1LMWB

Lmw u-pa structure complexed with egrcmk (glu-gly-arg chloromethyl ketone)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
248
structure length
248
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title The crystal structure of the catalytic domain of human urokinase-type plasminogen activator.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 248
sequence length 248
chains with identical sequence D
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 1995-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lmwB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lmwB01
3GISB 5BRRE 1PQ8A 2ZNKH 1N6XA 3QLPH 2VINA 1CA8B 1YP9A 2P94A 2Y5GA 4NZLA 2PUQH 5C5OA 3SNCA 2R0LA 1Y5AT 1AWHB 1QJ7B 1JRSA 2O8MA 1MCVA 5FX6A 1AI8H 2BM2A 2BD9A 4TPYA 1LHGH 1EXFA 7KMEH 3DD2H 3A87A 1C1TA 3SJKA 2FWWA 1NROH 2NU3E 1C5TA 2ANWA 2H5DA 1DT2A 3EE0B 4WXIA 5DP9A 3B8JA 1K1LA 1P9SA 2PKSB 1FIZA 3A8CA 1C2EA 4IGDA 3H5CB 4Y6DA 1O3IA 2A7JA 2XW9A 3Q3XA 1O2TA 3BG8A 8ESTE 1ZTLA 3Q77A 2O9QA 1S6HA 1LTOA 1NZQH 3UQVA 1C2KA 1EAUA 4NIXA 4AN7A 2QGRA 4Y11E 1L1GA 1J15A 2ZTXA 1MTVA 4JYUH 1V6DA 3VXFH 3EDXB 2ZQ1A 1GI0A 1GJ5H 1TX7A 4X8TH 3MO6A 3BIUH 2KAIA 1C2FA 3KGPA 2H9HA 2FO9A 1GVLA 4RKJB 1C9PA 3U8RH 2PW8H 1W2KH 4AFUA 1GJ9B 5HMAA 1C9TA 1ZMJA 4Y71A 3OX7U 1TWXB 5E2OA 5K0HA 4HI3A 2QF0A 1EPTC 5I46H 3RXDA 1ANEA 3RXGA 1QBOA 3SUGA 5LPEA 3T2NA 2XBYA 4X1NU 1Y3VA 2JETB 4IBLH 1AZZA 2DUCA 2ZHEH 2ZIQH 2VWMA 1CO7E 1UVSH 3NCLA 2YNAA 4NA9H 3SU0A 4MPUA 2WPKS 1HB0B 4D7FA 1O2HA 1NO9H 3R3GB 1F92A 2FM2A 3K2UA 3GDVA 3PLPA 1LPGB 1K1NA 2CHAB 3HK3B 1EAIA 3LJOA 3KNXA 1PPFE 1KLJH 4BAOB 2CMYA 1W11U 1PQ7A 5EQSA 5FCKA 4MNVA 1ZOMA 1GJAB 3Q76A 1V2WT 4GCHG 1ZYOA 1ANCA 1TNJA 3TIUA 1GCDA 3UREA 3MU1A 4I8KA 2ZPSA 1BIOA 3BG4B 4FXGH 4CREA 2ZTYA 5C67A 1A0HB 3M61U 1O2SA 1GJ8B 1BTUA 3MU5A 4IMZA 1EP5A 1O2PA 2O8LA 3MH4A 1FN8A 3QTVH 1YYY1 1HNEE 2NU1E 3MU8A 1AWFH 3T29A 3E8LA 5JDUB 2UWLA 2ANKH 1IQJA 4YO9A 3TJOA 5E0HA 1BUIA 2PTCE 1O39A 1C5UA 1AFQB 1TABE 3BTDE 1TGBA 3U8OH 3S0NA 4J1YA 6ESTA 2VIVA 1OWDA 2WYJA 4LZ1H 2GT8A 4BTTB 1EPTA 2BLQA 1CHGA 2BQWB 4YLUA 3LH1A 3O8RA 3BEFB 5A8XA 1TOCB 1LPZB 1BITA 1SSXA 1THRH 5JBTA 1O34A 5EOKA 4GSOA 5EXMA 5FPSA 5DP8A 1A3EH 2ZCLP 3ZZCA 3PTBA 1ZHRA 4UD9H 4CRGA 3G01A 3U1IB 1C1SA 4FUCA 2BXUH 3M5OA 5GCHG 1Z7KA 1BTZA 1Z1JA 1BTWA 1RXPA 3TH3H 3MYWA 1QL8A 1TOMH 1LVYA 1N8OB 3RMNH 4CR5A 3VB5A 3TPIZ 1IQLA 2BD4A 1GHYH 3I29A 2Z3EA 4X6PA 6CHAB 2W3KA 1GMHF 1GBBA 3LU9B 1MU6B 5JBAS 1AFEH 4ZHAA 4ZXYH 1HAVA 2PSYA 2STAE 2G8TA 3GCTG 1DPOA 4I32A 1CA0B 2FXRA 2K1QA 1C1RA 2W3IA 1SGTA 1W8BH 4X2WA 3SN8A 4AB8A 4XBCA 1HRTH 2UUYA 4FU8A 2IOTA 3MNBA 2OQUA 3ODDA 3UOPA 2CV3A 4YOGA 1SHYA 2Z6BD 2B5TB 3ODFA 2GP9B 1FN6A 1A61H 1G9IE 1O2ZA 3E3TA 1AZ8A 1MH0A 1H4WA 2ZDNA 4M7GA 4XBDA 1AE5A 1GGDB 3QGJA 3RXJA 2BLOA 2FTMA 3LOXA 3M3TA 1DITH 5C20A 1VCQA 1QTFA 1WBGB 2R3YA 4B71A 2ANMH 4IS5A 1MUEB 1NPMA 1NFYA 3M7UA 3SNEA 4ZKRU 1O37A 4YLQH 1OPHB 4WXVA 1W13U 1H9HE 2G00A 1YCPM 4UONA 1G30B 1FZZA 2BZAA 2BYAX 5ETXA 1GHAF 1V2VT 4DIIH 2SGFE 3ZZDA 2QC2A 2ZU2A 1CHOF 2OBOA 1F5KU 3ZZ3A 1S5SA 2R0KA 4NSYA 3MNCA 4QT8C 1XUGA 3T28A 1K21H 4RKOB 1TPPA 2GCHF 3ZZ6A 1BA8B 1BJVA 2XCFA 3LT3A 4IMQA 3LC5A 4MNYA 1KIGH 1GVZA 1A46H 1GHWH 1O2KA 1SMFE 1AD8H 1O3LA 1BMAA 2EI8A 4BANB 4KTSA 4H6SB 2GCTC 2VU8E 4GAWA 1PQ5A 5LGOA 4BAHB 1SGEE 2P3FH 3TVJB 4BAMB 1KXCA 1H8IH 2H9TH 2HGTH 1AVGH 1W3CA 4H4FA 1YLCA 3MH6A 4IC5A 3BSQA 3ZZ8A 2Z9LA 3P92A 1ZSLA 3RU4E 2V3OH 2RA3A 1C5WB 3ZZ7A 1EZQA 1G2MA 4BAKB 2A5IA 3ZZ5A 1LDTT 3P70B 1SG8B 4A1XA 3OTJE 3ZVAA 2AIPA 2XC4A 3PLBA 1VZQH 1Y3WA 1H9LB 4JYVH 2GT7A 2AEIH 6GCHG 5T6DA 1ANDA 1D6RA 2H2ZA 2SGPE 1GBKA 2FYQA 1K1IA 2C8XB 1VCPA 2Y5HA 2PTNA 2W7SA 2D1JA 2BHGA 2ALPA 5EQRA 1DXPA 3M5LA 3GCHB 2I6QA 1WYKA 4ZKSU 3HATH 1K1OA 1S84A 2IPHA 3NZIA 2BXTH 4ISLA 1GBCA 2DE9A 3SUFA 3L6PA 1SLUB 3U69H 2Y7ZA 2ZP0H 3GDSA 2XRCA 5IYTA 3RXAA 2SNVA 2AGGX 1E38B 1QCPA 1VGCC 1NM6A 1SOTA 3RXIA 4AG1A 2GDDA 1AUTC 1C1UH 1DWCH 1K1MA 1JIMA 3BV9B 4XOJA 3RP2A 4K60A 1Y3UA 3K6ZA 3MNXA 1UTNA 1GBDA 1P01A 2M5TA 2FEQH 3E0NB 5EG4A 1OOKB 1GI6A 1LVOA 1IHSH 1W10U 1FIWA 2ZGBH 4WWYA 3M3SA 2BD8A 3A7VA 1LQEA 1HAYB 5C5NA 3SU6A 3GY8A 2PKSC 1CT4E 1AIXH 2WINI 2HOBA 1C1PA 5FXLA 4H6TA 2BTCE 3VGCB 3UWIA 4IN2A 2R3UA 2ZHFH 2FDAA 3BN9A 3ZVBA 4ABDA 3P8NA 4AFQA 3TK5A 1O5FH 3UTUH 2LPRA 2C90B 3VEQB 1YPEH 1FLEE 1DX5M 5C3NA 5ABWA 3BF6H 1KXAA 2WUCA 5FCRA 1W12U 3PTNA 1Z6EA 1O3EA 3Q3KA 2TPIZ 3PMBB 1C5MD 1KDQA 3LGTA 4FU9A 1S0RA 3EA9A 1C5OH 2FI5E 2PKAB 2OCVB 2AERH 3AAUA 3C27B 2WV5A 3D62A 1LKBA 3P95A 3P6ZB 4AFZA 2OP9A 1V2MT 1O5DH 3RXKA 1FY8E 1F0TA 1WUNH 2BD7A 1Z8IB 1H1BA 2FLBH 2ZPQA 2JH5D 1GJ7B 2OC8A 4CRFA 1V2RT 1DWEH 4KTUA 2XWAA 1Q2WA 1BBRH 1Y5BT 4WMDA 4F49A 3MOCA 1BJUA 1O5AB 1K2I1 1UCYK 3FZDA 1EB1H 3M7QA 1E34B 3SV7A 2ZI2H 2PGQB 2B7DH 1GI5A 2A7CA 3U9AH 2AGEX 4HGCA 2CHAC 2FP7B 1BRBE 3BTKE 1ZGVA 1O32A 1F0UA 4AGJA 1GJ4H 5JPMH 5LPRA 2VVUA 4D76A 1XKBC 1BTPA 2QAAA 4K1EA 2FI4E 3BTGE 1MKWH 2BB4A 4O97A 3S69A 1XVMA 1SLWB 1O2YA 4JYTA 5GCHF 4CRAA 3BG4C 1JWTA 3SO3A 2ZWLH 4ZUHA 3DFJA 1GMCG 4THNH 2HLCA 1MTNB 1BMLA 1TIOA 1Z71A 3KQEA 