5C0UA

Crystal structure of the copper-bound form of merb mutant d99s
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALSTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase,metal binding protein
molecule keywords Alkylmercury lyase
publication title Structural and Biochemical Characterization of a Copper-Binding Mutant of the Organomercurial Lyase MerB: Insight into the Key Role of the Active Site Aspartic Acid in Hg-Carbon Bond Cleavage and Metal Binding Specificity.
pubmed doi rcsb
source organism Escherichia coli
total genus 63
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5c0uA00
5C17A 3F2GA 5DSFA 5C0TA 3F2HA 3F2FA 3F0PA 5C0UA 3F0OA 3FN8A
chains in the Genus database with same CATH superfamily
4NZQA 1P2IA 1BRUP 2BOHB 2WPJS 1HXFH 5E0GA 3M5NA 1OOKB 1C1SA 1RRKA 1YP9A 4FETA 1GBMA 1WYKA 3B23B 5C5OA 1MUEB 3KL6A 1GCDA 3ZZ6A 1SLUB 4AFQA 1O3JA 1TRMA 1T32A 2F9PA 2QY0B 1DS2E 5FCKA 1E36B 1QFKH 2V0BA 2FI3E 1GMCF 2W3IA 3I29A 5C0TA 1MZAA 4BAOB 4A1VA 4NIYA 1MKWK 1V2ST 1WSSH 1Y3YA 2WUBA 1MU6B 2RG3A 2G81E 1ELFA 1D3PB 1GBLA 2AGEX 4IBLH 3UB0A 4B71A 4AGKA 2F9OA 2GGVB 3V7TA 4D7GA 1FY5A 4HGCA 3SGAE 3EA9A 2UWPA 2ZF0H 4K1TA 3LH1A 4GCHG 1ACBE 4UE7H 5GCHF 3CNRA 2BLVA 2ZNKH 1CHGA 4E7NA 5KECA 1RIWC 2FX4A 1Y5BT 4MNVA 2F4LA 1Z8JB 3AAUA 2UUYA 3IWMA 2FESH 1GBTA 4X1RU 4DIIH 1O3LA 2XC4A 1K2I1 5FBEA 1TMUH 5AF9H 1C2KA 2QN5T 2YNAA 2DE8A 1O35A 1Y5AT 1S82A 4AFUA 1BJVA 2IJOB 1Z71A 4ABHA 1BUIA 3TIUA 1UVOA 4YZUA 4DIHH 1TOMH 2BB4A 2AMQA 3ZVEA 3RXMA 2OK5A 1AN1E 1G32B 4XDEA 4I8LA 1LQEA 1RTFB 1BITA 5L6NH 2ZGBH 3I77A 3E8LA 1GBAA 2JJ2D 5E0HA 1O2GH 2ZU3A 3AASA 3IITA 3F6UH 1FMGA 1GCTB 1KSNA 2BMGB 1J17T 1Z7KA 1SLWB 3S69A 1GI7B 5T6GA 1EB2A 1MTSA 1O3CA 2C8YB 4ZKNU 1MKWH 4TY7A 1AVWA 2XBXA 2J94A 1YLDA 1Z1IA 2AHME 4IC6A 1XUFA 4GVUA 3NPSA 5A8ZA 1O2YA 4K8BA 3V3MA 2CV3A 1ZMLA 1QBOA 1V2WT 2V35A 1SB1H 3P8FA 1WQVH 1EZUC 5I46H 1WUNH 1SGFG 1KTSB 1UK3A 3RLWH 1UJ1A 2ZKSA 2HNTC 1C5VA 2ZI2H 3QGJA 2ZPQA 3NCLA 1COWD 1O5CB 4K69A 1BJUA 3FZZA 3SNEA 2P3TB 1BTHH 1XUHA 5EPNA 5TJXA 2A7JA 1WOFA 2BLWA 3M61U 2FOMB 1DE7H 2BHGA 4D7FA 1TONA 1YPKH 5B6LA 3GISB 4NA7A 4WH8A 3UUZA 1GI1A 3MU5A 3PRDA 4Z6AH 2BDIA 1W0KD 4OS5A 5F8XA 1ABJH 1F2SE 2P3FH 2SGQE 1YCPH 1BOQA 1O3MA 2ZDAH 2BZAA 2DE9A 3SQHE 1ZLRA 2SGPE 3ZV8A 4P02A 2XWBI 5DP8A 3ZZ9A 3PMJA 1AUTC 4O3TA 1ELBA 1UTLM 1HAIH 1T8LA 3A87A 1Z8RA 1QY6A 1W13U 5J4SA 5JYIA 2ZIQH 4J1YA 4DGJA 4VGCB 2P8OC 4I86A 1HIAB 1WTHD 4MLFB 3VXFH 5FAHA 4RKOB 5EJZA 1J9CH 1G3DA 1W0JD 2J9NA 3RXRA 3GCOA 3DD2H 3ESTA 3QTVH 1EPTC 4O03A 5PTPA 2QCYA 3SUDA 4U01A 4Q80A 1BDAA 1E79D 3ZZ3A 2YOLA 2Z9GA 3AW0A 5A8XA 1C5XB 2P3UB 2YMSC 1GJBB 5FXLA 5FPYA 2I6QA 1NS3A 2B7DH 4Q7ZA 5FBIA 4FUCA 3TGKE 1NT1A 3O8CA 5FHTA 1GJCB 2ZCKP 3ODFA 4Q63A 1FPCH 1TOCB 4JMYA 4K8YA 2G5VA 4WMDA 1YY3A 2BOKA 2FLRH 2R2WU 4I7YH 2GDDA 2YMSD 1E34B 5FX5A 4X6OA 1HPGA 1JOUB 1CHOF 6ESTA 5KEDA 2AGGX 3MH5A 4HZHA 5IK2D 2ZA5A 1C4V2 2RA0A 1LHDH 2A5IA 3LC5A 3SN8A 1MTVA 1GI0A 1LPKB 2ULLA 3GDUA 3NK8A 3UREA 2BZ6H 2GJGA 4I31A 2G4TA 4BANB 1HJ9A 1NFYA 3A7ZA 1V6DA 1HB0B 2W3KA 3UAIC 3SV7A 2BY6X 1W0YH 3SU4A 2H1UA 1ELEE 1IHSH 1P0SH 1VGCC 4DJZB 2VWNA 1XXFA 3GDSA 1FN8A 4ABIA 3C1KA 3FANA 2ZECA 4HFPB 1LKBA 4CHAC 4FUGA 1GBHA 3OX7U 1UCYE 2W26A 1C5RA 1BMNH 1SBWA 2I6SA 3B8JA 4CRAA 1AQ7A 3BG8A 3S9BA 1LHEH 1KXCA 3M36A 5HYOA 1EFRD 1C1MA 4ABGA 4RT1A 1AIXH 2FDAA 2PGQB 1TNJA 4ABFA 1L0ZA 1LVMA 3K2UA 1SPJA 1NRNH 4ZXXH 4WF8A 3RXSA 2FMJA 1LQDB 4X2XA 2BTCE 2ZGHA 3N7DA 1AUJA 4GLYA 1NY22 3UQOA 3BTKE 1K22H 1RS0A 1EPTA 1ETRH 1AFEH 1CBWC 2VVCA 2ZFSA 4ZHLU 1CT2E 4I33A 1MTWA 3L33A 4CH2B 1TNGA 1NBME 1GMDG 2VBCA 3M3VA 1M9UA 2GP9B 3VGCB 1TPSA 1F0UA 3GYMA 2XW9A 2VU8E 4B6FA 3LGYA 1BRAA 1A61H 2XOKD 1WTGH 1GHYH 4NA8A 5EIYA 3M5MA 5JBAS 3SV2H 1C2JA 2QF0A 2FPZA 3U98H 1F5LA 5EG4A 2AFQB 2G5NA 1GBBA 4LZ1H 2OQUA 5FPTA 4OGYA 1F7ZA 1SLXB 1YF4A 2GDEH 1BHXF 1FONA 4MPWA 4F48B 1IQJA 1LMWB 1C1TA 1TRNA 1DWEH 3RP2A 1SOTA 2BD3A 1GVZA 4AG1A 1HJ8A 2J92A 1A3BH 3LIWA 3A88A 1SC8U 1O3EA 4FUBA 2JETB 1X7AC 1TB6H 4BAQB 1INCA 3LONA 1FIWA 4KKDA 4DCDA 1GI8B 4XBCA 1E37B 2RCEA 5SGAE 1THPB 4INLA 3TJUA 2WPLS 1O37A 4X1NU 1SGDE 5CHBA 1P2OA 3PLBA 3LGTA 2OUAA 3P6ZB 3VB5A 2Y6TA 3E0PB 2B8OH 2FTLE 3S7KB 1YYY1 1S83A 2CJIA 1C5UA 3A7YA 4THNH 1C2EA 3BIVH 4NSVA 2BDAA 2FS8A 4NZLA 1EAIA 2KCYA 3PTBA 4Y0YE 2C8XB 1TNIA 2SNWA 1SQOA 2AEIH 2Z9KA 2IOTA 3V0XA 1N6XA 1PQ8A 5HM9A 3UTUH 2HPPH 1ZHPA 1LVOA 1C2GA 1W12U 1ZPCA 3RU4T 1VITH 3PV5A 1BB0B 3B9FH 3VGCC 1O30A 2LPRA 3CENA 3N99A 3E16B 1S5SA 5IDKA 1G37A 3SORA 3SQEE 3RM0H 1A5GH 2QXHA 1P06A 2QF4A 1OKXA 4ISHH 3PV4A 3RXIA 5LPEA 1QJ6B 2WHXA 1C9TA 2VIWA 2FYQA 2JKHA 3PO1C 4DW2U 1GBDA 1E1RD 3MI4A 2R0LA 1O2NA 1GBEA 1AKSA 1BMAA 3MNXA 1JIMA 2A4GA 4GUXA 5K7RA 5GJ4B 1O2UA 2A32A 1O5FH 1P04A 1K0HA 1ZMNA 2L74A 4WMEA 1V2JT 2EI6A 4ZKOU 5A0CA 5JB8S 1P02A 1HAVB 2UUJB 4WVPE 3T27A 2VIQA 2Z6BD 2C8ZB 1S6HA 2ZPRA 1HAHH 1P2QA 1ZJKA 3RXEA 3VPKA 1G9IE 2WV4A 2ZDLA 3RXKA 2HALA 1O2WA 3EDXB 3VB7A 2ZU5A 3LOXA 3E6PH 1PQ7A 2QGRA 2KM0A 2PW8H 3GY5A 2ILNA 1V2UT 1HCGA 2OCVB 5G4BA 3M7UA 5ESTE 1NRQH 3TNTA 2Q6DA 1D6RA 1Y59T 3E0NB 5FX6A 1TE0A 2FLBH 3PMBB 1Y8TA 3M3SA 1N6YA 3PTNA 2D26C 4X8TH 3QGNB 1ANEA 4BAKB 3Q3XA 4Y8ZA 1JWTA 1HAZB 1F92A 4ABEA 1H8IH 1BZXE 4B2CA 1OP8A 5EJ1A 3PRBA 3SGQE 1RD3B 1AZ8A 3BTQE 3PM3A 1DM4B 3KQBA 3SU3A 1HFDA 3K65B 2Q6FA 3PMHB 5CMXH 2HOBA 5EXLA 3HKIB 1TGBA 3BG4C 1OX1A 2ZCLP 3GY6A 1K1NA 3KN2A 1V2NT 2TPIZ 3OY6U 1EUFA 2F9UA 2XNDD 5DPAA 1OP0A 2OLGA 2VINA 1NPMA 1XM1A 1YPMH 3UQVA 4AZ2B 1AVGH 1THSH 3E3TA 4K5ZA 1LPGB 1EZSC 4OS6A 3ATWA 2P93A 1L4DA 3SU0A 1EJNA 2ZFRH 1D3TB 4LK4A 2QF3A 2ZHQH 1P01A 2ZWLH 4XBBA 3EAJA 3OYPA 2FOCA 1G2LA 1O2HA 3F1SB 1AWFH 1CGHA 3F9EA 3GY7A 5AHGH 1GGDC 4J2YB 1UVSH 1KMHB 4GHTA 3SBKA 1MQ5A 1E35B 1V2OT 3QTOH 3TU7H 1GJ9B 1MTNB 1QJ7B 2TGPZ 1YPEH 1AFQB 4NIXA 2VB0A 2P16A 1GMHF 1TGCA 3P17H 