3MO3A

Investigation of global and local effects of radiation damage on porcine pancreatic elastase. fifth stage of radiation damage
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mo3A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mo3A01
4BAOB 1IQNA 4MNWA 4AN7A 4XFQA 2ANYA 1C5ZB 2Y6TA 1DWEH 4A1TA 4RN6A 1K1LA 1N8OB 4IC5A 1K1PA 3ZZ9A 1T8NA 1H9IE 1O2JA 1WQVH 3LC5A 4M7GA 3OU0A 2A4QA 1TOMH 3GY3A 3ZV9A 3FAOA 4X2YA 3DHKH 4KTSA 4JZDH 2GT7A 1ELVA 1H9HE 2R2WU 3TU7H 2TIOA 1MTVA 7GCHG 2Z3EA 3RXFA 1B0EA 1LCYA 1YP9A 1XX9A 3HK6B 1V2RT 4WJG2 3VPKA 4WMDA 1B7XB 4ISLA 1JIRA 3GYLB 3MH5A 2FOEA 3RXIA 2UUFB 1FZZA 2HVXA 1NRSH 2WPIS 3KGPA 5DP9A 2HOBA 3PWBA 3NPSA 1LO6A 1FAKH 2PHBA 2ZDNA 4GUXA 4GSOA 2A7HA 4AFSA 2ZU5A 1K1IA 4ISNA 1K1OA 3JZ2B 3GDVA 1G30B 1QFKH 1HRTH 1UCYE 2R2MB 1UMAH 3RXJA 1O2QA 1OWIA 2GMTB 2BDYA 2DE8A 4B2BA 3JZ1B 3PROA 1NS3A 2SNWA 4RSPA 4O3TA 3SV2H 2XBWA 2VJ1A 1MD8A 1V6DA 1VJ9U 1ZTJA 1CA8B 2HPPH 3KN2A 1AD8H 3U8TH 2FP7B 2FODA 1OKXA 2FTLE 4H42U 2C90B 1TGTA 1MCTA 3VB7A 2ZU1A 4DT7B 2B5TB 3H7TA 3SHAH 2BM2A 2HNTC 4NFFA 1QCPA 4R0IA 4YOIA 1F2SE 1GHYH 3NXPA 3HGNA 3T5FH 1GCTB 1UTLM 1YPJH 1O3MA 3OTJE 1Z71A 3Q3KA 1P2MA 3MH7A 1O33A 1EJMA 4ZHAA 2Y80A 1BMNH 3M3TA 3PTNA 4X1PU 4FU8A 3TH3H 1RD3B 4CRAA 1GMCF 2CF8H 2ZEBA 2Z9IA 3UUZA 4A1VA 2VWLA 1A7SA 4K1EA 1GBDA 3RXTA 3UNSA 4DJZB 3LPRA 4ZHMU 2RDLA 1AE5A 3TJVA 3UOUA 2RCEA 4Q7YA 1ZRBA 4OS6A 3GYMA 2GTBA 1O5FH 5JB9S 1IQLA 1BITA 4JK5A 3U9AH 3AW1A 1OP0A 3G01A 2ZHQH 1NU9A 1C2IA 4IN1A 1A3EH 3A7TA 2PTNA 1G9IE 4NGAH 3AASA 3UFAA 3T2NA 2TBSA 1W8BH 1GJ4H 1MQ6A 3RXMA 4CREA 1NY22 2ZCLP 1O2RA 2P8OC 1LMWB 1O30A 4AB8A 3RM0H 2ZG0H 1A5IA 1PQ7A 1TMTH 2XYAA 4ESTE 1CT2E 3A7WA 4JYUH 4CHAB 3GY2A 1CBWC 3RMOH 2BD5A 3TH4H 7ESTE 2FESH 1ZSLA 4X1NU 1C1QA 2XC0A 1EZXC 4Y10E 2FO9A 1IQIA 3Q00A 4ZKRU 2Z9GA 3NZIA 4PROA 3RU4D 5T6FA 1GBKA 4CH2B 2UUYA 1F5RA 4VGCC 3M36A 1SFQB 1S0RA 2ZFFH 3S7HB 1GBTA 1TX6A 4IC6A 3P8OA 4X0WU 1NZQH 4MPVA 2Y5HA 3BF6H 1YCPH 2JETC 1YBWA 