1Q3XA 1ELDE 1TBZH 2BD3A 3MTYA 1YLDA 4Y7BA 1ZMNA 2GGVB 3EQ0H 1GBLA 1GBJA 1AFQC 3QUMP 4SGAE 3T25A 4NGAH 1S85A 1DVAH 1P8VC 3N7OA 3RXSA 4TYDA 4X0WU 3VXEH 2BDCA 6LPRA 3GY2A 2OXSA 3NK8A 4NA8A 1DFPA 2Y80A 2HALA 1OWHA 2I6SA 1O3OA 3DA9B 3RXHA 1BTXA 3RXUA 3TITA 4ABHA 4TPIZ 2F9PA 1CU1A 1VITG 2HVXA 1E36B 2BY8X 1Z6JH 1QQUA 1OP8A 4OS2A 4X8UH 1MTWA 1THSH 1THPB 1SFIA 1DY9A 1N6YA 1F5RA 1SGIB 4WMEA 1GL1A 2W5EA 2NU0E 4INKA 3LGYA 2HNTF 3E6PH 2VIQA 1HLTH 3RXFA 5EW1H 1N8OC 2EA3A 4FUBA 2VVVA 2XBVA 1AUJA 3TJVA 4Y8YA 1OX1A 2P8OB 3CS7A 6CHAC 1SQTA 2J9NA 1MCTA 1MD8A 1YBWA 2BY6X 1QB9A 1ZR0A 1DY8A 2ZQ2A 3RUOA 1HGTH 3E16B 1WAYB 1T8LA 3T26A 4MQAA 1UVPA 1HAZB 4DJZB 2V6NA 1CA0C 4E05H 4WMFA 1VJ9U 1P57B 4D7GA 2F9NA 1SQAA 5DP7A 1LQDB 4WJG2 1OP0A 2QA9E 1DUAA 1IQFA 2BOKA 1KY9A 3SNBA 3NUMA 4I8GA 1ZJDA 1LHEH 2XNIA 1A1RA 1O38A 1P06A 5AFZH 2PR3A 1GGDC 1P2QA 3UUZA 9LPRA 1Y59T 4ASHA 4K8BA 2Z9JA 4AX9H 5F8TA 1O36A 7GCHG 2WYGA 1FPHH 2Z94A 3SZNA 4NCYA 1KYNA 3NPSA 5DP5A 4ZHLU 1SGDE 2ZG0H 2Z9GA 2ZGHA 2BDBA 1HJ8A 1OWJA 1QQ4A 1SFQB 1AMHA 3H7TA 3NKKA 3P8OA 2ESTE 1O2UA 2BDAA 3SI4H 1IAUA 4MNXA 1RS0A 1CT2E 4DCDA 4DG4A 4NIVA 1NFWA 4ZROA 4Y0YE 4FUIA 1ESAA 4WH6A 4UFGH 4DVAU 3A86A 1H9IE 1FPCH 3TNSA 1L1NA 2R9PA 2GV7A 6GCHF 1SLXB 2ZHDA 2VH6A 1T32A 1F0SA 5K7RA 2G52A 5EXLA 1C5ZB 1GBMA 1V3XA 4NWLA 3RU4T 1ETTH 3TJUA 2C3SA 2VWLA 1ZZZA 1J16A 2TGTA 5PTPA 4FUDA 1PPEE 2BQ6B 1CBWC 4D8NA 3TJNA 3FVFB 1C5VA 4DURA 3SNDA 2PHBA 4FUHA 1N1LA 1O5CB 2GZ9A 2ZDKA 3A80A 1TA2A 3P8FA 4KTCA 1CGHA 1HXEH 4JZEH 1O3BA 3QX5H 1QURH 3MHWU 5AF9H 5HM9A 1MU8B 3T62A 4DIHH 1Y5UT 1O5EH 1EOJA 3IG6B 1TA6A 4FUEA 2YOLA 1D4PB 1HCGA 3RXQA 4NWKA 2FOGA 3V13A 1SGFG 1TRNA 2VGCB 4DT7B 1EJMA 2FLRH 3MMGA 1C2JA 1L0ZA 2FPZA 1UVUH 3ZVDA 4TWYA 1P02A 1Z1IA 1C5NH 2ZU1A 4NFEA 1GBHA 2C8ZB 3GCHC 5DKMA 1FV9A 2NWNA 3F9FA 4ISIH 2H5CA 2QIQA 4YM9A 1GHXH 5L2ZH 3VB7A 1ANBA 3E90B 1BT7A 5EQQA 2BD5A 2ZFTA 1DUEA 1V2TT 2JKHA 1TNLA 2A32A 1ARCA 2XYAA 3MH7A 2P93A 1HPGA 2FX6A 2GKVE 2VIWA 5F8ZA 3A7TA 4Z0KA 4TWWA 3MU4A 2PFEA 4LOYH 4HFPB 2ZFSA 5JYIA 1O35A 2P3TB 3W94A 1EKBB 2ILNA 4E7RG 1FNIA 1C5XB 2CN0H 3MWIU 1FAKH 1BHXF 4VGCB 1L4ZA 3ATKA 1HAHH 1TMBH 3PYHA 7ESTE 4Y10E 3BTFE 4E06H 1O2NA 1IQMA 1VCWA 3GY7A 1OP2A 3RXRA 3MU0A 1UVTH 4ZAEA 3A81A 5FPTA 1S81A 1VR1H 1OWKA 1FY3A 1KLIH 2Y5FA 2BMGB 4NIWA 5EODA 1C2MA 5DP4A 1HIAB 2UWPA 1CSOE 3OYPA 1OWIA 1PFXC 1A0JA 3VGCC 3ZYEA 4YT6H 2OUAA 1QRZA 1TGCA 1PPBH 1TMTH 3CS0A 4O3UA 4CHAB 3CP7A 3RC5A 2SGQE 1C2LA 1YGCH 2WUBA 3RMOH 1UTQA 1NY22 3URDA 1ZHPA 4X2YA 1SBWA 7LPRA 1O2GH 1HFDA 3VB3A 1HAXB 1BB0B 4ISHH 1KXBA 1TBQH 1TE0A 3K65B 2OQ5A 2XC5A 1UMAH 2BVRH 2SGEE 1C1WH 5F8XA 1ZTKA 2Z3DA 1SGQE 3M3VA 1FXYA 1ZPZA 4BNRA 1QB6A 2QYIA 3SJIA 3BTWE 3UNSA 2BDGA 1Y3YA 1C1OA 4OS1A 1IQHA 4K8YA 4OGXA 1P10A 1ORFA 4FUFA 3RXTA 2FMJA 2BD2A 1WSSH 3HPTB 3KQDA 3AW0A 1MTSA 3GY5A 4MNWA 1AVXA 1AB9B 1O2XA 4AYVB 1T4UH 1VJAU 1GJCB 4ABAA 3E0PB 4MG3A 1FMGA 4A92A 5T6GA 1DANH 1O3FA 5I25A 1P2OA 2THFB 1GMDG 1P3EA 5IDKA 2ZDLA 1HXFH 1UO6A 3MFJA 4E7NA 4X6NA 2TIOA 3S7KB 2A31A 1G36A 4NSVA 3RXEA 2XWBI 5DPAA 5FBEA 1VITF 2RG3A 2FYRA 1P2IA 2WPLS 2W7UA 4HTCH 5F6MA 4ZMAH 3MNSA 1O2WA 2XC0A 4DGJA 1ID5H 4AB9A 1MTNC 3SV2H 5HYOA 1GL0E 2OC7A 1CBWB 3QZQA 2BQ7B 1A5GH 4X6MA 3WY8A 1GI3A 4K5ZA 4UDWH 2C8WB 3SJ9A 2GX4A 3NWUA 2PKAA 4AYYB 3URCA 2ODYB 1C2IA 4LXBH 4MDSA 1W0YH 1GJ6A 1C2DA 1XXFA 2QXIA 2HPPH 5DK1A 1P11E 4HZHA 2V0BA 1TNIA 3U1JB 2V35A 1BRCE 3KQBA 5GPIB 5A0BA 1TX8A 3CENA 4X8SH 1TNGA 3PO1B 1LMWB 1TGTA 3S9AA 1A3BH 1AVWA 1RTFB 1BTHH 3GDUA 5TCCA 3L33A 1T8OA 1UHBA 2ZA5A 1ZPCA 3UR6A 1KTTB 4UFEH 1TPAE 3GCOA 2GD4B 4AZ2B 1J9CH 1Z8GA 1GJBB 2ZEBA 4A7IB 1UCYE 1GDQA 5AVDA 2QN5T 3A88A 4ZXXH 1P09A 3SUEA 1TRMA 5TJXA 1ZGIA 1GJDB 5ESBA 3U8TH 1PJPA 1BDAA 1SGYE 1TYNA 5CHAB 1TPSA 3SGQE 2ZHQH 1HDTH 3EAJA 1LKAA 2J34A 2CJIA 3FAOA 2GMTB 4YOIA 2P8OC 2VJ1A 4O3TA 1S82A 3PB1E 5HXFA 2VVCA 4BTUB 1GVKB 1ZPBA 3VFEA 5FHTA 2HWLB 2R2MB 1MBMA 1O2QA 1ZHMA 1WQVH 1GWAA 2AYWA 2PGBB 4ZKOU 1Y3XA 3AVZA 4GLYA 3PMJA 1MKXK 4IW4E 2TGPZ 1O2OA 2Z7FE 1O3AA 1BBRK 5E0JA 1O30A 2FOAA 1O3KA 4NFFA 5FPYA 2ALVA 2B0FA 1GCTB 1IQIA 1P04A 2BLVA 4AG2A 1NU9A 2ZECA 1F7ZA 1G2LA 1XUFA 2EC9H 4XSKU 2A2QH 2J92A 4K1TA 4Y0ZE 1TLDA 1V2QT 2Y6TA 1EB2A 3EA7A 1V2LT 2FIRH 1TQ7B 4MPWA 2ZGXH 4Y79A 3RM0H 1FY1A 4KKDA 1ELBA 1SQOA 1YF4A 3BTEE 3SQEE 2CXVA 3SOSA 1MKWK 1KXFA 2A45B 4YT7H 4B75A 1UTMA 3ESTA 2H1UA 2W26A 4Y8ZA 4NZQA 1C5SA 3W95A 2AFQB 1L2EA 1H8DH 3JZ1B 3JZ2B 4JZFH 3OSYA 1DS2E 1LHFH 3ZV9A 1JOUB 2Q6GA 2Z3CA 3FP8E 4DW2U 1ZSJA 5C1UA 1Q31A 1GBAA 1MQ5A 1GDNA 1A7SA 1KXDA 3PWBA 9ESTA 2BY9X 3HGPA 2AH4X 4GCHF 3A8DA 1O3JA 3SV8A 5A2MH 1O3NA 2P95A 2QCYA 3LH3A 1FY5A 4SGBE 2BY7X 1B0FA 2A4OA 3HKJB 5E0GA 1AE8H 1W0ZU 1UK2A 5A09A 4YTAA 3SHCH 3SW2B 4CR9A 2FODA 1C2GA 4U32A 4FVDA 1LVMA 1MKXH 2ZTZA 1P9UA 8KME2 3BEIB 5L6NH 4U30A 2FZZA 1OXGA 1SGCA 1C1MA 4INLA 4A5TS 1SGFA 1V2KT 3FFGA 1A5IA 4NIYA 3AW1A 3SU2A 1P2JA 4B2CA 3RM2H 3F1SB 3O8CA 3Q3YA 3SBKA 1Z8RA 4IN1A 1QNJA 1AGJA 3H7OA 4X1SU 1MTUA 4ESTE 2FESH 1B0EA 3C1KA 8LPRA 5TCAA 2VWOA 2V3HH 3S9CA 1C5YB 1GMHG 3K9XB 3UPEA 4Q80A 4KELA 1AO5A 1SI5H 1EP6A 1O3HA 