5IYTA 3RXOA 2OD3B 1MD7A 2Z94A 2K0QA 3EGKH 4INHA 3F2HA 2OTVA 3D65E 1S84A 1U6QA 1NFUA 1G3BA 4H6SB 2Y81A 1VITG 3MU0A 3VFEA 3LPRA 3MO6A 1QURH 3D62A 4AGJA 1K9OE 2M2AA 1XUIA 4X1QU 5E2OA 4UFDH 3SJOA 1O2TA 1BHXB 2L6OA 1O2IA 1VJAU 1S85A 1CA0C 1S0QA 5F6MA 3HATH 1MU8B 1T8OA 3TNSA 1ESTA 2STBE 2ZFQH 3MU4A 3IG6B 3MH7A 3RU4D 1UTJA 1SGNE 2CXVA 8ESTE 2J5UA 1HAGE 1C9PA 1KXAA 2BX3A 3F9HA 2JH0D 4Y8XA 4CRFA 4YM9A 1OWIA 1TQ0B 2BQWB 4XOJA 1QHRB 1F0SA 2PKSC 4GAWA 4Y0ZE 1P2KA 2EY4C 1TWXB 5C1XA 2J38A 2GTBA 1GDUA 1Z8GA 2HLDD 4SGAE 1AI8H 1BTZA 4DVAU 1VCQA 3TK9A 2F9BH 1C2DA 4ZH8A 1CGJE 3U28C 4YOJA 1W3CA 1C1OA 5AVDA 4ESTE 3M7QA 3MTYA 1ANCA 2A4RA 3O8DA 3PMAB 1ETTH 1ZSKA 2IN2A 1B0EA 3BTGE 1GWAA 1BMLA 2FOBA 3ATKA 1XUGA 3SNAA 3MNBA 1B0FA 2F83A 3M7TA 1CQQA 2HNTE 2VWMA 2XYAA 2EA3A 4B1TA 1HAVA 3SZEA 3GDVA 2GT8A 4SGBE 3QWCH 3EE0B 1MTNC 3RXAA 1YCPM 3URDA 1P57B 1C1QA 1AFQC 1L1GA 1O38A 2R2MB 1XVMA 3T2NA 3U8RH 1LVBA 1QGFA 4K3JA 2QV1A 4RKJB 4F4OC 2B9LA 4Y7BA 2OC8A 3UOUA 1H4WA 1C5YB 1P2NA 2GKVE 2EQNA 2P94A 2C90B 3ZVDA 3TH2H 3PROA 3UPEA 1GI5A 1LKAA 1Z6EA 3UNQA 2BQ7B 3MU1A 4YLQH 3W95A 3FZDA 1QA7A 1YCPK 2M5TA 1KTTB 1HAYB 1DANH 4ABBA 3SU5A 2OXSA 5CE1A 2V3MA 4D9RA 1D6WA 1ZSLA 2DUCA 2Q1JA 5EQRA 1V2RT 2P8OB 1UK2A 4Q2KA 5C1UA 1FY8E 1DUAA 3SUGA 1O0DH 2HVYB 2XCNA 1EPTB 4E06H 3FAOA 3SHAH 4E7RG 2Y82A 3NUMA 3QK1A 3SJ9A 1DY9A 1GHXH 4X8UH 3T29A 3GYLB 1TX8A 3QZRA 2FOFA 1WV7H 4KTSA 1CO7E 2YMSB 4YOGA 2TGTA 2ZHEH 1GBKA 1LHFH 2STAE 3UWIA 3VG8A 1XUKA 3S9CA 5E8EH 4A7IB 4OS1A 1Z6JH 1NZQH 5GIBA 4KP0A 3F3BA 7GCHG 2ZGJA 1P10A 2C4FH 7KMEH 2HPQH 1S6FA 2EEKA 2ZDVH 3LKWA 3SNCA 3W94A 3U9AH 2FS9A 1Q31A 1NO9H 3BTHE 1SGCA 2BVSH 5T3HA 3TVJB 1C5SA 5GWZA 1O3BA 2J98B 1EJMA 1C2HA 2FOAA 2CF8H 3JZ2B 3VB3A 4X1PU 4AFZA 3RXVA 1IHTH 4ZROA 3S0NA 1GHAG 1DSUA 1D4PB 4DT7B 1GJ4H 1JRTA 4ZAEA 1TGTA 1VGCB 5KGOA 3FP8E 2SGFE 2QYIA 3EE7A 2BVRH 2Y5FA 3SJKA 4CHAB 1BTUA 3NWUA 2SGDE 4MPVA 2OQ5A 3ZVBA 2Z9JA 1GVKB 1FJSA 1PPFE 5C5NA 4CRCA 1TALA 4Y79A 2QXIA 1QB9A 1ABIH 4TWWA 3GCTG 4YT6H 9ESTA 1UVTH 1ANBA 1TNLA 2XBYA 4H42U 3RXTA 2BDGA 1NTPA 3KYFA 4OS4A 5EPYA 1QA0A 2ZU4A 1QL7A 1VKYA 3RXDA 3LC3A 1NRPH 2FIRH 1ZPZA 2EI8A 4DURA 5DP9A 1WDIA 2EC9H 2ZPSA 3UFAA 3TK5A 4I8JA 1DSTA 3JZ1B 3N7OA 1WXRA 1GHWH 1W8BH 1A0LA 5E0JA 4GHQA 1Z8IB 4XBDA 1AMHA 6LPRA 2B5TB 2XCFA 2QA9E 4K1EA 1K21H 1CSOE 1CBWB 1KIGH 1Y3VA 2VIVA 2BLOA 4A1TA 2G8TA 1V2VT 3KNXA 3OSYA 5C2ZA 1PPGE 1L1JA 3F68H 5L2ZH 1H8ED 3VXEH 2LP6A 3H7TA 1FZZA 2P95A 1ESBA 1GHBF 4IGDA 3Q00A 4JYUH 5EODA 3OY5U 1W10U 3BSQA 1OWJA 4CREA 1OP2A 3STIA 3NRLA 3ZZ5A 1GI9B 1OWHA 2VIOA 2A4QA 3T26A 2ZTXA 1AWHB 4U30A 3WWFA 4B75A 3BTWE 2ZTZA 1T31A 4UD9H 2PUXB 2FM2A 3ZYDA 5F53A 1TABE 1IQLA 1PPCE 1Q2WA 2BD4A 4O97A 4U2WA 1AKSB 1QJ1B 4JZIA 2WPIS 4WXIA 1HRTH 1V2QT 2KAIB 1UK4A 4NA9H 2ZQ1A 1DUEA 4A6LA 5CHAC 1ZHRA 1OS8A 2IJD1 4CR9A 5JB9S 5HIYA 1K1OA 2WPDD 2Z7FE 3TH4H 1AE8H 3A8CA 4I8KA 2CK3D 5C20A 1TRYA 3RDZA 1CT0E 2OP9A 4TPYA 3M37A 3QX5H 3OFND 1O34A 1TNHA 1BMMH 3ZVFA 3RC4A 1W14U 2AH4X 1FI8A 4Q7YA 1WCZA 4NIWA 2FX6A 1SR5C 3BTTE 3CS0A 3OTPA 4RT0A 1O2RA 2GV7A 2XC0A 4UFFH 4GPGA 1LDTT 1P09A 1OHHD 1QRXA 2GVFA 1O3HA 1TYNA 2BX4A 2Z9IA 1JXPA 2ZDKA 2B0FA 1FXYA 2QAAA 2GZ9A 2AGIX 1J16A 2FTMA 2NU3E 4JZ1A 3BF6H 2ANYA 2O8UA 1MTUA 1P11E 1FDPA 1EKBB 1L2EA 2ESTE 1QRWA 1MQ6A 5F03A 3ZZ7A 2V7QD 2AERH 1QQ4A 2CN0H 2KCAA 1KYNA 1DWBH 4X2VA 3V13A 4KELA 4ZXYH 3M3TA 1ZSJA 3OE7D 2F43B 3U69H 3A84A 4FU7A 1BTXA 1C1NA 1SGEE 3DT0H 1W7XH 2BQ6B 3ELAH 1DPOA 2QXGA 1JMOH 1YPHE 5BRRE 1OSSA 2ODPA 2FYRA 4YESB 3G01A 3PB1E 3SU2A 1C2LA 3S7HB 2JH5D 3PO1B 1ANDA 2QE7D 1NM6A 1PPBH 1YPGH 1O33A 1ZGIA 2BD2A 5AFYH 3K9XB 1CGIE 1O3KA 1THRH 3A80A 1HV7A 1QRZA 2HGTH 2QIQA 2XWAA 3U8OH 1FQ3A 2J98A 3OEHD 4AG2A 3BV9B 1QZ8A 5JDUB 2GT7A 1UTPA 3SU1A 4IN2A 2XXLA 3FO8D 2FOEA 1ZRKA 1QB1A 8LPRA 5H4IB 4WMFA 1OYQA 4XRNA 4OM9A 4IMQA 4MNXA 1P3EA 2BD5A 1BCUH 1ARBA 5JPMH 1C1UH 2OC7A 4TWYA 5HKKD 2BD9A 1H9IE 2FOHA 2ZHDA 1Y3UA 1UHBB 5FL7D 2KFWA 1IQKA 2XC5A 4TY6A 2F91A 4AC9A 2D8WA 5JBBS 8GCHF 3KGPA 2BD7A 1AU8A 4CRGA 4E05H 2A45B 3RC6A 4Z1MD 1PYTC 1PFXC 1AB9B 3HK6B 3T62A 2VNTA 1A5HA 5HMAA 2AMPA 2BVXH 4X1SU 4WXVA 1EX3A 2PLXA 4I8GA 5L30H 1HAXB 2ANKH 2GCHF 5DSFA 1O2ZA 4FUHA 2ZTYA 1UO6A 2PTCE 2FOGA 2SGEE 2TGAA 3C27B 2WINI 1BRCE 2ZFTA 1PYTD 2Y7XA 1O5DH 5TCCA 1SQTA 2OC0A 1K1MA 3BG4B 1N1LA 1XMNB 4TT3D 1TMTH 2NU4E 5LPFA 1IAUA 2HNTF 2JDID 4NFFA 3SI3H 1PQAA 5A09A 3QN7A 2TIOA 3UIRA 1S0RA 5EXNA 1VCWA 3LGIA 3MNSA 4DG4A 2TGDA 3GS9A 1O2LA 3KQCA 1DITH 2FODA 1O5AB 1F0TA 1V2KT 4FUJA 1BBRK 1GBCA 2QF5A 5C1YA 1V2TT 2KAIA 5HGGA 5JBCS 2V6NA 4Y11E 3MYWA 1RTLA 1O5BB 3SU6A 1GHVH 2OBOA 4JZEH 4Q4LA 1AY6H 5DG6A 4X2YA 1GJ7B 1IQEA 1NBMD 1RGQA 2ANMH 3ZZBA 5DP7A 1GGDB 3T25A 3DSPA 1E1QD 3MO9A 2THFB 1P12E 3O8BA 3VB4A 3L3TA 1MMJN 1C4Y2 3GICB 5A2MH 1FNIA 1C1PA 2D1JA 2ZQ2A 3GY2A 4ABDA 1YPJH 1O3PB 1FN6A 4JYTA 1V3XA 1OPHB 3DFJA 3SGBE 1XXDA 1SGTA 1AZZA 2A1DB 5HIZA 2FI5E 3KQEA 4JK5A 1DX5M 3RU4E 1QL8A 1GJ5H 4AX9H 3GCNA 1AB9C 1O39A 1O32A 4OS7A 1AHTH 3RMNH 1UTNA 6GCHG 3SJ8A 2C3SA 1CA0B 2KCPA 2PV9B 1GVLA 2FP7B 2R9PA 2FO9A 4FU8A 1S81A 2BY9X 2KCOA 3PWBA 4JK6A 2H5CA 2PFEA 1GHZA 1HLTH 4B2BA 2H9HA 4XD7D 1DVAH 4O9VA 3UWJH 4M9FA 4AYVB 4QT8C 3SI4H 4WJG2 3MWIU 5DK1A 1PPZA 1V2PT 1IQMA 1J15A 2PKSB 1XUJA 1C5WB 2VWOA 3ATMA 2G52A 1WBGB 1HAPH 1BMFD 2BLQA 4TPIZ 4BTTB 1BBRH 1DXWA 1NESE 5GDSH 4ZKSU 2J2UA 4ZUHA 5C0UA 4Q7XA 2W7SA 1UCYH 2OC1A 1K1IA 1N8OC 2HWLB 1KLIH 5ETXA 3DA9B 1ETSH 1C2FA 4FUEA 1NU7B 1EXFA 2ALVA 1EASA 2WPHS 2QC2A 3WWBA 3KYGA 3Q76A 1FY3A 2GV6A 1GDQA 4XSKU 1ELGA 3M5LA 1ZYOA 2PKAB 3NZIA 3A8DA 1GI2A 2JH6D 1HBTH 3U1JB 3UR6A 1C5ZB 3EQ0H 5BPEA 3HK3B 5A0BA 2F9NA 2WUCA 2VJ1A 5EJLA 2NU0E 2H2ZA 4CR5A 2CHAC 1SI5H 4K60A 4OS2A 1UHBA 2CGAA 3M5OA 4NGAH 2WPMS 1TMBH 3E91A 4CRBA 1UTKA 3AW1A 2VH6A 4JZDH 1C2IA 3ZIAD 3GCHC 1NRRH 1SHHB 4MTBA 3DSOA 4FOUC 3T5FH 2ZU2A 1HDTH 