E79D 2W6JD 3M5OA 1DY8A 2XNIA 1W0KD 2KFWA 3FKSD 5ESBA 3FO8D 2J5UA 5IDKA 2JIZD 3W1EA 3NRLA 2F9VA 2OC0A 3SUFA 3P8NA 2KR7A 2JDID 3O8DA 3F2FA 2KCYA 2OBQA 3RC4A 4XD7D 1OHHD 2CK3D 2XCFA 3OYPA 3PRDA 2A4QA 3F3BA 4B71A 3OE7D 4U01A 3OAAD 5T1VA 1JXPA 4FETA 3ZIAD 2YOLA 5FPTA 3PV5A 2OC7A 2AHME 3DSOA 1W3CA 3SV9A 3M5LA 1NBMD 3F0OA 5C0TA 3O8RA 4NWLA 2K1QA 5FL7D 3SU5A 5ETXA 5EPNA 4B76A 1WXRA 3AK5A 5IK2D 5EQSA 1E1RD 3SU6A 3F0PA 4Q4LA 3SUDA 4DT4A 5F53A 5C0UA 5HKKD 3U1IB 2KCPA 3H09A 3O8CA 4I33A 2F4LA 2QF4A 3DCLA 4WH6A 4OM9A 3SU1A 4Q63A 4Z1MD 3WWFA 3OEHD 4RI0A 3SYJA 1COWD 4TSFD 2K0QA 3OTPA 5FPSA 2A4GA 2JJ2D 3E90B 3KF2A 3UB0A 4KTCA 3EYDA 3M5NA 1BMFD 1DXPA 5DSFA 2K8IA 2KM0A 3KEEA 1A1RA 1RTLA 3M5MA 2OK5A 2FM2A 2XNDD 1H8HD 2L6OA 5GNDA 4A1VA 2QV1A 3GS9A 3PRBA 3SUGA 1N1LA 2F43B 3SZEA 4F55A 1S6LA 2IJD1 2GGVB 5B6LA 2XCNA 4I32A 3U1JB 1BT7A 3WWBA 3N99A 2WHXA 1RGQA 2WZQA 3SU2A 1DXWA 2YMSC 5EQQA 2LELA 2YMSB 4NWKA 3FOAA 4R8TB 3F2GA 5EPYA 2KCAA 2GVFA 4I31A 2HLDD 4A1XA 3SUEA 5EQRA 1EFRD 4TYDA 2P59A 4B73A 4A92A 4B74A 5C17A 3PV2A 1SKYE 2O8MA 5FPYA 3KN2A 4K8BA 2A4RA 5CDFE 2XOKD 1E1QD 4TT3D 3N7EA 2M2AA 3FN8A 5DN6D 3P8OA 3LOXA 2FOMB 2WV9A 2JJ1D 3KNXA 3SV7A 3OEED 2W6ID 1NBME 1KMHB 4JMYA 3WW7A 3SU4A 3O8BA 5H4IB 4ASUD 1H8ED 3RC6A 2KZ4A 5CHBA 3DSPA 4B6EA 3SV8A 1DY9A 2IJOB 3SV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FN8 A;  3F2H A;  5C17 A;  3F2F A;  3F0P A;  5C0U A;  3F0O A;  5DSF A;  5C0T A;  3F2G A; 
#chains in the Genus database with same CATH topology
 1O2Z A;  3BTK E;  1LPK B;  1HRT H;  2WPD D;  4IC5 A;  1OS8 A;  3TH2 H;  3RXD A;  1O3E A;  1GMC F;  4BAK B;  2SGF E;  1O3A A;  1GDU A;  3F2H A;  1W0J D;  2FOD A;  1JWT A;  1W0Y H;  2OBO A;  1EAW A;  3N7O A;  4BOH A;  1NFX A;  1KDQ B;  2C8Y B;  3BEI B;  3TK6 A;  2Z9K A;  5FAH A;  1C5Y B;  2Z3C A;  3P8N A;  1AI8 H;  2A5K A;  4JYV H;  1SI5 H;  3F2F A;  2J98 A;  2RA3 A;  1BIT A;  1V2L T;  2QYI A;  2P94 A;  2EI7 A;  1BMM H;  1QBV H;  1ELV A;  4AYY B;  1PFX C;  1BJU A;  1GJC B;  1SGP E;  3RML H;  1ANE A;  3ATI A;  1BBR H;  1DDJ A;  2K1Q A;  4D7F A;  1W12 U;  4FUF A;  1QJ6 B;  3TPI Z;  2VVV A;  3OU0 A;  5HKK D;  2SGA A;  1LTO A;  2ZFP H;  4J2Y B;  3SJK A;  1K1P A;  1O31 A;  1PQA A;  4KKD A;  3TLO A;  3OTJ E;  4FVB A;  4AG2 A;  1C5M D;  1J17 T;  3MTY A;  2J34 A;  3PTB A;  4Y10 E;  2QY0 B;  1T8O A;  1UCY E;  1ZTK A;  3GCT G;  3NZI A;  4HTC H;  4ISL A;  3TGK E;  3UWJ H;  4ISI H;  1KIG H;  1O34 A;  1WYK A;  1BT7 A;  1GCT C;  2Z7F E;  3WWB A;  3DT0 H;  4X0W U;  1UCY K;  1NRR H;  1TGT A;  2OUA A;  1G32 B;  1QHR B;  3TU7 H;  2H9E H;  4Z0K A;  1O0D H;  3LGT A;  1UW7 A;  2GVF A;  1GJ4 H;  5A0B A;  1EFR D;  4UEH H;  1GJ8 B;  1DAN H;  2BDC A;  2V6N A;  1K28 D;  1D6R A;  3ODF A;  1KXB A;  1UK4 A;  2F9N A;  1W10 U;  3AW1 A;  3GCT F;  4BTI B;  3A7X A;  4RT1 A;  4ABJ A;  2FI4 E;  5C2Z A;  1V2W T;  4GSO A;  4D7G A;  1EAI A;  2BQW B;  1W8B H;  4UE7 H;  1TPP A;  1NZQ H;  1Y3X A;  1O5F H;  2BD7 A;  1BRU P;  4ABD A;  4YT7 H;  5CHB A;  2ANY A;  2ODY B;  3B23 B;  1DT2 A;  2VIN A;  1FJS A;  4FUE A;  1TMT H;  5AHG H;  1MAB B;  3RC5 A;  2P93 A;  2Q1J A;  3PYH A;  4ABF A;  2ZHQ H;  5GPI B;  2H1U A;  1LVY A;  3JZ1 B;  5E0G A;  3UFA A;  5JBB S;  3GIS B;  5DKM A;  1W14 U;  1TNH A;  1Z8I B;  4GHQ A;  1C1R A;  3U28 C;  2R3U A;  1XUF A;  3T5F H;  4R0I A;  1P02 A;  4HZH A;  1YPH E;  2QF5 A;  3RXG A;  3F6U H;  4Y79 A;  4X8S H;  3ZVA A;  2JIZ D;  1GJ9 B;  6CHA B;  1LDT T;  2QXI A;  2OC0 A;  4U32 A;  4CHA B;  3O8D A;  1O5G H;  1KTT B;  5HGG A;  1C2L A;  1WUN H;  3SBK A;  1L2E A;  4U01 A;  1PYT