1C4V2 2VGCC 1UK3A 1OS8A 1T8MA 2BDYA 4OS7A 2A4RA 4JMYA 4CRCA 1NFUA 1PYTD 4I8JA 2YNBA 1UTJA 2Z9IA 1GBFA 2PWXA 1NRPH 2R2WU 2ZGJA 3V12A 4ZKNU 1SB1H 3A7WA 3VPKA 1ZRKA 2C8YB 4LZ4B 4OGYA 5C1YA 3GOVB 3SHAH 3KIDU 1CT0E 2A4GA 3SV6A 1DWBH 1GHBG 2BY5X 3GCTF 1FDPA 4X1PU 2B8OH 1XUIA 1FQ3A 2QY0B 5JBCS 1V2JT 1NRSH 2O8UA 2SGDE 4VGCC 1YPKH 2CGAA 1DOJA 2ZGCA 1UVOA 3QZRA 1EAXA 1O3CA 2SGAA 1JXPA 4X6OA 4I33A 2SNWA 2AS9A 2EI6A 1T8NA 1RD3B 4GUXA 1YPLH 2ZU4A 1V2UT 5AFYH 5AHGH 3TGKE 4UFFH 1T31A 3RXPA 1A2CH 1O31A 3SORA 2FOCA 3LGWA 3PWCA 2XCNA 1RGQA 1O2IA 1SVPA 3GCNA 3QO6A 1QJ1B 2UUKB 1F0RA 2O8WA 4Q7YA 1W7GH 1SR5C 1CQQA 4CHAC 4A1TA 1C1VH 1E37B 2G51A 2OC0A 2QXHA 3ITIA 1HBTH 2FS8A 3SV9A 3A7XA 2F91A 4B73A 1GMDF 3RXBA 3EA8A 1FY4A 5FBIA 3SU3A 3F9HA 4I31A 5JB8S 5HM2A 1TX6A 1JBUH 3HK6B 1D6WA 1D3QB 3PM3A 4BTIB 1G37A 1BQYA 3E1XB 1LCYA 5ESTE 4B2AA 4JK6A 3V7TA 1ZJKA 2BX3A 1OKXA 1EJAA 1XXDA 3A85A 3A84A 3SGBE 1SLVB 2F9OA 1GG6C 4ABBA 4X2VA 1JIRA 3M36A 4X1QU 1A5HA 4Z6AH 2DE8A 1MZAA 1TALA 3PMAB 4ZH8A 1AB9C 2GTBA 1KSNA 1S83A 1EOLA 2VIDA 1QA0A 5EXNA 3T27A 3LJJA 2A5AA 2GZ7A 1YC0A 2BLWA 1SL3A 1O33A 4X8VH 3RXMA 5EW2H 4FUGA 1XUKA 3TH2H 1HIAA 2F83A 5B6OA 1TNHA 1AKSB 1SPJA 1SGRE 2WPIS 2G4UA 3A8BA 3SI3H 1HUTH 3LPRA 3F9GA 3ZZ4A 1J8AA 1SHHB 1B7XB 3UFAA 3SGAE 1LVBA 3ELAH 5EPYA 5T3HA 1DE7H 1PPZA 4MPXA 3M5MA 1C5RA 1KXEA 4CBNA 1EZUC 3I78A 4CH8B 2ANYA 2GVFA 2G5NA 3BTME 3AASA 5L30H 4ISOA 5T6FA 1D9IA 1TPOA 3RDZA 4J2YB 1IOEA 2J4IA 2XXLA 3ZZ9A 5DGJA 3FZZA 2H9EH 3RLWH 3UWJH 5GWZA 1QR3E 5L2YH 8GCHG 5F03A 1O2MA 2QV1A 3DHKH 4OS6A 3RMLH 3STJA 1NU7B 1K28D 2A4QA 3FP7E 1TMUH 1D3PB 1GPZA 5LPFA 1EUFA 4TY6A 1HJ9A 2J2UA 3RC6A 5J4SA 3D23A 1M9UA 1C1QA 1IQGA 3PO1C 3LDXH 1BCUH 1BMNH 2P16A 4F4OC 1LHDH 4CH2B 4K2YA 3V3MA 1GI2A 4R0IA 1O5GH 4GPGA 1PPCE 3KCGH 4JCNA 1FUJA 4DY7B 2OINA 1EAWA 2VWNA 4KP0A 3EYDA 3RC4A 5CHAC 3F6UH 2Y82A 4XE4A 3LGIA 1FJSA 1WTGH 1A4WH 3F9EA 1LPKB 2AMQA 2EI7A 1RIWB 4UE7H 2GMTC 1RTLA 3ATIA 4RSPA 3KQCA 3TGIE 1ZRBA 3LGUA 3MO9A 4Y76A 2UUJB 3ATLA 1C5QA 2GV6A 2PV9B 2J94A 5GDSH 1QRXA 1C4Y2 1MQ6A 2F3CE 1OSSA 1C2HA 1YKTA 4ABEA 1HJAB 3QGNB 1J17T 1NRNH 1V2OT 3UNRA 3SJ8A 3KN2A 4BXSA 1S6FA 4I8HA 4JZIA 3ATWA 2WPJS 3KHVA 1YCPK 1GCTC 4OS4A 1HAGE 1GHZA 3NXPA 5BPEA 1K1JA 2A0QB 1D3TB 2VH0A 3PMHB 1X7AC 1OYTH 2JH0D 3MH5A 1HAPH 4KGAA 4A1VA 2ZU3A 1PPHE 3KEEA 1PQAA 1BRAA 1MD7A 1S0QA 1XVOA 1FONA 5E2PA 4B2BA 2TRMA 1C4U2 4CBOA 2AGIX 2P59A 1G3EA 1O2JA 4XDEA 3ZVGA 4MTBA 2CF9H 1ESBA 3AAVA 3ZVFA 5G4BA 2KAIB 3ZZBA 4H42U 1F2SE 3PV4A 1K9OE 1W7XH 1BRUP 4INHA 3SJOA 1WU1A 1O2RA 2SFAA 4MLFB 4U01A 4NA7A 2G55A 1DICA 1ELAA 1EQ9A 1KLTA 1O2VA 2FOBA 3PLKA 1XM1A 4LK4A 2B9LA 1V2ST 1ABJH 3ZZAA 3TGJE 4ABFA 5DO4H 1WQSA 1GI8B 1U6QA 1GBEA 4GHQA 1QRWA 2FI3E 1GI9B 1EASA 1C5LH 4YESB 1YPMH 1ABIH 1P3CA 2PLXA 2F9VA 1SOZA 2RDLA 4CRBA 1GMCF 3ATMA 3UY9A 1EZSC 4WF8A 1G32B 4X2XA 1GG6B 1HAIH 2HRVA 3QN7A 1EATA 3RLYH 1YCPH 2VNTA 5CE1A 3GY4A 2D8WA 2A7HA 4K1SA 3SUDA 4PROA 3LONA 1BBRE 1NESE 2OD3B 3DFLA 3A89A 2FOEA 1GHBF 1DDJA 3MO3A 1E35B 1ELFA 2Q1JA 1QB1A 2AMDA 4UFDH 3E91A 3O8BA 1DWDH 2AMPA 2XTTB 3BIVH 2UWOA 4IC6A 2RCEA 1QL7A 3ZV8A 4YOJA 1AQ7A 1AY6H 1ELGA 1CE5A 2LNCA 3RMMH 4WVPE 2IN2A 2H6MA 2ASUB 1DM4B 2XBWA 1J14A 3M7TA 4X1RU 1OYQA 1DSTA 1TRYA 1GI1A 1O2LA 2BZ6H 2P3UB 3P17H 1P12E 1DLEA 2A1DB 1EPTB 1Z8JB 1BZXE 4B74A 1IQEA 2ZZUH 1QL9A 3M35A 3DUXH 1O0DH 3A82A 3LGVA 3TK6A 3QDZB 4DOQA 4GHTA 5A0AE 3D65E 2FOFA 1ZSKA 3M5NA 3SNAA 5C1XA 1EX3A 2ZPRA 1QBVH 2BDIA 2G4TA 3OY6U 1AHTH 1NN6A 1WOFA 3KL6A 1JMOH 4I7YH 3RXLA 3TU7H 3A83A 3RU4D 2ZKSA 1QIXB 2ZU5A 2PSXA 1ACBE 4BXWA 1QGFA 1BHXB 1QBNA 1ETSH 2OC1A 4AGKA 2BDHA 5C2ZA 1RRKA 1JRTA 1C1NA 2ZO3H 2UUFB 3M37A 2ZCHP 4O9VA 4NG9H 5HGGA 5GJ4B 1V2NT 1HAVB 7GCHF 2D26C 1YPGH 2ZDMA 1P2KA 1ELVA 1MZDA 2QF3A 2GZ8A 3GY3A 1NFXA 1TAWA 2F9BH 3L3TA 2ZFQH 1ELTA 2Q6FA 3V0XA 4XBBA 1TGNA 4ISNA 1DXWA 1RTKA 2BVSH 3U98H 1BMMH 2ZFPH 1G3DA 3SQHE 3VB6A 1CGIE 1IQNA 1GI4A 2J95A 3P8GA 4K69A 2XBXA 3GICB 2OTVA 2TGAA 1XX9A 1HAOH 3MI4A 1O3GA 1GBTA 1BOQA 2TGDA 3B23B 2FS9A 4Q7ZA 3QK1A 2ODQA 5J4QA 1ARBA 1YM0A 2ZC9H 1GBIA 4I8LA 2VIPA 1HV7A 4AOQA 4RN6A 1TNKA 3D49H 3LIWA 2C93B 4TY7A 2ODPA 2VB0A 3VB4A 2ULLA 2J38A 2VIOA 1O3DA 3LKWA 4D9RA 3HKIB 2WV4A 3SU4A 3S7HB 3QWCH 1XUHA 1QFKH 4B76A 1ZTJA 1IHTH 1NTPA 1ZMLA 3SU5A 3GYLB 4R8TB 3TK9A 1NRQH 5A8ZA 4OS5A 4O03A 1INCA 1HYLA 4YZUA 5DJ7A 1F5LA 3ZYDA 8GCHF 2WPMS 2O8TA 2RA0A 2BOHB 4AORA 3UOUA 3IITA 3A7YA 1XKAC 1G3CA 2BX4A 4FUJA 5JBBS 1SC8U 1P0SH 1AN1E 4A6LA 1P05A 1NT1A 1ELEE 1IQKA 1ETRH 2C4FH 4ABGA 1B5GH 5EPNA 2FOMB 1TBRH 2FTLE 3GYMA 5A0CA 1RJXB 2D2DA 3B9FH 5FX5A 2EEKA 3GY6A 3TH4H 1SGNE 5GIBA 1QA7A 4XFQA 4WY3A 5DG6A 4AFSA 1T7CA 1TGSZ 4FU7A 1VITH 1NS3A 1Y8TA 1DLKB 1TB6H 1SGPE 5GXPA 1GHVH 4ABIA 5CMXH 1E0FD 1UTLM 2Z9KA 3EGKH 4WH8A 3BEUA 2JETC 3UNQA 1XUJA 4Y7AA 1L4DA 4JZ1A 2A2XH 3LC3A 5A8YA 2TBSA 3IWMA 3BTTE 2A5KA 3R0FA 3ZVEA 5SGAE 4UEHH 3RXCA 1XMNB 2ZFRH 2JH6D 1UHBB 1UTOA 3RXOA 1MAYA 3HGNA 1PYTC 1TONA 5DP6A 2OLGA 4MPVA 1V2PT 2NU4E 3TLOA 1MMJN 1K22H 1UTKA 2IJOB 3BTHE 1CVWH 1W14U 4B1TA 2QXGA 3UR9A 1PPGE 1AU8A 1T4VH 1MBQA 3STIA 1C5PA 1FAXA 