1GBIA 4ISOA 4YXWD 1ELTA 3OU0A 5K0HA 4CRDA 3RXFA 1EOLA 1TBRH 1CA8B 2RFKC 5LGOA 1H9LB 1MCTA 3LT3A 3UNRA 1A0HB 4MQAA 1KY9A 6CHAC 1P2JA 2JJ1D 1J8AA 3Q3KA 1BTWA 1MZDA 2J34A 4P00A 2Z9LA 3VB6A 1GMHG 3UOPA 2ZDNA 1C5OH 1K1PA 1MAYA 3MNCA 5JBTA 5FCRA 4UDWH 3FOAA 7ESTE 3HGNA 2FXRA 4MPXA 4D9QA 1L4ZA 5DO4H 1KDQB 2GZ8A 2PWXA 3MU8A 2WYGA 3F0PA 1L1NA 1QL9A 3LH3A 1ZOMA 5ABWA 4ISNA 1O3OA 1ZGVA 1RJXB 4GCHF 2PSXA 3L6PA 5C3NA 2Z3EA 1SGIB 4A92A 3ZZDA 1XX9A 5EQSA 1KXEA 2H5DA 3GY3A 3ATIA 3P8GA 3QO6A 4CBNA 2A5AA 4AFSA 4LZ4B 1T7CA 1W2KH 2JIZD 4AB8A 4BNRA 3F2FA 2ZHFH 3A7XA 3KF2A 2K1QA 4I32A 3A7TA 1GJ8B 2HRVA 1GMCG 1SGQE 3DCLA 4X6NA 1GI4A 3H7OA 1EATA 3MH4A 1UVPA 4ABAA 4K2YA 2OBQA 3RMOH 3SV8A 5C67A 4JYVH 1GG6C 1AE5A 1DY8A 4X2WA 4O3UA 4YTAA 3TGIE 1TIOA 1JRSA 1ORFA 4MNWA 2XBWA 4A5TS 1EP6A 2A4OA 3I78A 1HAOH 4AN7A 3BEIB 4NFEA 4MNYA 1VZQH 5EQQA 1Q3XA 2VGCB 1B5GH 3TJNA 4FVDA 5GCHG 3RXQA 3TJOA 3SOSA 2ZGCA 1YPLH 2J95A 1TPOA 1P05A 1DWCH 5T1VA 3A81A 1LCYA 4K1SA 3SW2B 1BA8B 1EOJA 4U32A 2GX4A 3TJVA 4YT7H 3S9AA 7GCHF 1ZMJA 2GZ7A 4NIVA 2W6ID 1BTYA 2LNCA 2BXUH 3BTDE 2A31A 1YC0A 1QNJA 4BTIB 2ZCHP 3TH3H 4ACBA 3P70B 5E2PA 5EGMA 1FAXA 1ZRBA 2AIQA 3FVFB 4HI3A 3F0OA 2BD8A 1ID5H 5HXFA 1P8VC 3OAAD 1MBMA 1A46H 3FKSD 1A1RA 1MABB 1OWEA 7LPRA 3RXGA 1GHAF 1C1VH 1EZXC 2PKAA 1VCPA 2A2XH 2Y7ZA 3SHCH 1CVWH 5A8YA 1TBQH 2HVXA 1LHCH 1O2VA 4AORA 1KLTA 1F0RA 5CHAB 5HM2A 1JBUH 2GMTB 2VIPA 1EAUA 4Y71A 3BTME 4AB9A 4CBOA 3GCTF 1O3DA 5DP5A 2BDHA 4AOQA 3LDXH 4ZHAA 5EW1H 2IPQX 2C93B 3RMMH 5EXMA 1DDJA 1XVOA 1O2MA 2D2DA 3RXCA 3ZZ8A 2Y80A 2O8MA 1QBNA 2CF9H 1OYTH 2XTTB 1LHGH 1ARCA 1KXFA 3RUOA 1BRBE 1H8DH 2H6MA 2ZU1A 3QZQA 1DLEA 1NRSH 3BN9A 1K1LA 3RXJA 2A5KA 2VGCC 1TFXA 4NWKA 1GJ6A 2R0KA 4JCNA 3STJA 8KME2 3KQDA 3TK6A 2WSSD 3QLPH 3M35A 4IN1A 3TLOA 3BEUA 3ZYEA 3KQ5A 2WV5A 4MDSA 4ZCNA 1A3EH 1EJAA 1Y3WA 3SV6A 3KHVA 4XFQA 2OINA 5ESBA 1HJAB 1G3CA 1WAYB 3KCGH 1KDQA 4F55A 1H8HD 2QXJA 4ASUD 4BAMB 1LVYA 3PLKA 1W0ZU 2AIPA 4CH8B 2EI7A 4Y7AA 1GCTC 4RN6A 3RM2H 2A0QB 2V3HH 4IMZA 3A7WA 4ACAA 2AS9A 1ELCA 2HLCA 2ALPA 1IQNA 3GOVB 1W11U 5LH8A 1W7GH 1G2MA 2UWLA 3EYDA 4ISIH 5LPRA 1G30B 5GPIB 1DWDH 1FUJA 3A83A 1F5KU 3MHWU 1S6LA 1O3GA 1A5IA 2TRMA 1GJDB 2GMTC 3P92A 5EW2H 1TA6A 1CT4E 4WH6A 1KLJH 1V2MT 3QDZB 4X8VH 1C5QA 1TAWA 3DUXH 3OTJE 3ZZ4A 3SV9A 3WW7A 2SGAA 1GHBG 3ZV9A 2KZ4A 1NFXA 1T4UH 4AYYB 1KXBA 1GI6A 2PTNA 1C5MD 2KR7A 4INKA 4DOQA 1H1BA 2FZZA 2AYWA 2YNBA 1ELDE 5L2YH 2ASUB 3F9FA 3RMLH 1FPHH 1E38B 3BIUH 4PROA 1FY1A 2ZG0H 4X0WU 3PWCA 3SZNA 1UTQA 3U8TH 1YBWA 3EA8A 3RXLA 1CHOG 3UR9A 1IQFA 2V3OH 4Y10E 1YLNA 2ODYB 1C4U2 1BBRE 2K8IA 2NU2E 4KGAA 2ZC9H 1GMDF 1WU1A 1T4VH 1QB6A 3MH6A 3RXHA 1YM0A 2FEQH 1SSXA 1SLVB 2G55A 2PGBB 3KEEA 3P8NA 3NXPA 5GXPA 4KTCA 1SQRA 5EOKA 4FUFA 2VIDA 3CP7A 1SGRE 3E90B 2A7HA 3AVZA 1T8MA 5DN6D 1FX0B 1HJAC 2RDEA 1TGNA 1NC6A 1QTFA 4VGCC 4ZHMU 3RXPA 4R8TB 1SQAA 3P95A 1JIRA 4MG3A 2ZHWH 4F49A 3A7VA 4Y8YA 1HXEH 3ZVGA 3QUMP 1UMAH 2PR3A 1O2JA 3R3GB 2F3CE 4H4FA 4ZMAH 3HKJB 2ZO3H 3LGWA 1C5NH 3E1XB 1ZTKA 4BOHA 3D23A 1D3QB 1TPAE 2FI4E 1FY4A 1P3CA 1VJ9U 3ATLA 2ODQA 4Z0KA 1B7XB 1EZQA 1V2LT 1SOZA 3LGUA 2F9VA 2WZQA 3A85A 5CDFE 3A82A 1Z1JA 2A2QH 3D49H 3T28A 3MOCA 4HTCH 4ASHA 2ANWA 1HUTH 1QR3E 1GBJA 5FPSA 1ZZZA 4YOIA 1HNEE 4RI0A 4IC5A 3ZVAA 1HYLA 3GY8A 5AFZH 5TCAA 4FXGH 1GI3A 4TSFD 1AVXA 4NWLA 3R0FA 3RXBA 3SYJA 1O3FA 1BTPA 5B6OA 1GPZA 3DSGA 1AGJA 1NFWA 4DT4A 1P03A 1RTKA 1A4WH 2VWLA 4ZKRU 1MH0A 1F5RA 1J14A 2G51A 2ZGXH 1FAKH 1XKAC 1P9UA 4BXSA 3UNSA 2VVVA 1UTOA 3DFLA 2Z3DA 5DP4A 2PUQH 1ZTLA 1O2PA 3P8OA 3Q3YA 4FVBA 4X8SH 1BQYA 5A0AE 2ZFFH 1QBVH 1SG8B 2C8WB 4UFGH 2J4IA 1ELAA 1DFPA 2BY7X 1CU1A 3CS7A 3LU9B 3MFJA 2BDBA 4KTUA 3PYHA 2R3UA 1EQ9A 1FV9A 4FUIA 1G36A 4UONA 1YKTA 3ODDA 3K6ZA 2XRCA 1HGTH 3W1EA 1O3AA 2H9EH 2NU1E 2ZEBA 3AK5A 1HIAA 5F8ZA 2BY8X 4DY7B 1P9SA 3WY8A 3SNDA 4M7GA 4A1XA 3F2GA 4ABJA 1A2CH 5F8TA 3H5CB 3FP6E 5C94A 3MMGA 8GCHG 2Z3CA 4IW4E 1XKBC 2BY5X 1BIOA 1N8OB 1TX6A 2H9TH 4ISLA 3BEFB 5J4QA 1KXDA 4R0IA 3OEED 1GDNA 2GCHG 2UUFB 1TX7A 3A86A 3TITA 1C5LH 1YPHC 4FU9A 1UCYK 1D9IA 1SMFE 1SVPA 2LELA 2G4UA 1MKXK 1ZR0A 1IQIA 2PSYA 4BXWA 3ENSB 3LGVA 4IS5A 1FIZA 1Y3XA 3BTEE 3LJOA 3Q77A 4UEHH 2R3YA 1O2XA 4XE4A 5C17A 4X6PA 1GL0E 4B73A 3K6YA 3SO3A 4MPUA 1ZTJA 2O8LA 2VH0A 4UFEH 5DJ7A 1IQHA 1AD8H 1EAWA 2CHAB 1YGCH 2WPKS 2BM2A 2Y5GA 2W5EA 3H09A 2ZP0H 4B74A 1OWKA 3A89A 2XBVA 6GCHF 2A7CA 1TGSZ 1K1JA 2W7UA 4TYDA 2BDCA 2UUKB 1TNKA 1EB1H 2JETC 3RLYH 4NSYA 2RDLA 4Y76A 1O3IA 4D8NA 3F9GA 3GCHB 3N7EA 4JZFH 2IPHA 2FWWA 1GBFA 4RSPA 1LTOA 5DGJA 5T6FA 1LO6A 1WQSA 3MO3A 1ZPBA 2GCTB 3ZZAA 1SFQB 1TLDA 1PPEE 1TBZH 6CHAB 1O31A 2Y5HA 1D3DB 2TBSA 3DHKH 4NCYA 1C1WH 1SHYA 4B6EA 4BTUB 1E0FD 1ZJDA 2O8WA 3RXUA 2J97A 3ITIA 1O5GH 4HG6A 1PJPA 4I8HA 1CE5A 2PHBA 1DT2A 1O5EH 1UTMA 2P59A 9LPRA 3URCA 3AAVA 2NWNA 1QCPA 2SFAA 3MQKC 2O9QA 1BT7A 1YLCA 2CMYA 1MAXA 1DLKB 4YO9A 3SUFA 1O36A 3A8BA 5T6DA 1MKXH 2Q6GA 3HPTB 2ZZUH 3FN8A 3UY9A 3ZVCA 3PV2A 1NROH 2ZDMA 4WWYA 2UWOA 1O2QA 1RXPA 1PPHE 1SL3A 3KIDU 3PLPA 1O2KA 2W6JD 4OGXA 4B76A 1GL1A 1TPPA 1ESAA 4Y6DA 5I25A 1IOEA 1AO5A 5DKMA 3U1IB 1EAXA 1PQ5A 1VITF 4BAHB 1DXPA 5EU8A 2RA3A 1ZHMA 1C1RA 1SGFA 1O3NA 4X6MA 1C5TA 1DICA 1EP5A 2VVUA 2BXTH 3TGJE 2ZFPH 3NKKA 3V12A 1O2OA 2G00A 3EA7A 4LXBH 1A0JA 1SKYE 2KX4A 3ZZCA 2AMDA 2WYJA 1ELVA 3LJJA 4WY3A 1C2MA 4YLUA 1NU9A 1K28D 1RFNA 1GG6B 3BTFE 4H6TA 1MBQA 2BYAX 3SUEA 1TQ7B 1NN6A 1T8NA 5DP6A 1DOJA 5GNDA 1H9HE 1RIWB 4LOYH 1IQGA 4MVNA 4FUDA 1SFIA 4D76A 3FP7E 1OWDA 2BDYA 2GCTC 1FLEE 1GJAB 1QQUA 1SGYE 3RC5A 1MD8A 3FFGA 1TA2A 3SNBA 2WV9A 1MCVA 4B2AA 2SNVA 3VEQB 2O8TA 3TPIZ 3O8RA 3SJIA 1P2MA 1LPZB 1O2SA 1SGPE 3HGPA 1A7SA 1UW7A 2PP6A 3GY4A 1YWUA 1QIXB 1UVUH 1VR1H 1G3EA 4NG9H 1Y5UT 3A8AA 2GD4B 4GSOA 1OXGA 5DP3A 1C5PA 2XNIA
chains in the Genus database with same CATH topology