D;  3A7Z A;  2BLV A;  2BLQ A;  1EPT A;  1ZSK A;  2ZTX A;  2R0L A;  3A8A A;  5C67 A;  1QRZ A;  2BOH B;  3ZZ7 A;  2AHM E;  2GDE H;  1FNI A;  3FVF B;  2ZG0 H;  5BRR E;  1A2C H;  5LH8 A;  5EJL A;  2A5I A;  3AK5 A;  1TGC A;  2J97 A;  1DWC H;  5FX5 A;  1BJV A;  1YPJ H;  1BRC E;  3UY9 A;  3QGJ A;  4FUD A;  1GMH G;  1ZGI A;  4OS6 A;  4Y0Y E;  4Y6D A;  1AD8 H;  4K8Y A;  1OWJ A;  1HAO H;  1VGC C;  3U69 H;  4IN2 A;  1O33 A;  2BYA X;  2IN2 A;  3BIU H;  1O32 A;  1NO9 H;  1EJM A;  2AH4 X;  1BTP A;  3E3T A;  4JK5 A;  1C4U 2;  5E2P A;  1N1L A;  2RA0 A;  3HAT H;  1AVX A;  4GHT A;  1TOC B;  3SND A;  4DUR A;  1LPZ B;  4YOG A;  2QA9 E;  2XCN A;  1TNG A;  4CBN A;  1FAK H;  1GMH F;  3A82 A;  1C5N H;  5HIY A;  1P2I A;  2YMS B;  4ZH8 A;  2PP6 A;  2Y6T A;  4OS2 A;  4UON A;  1EZU C;  4THN H;  5DP9 A;  4ZKS U;  5EPY A;  2FTM A;  2G55 A;  1Y3W A;  1OX1 A;  1ZHR A;  2P59 A;  4NCY A;  2GP9 B;  4INL A;  5C17 A;  1O2Y A;  7KME H;  2EEK A;  5DP8 A;  4IN1 A;  2FXR A;  1A5G H;  1OKX A;  3LIW A;  2RDE A;  1MUE B;  1MAX A;  4UD9 H;  1O3L A;  1P11 E;  3MU0 A;  3DFJ A;  1AWH B;  4B6E A;  3A88 A;  1YLD A;  3S9B A;  1OWD A;  1P9U A;  3D62 A;  3TGJ E;  1UTL M;  4X2V A;  1UVT H;  1S5S A;  1XUJ A;  1GHY H;  3RXE A;  3T2N A;  2GZ7 A;  1IQN A;  1GVZ A;  1TOM H;  2NU2 E;  1KLT A;  1GI2 A;  4A7I B;  4A6L A;  1HV7 A;  1TX6 A;  1F0R A;  1MBQ A;  3M5O A;  2ZCH P;  3FKS D;  1ID5 H;  1O36 A;  1GI0 A;  2ZCK P;  5DK1 A;  1ZML A;  2TGD A;  1C5X B;  2PHB A;  2JH0 D;  1S82 A;  4ISN A;  2VWN A;  4YM9 A;  5A8X A;  1HAI H;  3MMG A;  1QTF A;  3PRD A;  2TIO A;  4DG4 A;  1Y5U T;  3BTM E;  3HKJ B;  3TNT A;  1G9I E;  2VVU A;  5C94 A;  3H7T A;  1IQL A;  3LJJ A;  1SQR A;  2P8O C;  5EIY A;  1G3E A;  1SFQ B;  4Y8X A;  3RXU A;  5F53 A;  2FS9 A;  2KCP A;  2XWB I;  1O3J A;  5LPE A;  4HG6 A;  1ELB A;  3LU9 B;  1TE0 A;  1COW D;  2VH6 A;  1DLE A;  1D9I A;  1K1J A;  3URC A;  4FUJ A;  3SNA A;  1WOF A;  1P04 A;  1DXP A;  3D49 H;  1DPO A;  3UPE A;  5DP7 A;  1LHG H;  1XMN B;  1BBR E;  5KEC A;  3T29 A;  1SGF G;  4JZF H;  2VWO A;  2LPR A;  1GHW H;  3PRB A;  1G2L A;  1THS H;  3EQ0 H;  2XYA A;  1O2T A;  3IG6 B;  1CT0 E;  1Y8T A;  1Y3V A;  2A4O A;  4F55 A;  1F2S E;  1UVU H;  1BBR K;  2BY7 X;  2PTN A;  2ZPQ A;  2BX3 A;  1V2J T;  3SU2 A;  1ZR0 A;  5DJ7 A;  2QN5 T;  2BD2 A;  3DUX H;  3NKK A;  4IC6 A;  3EE7 A;  5C1U A;  3JZ2 B;  2TPI Z;  1T8M A;  2OD3 B;  2ZDK A;  2C93 B;  3GY4 A;  4YES B;  2BVR H;  1V2M T;  3GCN A;  1GBM A;  2KAI A;  2H9T H;  1LKA A;  3UOP A;  2VGC C;  4FOU C;  4E06 H;  5E0J A;  1VIT G;  1XUH A;  2WPL S;  1GCT B;  1ZPC A;  2G4U A;  4DVA U;  4X6P A;  5FX6 A;  3AAS A;  4DT7 B;  2VU8 E;  1O5A B;  1TGB A;  2ULL A;  4IMZ A;  1TMU H;  4B6F A;  1NRP H;  2ZEC A;  5ABW A;  1TNL A;  1OWH A;  1V2S T;  2AMQ A;  4RT0 A;  1QJ1 B;  8EST E;  3RXS A;  2BHG A;  4B75 A;  2W3I A;  2EQN A;  1NU7 B;  1HCG A;  4UFD H;  3GY6 A;  1GBB A;  2FEQ H;  1YY3 A;  1VIT F;  3K6Y A;  2BLW A;  7LPR A;  3ZVE A;  1SGE E;  3LPR A;  5DG6 A;  1ELF A;  2P3F H;  1EUF A;  1F5L A;  2GTB A;  2Z9I A;  1C5W B;  2A4Q A;  1V2T T;  1OYT H;  2CMY A;  1P3E A;  3NWU A;  4AFU A;  2A32 A;  7GCH G;  3TGI E;  2OC7 A;  1XUI A;  4CBO A;  1P2O A;  2G5V A;  1SGF A;  3LGY A;  1A0L A;  1O2L A;  1SGY E;  1EB2 A;  2ZFQ H;  1HDT H;  2A1D B;  2A2X H;  4WJG 2;  1H8I H;  3KHV A;  1ETS H;  1LVO A;  3LGV A;  1KLJ H;  4I8J A;  4U30 A;  3E90 B;  1MMJ N;  3KF2 A;  3UB0 A;  4OS5 A;  2BOK A;  1HIA B;  2G00 A;  4NIW A;  4LZ4 B;  1BRA A;  2PKA A;  5DO4 H;  5JB9 S;  1MQ6 A;  3HGN A;  1K2I 1;  2Y7Z A;  3SZE A;  3R3G