3BTQE 1EJNA 4Q2KA 1GI7B 3UQOA 4JK5A 2NU2E 2Y7XA 1P03A 3KF2A 5DP3A 1TQ0B 3ZVCA 3I77A 3FP6E 1QJ6B 2STBE 2ZFFH 5EU8A 2ZDVH 1RIWC 4BAQB 1O3PB 2G5VA 4ZHMU 1CGJE 1UTPA 1AKSA 2HNTC 1KTSB 1OWEA 1NRRH 5H4IB 2BVXH 2FX4A 1ESTA 3Q00A 3T5FH 4CRDA 2GCTB 1EZXC 1UK4A 1A0LA 2QXJA 1ZLRA 2ZDAH 3A7ZA 1HJAC 2HPQH 3FANA 4BOHA 1P2NA 2ZCKP 2ZF0H 1RFNA 1DSUA 1UJ1A 2HNTE 1D3DB 2Y81A 4K3JA 1GHAG 1L1JA 2AIQA 3ENSB 1BTYA 1FI8A 1TFXA 1O3MA 1WTHD 3UIRA 4FVBA 1NC6A 1WV7H 2ZHWH 4Y8XA 1CHOG 2GDEH 3DT0H 1ELCA 3RXVA 1LHCH 4GVUA 2FOHA 4JZDH 1YPHC 2F9UA 1O5BB 2PUXB 2Q6DA 2GCHG 1G3BA 3OU0A 3TNTA 2G81E 1YPJH 3F68H 2OBQA 1MAXA 5EGMA 1GDUA 3PROA 4U2WA 3S9BA 1UCYH 4ABJA 3K6YA 1LO6A 2CF8H 5E8EH 1QHRB 1YPHE 3QTOH 3O8DA 3OY5U 3SU1A 5JB9S 4MVNA 4Q7XA 1KDQB 5FAHA 4D9QA 1P2MA 3A8AA 2WPHS 1WCZA 1QY6A 1VGCB 5LH8A 1K1PA
chains in the Genus database with same CATH superfamily
3GISB 5BRRE 1PQ8A 2ZNKH 1N6XA 3QLPH 2VINA 1CA8B 1YP9A 2P94A 2Y5GA 4NZLA 2PUQH 5C5OA 3SNCA 2R0LA 1Y5AT 1AWHB 1QJ7B 1JRSA 2O8MA 1MCVA 5FX6A 1AI8H 2BM2A 5C94A 2BD9A 4TPYA 1LHGH 1EXFA 7KMEH 5KEDA 3DD2H 3A87A 1C1TA 3SJKA 2FWWA 1NROH 2NU3E 1C5TA 2ANWA 2H5DA 1DT2A 3EE0B 4WXIA 5DP9A 3B8JA 1K1LA 1P9SA 2PKSB 1FIZA 3A8CA 1C2EA 4IGDA 3H5CB 4Y6DA 1O3IA 2IJD1 2A7JA 2XW9A 3NRLA 3Q3XA 1O2TA 3BG8A 8ESTE 1ZTLA 3Q77A 2O9QA 1S6HA 1LTOA 1NZQH 3UQVA 1C2KA 1EAUA 4NIXA 4AN7A 2QGRA 4Y11E 1L1GA 1J15A 2ZTXA 2KR7A 1MTVA 4JYUH 1V6DA 3VXFH 3EDXB 2ZQ1A 1GI0A 1GJ5H 1TX7A 4X8TH 3MO6A 3BIUH 2KAIA 1C2FA 3KGPA 2H9HA 2FO9A 1GVLA 4RKJB 1C9PA 3U8RH 2PW8H 1W2KH 4AFUA 1GJ9B 5HMAA 1C9TA 1ZMJA 4Y71A 3OX7U 1TWXB 5E2OA 5K0HA 4HI3A 2QF0A 1EPTC 5HIZA 5I46H 3RXDA 1ANEA 3RXGA 1QBOA 3SUGA 5LPEA 3T2NA 2XBYA 4X1NU 1Y3VA 2JETB 4IBLH 1AZZA 2DUCA 2ZHEH 2ZIQH 1YY3A 2VWMA 1CO7E 1UVSH 3DSOA 3NCLA 2YNAA 4NA9H 3F3BA 3SU0A 4MPUA 2WPKS 1HB0B 4D7FA 1O2HA 1NO9H 3R3GB 1F92A 2FM2A 3K2UA 3GDVA 3PLPA 1LPGB 1K1NA 2CHAB 3HK3B 1EAIA 3LJOA 3KNXA 3KYFA 1PPFE 1KLJH 1YLNA 4BAOB 1BMFD 2CMYA 1W11U 1PQ7A 3OTPA 5EQSA 5FCKA 4MNVA 1ZOMA 1GJAB 3Q76A 1V2WT 4GCHG 1W0KD 1ZYOA 1ANCA 1TNJA 3TIUA 1GCDA 3UREA 3MU1A 4I8KA 2ZPSA 1BIOA 3BG4B 4FXGH 4CREA 2ZTYA 5C67A 1A0HB 3M61U 1O2SA 1GJ8B 1BTUA 3MU5A 4IMZA 1EP5A 1O2PA 2O8LA 3MH4A 1FN8A 3QTVH 1YYY1 1HNEE 2NU1E 3MU8A 1AWFH 3T29A 3E8LA 5JDUB 2UWLA 2ANKH 1IQJA 4YO9A 3TJOA 5E0HA 1BUIA 2PTCE 1O39A 1C5UA 1AFQB 1TABE 3BTDE 3H09A 1TGBA 3U8OH 2XNDD 3S0NA 4J1YA 6ESTA 2VIVA 1OWDA 2WYJA 4LZ1H 2GT8A 4BTTB 1EPTA 2BLQA 1CHGA 2BQWB 4YLUA 3LH1A 3O8RA 3BEFB 5A8XA 1TOCB 1LPZB 1BITA 1SSXA 1THRH 5JBTA 1O34A 2WSSD 3OAAD 5EOKA 4GSOA 5EXMA 5FPSA 5DP8A 1A3EH 2ZCLP 3ZZCA 3PTBA 1ZHRA 4UD9H 4CRGA 3G01A 3U1IB 1C1SA 4FUCA 2BXUH 3M5OA 5GCHG 1Z7KA 1BTZA 1Z1JA 1BTWA 1RXPA 3TH3H 3MYWA 4ASUD 1QL8A 1TOMH 5DSFA 1LVYA 1N8OB 3RMNH 4CR5A 3VB5A 3TPIZ 1IQLA 2BD4A 1GHYH 3I29A 2Z3EA 4X6PA 6CHAB 3N7EA 2W3KA 1GMHF 1GBBA 3LU9B 1MU6B 5JBAS 1AFEH 4ZHAA 4ZXYH 1HAVA 2PSYA 2STAE 2G8TA 3GCTG 1DPOA 2JJ1D 4I32A 1CA0B 2FXRA 2K1QA 1C1RA 2W3IA 1SGTA 1W8BH 4X2WA 3SN8A 4AB8A 4XBCA 1HRTH 2UUYA 1VKYA 4FU8A 2IOTA 3MNBA 2OQUA 3ODDA 3UOPA 2CV3A 4YOGA 1SHYA 2Z6BD 2B5TB 3ODFA 2GP9B 1FN6A 1A61H 1G9IE 1O2ZA 2IPQX 3E3TA 1AZ8A 5KECA 1MH0A 1H4WA 2ZDNA 4M7GA 4XBDA 1AE5A 1GGDB 3QGJA 3RXJA 2BLOA 2QF4A 2FTMA 3LOXA 3M3TA 1DITH 5C20A 1VCQA 1QTFA 1WBGB 2R3YA 4B71A 2ANMH 4IS5A 1MUEB 1NPMA 1NFYA 3M7UA 3SNEA 4ZKRU 1O37A 4YLQH 1OPHB 4WXVA 1W13U 1H9HE 2G00A 1YCPM 4UONA 1G30B 1FZZA 2BZAA 2BYAX 5ETXA 1GHAF 1V2VT 4DIIH 2SGFE 3ZZDA 2QC2A 2ZU2A 1CHOF 1EFRD 2OBOA 1F5KU 3ZZ3A 1S5SA 2R0KA 4NSYA 3MNCA 4QT8C 1XUGA 3T28A 1K21H 4RKOB 1TPPA 2GCHF 3ZZ6A 1BA8B 1BJVA 2XCFA 4Q63A 2VBCA 3LT3A 4IMQA 3LC5A 2WHXA 4MNYA 1KIGH 1GVZA 1A46H 1GHWH 1O2KA 1SMFE 1AD8H 2W6ID 1O3LA 1BMAA 2EI8A 4BANB 4RT1A 4KTSA 4H6SB 4RT0A 2GCTC 2VU8E 4GAWA 1PQ5A 5LGOA 1YWUA 4BAHB 4I86A 1SGEE 2P3FH 3TVJB 5C0TA 4BAMB 1KXCA 1H8IH 2H9TH 2HGTH 1AVGH 1W3CA 3F2GA 4H4FA 1YLCA 5CHBA 3MH6A 4IC5A 1NBME 3BSQA 3ZZ8A 2Z9LA 3AK5A 3P92A 1ZSLA 3RU4E 2V3OH 2RA3A 1C5WB 3ZZ7A 1EZQA 1G2MA 4BAKB 2A5IA 3ZZ5A 1LDTT 3P70B 1SG8B 1E79D 4A1XA 3OTJE 3ZVAA 2AIPA 2XC4A 3PLBA 1VZQH 1Y3WA 1H9LB 4JYVH 2GT7A 2AEIH 6GCHG 5T6DA 1ANDA 1D6RA 3DSGA 2H2ZA 2SGPE 1GBKA 2FYQA 3OEHD 1K1IA 2C8XB 1VCPA 2Y5HA 2PTNA 2W7SA 2D1JA 2BHGA 2ALPA 5EQRA 1DXPA 3M5LA 3GCHB 2I6QA 1WYKA 4ZKSU 3HATH 1K1OA 1S84A 2IPHA 3NZIA 2BXTH 1COWD 1GBCA 2DE9A 4ISLA 3SUFA 3L6PA 1SLUB 3U69H 2Y7ZA 2ZP0H 3GDSA 2XRCA 5IYTA 3RXAA 2SNVA 2AGGX 1E38B 1QCPA 1VGCC 2YMSB 1NM6A 1SOTA 3DSPA 3RXIA 4AG1A 2GDDA 1AUTC 1C1UH 1DWCH 1K1MA 1JIMA 3BV9B 4XOJA 3RP2A 4K60A 1Y3UA 2J98B 3K6ZA 3MNXA 1UTNA 1GBDA 1P01A 2M5TA 2FEQH 3E0NB 5EG4A 1OOKB 4ACAA 1GI6A 1LVOA 1IHSH 1W10U 1FIWA 2ZGBH 4WWYA 3M3SA 2BD8A 3A7VA 1LQEA 1HAYB 5C5NA 3SU6A 3GY8A 2PKSC 1CT4E 1AIXH 2WINI 2HOBA 1C1PA 5FXLA 4H6TA 2BTCE 3VGCB 3UWIA 4IN2A 2R3UA 2ZHFH 2FDAA 3BN9A 3ZVBA 4ABDA 3P8NA 4AFQA 3TK5A 1O5FH 3UTUH 2LPRA 2C90B 3VEQB 1YPEH 1FLEE 1DX5M 5C3NA 5ABWA 3BF6H 1KXAA 2WUCA 3ZIAD 2KZ4A 5FCRA 1W12U 3PTNA 1Z6EA 1O3EA 3Q3KA 2TPIZ 3PMBB 1C5MD 3F2FA 1KDQA 3LGTA 4FU9A 1S0RA 3EA9A 1C5OH 2FI5E 2PKAB 2OCVB 2AERH 3SZEA 4F55A 3AAUA 