4B6EA 2JDID 3F2HA 4Q63A 1WXRA 4JMYA 3M5NA 2O8MA 3WWBA 2JIZD 2P59A 3OE7D 2F43B 1CU1A 3GS9A 3M5LA 3SU5A 3F2FA 5FPTA 2AHME 2XCFA 4FETA 2K8IA 2YMSD 3KF2A 2M2AA 2K1QA 4I32A 4A1TA 3U1JB 1BT7A 5EQRA 3DCLA 2QF5A 4K8BA 3KNXA 3SUFA 3LONA 2L6OA 3KEEA 3W1EA 1RTLA 3SU6A 5IK2D 3LOXA 3SU2A 3P8NA 3AK5A 3SUGA 2KM0A 2OBQA 1H8ED 2OBOA 4Q4LA 3SV8A 2XCNA 4KTCA 2QE7D 3FN8A 4I31A 3PV2A 4A1XA 3F2GA 1DY8A 1DY9A 3E90B 5C0TA 4NWKA 5DN6D 1NBMD 1FX0B 1RGQA 3NRLA 1COWD 4A1VA 3M5OA 2WSSD 2J5UA 2A4QA 3SV7A 5EPNA 3DSPA 1E1QD 2YMSB 3SU4A 4R8TB 2W6JD 3WWFA 5CHBA 4B75A 3OEHD 4B76A 3O8BA 2FM2A 5EQQA 3VG8A 3UB0A 4ZCNA 3ZIAD 4B71A 5F53A 3SU1A 3DSOA 3SV6A 2GGVB 3OEED 2FOMB 3U1IB 4YXWD 3FO8D 2OINA 5ESBA 3F3BA 5B6LA 3PRBA 1DXPA 4WH8A 2LELA 5T1VA 5H4IB 2KCYA 2IJD1 4F55A 3SU3A 1H8HD 1EFRD 2HLDD 3PRDA 4OM9A 1W0KD 4ASUD 3LKWA 2WPDD 2OC7A 5HKKD 2CK3D 2W6ID 5FL7D 2KFWA 1W3CA 1SKYE 2F9VA 2JJ1D 2F4LA 2WZQA 3KN2A 4WF8A 4B73A 5C17A 5CDFE 2A4RA 3O8DA 3OFND 3N7DA 2KCPA 2F9UA 2XNDD 2FP7B 3PV5A 3RC4A 3RC6A 4Z1MD 3EYDA 3H09A 2KCOA 3SUEA 5GPIB 4B74A 5FPSA 3FOAA 3N99A 5GNDA 3OTPA 4RI0A 4TYDA 4XD7D 5IDKA 3F0OA 1S6LA 3SZEA 4M9FA 4I33A 3SU0A 2IJOB 2QF4A 3OAAD 5DSFA 4TSFD 3F0PA 4NWLA 1NBME 2VBCA 3FKSD 1A1RA 4WH6A 1W0JD 1OHHD 3SYJA 1MABB 2OK5A 3RC5A 2GVFA 2WHXA 3N7EA 3OYPA 1JXPA 2WV9A 1E1RD 3SUDA 4DT4A 1BMFD 3SV9A 4U01A 4B6FA 3L6PA 3WW7A 2QV1A 2XOKD 1E79D 2YOLA 1DXWA 2JJ2D 1KMHB 2KZ4A 4A92A 3O8RA 2A4GA 3M5MA 2OC0A 2YMSC 5EQSA 5C0UA 2KR7A 5EPYA 2OC1A 5FPYA 5GJ4B 2OC8A 1NS3A 2V7QD 1N1LA 5ETXA 3P8OA 4TT3D 2KCAA 3O8CA 2XNIA 2K0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C17 A;  3F2G A;  5DSF A;  5C0T A;  3F2H A;  3F2F A;  3F0P A;  5C0U A;  3F0O A;  3FN8 A; 
#chains in the Genus database with same CATH topology
 4NZQ A;  1P2I A;  1BRU P;  2BOH B;  2WPJ S;  1HXF H;  5E0G A;  3M5N A;  1OOK B;  1C1S A;  1RRK A;  1YP9 A;  4FET A;  1GBM A;  1WYK A;  3B23 B;  5C5O A;  1MUE B;  3KL6 A;  1GCD A;  3ZZ6 A;  1SLU B;  4AFQ A;  1O3J A;  1TRM A;  1T32 A;  2F9P A;  2QY0 B;  1DS2 E;  5FCK A;  1E36 B;  1QFK H;  2V0B A;  2FI3 E;  1GMC F;  2W3I A;  3I29 A;  5C0T A;  1MZA A;  4BAO B;  4A1V A;  4NIY A;  1MKW K;  1V2S T;  1WSS H;  1Y3Y A;  2WUB A;  1MU6 B;  2RG3 A;  2G81 E;  1ELF A;  1D3P B;  1GBL A;  2AGE X;  4IBL H;  3UB0 A;  4B71 A;  4AGK A;  2F9O A;  2GGV B;  3V7T A;  4D7G A;  1FY5 A;  4HGC A;  3SGA E;  3EA9 A;  2UWP A;  2ZF0 H;  4K1T A;  3LH1 A;  4GCH G;  1ACB E;  4UE7 H;  5GCH F;  3CNR A;  2BLV A;  2ZNK H;  1CHG A;  4E7N A;  5KEC A;  1RIW C;  2FX4 A;  1Y5B T;  4MNV A;  2F4L A;  1Z8J B;  3AAU A;  2UUY A;  3IWM A;  2FES H;  1GBT A;  4X1R U;  4DII H;  1O3L A;  2XC4 A;  1K2I 1;  5FBE A;  1TMU H;  5AF9 H;  1C2K A;  2QN5 T;  2YNA A;  2DE8 A;  1O35 A;  1Y5A T;  1S82 A;  4AFU A;  1BJV A;  2IJO B;  1Z71 A;  4ABH A;  1BUI A;  3TIU A;  1UVO A;  4YZU A;  4DIH H;  1TOM H;  2BB4 A;  2AMQ A;  3ZVE A;  3RXM A;  2OK5 A;  1AN1 E;  1G32 B;  4XDE A;  4I8L A;  1LQE A;  1RTF B;  1BIT A;  5L6N H;  2ZGB H;  3I77 A;  3E8L A;  1GBA A;  2JJ2 D;  5E0H A;  1O2G H;  2ZU3 A;  3AAS A;  3IIT A;  3F6U H;  1FMG A;  1GCT B;  1KSN A;  2BMG B;  1J17 T;  1Z7K A;  1SLW B;  3S69 A;  1GI7 B;  5T6G A;  1EB2 A;  1MTS A;  1O3C A;  2C8Y B;  4ZKN U;  1MKW H;  4TY7 A;  1AVW A;  2XBX A;  2J94 A;  1YLD A;  1Z1I A;  2AHM E;  4IC6 A;  1XUF A;  4GVU A;  3NPS A;  5A8Z A;  1O2Y A;  4K8B A;  3V3M A;  2CV3 A;  1ZML A;  1QBO A;  1V2W T;  2V35 A;  1SB1 H;  3P8F A;  1WQV H;  1EZU C;  5I46 H;  1WUN H;  1SGF G;  1KTS B;  1UK3 A;  3RLW H;  1UJ1 A;  2ZKS A;  2HNT C;  1C5V A;  2ZI2 H;  3QGJ A;  2ZPQ A;  3NCL A;  1COW D;  1O5C B;  4K69 A;  1BJU A;  3FZZ A;  3SNE A;  2P3T B;  1BTH H;  1XUH A;  5EPN A;  5TJX A;  2A7J A;  1WOF A;  2BLW A;  3M61 U;  2FOM B;  1DE7 H;  2BHG A;  4D7F A;  1TON A;  1YPK H;  5B6L A;  3GIS B;  4NA7 A;  4WH8 A;  3UUZ A;  1GI1 A;  3MU5 A;  3PRD A;  4Z6A H;  2BDI A;  1W0K D;  4OS5 A;  5F8X A;  1ABJ H;  1F2S E;  2P3F H;  2SGQ E;  1YCP H;  1BOQ A;  1O3M A;  2ZDA H;  2BZA A;  2DE9 A;  3SQH E;  1ZLR A;  2SGP E;  3ZV8 A;  4P02 A;  2XWB I;  5DP8 A;  3ZZ9 A;  3PMJ A;  1AUT C;  4O3T A;  1ELB A;  1UTL M;  1HAI H;  1T8L A;  3A87 A;  1Z8R A;  1QY6 A;  1W13 U;  5J4S A;  5JYI A;  2ZIQ H;  4J1Y A;  4DGJ A;  4VGC B;  2P8O C;  4I86 A;  1HIA B;  1WTH D;  4MLF B;  3VXF H;  5FAH A;  4RKO B;  5EJZ A;  1J9C H;  1G3D A;  1W0J D;  2J9N A;  3RXR A;  3GCO A;  3DD2 H;  3EST A;  3QTV H;  1EPT C;  4O03 A;  5PTP A;  2QCY A;  3SUD A;  4U01 A;  4Q80 A;  1BDA A;  1E79 D;  3ZZ3 A;  2YOL A;  2Z9G A;  3AW0 A;  5A8X A;  1C5X B;  2P3U B;  2YMS C;  1GJB B;  5FXL A;  5FPY A;  2I6Q A;  1NS3 A;  2B7D H;  4Q7Z A;  5FBI A;  4FUC A;  3TGK E;  1NT1 A;  3O8C A;  5FHT A;  1GJC B;  2ZCK P;  3ODF A;  4Q63 A;  1FPC H;  1TOC B;  4JMY A;  4K8Y A;  2G5V A;  4WMD A;  1YY3 A;  2BOK A;  2FLR H;  2R2W U;  4I7Y H;  2GDD A;  2YMS D;  1E34 B;  5FX5 A;  4X6O A;  1HPG A;  1JOU B;  1CHO F;  6EST A;  5KED A;  2AGG X;  3MH5 A;  4HZH A;  5IK2 D;  2ZA5 A;  1C4V 2;  2RA0 A;  1LHD H;  2A5I A;  3LC5 A;  3SN8 A;  1MTV A;  1GI0 A;  1LPK B;  2ULL A;  3GDU A;  3NK8 A;  3URE A;  2BZ6 H;  2GJG A;  4I31 A;  2G4T A;  4BAN B;  1HJ9 A;  1NFY A;  3A7Z A;  1V6D A;  1HB0 B;  2W3K A;  3UAI C;  3SV7 A;  2BY6 X;  1W0Y H;  3SU4 A;  2H1U A;  1ELE E;  1IHS H;  1P0S H;  1VGC C;  4DJZ B;  2VWN A;  1XXF A;  3GDS A;  1FN8 A;  4ABI A;  3C1K A;  3FAN A;  2ZEC A;  4HFP B;  1LKB A;  4CHA C;  4FUG A;  1GBH A;  3OX7 U;  1UCY E;  2W26 A;  1C5R A;  1BMN H;  1SBW A;  2I6S A;  3B8J A;  4CRA A;  1AQ7 A;  3BG8 A;  3S9B A;  1LHE H;  1KXC A;  3M36 A;  5HYO A;  1EFR D;  1C1M A;  4ABG A;  4RT1 A;  1AIX H;  2FDA A;  2PGQ B;  1TNJ A;  4ABF A;  1L0Z A;  1LVM A;  3K2U A;  1SPJ A;  1NRN H;  4ZXX H;  4WF8 A;  3RXS A;  2FMJ A;  1LQD B;  4X2X A;  2BTC E;  2ZGH A;  3N7D A;  1AUJ A;  4GLY A;  1NY2 