B;  4AZ2 B;  2RFK C;  2GGV B;  1P57 B;  1XKA C;  2DUC A;  1SLU B;  3C27 B;  4UFF H;  1FDP A;  1DXW A;  3F9E A;  1MTV A;  1RGQ A;  4ZUH A;  2BDB A;  1ELA A;  1GJA B;  3PMB B;  1DSU A;  2BZA A;  4DOQ A;  5EXM A;  2WPK S;  1QRW A;  1BTW A;  2BD4 A;  3QK1 A;  1VGC B;  3M35 A;  4MPX A;  1T32 A;  4TPY A;  1LHF H;  1AFE H;  1ZMN A;  3CS0 A;  5BPE A;  3MOC A;  3KN2 A;  5F8X A;  1ZTJ A;  2B9L A;  2KX4 A;  4AB8 A;  2ANK H;  1W13 U;  3L33 A;  2OCV B;  5B6O A;  2FOM B;  5GCH F;  4K5Z A;  1EP6 A;  4NFF A;  2STA E;  5E0H A;  1P05 A;  1C1M A;  4J1Y A;  4ASU D;  2OTV A;  3SV8 A;  1IQI A;  3ZYE A;  1OPH B;  3RXM A;  2ZQ2 A;  1UO6 A;  2KCO A;  1UVP A;  2B0F A;  1ZHP A;  4U2W A;  1LHD H;  3SQE E;  4Z6A H;  5JBA S;  5AFZ H;  1AQ7 A;  1ARB A;  2BXT H;  3SU3 A;  1SOZ A;  1RS0 A;  1TBR H;  3OFN D;  3N7D A;  2BDI A;  2FOA A;  1CHO F;  4YLQ H;  1OP2 A;  2HLC A;  2D1J A;  2BD3 A;  2D8W A;  1C9P A;  3RM2 H;  1GI9 B;  3P92 A;  1ZPZ A;  1YPH C;  1C1W H;  2ANM H;  4ASH A;  2KR7 A;  4E7R G;  2JDI D;  1ELT A;  1G37 A;  1V2Q T;  2C3S A;  3SQH E;  1MCT A;  1AUJ A;  3RXL A;  2XC0 A;  1FAX A;  1FY8 E;  1HAH H;  1O5B B;  2FX4 A;  3ZV8 A;  3Q77 A;  5EW1 H;  2HNT E;  1SGD E;  1J15 A;  1D4P B;  4ZAE A;  1WXR A;  3RXB A;  3K6Z A;  2PUX B;  4Q7X A;  1EAT A;  3HK6 B;  3FP8 E;  3SU1 A;  5FBE A;  3D23 A;  1BIO A;  1GJ5 H;  3SYJ A;  1C1T A;  1TNI A;  4CR5 A;  1RRK A;  3BTE E;  1HAP H;  4XSK U;  1TBQ H;  4KTC A;  1BMF D;  2Y7X A;  1EZQ A;  5DP5 A;  4WXV A;  1QB1 A;  2GJG A;  2HGT H;  1GI7 B;  2OK5 A;  3RXI A;  3SJ9 A;  1O3F A;  1QA0 A;  2HPP H;  1B5G H;  4OS7 A;  2QXJ A;  3GS9 A;  1K22 H;  1O5E H;  3MQK C;  2ZEB A;  1O2V A;  3BTQ E;  4CRF A;  2P8O B;  4AC9 A;  1VJA U;  2GDD A;  3U1J B;  2WZQ A;  5E8E H;  5CHA C;  2YMS C;  2Y5G A;  4Y0Z E;  2Y5H A;  2NU3 E;  2Q6G A;  4RKO B;  3FZD A;  4F48 B;  1AUT C;  1F0U A;  2W5E A;  2FYQ A;  2VVC A;  2FOC A;  4CH8 B;  5L30 H;  5EJZ A;  2LP6 A;  3STI A;  1EX3 A;  2GZ9 A;  3TJV A;  2CJI A;  1MQ5 A;  4IW4 E;  1TQ0 B;  1F0S A;  2QXG A;  2HAL A;  2CV3 A;  2XC4 A;  1BB0 B;  1JOU B;  2EST E;  5LPF A;  1O2R A;  4LZ1 H;  1OWE A;  3O8B A;  3FP6 E;  4DY7 B;  1IQG A;  1UJ1 A;  4DW2 U;  2ZDM A;  5EST E;  3W94 A;  4CRA A;  1MTU A;  4UFG H;  3PM3 A;  4JZ1 A;  1GJ7 B;  2G8T A;  4X8T H;  2ZU5 A;  1EAU A;  1ANC A;  4MQA A;  1SMF E;  4WMD A;  4IMQ A;  5JBC S;  2ZU1 A;  4NA7 A;  2XBW A;  3GDS A;  1GMC G;  1YLN A;  1T8N A;  1G3B A;  1GL1 A;  1HPG A;  3IWM A;  3FO8 D;  3K65 B;  4A5T S;  5C5N A;  3T62 A;  5JBT A;  2ZFT A;  4CH2 B;  2VGC B;  3KQB A;  1XVM A;  2CF8 H;  1NN6 A;  1Q31 A;  3MNX A;  2BY9 X;  1GBD A;  3A80 A;  3GY2 A;  3VB5 A;  2D2D A;  3E6P H;  4B2A A;  1C4Y 2;  3BTW E;  3TJO A;  1IQM A;  1EOL A;  2ODQ A;  4GUX A;  1DST A;  1JXP A;  4JYT A;  3RUO A;  3SI4 H;  3ZIA D;  4ABI A;  3VFE A;  3I77 A;  3A7V A;  1ZLR A;  1AZZ A;  1YC0 A;  4YZU A;  1HAX B;  1O5D H;  3PWC A;  3QUM P;  3P6Z B;  1C2I A;  1ORF A;  2GX4 A;  3U8O H;  4X1R U;  2JH5 D;  2QF4 A;  1SHY A;  2HOB A;  2GCH G;  3CNR A;  4RSP A;  5F03 A;  3M3S A;  1TFX A;  6GCH G;  4NFE A;  3EYD A;  1NT1 A;  2FLR H;  1YYY 1;  1RTL A;  3MHW U;  6EST A;  4AG1 A;  1Q3X A;  1TQ7 B;  3AAV A;  1G2M A;  3PLB A;  4CRD A;  3SJ8 A;  3UIR A;  1VR1 H;  1K21 H;  3RXF A;  2GCH F;  1O5C B;  4CRC A;  3DA9 B;  4OGX A;  3EST A;  1C5V A;  1MTW A;  2BDG A;  2NU1 E;  3T28 A;  4ZXY H;  6GCH F;  4E05 H;  1ELC A;  5F6M A;  1C5Q A;  1HUT H;  3PTN A;  5L6N H;  3A7W A;  3SUE A;  4XFQ A;  3PO1 C;  5HMA A;  1Q2W A;  4BAM B;  5HIZ A;  3QN7 A;  1SGN E;  1INC A;  1IQJ A;  1GG6 