2M2AA 2WV5A 3C27B 3D62A 1LKBA 3P95A 3P6ZB 4AFZA 1W0JD 2OP9A 1V2MT 1O5DH 3RXKA 1FY8E 1F0TA 1WUNH 2BD7A 1Z8IB 1H1BA 2FLBH 2ZPQA 2JH5D 1GJ7B 2OC8A 4CRFA 1V2RT 1DWEH 4KTUA 2XWAA 1Q2WA 1BBRH 1Y5BT 4WMDA 4F49A 3MOCA 1BJUA 1O5AB 1K2I1 3F0PA 1UCYK 3FZDA 1EB1H 3M7QA 1S6LA 1E34B 3SV7A 2ZI2H 2PGQB 2B7DH 1GI5A 2A7CA 3U9AH 2AGEX 4HGCA 4AC9A 2CHAC 2FP7B 1BRBE 3BTKE 1ZGVA 3PRBA 1O32A 1F0UA 4AGJA 1GJ4H 5JPMH 5LPRA 2VVUA 4D76A 1XKBC 1BTPA 2QAAA 4K1EA 2FI4E 3BTGE 1MKWH 2BB4A 4O97A 3S69A 1XVMA 2HVYB 1SLWB 5F53A 1O2YA 4JYTA 5GCHF 4CRAA 3BG4C 1JWTA 3SO3A 2ZWLH 4ZUHA 3DFJA 1GMCG 4THNH 2HLCA 2JDID 1MTNB 1BMLA 3F0OA 1TIOA 1Z71A 3KQEA 1Q3XA 1ELDE 1TBZH 2BD3A 3MTYA 1YLDA 4Y7BA 1ZMNA 2GGVB 3EQ0H 1GBLA 1GBJA 1AFQC 3QUMP 4SGAE 3T25A 4NGAH 1S85A 2KCAA 1DVAH 1P8VC 3N7OA 3RXSA 4TYDA 4X0WU 3VXEH 2BDCA 6LPRA 5EJLA 1E1RD 3GY2A 2OXSA 3NK8A 4NA8A 1DFPA 2Y80A 2HALA 1OWHA 2I6SA 1O3OA 3DA9B 3RXHA 1BTXA 3RXUA 3TITA 4ABHA 4TPIZ 2F9PA 1CU1A 1VITG 2HVXA 1E36B 2BY8X 1Z6JH 1QQUA 1OP8A 4OS2A 4X8UH 1MTWA 1THSH 1THPB 1SFIA 1DY9A 1FX0B 1N6YA 1F5RA 1SGIB 4WMEA 1GL1A 2W5EA 2NU0E 4INKA 3LGYA 2HNTF 3DCLA 3E6PH 2VIQA 1HLTH 3RXFA 5EW1H 1N8OC 2EA3A 4FUBA 2VVVA 2XBVA 5EJ1A 1AUJA 3TJVA 4Y8YA 1OX1A 2P8OB 3CS7A 6CHAC 1SQTA 2J9NA 1MCTA 1MD8A 1YBWA 2BY6X 1QB9A 1ZR0A 1DY8A 2ZQ2A 3RUOA 1HGTH 1MABB 1WAYB 3E16B 1T8LA 3T26A 4MQAA 1UVPA 1HAZB 4DJZB 2V6NA 1CA0C 4E05H 4WMFA 1VJ9U 1P57B 4D7GA 2F9NA 1SQAA 5DP7A 1LQDB 4WJG2 1OP0A 2QA9E 1DUAA 1IQFA 2BOKA 1KY9A 3PV5A 3SNBA 3NUMA 4I8GA 3FN8A 1ZJDA 1LHEH 2XNIA 1E1QD 4FETA 1A1RA 1O38A 1P06A 5AFZH 2PR3A 1GGDC 1P2QA 3UUZA 9LPRA 1Y59T 4ASHA 4K8BA 2Z9JA 4AX9H 5F8TA 1O36A 7GCHG 2WYGA 1FPHH 2Z94A 3FO8D 3SZNA 3WW7A 4NCYA 1KYNA 3NPSA 5DP5A 4ZHLU 1SGDE 2ZG0H 3FOAA 2Z9GA 2ZGHA 2BDBA 1HJ8A 1OWJA 1QQ4A 1SFQB 1AMHA 3H7TA 3NKKA 3P8OA 2ESTE 1O2UA 2BDAA 3SI4H 1IAUA 4MNXA 1RS0A 1CT2E 4DCDA 4DG4A 4NIVA 1NFWA 4M9FA 4ZROA 4Y0YE 4FUIA 1ESAA 4WH6A 4UFGH 4DVAU 3A86A 1H9IE 1FPCH 3TNSA 1L1NA 2R9PA 2GV7A 6GCHF 1SLXB 2ZHDA 2VH6A 1T32A 1F0SA 5K7RA 2G52A 5EXLA 1C5ZB 1GBMA 1V3XA 4NWLA 3RU4T 1ETTH 3TJUA 2C3SA 2VWLA 1ZZZA 1J16A 2TGTA 5PTPA 4FUDA 1PPEE 2BQ6B 1CBWC 4D8NA 3TJNA 3FVFB 1C5VA 4DURA 3SNDA 2PHBA 4FUHA 1N1LA 1O5CB 2GZ9A 2ZDKA 3A80A 1TA2A 3P8FA 4KTCA 1CGHA 1HXEH 4JZEH 1O3BA 3QX5H 1QURH 3MHWU 3FKSD 5AF9H 5HM9A 1MU8B 3T62A 4DIHH 1Y5UT 1O5EH 1EOJA 3IG6B 1TA6A 4FUEA 2YOLA 1D4PB 2EQNA 1HCGA 3RXQA 4NWKA 2FOGA 3V13A 1SGFG 1TRNA 2VGCB 4DT7B 1EJMA 2FLRH 3MMGA 1C2JA 2RDEA 4FOUC 4P00A 1L0ZA 2FPZA 1UVUH 3ZVDA 4ACBA 4TWYA 1P02A 1Z1IA 1C5NH 2ZU1A 4NFEA 1GBHA 2C8ZB 3GCHC 5DKMA 1FV9A 2NWNA 3F9FA 4ISIH 2H5CA 2QIQA 4YM9A 1GHXH 5L2ZH 3VB7A 1ANBA 3E90B 1BT7A 5EQQA 2BD5A 2ZFTA 1DUEA 1V2TT 2JKHA 1TNLA 2A32A 1ARCA 2XYAA 3MH7A 2P93A 1HPGA 2FX6A 2GKVE 2VIWA 2YMSC 3KQ5A 5F8ZA 3A7TA 4Z0KA 4TWWA 3MU4A 2PFEA 4LOYH 4HFPB 2ZFSA 5JYIA 1O35A 2P3TB 3W94A 1EKBB 2ILNA 4E7RG 1FNIA 1C5XB 2CN0H 2YMSD 3MWIU 1FAKH 1BHXF 4VGCB 1L4ZA 3ATKA 1HAHH 1TMBH 3PYHA 7ESTE 4Y10E 3BTFE 4E06H 1O2NA 1IQMA 1VCWA 3GY7A 1OP2A 3RXRA 3MU0A 1UVTH 4ZAEA 3A81A 5FPTA 1S81A 1VR1H 1OWKA 1FY3A 1KLIH 2Y5FA 2BMGB 4NIWA 5EODA 5HIYA 1C2MA 5DP4A 1HIAB 2UWPA 1CSOE 2LP6A 3OYPA 1OWIA 1PFXC 1A0JA 3VGCC 3ZYEA 4YT6H 2OUAA 4DT4A 1QRZA 1KMHB 1TGCA 1PPBH 1TMTH 3CS0A 4O3UA 4CHAB 3CP7A 3RC5A 2SGQE 1C2LA 1YGCH 2WUBA 3RMOH 1UTQA 1NY22 3URDA 1ZHPA 4X2YA 1SBWA 2KM0A 7LPRA 1O2GH 1HFDA 3VB3A 1HAXB 1BB0B 4ISHH 1KXBA 1TBQH 1TE0A 3K65B 2OQ5A 2XC5A 1UMAH 3GS9A 2BVRH 2SGEE 1C1WH 5F8XA 1ZTKA 2Z3DA 1SGQE 3M3VA 1FXYA 1ZPZA 4BNRA 1QB6A 2QYIA 3SJIA 3N7DA 3BTWE 3UNSA 2BDGA 1Y3YA 1C1OA 4OS1A 1IQHA 4K8YA 4OGXA 1P10A 1ORFA 4FUFA 2J98A 3RXTA 2FMJA 2BD2A 2JIZD 1WSSH 3HPTB 3KQDA 3AW0A 1MTSA 3GY5A 4MNWA 1AVXA 1AB9B 1O2XA 4AYVB 1T4UH 1VJAU 1GJCB 3U28C 4ABAA 3E0PB 4MG3A 1FMGA 4A92A 5T6GA 3N99A 1DANH 1O3FA 5I25A 1P2OA 2THFB 1GMDG 1P3EA 5IDKA 2ZDLA 1HXFH 1UO6A 3MFJA 4E7NA 4X6NA 2TIOA 3S7KB 2A31A 1G36A 4NSVA 3RXEA 2XWBI 5DPAA 5FBEA 1VITF 2RG3A 2FYRA 1P2IA 2WPLS 2W7UA 4HTCH 5F6MA 4ZMAH 3MNSA 1O2WA 2XC0A 4DGJA 1ID5H 4AB9A 4TT3D 1MTNC 3SV2H 5HYOA 1GL0E 2OC7A 1CBWB 3QZQA 2BQ7B 1A5GH 4X6MA 3WY8A 1GI3A 4K5ZA 4UDWH 2C8WB 3SJ9A 2GX4A 3NWUA 2PKAA 4AYYB 3URCA 2ODYB 1C2IA 4LXBH 2KCOA 1W0YH 1GJ6A 1C2DA 4MDSA 1XXFA 2QXIA 2HPPH 5KGOA 5DK1A 1P11E 4HZHA 2V0BA 1TNIA 3U1JB 2V35A 1BRCE 3KQBA 5GPIB 5A0BA 1TX8A 3CENA 4P02A 4X8SH 1TNGA 3PO1B 3VG8A 1LMWB 1TGTA 3S9AA 1A3BH 1AVWA 1RTFB 1BTHH 3GDUA 5TCCA 3L33A 1T8OA 1UHBA 2ZA5A 1ZPCA 3UR6A 3EE7A 1KTTB 4UFEH 1TPAE 3GCOA 2GD4B 4AZ2B 1J9CH 1Z8GA 1GJBB 2ZEBA 4A7IB 1UCYE 1GDQA 5AVDA 2QN5T 3A88A 4ZXXH 1P09A 3SUEA 1TRMA 5TJXA 1ZGIA 1GJDB 5ESBA 3U8TH 1PJPA 1BDAA 1SGYE 1TYNA 5CHAB 1TPSA 3SGQE 2ZHQH 1HDTH 3EAJA 1LKAA 2J34A 2CJIA 3UB0A 3FAOA 2GMTB 4YOIA 2P8OC 2VJ1A 4O3TA 1S82A 3PB1E 5HXFA 2VVCA 4BTUB 1GVKB 1ZPBA 3VFEA 5FHTA 2HWLB 2R2MB 1MBMA 1O2QA 1ZHMA 1WQVH 1GWAA 2AYWA 2PGBB 4ZKOU 1Y3XA 3AVZA 4GLYA 3PMJA 1MKXK 4IW4E 2TGPZ 1O2OA 2Z7FE 1O3AA 3KYGA 1BBRK 5E0JA 1O30A 2FOAA 1O3KA 4NFFA 5FPYA 2ALVA 2B0FA 1GCTB 1IQIA 1P04A 2BLVA 4AG2A 1NU9A 2ZECA 1F7ZA 1G2LA 1XUFA 2EC9H 4XSKU 2A2QH 2J92A 3CNRA 