2;  3UQO A;  3BTK E;  1K22 H;  1RS0 A;  1EPT A;  1ETR H;  1AFE H;  1CBW C;  2VVC A;  2ZFS A;  4ZHL U;  1CT2 E;  4I33 A;  1MTW A;  3L33 A;  4CH2 B;  1TNG A;  1NBM E;  1GMD G;  2VBC A;  3M3V A;  1M9U A;  2GP9 B;  3VGC B;  1TPS A;  1F0U A;  3GYM A;  2XW9 A;  2VU8 E;  4B6F A;  3LGY A;  1BRA A;  1A61 H;  2XOK D;  1WTG H;  1GHY H;  4NA8 A;  5EIY A;  3M5M A;  5JBA S;  3SV2 H;  1C2J A;  2QF0 A;  2FPZ A;  3U98 H;  1F5L A;  5EG4 A;  2AFQ B;  2G5N A;  1GBB A;  4LZ1 H;  2OQU A;  5FPT A;  4OGY A;  1F7Z A;  1SLX B;  1YF4 A;  2GDE H;  1BHX F;  1FON A;  4MPW A;  4F48 B;  1IQJ A;  1LMW B;  1C1T A;  1TRN A;  1DWE H;  3RP2 A;  1SOT A;  2BD3 A;  1GVZ A;  4AG1 A;  1HJ8 A;  2J92 A;  1A3B H;  3LIW A;  3A88 A;  1SC8 U;  1O3E A;  4FUB A;  2JET B;  1X7A C;  1TB6 H;  4BAQ B;  1INC A;  3LON A;  1FIW A;  4KKD A;  4DCD A;  1GI8 B;  4XBC A;  1E37 B;  2RCE A;  5SGA E;  1THP B;  4INL A;  3TJU A;  2WPL S;  1O37 A;  4X1N U;  1SGD E;  5CHB A;  1P2O A;  3PLB A;  3LGT A;  2OUA A;  3P6Z B;  3VB5 A;  2Y6T A;  3E0P B;  2B8O H;  2FTL E;  3S7K B;  1YYY 1;  1S83 A;  2CJI A;  1C5U A;  3A7Y A;  4THN H;  1C2E A;  3BIV H;  4NSV A;  2BDA A;  2FS8 A;  4NZL A;  1EAI A;  2KCY A;  3PTB A;  4Y0Y E;  2C8X B;  1TNI A;  2SNW A;  1SQO A;  2AEI H;  2Z9K A;  2IOT A;  3V0X A;  1N6X A;  1PQ8 A;  5HM9 A;  3UTU H;  2HPP H;  1ZHP A;  1LVO A;  1C2G A;  1W12 U;  1ZPC A;  3RU4 T;  1VIT H;  3PV5 A;  1BB0 B;  3B9F H;  3VGC C;  1O30 A;  2LPR A;  3CEN A;  3N99 A;  3E16 B;  1S5S A;  5IDK A;  1G37 A;  3SOR A;  3SQE E;  3RM0 H;  1A5G H;  2QXH A;  1P06 A;  2QF4 A;  1OKX A;  4ISH H;  3PV4 A;  3RXI A;  5LPE A;  1QJ6 B;  2WHX A;  1C9T A;  2VIW A;  2FYQ A;  2JKH A;  3PO1 C;  4DW2 U;  1GBD A;  1E1R D;  3MI4 A;  2R0L A;  1O2N A;  1GBE A;  1AKS A;  1BMA A;  3MNX A;  1JIM A;  2A4G A;  4GUX A;  5K7R A;  5GJ4 B;  1O2U A;  2A32 A;  1O5F H;  1P04 A;  1K0H A;  1ZMN A;  2L74 A;  4WME A;  1V2J T;  2EI6 A;  4ZKO U;  5A0C A;  5JB8 S;  1P02 A;  1HAV B;  2UUJ B;  4WVP E;  3T27 A;  2VIQ A;  2Z6B D;  2C8Z B;  1S6H A;  2ZPR A;  1HAH H;  1P2Q A;  1ZJK A;  3RXE A;  3VPK A;  1G9I E;  2WV4 A;  2ZDL A;  3RXK A;  2HAL A;  1O2W A;  3EDX B;  3VB7 A;  2ZU5 A;  3LOX A;  3E6P H;  1PQ7 A;  2QGR A;  2KM0 A;  2PW8 H;  3GY5 A;  2ILN A;  1V2U T;  1HCG A;  2OCV B;  5G4B A;  3M7U A;  5EST E;  1NRQ H;  3TNT A;  2Q6D A;  1D6R A;  1Y59 T;  3E0N B;  5FX6 A;  1TE0 A;  2FLB H;  3PMB B;  1Y8T A;  3M3S A;  1N6Y A;  3PTN A;  2D26 C;  4X8T H;  3QGN B;  1ANE A;  4BAK B;  3Q3X A;  4Y8Z A;  1JWT A;  1HAZ B;  1F92 A;  4ABE A;  1H8I H;  1BZX E;  4B2C A;  1OP8 A;  5EJ1 A;  3PRB A;  3SGQ E;  1RD3 B;  1AZ8 A;  3BTQ E;  3PM3 A;  1DM4 B;  3KQB A;  3SU3 A;  1HFD A;  3K65 B;  2Q6F A;  3PMH B;  5CMX H;  2HOB A;  5EXL A;  3HKI B;  1TGB A;  3BG4 C;  1OX1 A;  2ZCL P;  3GY6 A;  1K1N A;  3KN2 A;  1V2N T;  2TPI Z;  3OY6 U;  1EUF A;  2F9U A;  2XND D;  5DPA A;  1OP0 A;  2OLG A;  2VIN A;  1NPM A;  1XM1 A;  1YPM H;  3UQV A;  4AZ2 B;  1AVG H;  1THS H;  3E3T A;  4K5Z A;  1LPG B;  1EZS C;  4OS6 A;  3ATW A;  2P93 A;  1L4D A;  3SU0 A;  1EJN A;  2ZFR H;  1D3T B;  4LK4 A;  2QF3 A;  2ZHQ H;  1P01 A;  2ZWL H;  4XBB A;  3EAJ A;  3OYP A;  2FOC A;  1G2L A;  1O2H A;  3F1S B;  1AWF H;  1CGH A;  3F9E A;  3GY7 A;  5AHG H;  1GGD C;  4J2Y B;  1UVS H;  1KMH B;  4GHT A;  3SBK A;  1MQ5 A;  1E35 B;  1V2O T;  3QTO H;  3TU7 H;  1GJ9 B;  1MTN B;  1QJ7 B;  2TGP Z;  1YPE H;  1AFQ B;  4NIX A;  2VB0 A;  2P16 A;  1GMH F;  1TGC A;  3P17 H;  5IYT A;  3RXO A;  2OD3 B;  1MD7 A;  2Z94 A;  2K0Q A;  3EGK H;  4INH A;  3F2H A;  2OTV A;  3D65 E;  1S84 A;  1U6Q A;  1NFU A;  1G3B A;  4H6S B;  2Y81 A;  1VIT G;  3MU0 A;  3VFE A;  3LPR A;  3MO6 A;  1QUR H;  3D62 A;  4AGJ A;  1K9O E;  2M2A A;  1XUI A;  4X1Q U;  5E2O A;  4UFD H;  3SJO A;  1O2T A;  1BHX B;  2L6O A;  1O2I A;  1VJA U;  1S85 A;  1CA0 C;  1S0Q A;  5F6M A;  3HAT H;  1MU8 B;  1T8O A;  3TNS A;  1EST A;  2STB E;  2ZFQ H;  3MU4 A;  3IG6 B;  3MH7 A;  3RU4 D;  1UTJ A;  1SGN E;  2CXV A;  8EST E;  2J5U A;  1HAG E;  1C9P A;  1KXA A;  2BX3 A;  3F9H A;  2JH0 D;  4Y8X A;  4CRF A;  4YM9 A;  1OWI A;  1TQ0 B;  2BQW B;  4XOJ A;  1QHR B;  1F0S A;  2PKS C;  4GAW A;  4Y0Z E;  1P2K A;  2EY4 C;  1TWX B;  5C1X A;  2J38 A;  2GTB A;  1GDU A;  1Z8G A;  2HLD D;  4SGA E;  1AI8 H;  1BTZ A;  4DVA U;  1VCQ A;  3TK9 A;  2F9B H;  1C2D A;  4ZH8 A;  1CGJ E;  3U28 C;  4YOJ A;  1W3C A;  1C1O A;  5AVD A;  4EST E;  3M7Q A;  3MTY A;  1ANC A;  2A4R A;  3O8D A;  3PMA B;  1ETT H;  1ZSK A;  2IN2 A;  1B0E A;  3BTG E;  1GWA A;  1BML A;  2FOB A;  3ATK A;  1XUG A;  3SNA A;  3MNB A;  1B0F A;  2F83 A;  3M7T A;  1CQQ A;  2HNT E;  2VWM A;  2XYA A;  2EA3 A;  4B1T A;  1HAV A;  3SZE A;  3GDV A;  2GT8 A;  4SGB E;  3QWC H;  3EE0 B;  1MTN C;  3RXA A;  1YCP M;  3URD A;  1P57 B;  1C1Q A;  1AFQ C;  1L1G A;  1O38 A;  2R2M B;  1XVM A;  3T2N A;  3U8R H;  1LVB A;  1QGF A;  4K3J A;  2QV1 A;  4RKJ B;  4F4O C;  2B9L A;  4Y7B A;  2OC8 A;  3UOU A;  1H4W A;  1C5Y B;  1P2N A;  2GKV E;  2EQN A;  2P94 A;  2C90 B;  3ZVD A;  3TH2 H;  3PRO A;  3UPE A;  1GI5 A;  1LKA A;  1Z6E A;  3UNQ A;  2BQ7 B;  3MU1 A;  4YLQ H;  3W95 A;  3FZD A;  1QA7 A;  1YCP K;  2M5T A;  1KTT B;  1HAY B;  1DAN H;  4ABB A;  3SU5 A;  2OXS A;  5CE1 A;  2V3M A;  4D9R A;  1D6W A;  1ZSL A;  2DUC A;  2Q1J A;  5EQR A;  1V2R T;  2P8O B;  1UK2 A;  4Q2K A;  5C1U A;  1FY8 E;  1DUA A;  3SUG A;  1O0D H;  2HVY B;  2XCN A;  1EPT B;  4E06 H;  3FAO A;  3SHA H;  4E7R G;  2Y82 A;  3NUM A;  3QK1 A;  3SJ9 A;  1DY9 A;  1GHX H;  4X8U H;  3T29 A;  3GYL B;  1TX8 A;  3QZR A;  2FOF A;  1WV7 H;  4KTS A;  1CO7 E;  2YMS B;  4YOG A;  2TGT A;  2ZHE H;  1GBK A;  1LHF H;  2STA E;  3UWI A;  3VG8 A;  1XUK A;  3S9C A;  5E8E H;  4A7I B;  4OS1 A;  1Z6J H;  1NZQ H;  5GIB A;  4KP0 A;  3F3B A;  7GCH