C;  1JMO H;  2F3C E;  2ZCL P;  3E1X B;  1TRY A;  1EZX C;  1C2H A;  3KNX A;  4K69 A;  5JDU B;  3OEE D;  1KMH B;  1U6Q A;  3R0F A;  1IAU A;  4UFE H;  4X1Q U;  1LKB A;  2EY4 C;  1FIZ A;  2ZF0 H;  1UVS H;  1DY9 A;  1NY2 2;  2FX6 A;  1AO5 A;  1VJ9 U;  1IHS H;  4VGC C;  3QZR A;  2SFA A;  3RMO H;  2YNB A;  1AKS B;  2FES H;  2C90 B;  1AN1 E;  2UWP A;  1FZZ A;  2J94 A;  4FU7 A;  2A45 B;  1ZOM A;  4Q7Y A;  1C5T A;  3ODD A;  1D3P B;  1WU1 A;  1VIT H;  3ZZB A;  1SG8 B;  2BD8 A;  3GY8 A;  1E36 B;  3A83 A;  4I8K A;  1OHH D;  5A8Y A;  4IS5 A;  4ABG A;  2ODP A;  1ELG A;  1UTM A;  1GJD B;  1QB9 A;  1GI5 A;  1GBI A;  3S9A A;  1GBK A;  1LQE A;  3P8F A;  2HVX A;  2PLX A;  5AFY H;  3O8R A;  3HKI B;  4BNR A;  3SGQ E;  1AFQ C;  1QCP A;  3SV2 H;  4WH6 A;  4OM9 A;  1GHX H;  2R2W U;  2ZU3 A;  1SQA A;  1A46 H;  2K0Q A;  1K1I A;  2GT8 A;  3SJO A;  5T6F A;  2R3Y A;  1ZSJ A;  3IIT A;  1THR H;  3SZN A;  2W26 A;  2L6O A;  5GND A;  1D6W A;  4F4O C;  3ATL A;  2ZWL H;  1ZJK A;  1S0R A;  2ZPR A;  1M9U A;  1B0F A;  2AFQ B;  3BTF E;  3RMN H;  3S7H B;  1GBE A;  1JIR A;  1QL8 A;  2WHX A;  2XC5 A;  2BY5 X;  1HNE E;  4NWK A;  4O3U A;  1P01 A;  1ZSL A;  2SGD E;  3VGC C;  5FCR A;  1C2D A;  1A4W H;  3Q00 A;  4KGA A;  1UVO A;  4X2Y A;  1XUG A;  1HJ8 A;  1O2O A;  1GI8 B;  2FI3 E;  1Z1I A;  2FOH A;  4DGJ A;  6LPR A;  4YOJ A;  5FPY A;  2BDY A;  4D8N A;  2A4R A;  2F9O A;  2WV5 A;  1RD3 B;  2XRC A;  3QTV H;  2A7J A;  4GCH F;  2WV9 A;  4LOY H;  3WW7 A;  4BTU B;  1SGT A;  1OXG A;  1DM4 B;  5IYT A;  5CHA B;  1K1O A;  3DD2 H;  1NRO H;  3F9G A;  4WWY A;  2V3O H;  2B8O H;  2AMP A;  4X6M A;  3OSY A;  1EB1 H;  3A7Y A;  1HYL A;  1QJ7 B;  2RG3 A;  3U98 H;  1DUA A;  2GZ8 A;  4I8G A;  1S6F A;  3L6P A;  2UUJ B;  5KGO A;  2OC1 A;  1PPF E;  2Z9G A;  5DP3 A;  3GY7 A;  2UUK B;  4I7Y H;  1YGC H;  4EST E;  2XW9 A;  3UR6 A;  2EC9 H;  2BTC E;  1F0T A;  2ZFF H;  4YLU A;  4Y76 A;  3OYP A;  3L3T A;  2WYG A;  1SVP A;  3M7U A;  1C2M A;  3AVZ A;  5CE1 A;  2EI8 A;  1A5H A;  1Z8J B;  3AW0 A;  2YOL A;  2ZIQ H;  1G36 A;  1LVM A;  1NBM D;  1HGT H;  1P10 A;  5FL7 D;  4NG9 H;  2I6Q A;  1ESA A;  1BA8 B;  3A87 A;  1VCQ A;  2HNT C;  1Z8R A;  3UTU H;  1VZQ H;  3B8J A;  4PRO A;  3OEH D;  1GI4 A;  2VH0 A;  2BDA A;  2FTL E;  1LVB A;  1ZZZ A;  1BDA A;  3LJO A;  3RP2 A;  1WCZ A;  1ZRB A;  4TY7 A;  5DP4 A;  5L2Z H;  1QZ8 A;  1UHB B;  2KM0 A;  1TWX B;  3TH4 H;  1CA0 C;  1MKW K;  2V3M A;  3S69 A;  3GCO A;  1W2K H;  4A1V A;  2QV1 A;  1NRQ H;  3Q3X A;  3RDZ A;  2G5N A;  1IQK A;  3NCL A;  1TGS Z;  2TGA A;  3P17 H;  1IOE A;  1C2G A;  2WUC A;  5EQQ A;  2BY8 X;  2ZC9 H;  4KP0 A;  3A8D A;  1FN8 A;  2BQ7 B;  4A1X A;  1WQS A;  1FUJ A;  1QGF A;  3FP7 E;  2ASU B;  2A2Q H;  4O97 A;  3EA8 A;  1E34 B;  5T6D A;  2PGB B;  3LGW A;  1S83 A;  2O8U A;  1SLV B;  3QO6 A;  1HAZ B;  2DE9 A;  5CMX H;  1Y3Y A;  5EW2 H;  2HWL B;  1FON A;  4KTS A;  1O2N A;  5F8Z A;  1TNJ A;  5DN6 D;  1HLT H;  2OP9 A;  3LOX A;  3SNE A;  4BAH B;  1Y59 T;  1O2U A;  1WTG H;  1H9L B;  2FOF A;  3E91 A;  3RC6 A;  4BAQ B;  3M3V A;  1V3X A;  1TAW A;  3SV6 A;  1P09 A;  4CR9 A;  2CN0 H;  1TAL A;  1J14 A;  1G3C A;  4ABA A;  5T6G A;  2R2M B;  1MZD A;  2ZU2 A;  1W7G H;  1Z6E A;  2IOT A;  3PO1 B;  1T4U H;  2AER H;  2F9U A;  1H4W A;  1V2K T;  2VBC A;  3QTO H;  1ELD E;  3WY8 A;  5F8T A;  3RXR A;  1NRS H;  3U9A H;  4INK A;  1GG6 B;  5IDK A;  3D65 E;  4TPI Z;  3B9F H;  3NRL A;  1AY6 H;  1H9H E;  3OX7 U;  5SGA E;  1FY5 A;  2XBY A;  3KQE A;  2FLB H;  3P70 B;  4P02 A;  4B71 A;  1NPM A;  5JYI A;  5GXP A;  1KTS B;  1D3Q B;  1OWI A;  