4K1TA 4Y0ZE 1TLDA 1V2QT 2Y6TA 1EB2A 3EA7A 1V2LT 2FIRH 1TQ7B 4MPWA 2ZGXH 4Y79A 3RM0H 1FY1A 2V7QD 1ELBA 4KKDA 1SQOA 1YF4A 3BTEE 3SQEE 2CXVA 3SOSA 1MKWK 1KXFA 2A45B 4YT7H 4B75A 1UTMA 3ESTA 2H1UA 2W26A 4Y8ZA 4NZQA 1C5SA 3W95A 2AFQB 1L2EA 1H8DH 3JZ1B 3JZ2B 4JZFH 3OSYA 2XOKD 1DS2E 1LHFH 3ZV9A 1JOUB 2Q6GA 2Z3CA 3FP8E 4DW2U 1ZSJA 5C1UA 1Q31A 1GBAA 1MQ5A 1GDNA 1A7SA 1KXDA 3PWBA 9ESTA 2BY9X 3HGPA 2AH4X 4GCHF 3A8DA 1O3JA 3SV8A 5A2MH 1O3NA 2P95A 2QCYA 3LH3A 1FY5A 4SGBE 2BY7X 1B0FA 2A4OA 3HKJB 5E0GA 1AE8H 1W0ZU 1UK2A 5A09A 4YTAA 3SHCH 3SW2B 4CR9A 2FODA 1C2GA 4U32A 4FVDA 1LVMA 1MKXH 2ZTZA 1P9UA 8KME2 2KCPA 3BEIB 5L6NH 4U30A 2FZZA 1OXGA 1SGCA 1C1MA 4INLA 4A5TS 1SGFA 1V2KT 3FFGA 1A5IA 4NIYA 3AW1A 3SU2A 1P2JA 4B2CA 3RM2H 3F1SB 3O8CA 3Q3YA 3SBKA 2KFWA 1Z8RA 4IN1A 1QNJA 1AGJA 3H7OA 4X1SU 1MTUA 4ESTE 2FESH 1B0EA 3C1KA 8LPRA 5TCAA 2VWOA 2V3HH 2KX4A 3S9CA 1C5YB 1GMHG 3K9XB 3UPEA 4Q80A 4KELA 1AO5A 1SI5H 1EP6A 1O3HA 1C4V2 2VGCC 1UK3A 2KCYA 1OS8A 1T8MA 2BDYA 4OS7A 2A4RA 4JMYA 4CRCA 1NFUA 1PYTD 4I8JA 2YNBA 1UTJA 2Z9IA 1GBFA 2PWXA 1WDIA 1NRPH 2R2WU 2ZGJA 3V12A 4ZKNU 1SB1H 1K0HA 3A7WA 3VPKA 1ZRKA 2C8YB 4LZ4B 4OGYA 5C1YA 3GOVB 3SHAH 3KIDU 1CT0E 2A4GA 3SV6A 1DWBH 1GHBG 2BY5X 3GCTF 1FDPA 4X1PU 2B8OH 1XUIA 1FQ3A 2QY0B 5JBCS 1V2JT 1NRSH 2O8UA 2SGDE 4VGCC 1YPKH 2AHME 2CGAA 1DOJA 2ZGCA 1UVOA 3QZRA 1EAXA 1O3CA 2SGAA 1JXPA 1QZ8A 4X6OA 4I33A 2SNWA 2AS9A 2EI6A 1T8NA 1RD3B 4GUXA 1YPLH 2ZU4A 1V2UT 5AFYH 5AHGH 3TGKE 4UFFH 1T31A 3RXPA 1A2CH 1O31A 3SORA 2FOCA 3LGWA 3PWCA 2XCNA 1RGQA 1O2IA 1SVPA 3GCNA 3QO6A 1QJ1B 2UUKB 1F0RA 2O8WA 4Q7YA 1W7GH 1SR5C 1CQQA 4CHAC 4A1TA 1C1VH 1E37B 2G51A 2OC0A 2L74A 2QXHA 3ITIA 1HBTH 2FS8A 3SV9A 3A7XA 2F91A 4B73A 1GMDF 3RXBA 3EA8A 1FY4A 5FBIA 3SU3A 3F9HA 4I31A 5JB8S 5HM2A 1TX6A 1JBUH 3HK6B 2EY4C 1D6WA 1D3QB 3PM3A 4BTIB 1G37A 1BQYA 3E1XB 1LCYA 5ESTE 4B2AA 4JK6A 3V7TA 1ZJKA 2BX3A 1OKXA 1EJAA 1XXDA 3A85A 3A84A 3SGBE 1SLVB 2F9OA 1GG6C 4ABBA 4X2VA 1JIRA 3M36A 4F48B 4X1QU 1A5HA 4Z6AH 2DE8A 1MZAA 1TALA 3PMAB 5EIYA 4ZH8A 2WV9A 1AB9C 2GTBA 1KSNA 1S83A 1EOLA 2VIDA 1QA0A 5EXNA 3T27A 3LJJA 3W1EA 2A5AA 2GZ7A 1YC0A 2BLWA 1SL3A 1O33A 3MQKC 4X8VH 3RXMA 5EW2H 4FUGA 2RFKC 1XUKA 3TH2H 1HIAA 2F83A 5B6OA 1TNHA 1AKSB 1SPJA 1SGRE 2WPIS 2G4UA 3A8BA 3SI3H 1HUTH 3LPRA 3F9GA 3ZZ4A 1J8AA 1SHHB 1B7XB 3UFAA 3SGAE 1LVBA 3ELAH 5EPYA 5T3HA 1DE7H 2QF5A 1PPZA 4MPXA 3M5MA 1C5RA 1KXEA 5DN6D 4CBNA 1EZUC 3I78A 4CH8B 2ANYA 2GVFA 2G5NA 3BTME 3AASA 5L30H 4ISOA 5T6FA 1D9IA 1TPOA 3RDZA 4J2YB 1IOEA 2J4IA 2XXLA 3ZZ9A 5DGJA 3FZZA 2H9EH 3RLWH 3UWJH 5GWZA 1QR3E 5L2YH 8GCHG 2LELA 5F03A 1O2MA 2QV1A 3DHKH 4OS6A 3RMLH 3STJA 1NU7B 1K28D 2A4QA 3F2HA 5B6LA 3FP7E 1TMUH 2PP6A 1D3PB 1GPZA 5LPFA 1EUFA 4TY6A 1HJ9A 2J2UA 3RC6A 5J4SA 3D23A 1M9UA 1C1QA 1IQGA 3PO1C 3LDXH 1BCUH 1BMNH 2P16A 4F4OC 1LHDH 4CH2B 4K2YA 3PV2A 3V3MA 1GI2A 4R0IA 1O5GH 4GPGA 1PPCE 3KCGH 4JCNA 1FUJA 4DY7B 2OINA 1EAWA 2VWNA 4KP0A 3EYDA 3RC4A 5CHAC 3F6UH 4OM9A 5EJZA 2Y82A 4XE4A 3LGIA 1FJSA 1WTGH 1A4WH 3F9EA 1LPKB 2AMQA 2EI7A 1RIWB 4UE7H 2GMTC 1RTLA 3ATIA 4RSPA 3KQCA 3TGIE 1ZRBA 3LGUA 3MO9A 4Y76A 2UUJB 3ATLA 1C5QA 2GV6A 2PV9B 2J94A 5GDSH 1QRXA 1C4Y2 1MQ6A 2F3CE 1OSSA 1C2HA 1YKTA 4ABEA 1HJAB 2WZQA 3QGNB 1J17T 1NRNH 1V2OT 3UNRA 3SJ8A 3KN2A 4BXSA 4XD7D 1S6FA 4I8HA 4JZIA 3ATWA 2WPJS 3KHVA 1YCPK 1SKYE 4XRNA 1GCTC 4OS4A 1HAGE 1GHZA 3NXPA 5BPEA 1K1JA 2A0QB 1D3TB 2V3MA 2VH0A 3PMHB 1X7AC 1OYTH 2JH0D 3MH5A 1HAPH 4KGAA 4A1VA 2ZU3A 1PPHE 3KEEA 1PQAA 1BRAA 1MD7A 1S0QA 1XVOA 1FONA 2K0QA 5E2PA 4B2BA 2TRMA 1C4U2 2K8IA 4CBOA 2AGIX 2P59A 1G3EA 1O2JA 2GJGA 4XDEA 3ZVGA 4MTBA 2CF9H 1ESBA 4ZCNA 3AAVA 3ZVFA 5G4BA 2KAIB 3ZZBA 4H42U 1F2SE 3PV4A 1K9OE 1W7XH 1BRUP 4INHA 3SJOA 1WU1A 1O2RA 2SFAA 4MLFB 4U01A 4NA7A 2G55A 1DICA 1ELAA 1EQ9A 1KLTA 1O2VA 2FOBA 3PLKA 1XM1A 4LK4A 2B9LA 1V2ST 1ABJH 3ZZAA 3TGJE 4ABFA 2JJ2D 4Z1MD 5DO4H 1WQSA 1GI8B 1U6QA 1GBEA 3SYJA 4GHQA 1QRWA 2FI3E 1GI9B 1EASA 1C5LH 4YESB 1YPMH 1ABIH 1P3CA 2PLXA 2F9VA 1SOZA 2RDLA 4CRBA 1WXRA 1GMCF 3ATMA 3UY9A 1EZSC 4WF8A 1G32B 4X2XA 1GG6B 1HAIH 2HRVA 3QN7A 1EATA 3RLYH 1YCPH 2VNTA 5CE1A 3GY4A 2D8WA 5CDFE 2A7HA 4K1SA 3SUDA 4PROA 3LONA 1BBRE 1NESE 2OD3B 3DFLA 3A89A 2FOEA 1GHBF 1DDJA 3MO3A 1E35B 1ELFA 2Q1JA 1QB1A 2AMDA 4UFDH 3E91A 3O8BA 1DWDH 2AMPA 2XTTB 3BIVH 2UWOA 4IC6A 2RCEA 1QL7A 3ZV8A 3WWBA 4YOJA 1AQ7A 1AY6H 1ELGA 1CE5A 2LNCA 3RMMH 4WVPE 2IN2A 4TSFD 2H6MA 2ASUB 1DM4B 2XBWA 1J14A 3M7TA 4X1RU 5GNDA 1OYQA 1DSTA 1TRYA 1GI1A 1O2LA 2BZ6H 2P3UB 3P17H 1P12E 2QE7D 5FL7D 1DLEA 2A1DB 1EPTB 1Z8JB 1BZXE 2OK5A 4B74A 1IQEA 2ZZUH 1QL9A 3M35A 1UW7A 3DUXH 1O0DH 3A82A 3LGVA 3TK6A 3QDZB 4DOQA 4GHTA 5A0AE 3D65E 2FOFA 1ZSKA 3M5NA 3SNAA 5C1XA 1EX3A 2ZPRA 1QBVH 2BDIA 2G4TA 3OY6U 1AHTH 1NN6A 1WOFA 3KL6A 1JMOH 1NBMD 4I7YH 3RXLA 3TU7H 3A83A 3RU4D 4B6EA 2ZKSA 1QIXB 2ZU5A 2PSXA 1ACBE 4BXWA 1QGFA 1BHXB 1QBNA 4HG6A 1ETSH 2OC1A 4AGKA 2BDHA 5C2ZA 1RRKA 1JRTA 1C1NA 2ZO3H 2UUFB 3M37A 2ZCHP 4O9VA 4NG9H 5HGGA 5GJ4B 1V2NT 1HAVB 7GCHF 2D26C 1YPGH 2ZDMA 1P2KA 4YXWD 1ELVA 4RI0A 1MZDA 2QF3A 2GZ8A 3GY3A 1NFXA 1TAWA 2F9BH 3L3TA 2ZFQH 1ELTA 3UAIC 2Q6FA 3V0XA 