G;  2ZGJ A;  1P10 A;  2C4F H;  7KME H;  2HPQ H;  1S6F A;  2EEK A;  2ZDV H;  3LKW A;  3SNC A;  3W94 A;  3U9A H;  2FS9 A;  1Q31 A;  1NO9 H;  3BTH E;  1SGC A;  2BVS H;  5T3H A;  3TVJ B;  1C5S A;  5GWZ A;  1O3B A;  2J98 B;  1EJM A;  1C2H A;  2FOA A;  2CF8 H;  3JZ2 B;  3VB3 A;  4X1P U;  4AFZ A;  3RXV A;  1IHT H;  4ZRO A;  3S0N A;  1GHA G;  1DSU A;  1D4P B;  4DT7 B;  1GJ4 H;  1JRT A;  4ZAE A;  1TGT A;  1VGC B;  5KGO A;  3FP8 E;  2SGF E;  2QYI A;  3EE7 A;  2BVR H;  2Y5F A;  3SJK A;  4CHA B;  1BTU A;  3NWU A;  2SGD E;  4MPV A;  2OQ5 A;  3ZVB A;  2Z9J A;  1GVK B;  1FJS A;  1PPF E;  5C5N A;  4CRC A;  1TAL A;  4Y79 A;  2QXI A;  1QB9 A;  1ABI H;  4TWW A;  3GCT G;  4YT6 H;  9EST A;  1UVT H;  1ANB A;  1TNL A;  2XBY A;  4H42 U;  3RXT A;  2BDG A;  1NTP A;  3KYF A;  4OS4 A;  5EPY A;  1QA0 A;  2ZU4 A;  1QL7 A;  1VKY A;  3RXD A;  3LC3 A;  1NRP H;  2FIR H;  1ZPZ A;  2EI8 A;  4DUR A;  5DP9 A;  1WDI A;  2EC9 H;  2ZPS A;  3UFA A;  3TK5 A;  4I8J A;  1DST A;  3JZ1 B;  3N7O A;  1WXR A;  1GHW H;  1W8B H;  1A0L A;  5E0J A;  4GHQ A;  1Z8I B;  4XBD A;  1AMH A;  6LPR A;  2B5T B;  2XCF A;  2QA9 E;  4K1E A;  1K21 H;  1CSO E;  1CBW B;  1KIG H;  1Y3V A;  2VIV A;  2BLO A;  4A1T A;  2G8T A;  1V2V T;  3KNX A;  3OSY A;  5C2Z A;  1PPG E;  1L1J A;  3F68 H;  5L2Z H;  1H8E D;  3VXE H;  2LP6 A;  3H7T A;  1FZZ A;  2P95 A;  1ESB A;  1GHB F;  4IGD A;  3Q00 A;  4JYU H;  5EOD A;  3OY5 U;  1W10 U;  3BSQ A;  1OWJ A;  4CRE A;  1OP2 A;  3STI A;  3NRL A;  3ZZ5 A;  1GI9 B;  1OWH A;  2VIO A;  2A4Q A;  3T26 A;  2ZTX A;  1AWH B;  4U30 A;  3WWF A;  4B75 A;  3BTW E;  2ZTZ A;  1T31 A;  4UD9 H;  2PUX B;  2FM2 A;  3ZYD A;  5F53 A;  1TAB E;  1IQL A;  1PPC E;  1Q2W A;  2BD4 A;  4O97 A;  4U2W A;  1AKS B;  1QJ1 B;  4JZI A;  2WPI S;  4WXI A;  1HRT H;  1V2Q T;  2KAI B;  1UK4 A;  4NA9 H;  2ZQ1 A;  1DUE A;  4A6L A;  5CHA C;  1ZHR A;  1OS8 A;  2IJD 1;  4CR9 A;  5JB9 S;  5HIY A;  1K1O A;  2WPD D;  2Z7F E;  3TH4 H;  1AE8 H;  3A8C A;  4I8K A;  2CK3 D;  5C20 A;  1TRY A;  3RDZ A;  1CT0 E;  2OP9 A;  4TPY A;  3M37 A;  3QX5 H;  3OFN D;  1O34 A;  1TNH A;  1BMM H;  3ZVF A;  3RC4 A;  1W14 U;  2AH4 X;  1FI8 A;  4Q7Y A;  1WCZ A;  4NIW A;  2FX6 A;  1SR5 C;  3BTT E;  3CS0 A;  3OTP A;  4RT0 A;  1O2R A;  2GV7 A;  2XC0 A;  4UFF H;  4GPG A;  1LDT T;  1P09 A;  1OHH D;  1QRX A;  2GVF A;  1O3H A;  1TYN A;  2BX4 A;  2Z9I A;  1JXP A;  2ZDK A;  2B0F A;  1FXY A;  2QAA A;  2GZ9 A;  2AGI X;  1J16 A;  2FTM A;  2NU3 E;  4JZ1 A;  3BF6 H;  2ANY A;  2O8U A;  1MTU A;  1P11 E;  1FDP A;  1EKB B;  1L2E A;  2EST E;  1QRW A;  1MQ6 A;  5F03 A;  3ZZ7 A;  2V7Q D;  2AER H;  1QQ4 A;  2CN0 H;  2KCA A;  1KYN A;  1DWB H;  4X2V A;  3V13 A;  4KEL A;  4ZXY H;  3M3T A;  1ZSJ A;  3OE7 D;  2F43 B;  3U69 H;  3A84 A;  4FU7 A;  1BTX A;  1C1N A;  1SGE E;  3DT0 H;  1W7X H;  2BQ6 B;  3ELA H;  1DPO A;  2QXG A;  1JMO H;  1YPH E;  5BRR E;  1OSS A;  2ODP A;  2FYR A;  4YES B;  3G01 A;  3PB1 E;  3SU2 A;  1C2L A;  3S7H B;  2JH5 D;  3PO1 B;  1AND A;  2QE7 D;  1NM6 A;  1PPB H;  1YPG H;  1O33 A;  1ZGI A;  2BD2 A;  5AFY H;  3K9X B;  1CGI E;  1O3K A;  1THR H;  3A80 A;  1HV7 A;  1QRZ A;  2HGT H;  2QIQ A;  2XWA A;  3U8O H;  1FQ3 A;  2J98 A;  3OEH D;  4AG2 A;  3BV9 B;  1QZ8 A;  5JDU B;  2GT7 A;  1UTP A;  3SU1 A;  4IN2 A;  2XXL A;  3FO8 D;  2FOE A;  1ZRK A;  1QB1 A;  8LPR A;  5H4I B;  4WMF A;  1OYQ A;  4XRN A;  4OM9 A;  4IMQ A;  4MNX A;  1P3E A;  2BD5 A;  1BCU H;  1ARB A;  5JPM H;  1C1U H;  2OC7 A;  4TWY A;  5HKK D;  2BD9 A;  1H9I E;  2FOH A;  2ZHD A;  1Y3U A;  1UHB B;  5FL7 D;  2KFW A;  1IQK A;  2XC5 A;  4TY6 A;  2F91 A;  4AC9 A;  2D8W A;  5JBB S;  8GCH F;  3KGP A;  2BD7 A;  1AU8 A;  4CRG A;  4E05 H;  2A45 B;  3RC6 A;  4Z1M D;  1PYT C;  1PFX C;  1AB9 B;  3HK6 B;  3T62 A;  2VNT A;  1A5H A;  5HMA A;  2AMP A;  2BVX H;  4X1S U;  4WXV A;  1EX3 A;  2PLX A;  4I8G A;  5L30 H;  1HAX B;  2ANK H;  2GCH F;  5DSF A;  1O2Z A;  4FUH A;  2ZTY A;  1UO6 A;  2PTC E;  2FOG A;  2SGE E;  2TGA A;  3C27 B;  2WIN I;  1BRC E;  2ZFT A;  1PYT D;  2Y7X A;  1O5D H;  5TCC A;  1SQT A;  2OC0 A;  1K1M A;  3BG4 B;  1N1L A;  1XMN B;  4TT3 D;  1TMT H;  2NU4 E;  5LPF A;  1IAU A;  2HNT F;  2JDI D;  4NFF A;  3SI3 H;  1PQA A;  5A09 A;  3QN7 A;  2TIO A;  3UIR A;  1S0R A;  5EXN A;  1VCW A;  3LGI A;  3MNS A;  4DG4 A;  2TGD A;  3GS9 A;  1O2L A;  3KQC A;  1DIT H;  2FOD A;  1O5A B;  1F0T A;  1V2K T;  4FUJ A;  1BBR K;  1GBC A;  2QF5 A;  5C1Y A;  1V2T T;  2KAI A;  5HGG A;  5JBC S;  2V6N A;  4Y11 E;  3MYW A;  1RTL A;  1O5B B;  3SU6 A;  1GHV H;  2OBO A;  4JZE H;  4Q4L A;  1AY6 H;  5DG6 A;  4X2Y A;  1GJ7 B;  1IQE A;  1NBM D;  1RGQ A;  2ANM H;  3ZZB A;  5DP7 A;  1GGD B;  3T25 A;  3DSP A;  1E1Q D;  3MO9 A;  2THF B;  1P12 E;  3O8B A;  3VB4 A;  3L3T A;  1MMJ N;  1C4Y 2;  3GIC B;  5A2M H;  1FNI A;  1C1P A;  2D1J A;  2ZQ2 A;  3GY2 A;  4ABD A;  1YPJ H;  1O3P B;  1FN6 A;  4JYT A;  1V3X A;  1OPH B;  3DFJ A;  3SGB E;  1XXD A;  1SGT A;  1AZZ A;  2A1D B;  5HIZ A;  2FI5 E;  3KQE A;  4JK5 A;  1DX5 M;  3RU4 E;  1QL8 A;  1GJ5 H;  4AX9 H;  3GCN A;  1AB9 C;  1O39 A;  1O32 A;  4OS7 A;  1AHT H;  3RMN H;  1UTN A;  6GCH G;  3SJ8 A;  2C3S A;  1CA0 B;  2KCP A;  2PV9 B;  1GVL A;  2FP7 B;  2R9P A;  2FO9 A;  4FU8 A;  1S81 A;  2BY9 X;  2KCO A;  3PWB A;  4JK6 A;  2H5C A;  2PFE A;  1GHZ A;  1HLT H;  4B2B A;  2H9H A;  4XD7 D;  1DVA H;  4O9V A;  3UWJ H;  4M9F A;  4AYV B;  4QT8 C;  3SI4 H;  4WJG 2;  3MWI U;  5DK1 A;  1PPZ A;  1V2P T;  1IQM A;  1J15 A;  2PKS B;  1XUJ A;  1C5W B;  2VWO A;  3ATM A;  2G52 A;  1WBG B;  1HAP H;  1BMF D;  2BLQ A;  4TPI Z;  4BTT B;  1BBR H;  1DXW A;  1NES E;  5GDS H;  4ZKS U;  2J2U A;  4ZUH A;  5C0U A;  4Q7X A;  2W7S A;  1UCY H;  2OC1 A;  1K1I A;  1N8O C;  2HWL B;  1KLI H;  5ETX A;  3DA9 B;  1ETS H;  1C2F A;  4FUE A;  1NU7 B;  