3ZVD A;  1MZA A;  3KL6 A;  3RMM H;  1PQ8 A;  1SGC A;  4JK6 A;  4VGC B;  3BG8 A;  3M5L A;  4ACA A;  4FUH A;  5ETX A;  3V3M A;  1F92 A;  1SGQ E;  1C1Q A;  4I8L A;  1WTH D;  1BTX A;  1SQO A;  3H7O A;  1CT4 E;  1TBZ H;  2XBV A;  2ZDV H;  3VEQ B;  1PPC E;  1TRN A;  2VNT A;  2J38 A;  1TPA E;  2VB0 A;  1L1J A;  3KCG H;  1BTZ A;  1WDI A;  1FV9 A;  1IQF A;  3MYW A;  5DSF A;  4CRB A;  2P3T B;  1K0H A;  2OLG A;  2WPH S;  3LGU A;  4M7G A;  2G4T A;  2Y5F A;  3ELA H;  1VCP A;  3ZZ9 A;  1KXF A;  1S84 A;  4ZKR U;  2GV6 A;  4K1S A;  1TGN A;  5K0H A;  5DPA A;  1BHX B;  1RFN A;  2SGP E;  1TPO A;  2ZGH A;  1AFQ B;  1J16 A;  4YO9 A;  1O38 A;  1E38 B;  2PGQ B;  1TMB H;  3KQ5 A;  1T8L A;  4Q2K A;  4XBB A;  3UNQ A;  2QXH A;  4I31 A;  5TCA A;  1GBA A;  1C1O A;  1DE7 H;  1ABJ H;  2VIV A;  2WV4 A;  2FPZ A;  1HJA C;  2ZO3 H;  3F1S B;  2O9Q A;  3BEU A;  2B5T B;  1BHX F;  2FS8 A;  3F68 H;  4NA9 H;  1GPZ A;  1N6Y A;  3M7T A;  4NZQ A;  8GCH G;  2J9N A;  1IHT H;  1T31 A;  3P8G A;  4X8U H;  3UOU A;  1P8V C;  5FBI A;  1AVW A;  4Y11 E;  1AMH A;  2W6I D;  4JMY A;  1PYT C;  1YM0 A;  2J4I A;  1C1U H;  4DII H;  5GCH G;  1CO7 E;  1O2J A;  1O35 A;  4AYV B;  3ATK A;  1BOQ A;  5HYO A;  3LKW A;  3VGC B;  1O2W A;  1EPT C;  1DUE A;  4MNY A;  3HPT B;  8GCH F;  1C5O H;  4M9F A;  1O2S A;  3SU0 A;  3LON A;  3V12 A;  1LHC H;  1TAB E;  1DY8 A;  2Z9J A;  3RLY H;  1EQ9 A;  3I78 A;  3UQV A;  1CHO G;  1C5R A;  5EGM A;  1OOK B;  2F9V A;  4I8H A;  1KSN A;  2FO9 A;  1KXD A;  5A8Z A;  2PSX A;  2KCY A;  4ZKO U;  1K1M A;  2P3U B;  2H6M A;  2NU0 E;  1XUK A;  3MI4 A;  5DP6 A;  1CA8 B;  3KQD A;  4DCD A;  3E0P B;  3BTH E;  3URE A;  3S0N A;  4MPU A;  3V13 A;  1MAY A;  1WBG B;  1YBW A;  1QQ4 A;  5EPN A;  4WMF A;  4Y7A A;  4OS1 A;  3KQC A;  4BXS A;  1CSO E;  2G81 E;  2SNV A;  1QA7 A;  3A8B A;  3U1I B;  2FOE A;  3DCL A;  1BUI A;  4Z1M D;  1ABI H;  3WWF A;  4MVN A;  1NM6 A;  1EXF A;  1A0H B;  2GD4 B;  1KY9 A;  1XM1 A;  3UUZ A;  2JJ2 D;  1FLE E;  1AIX H;  1LPG B;  1H1B A;  1BTU A;  4JCN A;  1A0J A;  1C5S A;  1HAV A;  2C8Z B;  1HIA A;  2K8I A;  3KEE A;  3SOR A;  2FOG A;  4X2W A;  4WY3 A;  3AAU A;  4INH A;  3PV4 A;  1V2P T;  1DOJ A;  3UWI A;  4H4F A;  1QUR H;  1TIO A;  4AOQ A;  1GHB G;  4MPW A;  5C1Y A;  4BTT B;  1CBW C;  1KXC A;  4I32 A;  3N99 A;  1C9T A;  4ZHA A;  1XKB C;  1FY4 A;  2J92 A;  1C1P A;  5DGJ A;  1BMN H;  2HLD D;  2QAA A;  2W7S A;  1P03 A;  2ZGJ A;  1SLX B;  1Z8G A;  1MU6 B;  4X8V H;  4XBC A;  4Y8Y A;  1CA0 B;  1AND A;  1O3K A;  2WPM S;  2PUQ H;  1DS2 E;  1O30 A;  1GHB F;  3RXV A;  2XOK D;  1RIW C;  1HXE H;  2BMG B;  3N7E A;  4MTB A;  1EAX A;  2HNT F;  1DIT H;  3MU1 A;  1LCY A;  4MNV A;  1UTP A;  2SGQ E;  2PFE A;  1GI3 A;  2B7D H;  1CU1 A;  2R9P A;  5C1X A;  2JH6 D;  1HB0 B;  2V7Q D;  4ZMA H;  3G01 A;  2FOB A;  1ELE E;  3ENS B;  3OY6 U;  2C4F H;  1O2Q A;  1E35 B;  3V0X A;  2FI5 E;  1O3D A;  1L4D A;  1YCP M;  1O2P A;  1ESB A;  1TNK A;  1EST A;  1SPJ A;  3SJI A;  3EA9 A;  1K1L A;  9EST A;  3GOV B;  2Z9L A;  4X6O A;  5A0A E;  1AE8 H;  4B2B A;  1JRS A;  4MLF B;  1W0Z U;  2I6S A;  3SOS A;  3KGP A;  1PQ5 A;  4WVP E;  2CK3 D;  2J98 B;  2JET C;  3F3B A;  3RU4 T;  4AFQ A;  2ANW A;  2QF0 A;  1QFK H;  4H42 U;  1O3H A;  2Z6B D;  4BXW A;  2BX4 A;  5C5O A;  1GHV H;  1W3C A;  3RXA A;  3ZZ8 A;  3SV9 A;  5FXL A;  4KTU A;  4IGD A;  4B2C A;  4B76 A;  1YCP H;  1D3T B;  3SU6 A;  1T4V H;  2SNW A;  5C0U A;  1BRB E;  1UMA H;  4NSY A;  2H5C A;  4ZRO A;  1P9S A;  1BML A;  4RI0 A;  2A0Q B;  4FUB A;  3OTP A;  2A4G A;  5EJ1 A;  1RJX B;  5I46 H;  3M5N A;  