4XBBA 1H8ED 1TGNA 4ISNA 1DXWA 1RTKA 2BVSH 3U98H 1BMMH 2ZFPH 1G3DA 3SQHE 3VB6A 1CGIE 1IQNA 1GI4A 2J95A 3P8GA 4K69A 2XBXA 3GICB 2OTVA 2TGAA 1XX9A 1HAOH 3MI4A 1O3GA 1GBTA 1BOQA 2TGDA 3B23B 2FS9A 4Q7ZA 3QK1A 2ODQA 5J4QA 1ARBA 1YM0A 2ZC9H 1GBIA 4I8LA 2VIPA 2F43B 1HV7A 4AOQA 4RN6A 1TNKA 3D49H 3LIWA 2C93B 4TY7A 2ODPA 2VB0A 3VB4A 2ULLA 2J38A 2VIOA 1O3DA 3LKWA 1H8HD 4D9RA 3HKIB 2WV4A 3SU4A 3S7HB 3QWCH 1XUHA 1QFKH 4B76A 1ZTJA 1IHTH 1NTPA 1ZMLA 3SU5A 3GYLB 4R8TB 3TK9A 1NRQH 5A8ZA 4OS5A 4O03A 1INCA 1HYLA 4YZUA 5DJ7A 1F5LA 3ZYDA 8GCHF 2WPMS 2O8TA 2RA0A 2BOHB 4AORA 3UOUA 3IITA 3A7YA 1XKAC 1G3CA 2BX4A 4FUJA 5JBBS 1SC8U 1P0SH 1AN1E 4A6LA 1P05A 1NT1A 1ELEE 1IQKA 2W6JD 1ETRH 2C4FH 2F4LA 4ABGA 1B5GH 5EPNA 2FOMB 1TBRH 2FTLE 3GYMA 5A0CA 1RJXB 2J97A 2D2DA 3B9FH 3OFND 5FX5A 2EEKA 3GY6A 3TH4H 4Q4LA 1SGNE 5GIBA 1QA7A 4XFQA 4WY3A 5DG6A 4AFSA 1T7CA 1TGSZ 4FU7A 1VITH 1NS3A 1Y8TA 1DLKB 1TB6H 1SGPE 5GXPA 1GHVH 4ABIA 5CMXH 1E0FD 1UTLM 2Z9KA 3EGKH 4WH8A 3BEUA 2JETC 3UNQA 1XUJA 4Y7AA 3WWFA 1L4DA 4JZ1A 2A2XH 3LC3A 5A8YA 2TBSA 3IWMA 3BTTE 2A5KA 3R0FA 1OHHD 3ZVEA 5SGAE 4UEHH 3RXCA 1XMNB 2ZFRH 5C17A 2JH6D 1UHBB 1UTOA 3RXOA 1MAYA 3HGNA 1PYTC 1TONA 5DP6A 2OLGA 4MPVA 1V2PT 2NU4E 3TLOA 1SQRA 1MMJN 1K22H 1UTKA 2IJOB 3BTHE 1CVWH 1W14U 4B1TA 2QXGA 3UR9A 1PPGE 1AU8A 1T4VH 1MBQA 3STIA 1C5PA 1FAXA 3BTQE 1EJNA 4Q2KA 1GI7B 3UQOA 4JK5A 2NU2E 2Y7XA 1P03A 3KF2A 5DP3A 1TQ0B 3ZVCA 3I77A 3FP6E 1QJ6B 2STBE 2ZFFH 5EU8A 2ZDVH 1RIWC 2WPDD 4BAQB 1O3PB 2G5VA 4ZHMU 1CGJE 1UTPA 1AKSA 2HNTC 1KTSB 3OE7D 1OWEA 1NRRH 5H4IB 2BVXH 2FX4A 1ESTA 3Q00A 3T5FH 4CRDA 2HLDD 2GCTB 2CK3D 1EZXC 1UK4A 1A0LA 2QXJA 1ZLRA 2ZDAH 3A7ZA 1HJAC 2HPQH 3FANA 4BOHA 1P2NA 2ZCKP 2ZF0H 1RFNA 1DSUA 1UJ1A 2HNTE 1D3DB 2Y81A 4K3JA 1GHAG 1L1JA 2AIQA 3ENSB 1BTYA 1FI8A 1TFXA 1O3MA 1WTHD 3UIRA 4FVBA 1NC6A 1WV7H 2ZHWH 4Y8XA 1CHOG 2GDEH 3DT0H 1ELCA 3RXVA 1LHCH 4GVUA 2FOHA 4JZDH 2L6OA 1YPHC 2F9UA 1O5BB 2PUXB 2Q6DA 2GCHG 1G3BA 3OU0A 3TNTA 2G81E 1YPJH 3F68H 2OBQA 4B6FA 2J5UA 1MAXA 5EGMA 1GDUA 3PROA 4U2WA 5HKKD 3S9BA 1UCYH 4ABJA 3K6YA 1LO6A 2CF8H 5E8EH 1QHRB 1YPHE 3QTOH 3O8DA 3OY5U 3SU1A 5JB9S 4MVNA 4Q7XA 1KDQB 5FAHA 4D9QA 3OEED 3PRDA 1P2MA 3A8AA 2WPHS 1WCZA 1QY6A 5T1VA 5IK2D 1VGCB 5C0UA 5LH8A 1K1PA
chains in the Genus database with same CATH topology
3GISB 5BRRE 1PQ8A 2ZNKH 1N6XA 3QLPH 2VINA 1CA8B 1YP9A 2P94A 2Y5GA 4NZLA 2PUQH 5C5OA 3SNCA 2R0LA 1Y5AT 1AWHB 1QJ7B 1JRSA 2O8MA 1MCVA 5FX6A 1AI8H 2BM2A 2BD9A 4TPYA 1LHGH 1EXFA 7KMEH 3DD2H 3A87A 1C1TA 3SJKA 2FWWA 1NROH 2NU3E 1C5TA 2ANWA 2H5DA 1DT2A 3EE0B 4WXIA 5DP9A 3B8JA 1K1LA 1P9SA 2PKSB 1FIZA 3A8CA 1C2EA 4IGDA 3H5CB 4Y6DA 1O3IA 2A7JA 2XW9A 3Q3XA 1O2TA 3BG8A 8ESTE 1ZTLA 3Q77A 2O9QA 1S6HA 1LTOA 1NZQH 3UQVA 1C2KA 1EAUA 4NIXA 4AN7A 2QGRA 4Y11E 1L1GA 1J15A 2ZTXA 1MTVA 4JYUH 1V6DA 3VXFH 3EDXB 2ZQ1A 1GI0A 1GJ5H 1TX7A 4X8TH 3MO6A 3BIUH 2KAIA 1C2FA 3KGPA 2H9HA 2FO9A 1GVLA 4RKJB 1C9PA 3U8RH 2PW8H 1W2KH 4AFUA 1GJ9B 5HMAA 1C9TA 1ZMJA 4Y71A 3OX7U 1TWXB 5E2OA 5K0HA 4HI3A 2QF0A 1EPTC 5I46H 3RXDA 1ANEA 3RXGA 1QBOA 3SUGA 5LPEA 3T2NA 2XBYA 4X1NU 1Y3VA 2JETB 4IBLH 1AZZA 2DUCA 2ZHEH 2ZIQH 2VWMA 1CO7E 1UVSH 3NCLA 2YNAA 4NA9H 3SU0A 4MPUA 2WPKS 1HB0B 4D7FA 1O2HA 1NO9H 3R3GB 1F92A 2FM2A 3K2UA 3GDVA 3PLPA 1LPGB 1K1NA 2CHAB 3HK3B 1EAIA 3LJOA 3KNXA 1PPFE 1KLJH 4BAOB 2CMYA 1W11U 1PQ7A 5EQSA 5FCKA 4MNVA 1ZOMA 1GJAB 3Q76A 1V2WT 4GCHG 1ZYOA 1ANCA 1TNJA 3TIUA 1GCDA 3UREA 3MU1A 4I8KA 2ZPSA 1BIOA 3BG4B 4FXGH 4CREA 2ZTYA 5C67A 1A0HB 3M61U 1O2SA 1GJ8B 1BTUA 3MU5A 4IMZA 1EP5A 1O2PA 2O8LA 3MH4A 1FN8A 3QTVH 1YYY1 1HNEE 2NU1E 3MU8A 1AWFH 3T29A 3E8LA 5JDUB 2UWLA 2ANKH 1IQJA 4YO9A 3TJOA 5E0HA 1BUIA 2PTCE 1O39A 1C5UA 1AFQB 1TABE 3BTDE 1TGBA 3U8OH 3S0NA 4J1YA 6ESTA 2VIVA 1OWDA 2WYJA 4LZ1H 2GT8A 4BTTB 1EPTA 2BLQA 1CHGA 2BQWB 4YLUA 3LH1A 3O8RA 3BEFB 5A8XA 1TOCB 1LPZB 1BITA 1SSXA 1THRH 5JBTA 1O34A 5EOKA 4GSOA 5EXMA 5FPSA 5DP8A 1A3EH 2ZCLP 3ZZCA 3PTBA 1ZHRA 4UD9H 4CRGA 3G01A 3U1IB 1C1SA 4FUCA 2BXUH 3M5OA 5GCHG 1Z7KA 1BTZA 1Z1JA 1BTWA 1RXPA 3TH3H 3MYWA 1QL8A 1TOMH 1LVYA 1N8OB 3RMNH 4CR5A 3VB5A 3TPIZ 1IQLA 2BD4A 1GHYH 3I29A 2Z3EA 4X6PA 6CHAB 2W3KA 1GMHF 1GBBA 3LU9B 1MU6B 5JBAS 1AFEH 4ZHAA 4ZXYH 1HAVA 2PSYA 2STAE 2G8TA 3GCTG 1DPOA 4I32A 1CA0B 2FXRA 2K1QA 1C1RA 2W3IA 1SGTA 1W8BH 4X2WA 3SN8A 4AB8A 4XBCA 1HRTH 2UUYA 4FU8A 2IOTA 3MNBA 2OQUA 3ODDA 3UOPA 2CV3A 4YOGA 1SHYA 2Z6BD 2B5TB 3ODFA 2GP9B 1FN6A 1A61H 1G9IE 1O2ZA 3E3TA 1AZ8A 1MH0A 1H4WA 2ZDNA 4M7GA 4XBDA 1AE5A 1GGDB 3QGJA 3RXJA 2BLOA 2FTMA 3LOXA 3M3TA 1DITH 5C20A 1VCQA 1QTFA 1WBGB 2R3YA 4B71A 2ANMH 4IS5A 1MUEB 1NPMA 1NFYA 3M7UA 3SNEA 4ZKRU 1O37A 4YLQH 1OPHB 4WXVA 1W13U 1H9HE 2G00A 1YCPM 4UONA 1G30B 1FZZA 2BZAA 2BYAX 5ETXA 1GHAF 1V2VT 4DIIH 2SGFE 3ZZDA 2QC2A 2ZU2A 1CHOF 2OBOA 1F5KU 3ZZ3A 1S5SA 2R0KA 4NSYA 3MNCA 4QT8C 1XUGA 3T28A 1K21H 4RKOB 1TPPA 2GCHF 3ZZ6A 1BA8B 1BJVA 2XCFA 3LT3A 4IMQA 3LC5A 4MNYA 1KIGH 1GVZA 1A46H 1GHWH 1O2KA 1SMFE 1AD8H 1O3LA 1BMAA 2EI8A 4BANB 4KTSA 4H6SB 2GCTC 2VU8E 4GAWA 1PQ5A 5LGOA 4BAHB 1SGEE 2P3FH 3TVJB 4BAMB 1KXCA 1H8IH 2H9TH 2HGTH 1AVGH 1W3CA 4H4FA 1YLCA 3MH6A 4IC5A 