1EXF A;  2ALV A;  1EAS A;  2WPH S;  2QC2 A;  3WWB A;  3KYG A;  3Q76 A;  1FY3 A;  2GV6 A;  1GDQ A;  4XSK U;  1ELG A;  3M5L A;  1ZYO A;  2PKA B;  3NZI A;  3A8D A;  1GI2 A;  2JH6 D;  1HBT H;  3U1J B;  3UR6 A;  1C5Z B;  3EQ0 H;  5BPE A;  3HK3 B;  5A0B A;  2F9N A;  2WUC A;  2VJ1 A;  5EJL A;  2NU0 E;  2H2Z A;  4CR5 A;  2CHA C;  1SI5 H;  4K60 A;  4OS2 A;  1UHB A;  2CGA A;  3M5O A;  4NGA H;  2WPM S;  1TMB H;  3E91 A;  4CRB A;  1UTK A;  3AW1 A;  2VH6 A;  4JZD H;  1C2I A;  3ZIA D;  3GCH C;  1NRR H;  1SHH B;  4MTB A;  3DSO A;  4FOU C;  3T5F H;  2ZU2 A;  1HDT H;  1GBI A;  4ISO A;  4YXW D;  1ELT A;  3OU0 A;  5K0H A;  4CRD A;  3RXF A;  1EOL A;  1TBR H;  1CA8 B;  2RFK C;  5LGO A;  1H9L B;  1MCT A;  3LT3 A;  3UNR A;  1A0H B;  4MQA A;  1KY9 A;  6CHA C;  1P2J A;  2JJ1 D;  1J8A A;  3Q3K A;  1BTW A;  1MZD A;  2J34 A;  4P00 A;  2Z9L A;  3VB6 A;  1GMH G;  3UOP A;  2ZDN A;  1C5O H;  1K1P A;  1MAY A;  3MNC A;  5JBT A;  5FCR A;  4UDW H;  3FOA A;  7EST E;  3HGN A;  2FXR A;  4MPX A;  4D9Q A;  1L4Z A;  5DO4 H;  1KDQ B;  2GZ8 A;  2PWX A;  3MU8 A;  2WYG A;  3F0P A;  1L1N A;  1QL9 A;  3LH3 A;  1ZOM A;  5ABW A;  4ISN A;  1O3O A;  1ZGV A;  1RJX B;  4GCH F;  2PSX A;  3L6P A;  5C3N A;  2Z3E A;  1SGI B;  4A92 A;  3ZZD A;  1XX9 A;  5EQS A;  1KXE A;  2H5D A;  3GY3 A;  3ATI A;  3P8G A;  3QO6 A;  4CBN A;  2A5A A;  4AFS A;  4LZ4 B;  1T7C A;  1W2K H;  2JIZ D;  4AB8 A;  4BNR A;  3F2F A;  2ZHF H;  3A7X A;  3KF2 A;  2K1Q A;  4I32 A;  3A7T A;  1GJ8 B;  2HRV A;  1GMC G;  1SGQ E;  3DCL A;  4X6N A;  1GI4 A;  3H7O A;  1EAT A;  3MH4 A;  1UVP A;  4ABA A;  4K2Y A;  2OBQ A;  3RMO H;  3SV8 A;  5C67 A;  4JYV H;  1GG6 C;  1AE5 A;  1DY8 A;  4X2W A;  4O3U A;  4YTA A;  3TGI E;  1TIO A;  1JRS A;  1ORF A;  4MNW A;  2XBW A;  4A5T S;  1EP6 A;  2A4O A;  3I78 A;  1HAO H;  4AN7 A;  3BEI B;  4NFE A;  4MNY A;  1VZQ H;  5EQQ A;  1Q3X A;  2VGC B;  1B5G H;  3TJN A;  4FVD A;  5GCH G;  3RXQ A;  3TJO A;  3SOS A;  2ZGC A;  1YPL H;  2J95 A;  1TPO A;  1P05 A;  1DWC H;  5T1V A;  3A81 A;  1LCY A;  4K1S A;  3SW2 B;  1BA8 B;  1EOJ A;  4U32 A;  2GX4 A;  3TJV A;  4YT7 H;  3S9A A;  7GCH F;  1ZMJ A;  2GZ7 A;  4NIV A;  2W6I D;  1BTY A;  2LNC A;  2BXU H;  3BTD E;  2A31 A;  1YC0 A;  1QNJ A;  4BTI B;  2ZCH P;  3TH3 H;  4ACB A;  3P70 B;  5E2P A;  5EGM A;  1FAX A;  1ZRB A;  2AIQ A;  3FVF B;  4HI3 A;  3F0O A;  2BD8 A;  1ID5 H;  5HXF A;  1P8V C;  3OAA D;  1MBM A;  1A46 H;  3FKS D;  1A1R A;  1MAB B;  1OWE A;  7LPR A;  3RXG A;  1GHA F;  1C1V H;  1EZX C;  2PKA A;  1VCP A;  2A2X H;  2Y7Z A;  3SHC H;  1CVW H;  5A8Y A;  1TBQ H;  2HVX A;  1LHC H;  1O2V A;  4AOR A;  1KLT A;  1F0R A;  5CHA B;  5HM2 A;  1JBU H;  2GMT B;  2VIP A;  1EAU A;  4Y71 A;  3BTM E;  4AB9 A;  4CBO A;  3GCT F;  1O3D A;  5DP5 A;  2BDH A;  4AOQ A;  3LDX H;  4ZHA A;  5EW1 H;  2IPQ X;  2C93 B;  3RMM H;  5EXM A;  1DDJ A;  1XVO A;  1O2M A;  2D2D A;  3RXC A;  3ZZ8 A;  2Y80 A;  2O8M A;  1QBN A;  2CF9 H;  1OYT H;  2XTT B;  1LHG H;  1ARC A;  1KXF A;  3RUO A;  1BRB E;  1H8D H;  2H6M A;  2ZU1 A;  3QZQ A;  1DLE A;  1NRS H;  3BN9 A;  1K1L A;  3RXJ A;  2A5K A;  2VGC C;  1TFX A;  4NWK A;  1GJ6 A;  2R0K A;  4JCN A;  3STJ A;  8KME 2;  3KQD A;  3TK6 A;  2WSS D;  3QLP H;  3M35 A;  4IN1 A;  3TLO A;  3BEU A;  3ZYE A;  3KQ5 A;  2WV5 A;  4MDS A;  4ZCN A;  1A3E H;  1EJA A;  1Y3W A;  3SV6 A;  3KHV A;  4XFQ A;  2OIN A;  5ESB A;  1HJA B;  1G3C A;  1WAY B;  3KCG H;  1KDQ A;  4F55 A;  1H8H D;  2QXJ A;  4ASU D;  4BAM B;  1LVY A;  3PLK A;  1W0Z U;  2AIP A;  4CH8 B;  2EI7 A;  4Y7A A;  1GCT C;  4RN6 A;  3RM2 H;  2A0Q B;  2V3H H;  4IMZ A;  3A7W A;  4ACA A;  2AS9 A;  1ELC A;  2HLC A;  2ALP A;  1IQN A;  3GOV B;  1W11 U;  5LH8 A;  1W7G H;  1G2M A;  2UWL A;  3EYD A;  4ISI H;  5LPR A;  1G30 B;  5GPI B;  1DWD H;  1FUJ A;  3A83 A;  1F5K U;  3MHW U;  1S6L A;  1O3G A;  1A5I A;  2TRM A;  1GJD B;  2GMT C;  3P92 A;  5EW2 H;  1TA6 A;  1CT4 E;  4WH6 A;  1KLJ H;  1V2M T;  3QDZ B;  4X8V H;  1C5Q A;  1TAW A;  3DUX H;  3OTJ E;  3ZZ4 A;  3SV9 A;  3WW7 A;  2SGA A;  1GHB G;  3ZV9 A;  2KZ4 A;  1NFX A;  1T4U H;  4AYY B;  1KXB A;  1GI6 A;  2PTN A;  1C5M D;  2KR7 A;  4INK A;  4DOQ A;  1H1B A;  2FZZ A;  2AYW A;  2YNB A;  1ELD E;  5L2Y H;  2ASU B;  3F9F A;  3RML H;  1FPH H;  1E38 B;  3BIU H;  4PRO A;  1FY1 A;  2ZG0 H;  4X0W U;  3PWC A;  3SZN A;  1UTQ A;  3U8T H;  1YBW A;  3EA8 A;  3RXL A;  1CHO G;  3UR9 A;  1IQF A;  2V3O H;  4Y10 E;  1YLN A;  2ODY B;  1C4U 2;  1BBR E;  2K8I A;  2NU2 E;  4KGA A;  2ZC9 H;  1GMD F;  1WU1 A;  1T4V H;  1QB6 A;  3MH6 A;  3RXH A;  1YM0 A;  2FEQ H;  1SSX A;  1SLV B;  2G55 A;  2PGB B;  3KEE A;  3P8N A;  3NXP A;  5GXP A;  4KTC A;  1SQR A;  5EOK A;  4FUF A;  2VID A;  3CP7 A;  1SGR E;  3E90 B;  2A7H A;  3AVZ A;  1T8M A;  5DN6 D;  1FX0 B;  1HJA C;  2RDE A;  1TGN A;  1NC6 A;  1QTF A;  4VGC C;  4ZHM U;  3RXP A;  4R8T B;  1SQA A;  3P95 A;  1JIR A;  4MG3 A;  2ZHW H;  4F49 A;  3A7V A;  4Y8Y A;  1HXE H;  3ZVG A;  3QUM P;  1UMA H;  2PR3 A;  1O2J A;  3R3G B;  2F3C E;  4H4F A;  4ZMA H;  3HKJ B;  2ZO3 H;  3LGW A;  1C5N H;  3E1X B;  1ZTK A;  4BOH A;  3D23 A;  1D3Q B;  1TPA E;  2FI4 E;  1FY4 A;  1P3C A;  1VJ9 U;  3ATL A;  2ODQ A;  4Z0K A;  1B7X B;  1EZQ A;  1V2L T;  1SOZ A;  3LGU A;  2F9V A;  2WZQ A;  3A85 A;  5CDF E;  3A82 A;  1Z1J A;  2A2Q H;  3D49 H;  3T28 A;  3MOC A;  4HTC H;  4ASH A;  2ANW A;  1HUT H;  1QR3 E;  1GBJ A;  5FPS A;  1ZZZ A;  4YOI A;  1HNE E;  4RI0 A;  4IC5 A;  3ZVA A;  1HYL A;  3GY8 A;  5AFZ H;  5TCA A;  4FXG H;  1GI3 A;  4TSF D;  1AVX A;  4NWL A;  3R0F A;  3RXB A;  3SYJ A;  1O3F A;  1BTP A;  5B6O A;  1GPZ A;  3DSG A;  1AGJ A;  1NFW A;  4DT4 A;  1P03 A;  1RTK A;  1A4W H;  2VWL A;  4ZKR U;  1MH0 A;  1F5R A;  1J14 A;  2G51 A;  2ZGX H;  1FAK H;  1XKA C;  1P9U A;  4BXS A;  3UNS A;  2VVV A;  1UTO