3SHC H;  2BB4 A;  3EA7 A;  3SN8 A;  2ILN A;  1HJ9 A;  1Y5A T;  1CQQ A;  1GBH A;  2F9P A;  3MH6 A;  2BD5 A;  1AU8 A;  2CHA C;  1E37 B;  1F5R A;  1HAG E;  1S6L A;  1ETT H;  1O2M A;  1SHH B;  4MNW A;  1LMW B;  5A09 A;  2Z94 A;  3PRO A;  2WUB A;  3DSG A;  4X2X A;  2LEL A;  1WSS H;  1O39 A;  2WPI S;  2QC2 A;  1C4V 2;  4K3J A;  2P95 A;  4B1T A;  1C2F A;  1N8O C;  2D26 C;  2ZTZ A;  5EQR A;  4ABB A;  4AGK A;  1MD7 A;  1A61 H;  3NUM A;  1FIW A;  2BXU H;  1SKY E;  2BZ6 H;  1LHE H;  4AX9 H;  5EOK A;  2CF9 H;  1E1Q D;  1P2K A;  1ZHM A;  1QQU A;  4ABE A;  3FZZ A;  1GI6 A;  2H9H A;  2M2A A;  1NFW A;  2C8W B;  1WAY B;  1UK2 A;  1GJB B;  2QIQ A;  2AYW A;  2PW8 H;  4D76 A;  5AF9 H;  2ALP A;  3PWB A;  1CGJ E;  4ZXX H;  1THP B;  1YKT A;  1ZTL A;  1MH0 A;  2OIN A;  1BQY A;  2FP7 B;  2QGR A;  2L74 A;  2QE7 D;  1C1S A;  4FUC A;  1K1N A;  1HJA B;  1O2H A;  3BTD E;  3ZYD A;  5GWZ A;  2HRV A;  2VWM A;  1YPL H;  4JZI A;  5GJ4 B;  3RXK A;  4YXW D;  2GCT C;  1O3G A;  1VKY A;  1Y3U A;  3O8C A;  1E79 D;  1GBJ A;  4CRE A;  5ESB A;  1LQD B;  2AIP A;  5JPM H;  1QL9 A;  3BEF B;  2A7C A;  1TLD A;  3ITI A;  3DFL A;  1TB6 H;  3BTT E;  2XWA A;  1W11 U;  2ZI2 H;  5EOD A;  1BMA A;  2AEI H;  4RN6 A;  5T1V A;  4FET A;  3SGA E;  2AMD A;  1GI1 A;  1TYN A;  1JRT A;  1FXY A;  1EPT B;  3E8L A;  2VIP A;  3QDZ B;  4ZKN U;  5C0T A;  1KDQ A;  3M61 U;  1CHG A;  1Z1J A;  1C5Z B;  4Q4L A;  1YPE H;  2CGA A;  3MO6 A;  4TSF D;  2JKH A;  4P00 A;  3ZZD A;  3EE0 B;  1GDQ A;  1DWD H;  1YPK H;  1EJN A;  3VB3 A;  2EA3 A;  1RXP A;  1C5L H;  3MH5 A;  3A84 A;  3MU4 A;  4Y71 A;  2XND D;  5HM2 A;  4MNX A;  1TA6 A;  3I29 A;  1UK3 A;  1C5P A;  2PV9 B;  3SUG A;  3ZVF A;  1SC8 U;  2V3H H;  2DE8 A;  2CXV A;  2HVY B;  2VJ1 A;  3C1K A;  4NA8 A;  1ANB A;  2F9B H;  3W95 A;  3CS7 A;  1SL3 A;  4R8T B;  3ZVC A;  3F2G A;  2BQ6 B;  1UTQ A;  3GY3 A;  1PJP A;  1UTJ A;  3GDU A;  4DJZ B;  2FMJ A;  1C2K A;  2VIW A;  2AS9 A;  1TON A;  4WXI A;  3MH4 A;  3UQO A;  2FIR H;  2A31 A;  2J95 A;  2GT7 A;  1NES E;  1QB6 A;  3FN8 A;  1YLC A;  2GMT C;  3RXO A;  4ACB A;  1NBM E;  1C1N A;  5FHT A;  1CBW B;  4GCH G;  1H8E D;  2VID A;  4BAO B;  5L2Y H;  1X7A C;  2IJO B;  3DSO A;  4ZHM U;  3PB1 E;  1O3O A;  2ZPS A;  3VB7 A;  3QX5 H;  4XOJ A;  2AGE X;  4SGA E;  1NS3 A;  2VWL A;  1AKS A;  1AB9 C;  2ZGB H;  1MD8 A;  1BZX E;  1GCD A;  1EOJ A;  1ZGV A;  4FXG H;  1IQH A;  3HGP A;  3UAI C;  4WF8 A;  3ZVG A;  5LGO A;  1KYN A;  2Y80 A;  1RIW B;  4GAW A;  4BAN B;  2HPQ H;  3MH7 A;  3STJ A;  4E7N A;  1UTN A;  5GIB A;  1V2U T;  3E16 B;  3E0N B;  4RKJ B;  5J4Q A;  1GBC A;  3H5C B;  3RC4 A;  1AGJ A;  2V35 A;  4WME A;  1B0E A;  4YT6 H;  5C3N A;  3A8C A;  2OXS A;  2TGT A;  3PMA B;  4YOI A;  4XDE A;  4F49 A;  2PTC E;  3PV5 A;  1NFU A;  3RU4 E;  1V2N T;  1C1V H;  8KME 2;  1AZ8 A;  1Z71 A;  3GIC B;  1E1R D;  1Z7K A;  1MKX H;  3UNS A;  3H09 A;  2F4L A;  1GMD G;  3TK5 A;  1G30 B;  1ETR H;  1PPH E;  1V2O T;  3V7T A;  3RXQ A;  4K2Y A;  3MO9 A;  3F9F A;  5FCK A;  3SNC A;  5JB8 S;  1ZJD A;  1SQT A;  3MO3 A;  1A5I A;  1L1N A;  2JET B;  4JYU H;  5A0C A;  2UWL A;  1EJA A;  3M5M A;  1VCW A;  2ZHD A;  3A89 A;  1YF4 A;  1HFD A;  3MWI U;  1GBL A;  1SGI B;  2XTT B;  3Q76 A;  5G4B A;  3MNB A;  1TPS A;  3RXP A;  5EG4 A;  2ZU4 A;  1GMD F;  5EU8 A;  2OQ5 A;  4Q7Z A;  1LO6 A;  2QCY A;  4XE4 A;  1YCP K;  1GBT A;  2ALV A;  1P2M A;  3BG4 C;  1B7X B;  2Y82 A;  2LNC A;  1TRM A;  2WPJ S;  3TNS A;  3VXE H;  1UTO A;  4MPV A;  2THF B;  1A3B H;  3NPS A;  3QWC H;  3URD A;  1CVW H;  4B74 A;  2ZTY A;  4X1P U;  2RDL A;  1YPM