3BSQA 3ZZ8A 2Z9LA 3P92A 1ZSLA 3RU4E 2V3OH 2RA3A 1C5WB 3ZZ7A 1EZQA 1G2MA 4BAKB 2A5IA 3ZZ5A 1LDTT 3P70B 1SG8B 4A1XA 3OTJE 3ZVAA 2AIPA 2XC4A 3PLBA 1VZQH 1Y3WA 1H9LB 4JYVH 2GT7A 2AEIH 6GCHG 5T6DA 1ANDA 1D6RA 2H2ZA 2SGPE 1GBKA 2FYQA 1K1IA 2C8XB 1VCPA 2Y5HA 2PTNA 2W7SA 2D1JA 2BHGA 2ALPA 5EQRA 1DXPA 3M5LA 3GCHB 2I6QA 1WYKA 4ZKSU 3HATH 1K1OA 1S84A 2IPHA 3NZIA 2BXTH 4ISLA 1GBCA 2DE9A 3SUFA 3L6PA 1SLUB 3U69H 2Y7ZA 2ZP0H 3GDSA 2XRCA 5IYTA 3RXAA 2SNVA 2AGGX 1E38B 1QCPA 1VGCC 1NM6A 1SOTA 3RXIA 4AG1A 2GDDA 1AUTC 1C1UH 1DWCH 1K1MA 1JIMA 3BV9B 4XOJA 3RP2A 4K60A 1Y3UA 3K6ZA 3MNXA 1UTNA 1GBDA 1P01A 2M5TA 2FEQH 3E0NB 5EG4A 1OOKB 1GI6A 1LVOA 1IHSH 1W10U 1FIWA 2ZGBH 4WWYA 3M3SA 2BD8A 3A7VA 1LQEA 1HAYB 5C5NA 3SU6A 3GY8A 2PKSC 1CT4E 1AIXH 2WINI 2HOBA 1C1PA 5FXLA 4H6TA 2BTCE 3VGCB 3UWIA 4IN2A 2R3UA 2ZHFH 2FDAA 3BN9A 3ZVBA 4ABDA 3P8NA 4AFQA 3TK5A 1O5FH 3UTUH 2LPRA 2C90B 3VEQB 1YPEH 1FLEE 1DX5M 5C3NA 5ABWA 3BF6H 1KXAA 2WUCA 5FCRA 1W12U 3PTNA 1Z6EA 1O3EA 3Q3KA 2TPIZ 3PMBB 1C5MD 1KDQA 3LGTA 4FU9A 1S0RA 3EA9A 1C5OH 2FI5E 2PKAB 2OCVB 2AERH 3AAUA 3C27B 2WV5A 3D62A 1LKBA 3P95A 3P6ZB 4AFZA 2OP9A 1V2MT 1O5DH 3RXKA 1FY8E 1F0TA 1WUNH 2BD7A 1Z8IB 1H1BA 2FLBH 2ZPQA 2JH5D 1GJ7B 2OC8A 4CRFA 1V2RT 1DWEH 4KTUA 2XWAA 1Q2WA 1BBRH 1Y5BT 4WMDA 4F49A 3MOCA 1BJUA 1O5AB 1K2I1 1UCYK 3FZDA 1EB1H 3M7QA 1E34B 3SV7A 2ZI2H 2PGQB 2B7DH 1GI5A 2A7CA 3U9AH 2AGEX 4HGCA 2CHAC 2FP7B 1BRBE 3BTKE 1ZGVA 1O32A 1F0UA 4AGJA 1GJ4H 5JPMH 5LPRA 2VVUA 4D76A 1XKBC 1BTPA 2QAAA 4K1EA 2FI4E 3BTGE 1MKWH 2BB4A 4O97A 3S69A 1XVMA 1SLWB 1O2YA 4JYTA 5GCHF 4CRAA 3BG4C 1JWTA 3SO3A 2ZWLH 4ZUHA 3DFJA 1GMCG 4THNH 2HLCA 1MTNB 1BMLA 1TIOA 1Z71A 3KQEA 1Q3XA 1ELDE 1TBZH 2BD3A 3MTYA 1YLDA 4Y7BA 1ZMNA 2GGVB 3EQ0H 1GBLA 1GBJA 1AFQC 3QUMP 4SGAE 3T25A 4NGAH 1S85A 1DVAH 1P8VC 3N7OA 3RXSA 4TYDA 4X0WU 3VXEH 2BDCA 6LPRA 3GY2A 2OXSA 3NK8A 4NA8A 1DFPA 2Y80A 2HALA 1OWHA 2I6SA 1O3OA 3DA9B 3RXHA 1BTXA 3RXUA 3TITA 4ABHA 4TPIZ 2F9PA 1CU1A 1VITG 2HVXA 1E36B 2BY8X 1Z6JH 1QQUA 1OP8A 4OS2A 4X8UH 1MTWA 1THSH 1THPB 1SFIA 1DY9A 1N6YA 1F5RA 1SGIB 4WMEA 1GL1A 2W5EA 2NU0E 4INKA 3LGYA 2HNTF 3E6PH 2VIQA 1HLTH 3RXFA 5EW1H 1N8OC 2EA3A 4FUBA 2VVVA 2XBVA 1AUJA 3TJVA 4Y8YA 1OX1A 2P8OB 3CS7A 6CHAC 1SQTA 2J9NA 1MCTA 1MD8A 1YBWA 2BY6X 1QB9A 1ZR0A 1DY8A 2ZQ2A 3RUOA 1HGTH 3E16B 1WAYB 1T8LA 3T26A 4MQAA 1UVPA 1HAZB 4DJZB 2V6NA 1CA0C 4E05H 4WMFA 1VJ9U 1P57B 4D7GA 2F9NA 1SQAA 5DP7A 1LQDB 4WJG2 1OP0A 2QA9E 1DUAA 1IQFA 2BOKA 1KY9A 3SNBA 3NUMA 4I8GA 1ZJDA 1LHEH 2XNIA 1A1RA 1O38A 1P06A 5AFZH 2PR3A 1GGDC 1P2QA 3UUZA 9LPRA 1Y59T 4ASHA 4K8BA 2Z9JA 4AX9H 5F8TA 1O36A 7GCHG 2WYGA 1FPHH 2Z94A 3SZNA 4NCYA 1KYNA 3NPSA 5DP5A 4ZHLU 1SGDE 2ZG0H 2Z9GA 2ZGHA 2BDBA 1HJ8A 1OWJA 1QQ4A 1SFQB 1AMHA 3H7TA 3NKKA 3P8OA 2ESTE 1O2UA 2BDAA 3SI4H 1IAUA 4MNXA 1RS0A 1CT2E 4DCDA 4DG4A 4NIVA 1NFWA 4ZROA 4Y0YE 4FUIA 1ESAA 4WH6A 4UFGH 4DVAU 3A86A 1H9IE 1FPCH 3TNSA 1L1NA 2R9PA 2GV7A 6GCHF 1SLXB 2ZHDA 2VH6A 1T32A 1F0SA 5K7RA 2G52A 5EXLA 1C5ZB 1GBMA 1V3XA 4NWLA 3RU4T 1ETTH 3TJUA 2C3SA 2VWLA 1ZZZA 1J16A 2TGTA 5PTPA 4FUDA 1PPEE 2BQ6B 1CBWC 4D8NA 3TJNA 3FVFB 1C5VA 4DURA 3SNDA 2PHBA 4FUHA 1N1LA 1O5CB 2GZ9A 2ZDKA 3A80A 1TA2A 3P8FA 4KTCA 1CGHA 1HXEH 4JZEH 1O3BA 3QX5H 1QURH 3MHWU 5AF9H 5HM9A 1MU8B 3T62A 4DIHH 1Y5UT 1O5EH 1EOJA 3IG6B 1TA6A 4FUEA 2YOLA 1D4PB 1HCGA 3RXQA 4NWKA 2FOGA 3V13A 1SGFG 1TRNA 2VGCB 4DT7B 1EJMA 2FLRH 3MMGA 1C2JA 1L0ZA 2FPZA 1UVUH 3ZVDA 4TWYA 1P02A 1Z1IA 1C5NH 2ZU1A 4NFEA 1GBHA 2C8ZB 3GCHC 5DKMA 1FV9A 2NWNA 3F9FA 4ISIH 2H5CA 2QIQA 4YM9A 1GHXH 5L2ZH 3VB7A 1ANBA 3E90B 1BT7A 5EQQA 2BD5A 2ZFTA 1DUEA 1V2TT 2JKHA 1TNLA 2A32A 1ARCA 2XYAA 3MH7A 2P93A 1HPGA 2FX6A 2GKVE 2VIWA 5F8ZA 3A7TA 4Z0KA 4TWWA 3MU4A 2PFEA 4LOYH 4HFPB 2ZFSA 5JYIA 1O35A 2P3TB 3W94A 1EKBB 2ILNA 4E7RG 1FNIA 1C5XB 2CN0H 3MWIU 1FAKH 1BHXF 4VGCB 1L4ZA 3ATKA 1HAHH 1TMBH 3PYHA 7ESTE 4Y10E 3BTFE 4E06H 1O2NA 1IQMA 1VCWA 3GY7A 1OP2A 3RXRA 3MU0A 1UVTH 4ZAEA 3A81A 5FPTA 1S81A 1VR1H 1OWKA 1FY3A 1KLIH 2Y5FA 2BMGB 4NIWA 5EODA 1C2MA 5DP4A 1HIAB 2UWPA 1CSOE 3OYPA 1OWIA 1PFXC 1A0JA 3VGCC 3ZYEA 4YT6H 2OUAA 1QRZA 1TGCA 1PPBH 1TMTH 3CS0A 4O3UA 4CHAB 3CP7A 3RC5A 2SGQE 1C2LA 1YGCH 2WUBA 3RMOH 1UTQA 1NY22 3URDA 1ZHPA 4X2YA 1SBWA 7LPRA 1O2GH 1HFDA 3VB3A 1HAXB 1BB0B 4ISHH 1KXBA 1TBQH 1TE0A 3K65B 2OQ5A 2XC5A 1UMAH 2BVRH 2SGEE 1C1WH 5F8XA 1ZTKA 2Z3DA 1SGQE 3M3VA 1FXYA 1ZPZA 4BNRA 1QB6A 2QYIA 3SJIA 3BTWE 3UNSA 2BDGA 1Y3YA 1C1OA 4OS1A 1IQHA 4K8YA 4OGXA 1P10A 1ORFA 4FUFA 3RXTA 2FMJA 2BD2A 1WSSH 3HPTB 3KQDA 3AW0A 1MTSA 3GY5A 4MNWA 1AVXA 1AB9B 1O2XA 4AYVB 1T4UH 1VJAU 1GJCB 4ABAA 3E0PB 4MG3A 1FMGA 4A92A 5T6GA 1DANH 1O3FA 5I25A 1P2OA 2THFB 1GMDG 1P3EA 5IDKA 2ZDLA 1HXFH 1UO6A 3MFJA 4E7NA 4X6NA 2TIOA 3S7KB 2A31A 1G36A 4NSVA 3RXEA 2XWBI 5DPAA 5FBEA 1VITF 2RG3A 2FYRA 1P2IA 2WPLS 2W7UA 4HTCH 5F6MA 4ZMAH 3MNSA 1O2WA 2XC0A 4DGJA 1ID5H 4AB9A 1MTNC 3SV2H 5HYOA 1GL0E 2OC7A 1CBWB 3QZQA 2BQ7B 1A5GH 4X6MA 3WY8A 1GI3A 4K5ZA 4UDWH 2C8WB 3SJ9A 2GX4A 3NWUA 2PKAA 4AYYB 3URCA 2ODYB 1C2IA 4LXBH 4MDSA 1W0YH 1GJ6A 1C2DA 1XXFA 2QXIA 2HPPH 5DK1A 1P11E 4HZHA 2V0BA 1TNIA 3U1JB 2V35A 1BRCE 3KQBA