A;  3DFL A;  2Z3D A;  5DP4 A;  2PUQ H;  1ZTL A;  1O2P A;  3P8O A;  3Q3Y A;  4FVB A;  4X8S H;  1BQY A;  5A0A E;  2ZFF H;  1QBV H;  1SG8 B;  2C8W B;  4UFG H;  2J4I A;  1ELA A;  1DFP A;  2BY7 X;  1CU1 A;  3CS7 A;  3LU9 B;  3MFJ A;  2BDB A;  4KTU A;  3PYH A;  2R3U A;  1EQ9 A;  1FV9 A;  4FUI A;  1G36 A;  4UON A;  1YKT A;  3ODD A;  3K6Z A;  2XRC A;  1HGT H;  3W1E A;  1O3A A;  2H9E H;  2NU1 E;  2ZEB A;  3AK5 A;  1HIA A;  5F8Z A;  2BY8 X;  4DY7 B;  1P9S A;  3WY8 A;  3SND A;  4M7G A;  4A1X A;  3F2G A;  4ABJ A;  1A2C H;  5F8T A;  3H5C B;  3FP6 E;  5C94 A;  3MMG A;  8GCH G;  2Z3C A;  4IW4 E;  1XKB C;  2BY5 X;  1BIO A;  1N8O B;  1TX6 A;  2H9T H;  4ISL A;  3BEF B;  5J4Q A;  1KXD A;  4R0I A;  3OEE D;  1GDN A;  2GCH G;  2UUF B;  1TX7 A;  3A86 A;  3TIT A;  1C5L H;  1YPH C;  4FU9 A;  1UCY K;  1D9I A;  1SMF E;  1SVP A;  2LEL A;  2G4U A;  1MKX K;  1ZR0 A;  1IQI A;  2PSY A;  4BXW A;  3ENS B;  3LGV A;  4IS5 A;  1FIZ A;  1Y3X A;  3BTE E;  3LJO A;  3Q77 A;  4UEH H;  2R3Y A;  1O2X A;  4XE4 A;  5C17 A;  4X6P A;  1GL0 E;  4B73 A;  3K6Y A;  3SO3 A;  4MPU A;  1ZTJ A;  2O8L A;  2VH0 A;  4UFE H;  5DJ7 A;  1IQH A;  1AD8 H;  1EAW A;  2CHA B;  1YGC H;  2WPK S;  2BM2 A;  2Y5G A;  2W5E A;  3H09 A;  2ZP0 H;  4B74 A;  1OWK A;  3A89 A;  2XBV A;  6GCH F;  2A7C A;  1TGS Z;  1K1J A;  2W7U A;  4TYD A;  2BDC A;  2UUK B;  1TNK A;  1EB1 H;  2JET C;  3RLY H;  4NSY A;  2RDL A;  4Y76 A;  1O3I A;  4D8N A;  3F9G A;  3GCH B;  3N7E A;  4JZF H;  2IPH A;  2FWW A;  1GBF A;  4RSP A;  1LTO A;  5DGJ A;  5T6F A;  1LO6 A;  1WQS A;  3MO3 A;  1ZPB A;  2GCT B;  3ZZA A;  1SFQ B;  1TLD A;  1PPE E;  1TBZ H;  6CHA B;  1O31 A;  2Y5H A;  1D3D B;  2TBS A;  3DHK H;  4NCY A;  1C1W H;  1SHY A;  4B6E A;  4BTU B;  1E0F D;  1ZJD A;  2O8W A;  3RXU A;  2J97 A;  3ITI A;  1O5G H;  4HG6 A;  1PJP A;  4I8H A;  1CE5 A;  2PHB A;  1DT2 A;  1O5E H;  1UTM A;  2P59 A;  9LPR A;  3URC A;  3AAV A;  2NWN A;  1QCP A;  2SFA A;  3MQK C;  2O9Q A;  1BT7 A;  1YLC A;  2CMY A;  1MAX A;  1DLK B;  4YO9 A;  3SUF A;  1O36 A;  3A8B A;  5T6D A;  1MKX H;  2Q6G A;  3HPT B;  2ZZU H;  3FN8 A;  3UY9 A;  3ZVC A;  3PV2 A;  1NRO H;  2ZDM A;  4WWY A;  2UWO A;  1O2Q A;  1RXP A;  1PPH E;  1SL3 A;  3KID U;  3PLP A;  1O2K A;  2W6J D;  4OGX A;  4B76 A;  1GL1 A;  1TPP A;  1ESA A;  4Y6D A;  5I25 A;  1IOE A;  1AO5 A;  5DKM A;  3U1I B;  1EAX A;  1PQ5 A;  1VIT F;  4BAH B;  1DXP A;  5EU8 A;  2RA3 A;  1ZHM A;  1C1R A;  1SGF A;  1O3N A;  4X6M A;  1C5T A;  1DIC A;  1EP5 A;  2VVU A;  2BXT H;  3TGJ E;  2ZFP H;  3NKK A;  3V12 A;  1O2O A;  2G00 A;  3EA7 A;  4LXB H;  1A0J A;  1SKY E;  2KX4 A;  3ZZC A;  2AMD A;  2WYJ A;  1ELV A;  3LJJ A;  4WY3 A;  1C2M A;  4YLU A;  1NU9 A;  1K28 D;  1RFN A;  1GG6 B;  3BTF E;  4H6T A;  1MBQ A;  2BYA X;  3SUE A;  1TQ7 B;  1NN6 A;  1T8N A;  5DP6 A;  1DOJ A;  5GND A;  1H9H E;  1RIW B;  4LOY H;  1IQG A;  4MVN A;  4FUD A;  1SFI A;  4D76 A;  3FP7 E;  1OWD A;  2BDY A;  2GCT C;  1FLE E;  1GJA B;  1QQU A;  1SGY E;  3RC5 A;  1MD8 A;  3FFG A;  1TA2 A;  3SNB A;  2WV9 A;  1MCV A;  4B2A A;  2SNV A;  3VEQ B;  2O8T A;  3TPI Z;  3O8R A;  3SJI A;  1P2M A;  1LPZ B;  1O2S A;  1SGP E;  3HGP A;  1A7S A;  1UW7 A;  2PP6 A;  3GY4 A;  1YWU A;  1QIX B;  1UVU H;  1VR1 H;  1G3E A;  4NG9 H;  1Y5U T;  3A8A A;  2GD4 B;  4GSO A;  1OXG A;  5DP3 A;  1C5P A;  2XNI A; 
#chains in the Genus database with same CATH homology
 4B6E A;  2JDI D;  3F2H A;  4Q63 A;  1WXR A;  4JMY A;  3M5N A;  2O8M A;  3WWB A;  2JIZ D;  2P59 A;  3OE7 D;  2F43 B;  1CU1 A;  3GS9 A;  3M5L A;  3SU5 A;  3F2F A;  5FPT A;  2AHM E;  2XCF A;  4FET A;  2K8I A;  2YMS D;  3KF2 A;  2M2A A;  2K1Q A;  4I32 A;  4A1T A;  3U1J B;  1BT7 A;  5EQR A;  3DCL A;  2QF5 A;  4K8B A;  3KNX A;  3SUF A;  3LON A;  2L6O A;  3KEE A;  3W1E A;  1RTL A;  3SU6 A;  5IK2 D;  3LOX A;  3SU2 A;  3P8N A;  3AK5 A;  3SUG A;  2KM0 A;  2OBQ A;  1H8E D;  2OBO A;  4Q4L A;  3SV8 A;  2XCN A;  4KTC A;  2QE7 D;  3FN8 A;  4I31 A;  3PV2 A;  4A1X A;  3F2G A;  1DY8 A;  1DY9 A;  3E90 B;  5C0T A;  4NWK A;  5DN6 D;  1NBM D;  1FX0 B;  1RGQ A;  3NRL A;  1COW D;  4A1V A;  3M5O A;  2WSS D;  2J5U A;  2A4Q A;  3SV7 A;  5EPN A;  3DSP A;  1E1Q D;  2YMS B;  3SU4 A;  4R8T B;  2W6J D;  3WWF A;  5CHB A;  4B75 A;  3OEH D;  4B76 A;  3O8B A;  2FM2 A;  5EQQ A;  3VG8 A;  3UB0 A;  4ZCN A;  3ZIA D;  4B71 A;  5F53 A;  3SU1 A;  3DSO A;  3SV6 A;  2GGV B;  3OEE D;  2FOM B;  3U1I B;  4YXW D;  3FO8 D;  2OIN A;  5ESB A;  3F3B A;  5B6L A;  3PRB A;  1DXP A;  4WH8 A;  2LEL A;  5T1V A;  5H4I B;  2KCY A;  2IJD 1;  4F55 A;  3SU3 A;  1H8H D;  1EFR D;  2HLD D;  3PRD A;  4OM9 A;  1W0K D;  4ASU D;  3LKW A;  2WPD D;  2OC7 A;  5HKK D;  2CK3 D;  2W6I D;  5FL7 D;  2KFW A;  1W3C A;  1SKY E;  2F9V A;  2JJ1 D;  2F4L A;  2WZQ A;  3KN2 A;  4WF8 A;  4B73 A;  5C17 A;  5CDF E;  2A4R A;  3O8D A;  3OFN D;  3N7D A;  2KCP A;  2F9U A;  2XND D;  2FP7 B;  3PV5 A;  3RC4 A;  3RC6 A;  4Z1M D;  3EYD A;  3H09 A;  2KCO A;  3SUE A;  5GPI B;  4B74 A;  5FPS A;  3FOA A;  3N99 A;  5GND A;  3OTP A;  4RI0 A;  4TYD A;  4XD7 D;  5IDK A;  3F0O A;  1S6L A;  3SZE A;  4M9F A;  4I33 A;  3SU0 A;  2IJO B;  2QF4 A;  3OAA D;  5DSF A;  4TSF D;  3F0P A;  4NWL A;  1NBM E;  2VBC A;  3FKS D;  1A1R A;  4WH6 A;  1W0J D;  1OHH D;  3SYJ A;  1MAB B;  2OK5 A;  3RC5 A;  2GVF A;  2WHX A;  3N7E A;  3OYP A;  1JXP A;  2WV9 A;  1E1R D;  3SUD A;  4DT4 A;  1BMF D;  3SV9 A;  4U01 A;  4B6F A;  3L6P A;  3WW7 A;  2QV1 A;  2XOK D;  1E79 D;  2YOL A;  1DXW A;  2JJ2 D;  1KMH B;  2KZ4 A;  4A92 A;  3O8R A;  2A4G A;  3M5M A;  2OC0 A;  2YMS C;  5EQS A;  5C0U A;  2KR7 A;  5EPY A;  2OC1 A;  5FPY A;  5GJ4 B;  2OC8 A;  1NS3 A;  2V7Q D;  1N1L A;  5ETX A;  3P8O A;  4TT3 D;  2KCA A;  3O8C A;  2XNI A;  2K0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...