H;  1TA2 A;  4FUI A;  2KAI B;  2CHA B;  3RLW H;  1GGD C;  3K2U A;  2ZGC A;  2TRM A;  1XVO A;  3PLP A;  1FY3 A;  3SU4 A;  3F9H A;  2EI6 A;  2FWW A;  1PPZ A;  1V2R T;  1NTP A;  9LPR A;  3CEN A;  1GVL A;  3GCH C;  1RTF B;  3TVJ B;  4SGB E;  3LC3 A;  1S81 A;  2O8L A;  4FU9 A;  5J4S A;  1FY1 A;  2W3K A;  1T7C A;  2ZKS A;  2PKS C;  3BSQ A;  2XXL A;  1EKB B;  4NIY A;  4O03 A;  5EXL A;  3RU4 D;  2YMS D;  1N8O B;  3TIU A;  4ZCN A;  1FN6 A;  1ZPB A;  2G51 A;  2ZFR H;  1PQ7 A;  1AE5 A;  3QZQ A;  2Y81 A;  2C8X B;  2SGE E;  1FMG A;  3MFJ A;  2W6J D;  1W0K D;  1EZS C;  2J5U A;  4XRN A;  4ISH H;  3U8T H;  4NZL A;  1P2N A;  5TJX A;  1BCU H;  4XD7 D;  3ZZC A;  2XCF A;  1DFP A;  3TJU A;  4HGC A;  3VXF H;  2F91 A;  2OQU A;  8LPR A;  2GKV E;  5HXF A;  3VB4 A;  1Z6J H;  3TIT A;  4AB9 A;  1NFY A;  3FAN A;  3ATW A;  3A86 A;  4FUG A;  3SU5 A;  2GCT B;  4QT8 C;  4AFZ A;  3BIV H;  1FPH H;  3SUD A;  4LXB H;  1W7X H;  4I33 A;  3BN9 A;  3PLK A;  3VPK A;  1O3I A;  3RXJ A;  3ZZ4 A;  1UHB A;  3A7T A;  2A7H A;  1GBF A;  4CRG A;  1QR3 E;  1A1R A;  5GDS H;  1OSS A;  1GWA A;  1PPE E;  1OP8 A;  5AVD A;  1L1G A;  1H8H D;  4GVU A;  1MTN C;  3BF6 H;  1CGI E;  1DWE H;  3ZVB A;  3DHK H;  1OYQ A;  2PKA B;  1D3D B;  5EXN A;  1V6D A;  5B6L A;  1AHT H;  4TY6 A;  3MU5 A;  1XXD A;  3ZZ6 A;  1AWF H;  4D9R A;  2PR3 A;  3FOA A;  1S85 A;  1H9I E;  1CE5 A;  1GDN A;  2TBS A;  3GYL B;  2KCA A;  1CGH A;  1P2J A;  1QBN A;  4ABH A;  1GJ6 A;  1TX7 A;  5K7R A;  4X6N A;  3VB6 A;  5LPR A;  3M36 A;  1P06 A;  3PV2 A;  2O8M A;  3QLP H;  3GY5 A;  5TCC A;  1FI8 A;  3LH3 A;  4NIX A;  5CDF E;  4TT3 D;  3TH3 H;  1TX8 A;  2O8T A;  1ZMJ A;  3PMH B;  4O3T A;  5I25 A;  3SV7 A;  3SW2 B;  3A81 A;  2BY6 X;  2KZ4 A;  3DSP A;  2IPQ X;  2A5A A;  4AOR A;  5A2M H;  1NRN H;  1GL0 E;  4HFP B;  1CT2 E;  5PTP A;  3VG8 A;  2WSS D;  3M37 A;  1WV7 H;  3ZZA A;  1P0S H;  4A1T A;  3LT3 A;  4MDS A;  4X1N U;  4GLY A;  1EAS A;  1QRX A;  1BTH H;  3Q3Y A;  3FAO A;  4WH8 A;  4D9Q A;  2XNI A;  1QL7 A;  1SFI A;  5T3H A;  4TWW A;  4OS4 A;  1PPB H;  1DX5 M;  1P3C A;  1QBO A;  2GMT B;  2RCE A;  4Q80 A;  3W1E A;  2ZZU H;  2YNA A;  4NGA H;  1K9O E;  3RXC A;  3CP7 A;  3LH1 A;  3NXP A;  4OGY A;  3LC5 A;  3T25 A;  7GCH F;  1HAV B;  3OAA D;  2O8W A;  4UDW H;  1O3C A;  3M3T A;  1A7S A;  1C2J A;  1NU9 A;  2XBX A;  1O3M A;  3BTG E;  3ZZ3 A;  1AB9 B;  3F0O A;  4HI3 A;  1S0Q A;  3S9C A;  1NC6 A;  3PMJ A;  5IK2 D;  1UCY H;  1FPC H;  3F0P A;  2QF3 A;  2ZA5 A;  2H5D A;  4Q63 A;  2ZP0 H;  1SSX A;  4H6S B;  5FPS A;  3MNC A;  2BLO A;  3TJN A;  1C5U A;  4K60 A;  2BVX H;  1P12 E;  4IBL H;  1MCV A;  5E2O A;  1F5K U;  3MNS A;  3UNR A;  2UUY A;  1G3D A;  1DLK B;  1XXF A;  4KEL A;  2WYJ A;  3EGK H;  2STB E;  2IJD 1;  1E0F D;  1SBW A;  1KXA A;  3RM0 H;  2PWX A;  2ZHE H;  3ZV9 A;  2TGP Z;  1HAY B;  1MKX K;  1QIX B;  2GV7 A;  3T27 A;  1JIM A;  4FVD A;  2G52 A;  1O3N A;  3A85 A;  2ZDN A;  3KYF A;  3LGI A;  3M7Q A;  4YTA A;  3TK9 A;  4A92 A;  1HBT H;  3ATM A;  1KXE A;  1IQE A;  1OP0 A;  4DIH H;  3ZZ5 A;  3KYG A;  1O2K A;  3EDX B;  4NIV A;  2ZQ1 A;  3NK8 A;  6CHA C;  3P8O A;  4K1E A;  1FQ3 A;  3Q3K A;  2J2U A;  1SB1 H;  3LDX H;  1DIC A;  2ZHW H;  4CHA C;  3UR9 A;  1J8A A;  3S7K B;  1OWK A;  1GHA G;  4NSV A;  4AGJ A;  3QGN B;  1WQV H;  3BG4 B;  1O2G H;  2BM2 A;  3BV9 B;  3GYM A;  2Q6F A;  2VIQ A;  1O3B A;  2FDA A;  3SGB E;  1MU8 B;  4AN7 A;  2OC8 A;  1FX0 B;  2ZDA H;  1ARC A;  2NU4 E;  4I86 A;  3MU8 A;  1MTS A;  2W7U A;  2KFW A;  1QNJ A;  1SLW B;  1BTY A;  1GHA F;  1C2E A;  3SUF A;  1GVK B;  1F7Z A;  1GGD B;  1JBU H;  1O37 A;  2OBQ A;  1O2I A;  4Y7B A;  1ZRK A;  2ZDL A;  2Z3D A;  3GCH B;  4O9V A;  1GHZ A;  2UWO A;  1AVG H;  3OE7 D;  1PPG E;  3U8R H;  2PKS B;  4GPG A;  7EST E;  4JZD H;  5FPT A;  4ZHL U;  3HK3 B;  1QY6 A;  2M5T A;  1SOT A;  4NWL A;  1O2X A;  1V2V T;  1DWB H;  2BDH A;  5EQS A;  3FFG A;  2ZNK H;  1RTK A;  4LK4 A;  4DT4 A;  3SI3 H;  3SO3 A;  2AIQ A;  4FU8 A;  4TWY A;  2WIN I;  2FZZ A;  1XX9 A;  3GDV A;  1HXF H;  2P16 A;  1L4Z A;  2UUF B;  2Q6D A;  2BVS H;  1N6X A;  2F83 A;  2ZFS A;  2VIO A;  3P95 A;  2FM2 A;  4K1T A;  4JZE H;  1S6H A;  1YPG H;  4Y8Z A;  2F43 B;  2AGI X;  4MG3 A;  1EP5 A;  1P2Q A;  4X1S U;  2H2Z A;  1SR5 C;  3OY5 U;  3SNB A;  3SHA H;  4ISO A;  3T26 A;  2ZHF H;  1A3E H;  3K9X B;  5HM9 A;  3RXT A;  2IPH A;  4TYD A;  4B73 A;  1ZYO A;  3EAJ A;  1MBM A;  1DVA H;  4H6T A;  1KLI H;  1SGR E;  4XBD A;  1H8D H;  1UTK A;  3RXH A;  1YWU A;  4K8B A;  1MTN B;  5KED A;  3KID U;  1L0Z A;  2NWN A;  1J9C H;  2R0K A;  1Y5B T;  2ZGX H;  2AGG X;  2PSY A;  2JJ1 D;  1ACB E;  2Z3E A;  4AFS A;  5H4I B;  1O3P B;  5C20 A;  2FYR A;  2V0B A;  1YP9 A;  2BD9 A;  1MKW H; 
#chains in the Genus database with same CATH homology
 1CU1 A;  2OIN A;  1MAB B;  3RC5 A;  3LKW A;  3VG8 A;  2WSS D;  2V7Q D;  2KCO A;  4B6F A;  2FP7 B;  2QE7 D;  2WPD D;  5GPI B;  4A1T A;  2YMS D;  1NS3 A;  4ZCN A;  2OC8 A;  1FX0 B;  4M9F A;  3F2H A;  2F9U A;  3SU3 A;  1W0J D;  3SU0 A;  5GJ4 B;  3L6P A;  4B75 A;  4YXW D;  3LON A;  2OBO A;  2OC1 A;  2VBC A;  3OFN D;  3N7D A;  4WH8 A;  2QF5 A;  4WF8 A;  1E79 D;  2W6J D;  3M5O A;  1DY8 A;  2XNI A;  1W0K D;  2KFW A;  3FKS D;  5ESB A;  3FO8 D;  2J5U A;  5IDK A;  2JIZ D;  3W1E A;  3NRL A;  2F9V A;  2OC0 A;  3SUF A;  3P8N A;  2KR7 A;  2JDI D;  3O8D A;  3F2F A;  2KCY A;  2OBQ A;  3RC4 A;  4XD7 D;  1OHH D;  2CK3 D;  2XCF A;  3OYP A;  3PRD A;  2A4Q A;  3F3B A;  4B71 A;  3OE7 D;  4U01 A;  3OAA D;  5T1V A;  1JXP A;  4FET A;  3ZIA D;  2YOL A;  5FPT A;  3PV5 A;  2OC7 A;  2AHM E;  3DSO A;  1W3C A;  3SV9 A;  3M5L A;  1NBM D;  3F0O A;  5C0T A;  3O8R A;  4NWL A;  2K1Q A;  5FL7 D;  3SU5 A;  5ETX A;  5EPN A;  4B76 A;  1WXR A;  3AK5 A;  5IK2 D;  5EQS A;  1E1R D;  3SU6 A;  3F0P A;  4Q4L A;  3SUD A;  4DT4 A;  5F53 A;  5C0U A;  5HKK D;  3U1I B;  2KCP A;  3H09 A;  3O8C A;  4I33 A;  2F4L A;  2QF4 A;  3DCL A;  4WH6 A;  4OM9 A;  3SU1 A;  4Q63 A;  4Z1M D;  3WWF A;  3OEH D;  4RI0 A;  3SYJ A;  1COW D;  4TSF D;  2K0Q A;  3OTP A;  5FPS A;  2A4G A;  2JJ2 D;  3E90 B;  3KF2 A;  3UB0 A;  4KTC A;  3EYD A;  3M5N A;  1BMF D;  1DXP A;  5DSF A;  2K8I A;  2KM0 A;  3KEE A;  1A1R A;  1RTL A;  3M5M A;  2OK5 A;  2FM2 A;  2XND D;  1H8H D;  2L6O A;  5GND A;  4A1V A;  2QV1 A;  3GS9 A;  3PRB A;  3SUG A;  1N1L A;  2F43 B;  3SZE A;  4F55 A;  1S6L A;  2IJD 1;  2GGV B;  5B6L A;  2XCN A;  4I32 A;  3U1J B;  1BT7 A;  3WWB A;  3N99 A;  2WHX A;  1RGQ A;  2WZQ A;  3SU2 A;  1DXW A;  2YMS C;  5EQQ A;  2LEL A;  2YMS B;  4NWK A;  3FOA A;  4R8T B;  3F2G A;  5EPY A;  2KCA A;  2GVF A;  4I31 A;  2HLD D;  4A1X A;  3SUE A;  5EQR A;  1EFR D;  4TYD A;  2P59 A;  4B73 A;  4A92 A;  4B74 A;  5C17 A;  3PV2 A;  1SKY E;  2O8M A;  5FPY A;  3KN2 A;  4K8B A;  2A4R A;  5CDF E;  2XOK D;  1E1Q D;  4TT3 D;  3N7E A;  2M2A A;  3FN8 A;  5DN6 D;  3P8O A;  3LOX A;  2FOM B;  2WV9 A;  2JJ1 D;  3KNX A;  3SV7 A;  3OEE D;  2W6I D;  1NBM E;  1KMH B;  4JMY A;  3WW7 A;  3SU4 A;  3O8B A;  5H4I B;  4ASU D;  1H8E D;  3RC6 A;  2KZ4 A;  5CHB A;  3DSP A;  4B6E A;  3SV8 A;  1DY9 A;  2IJO B;  3SV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...