3M7UA 5FCRA 1O0DH 1SOZA 1BBRK 4TY7A 2LNCA 3UNRA 1TQ0B 1Z8IB 3RXDA 2FYQA 1BTWA 2VINA 4E06H 1GI2A 2HPQH 4WH6A 2OTVA 4YOJA 4DG4A 1GHBG 3EQ0H 1WUNH 2EI6A 3QGNB 1O5GH 3NK8A 2K1QA 4X2VA 2Z6BD 1TRMA 1GBFA 1O2HA 2UUJB 2A31A 1N8OC 1UK3A 2PGBB 1S83A 1A5HA 1ABJH 4I7YH 1DICA 2OC7A 1W7GH 1GJ6A 3BTFE 4AG1A 2BB4A 4FXGH 2QAAA 1SOTA 2C8ZB 1VITF 1KXCA 3T28A 1GI3A 2BDAA 1QIXB 4ZXXH 4NWLA 3E3TA 4O3UA 3EGKH 1QHRB 3FANA 4FUFA 4U30A 2IJOB 2DE9A 4DVAU 4MNYA 1O2PA 3MFJA 2XCFA 1OXGA 1DOJA 5EQQA 3RXVA 3ZVFA 1MD7A 2V3OH 4WH8A 1SGQE 3K2UA 1N6YA 3Q3XA 1TGCA 3RMLH 1O5CB 4CR5A 1GMHG 1MKWH 1C1NA 1XVOA 3UIRA 4NZLA 2P59A 2Y81A 2ZDAH 4WF8A 3BTHE 5C3NA 4F4OC 1AFQB 1F0SA 1L2EA 1LHFH 1SGNE 1NTPA 3T25A 1GL0E 1EX3A 3HKIB 2A4OA 3M7TA 2FDAA 4CRCA 1TMUH 1O37A 3A8BA 1KXBA 2GMTC 1Y3UA 1V2QT 3A81A 1GBCA 4GVUA 3V7TA 1GBLA 1BIOA 1ZYOA 3W94A 3R0FA 4GHTA 4FUCA 2TGPZ 1DXPA 4K8BA 3RXHA 1LKAA 1P12E 4DCDA 3ENSB 3MO3A 1X7AC 2QC2A 1NESE 3LH1A 1DLKB 3A7XA 2FM2A 4ABEA 1A61H 3CS7A 1Y3XA 1SHYA 1C1PA 1C1UH 2WUBA 4CRBA 3VEQB 4I8HA 1GCTC 2HGTH 3BN9A 3T29A 5DP4A 5EXLA 4DY7B 1S82A 5HYOA 4A1XA 3H5CB 4OS2A 1GMDG 3E91A 1RIWB 2D8WA 5L6NH 1CA0B 2ALVA 3SV6A 2C8YB 1ELTA 1OSSA 2GZ8A 4WMFA 3M5NA 4Q80A 3DD2H 1C5XB 3IWMA 3EA7A 2ZTZA 1C2MA 1ZHPA 2NU2E 4WWYA 1XUHA 1SBWA 1JXPA 1FY5A 2VVUA 3LJOA 3VB6A 4DIIH 4AX9H 1ACBE 2TRMA 5E0HA 1SHHB 2VIWA 4UE7H 2ZP0H 4FUIA 1E36B 3RC5A 1CGIE 1V2KT 3FP6E 4F49A 2G5VA 1ZGVA 3TNTA 5AHGH 4UDWH 5JBAS 3IG6B 1H1BA 1AE8H 1V3XA 2FOBA 1C5MD 1N6XA 3QX5H 1RJXB 2AFQB 4Q7ZA 1TWXB 5EW1H 3MU1A 5JB8S 1ETTH 1YKTA 3F9GA 3RXCA 1LVOA 1O3GA 2R3UA 4OS7A 1DY8A 3ZZBA 4NIWA 2FI5E 3QGJA 1UHBB 2UUKB 2PUQH 2VWMA 4ABHA 4UONA 1WSSH 2AIPA 4GHQA 4CHAC 1CT0E 2ODQA 5FPYA 2PFEA 3RXLA 1P2KA 1TLDA 4X8SH 1ZTKA 2FOAA 1ZPBA 2BD2A 1BOQA 1L1JA 1DWDH 1GHZA 2F9BH 2BX3A 2YOLA 2VIVA 3O8CA 5DG6A 3UPEA 2I6QA 1HAZB 3TK5A 3EE0B 1EAUA 1NRRH 1P8VC 5AF9H 2NWNA 1DSTA 3PLKA 4DOQA 1J9CH 1ID5H 3O8DA 3SU1A 2GZ9A 4B1TA 1P02A 1O5BB 3T26A 4TPYA 1FY1A 1O3HA 1NM6A 1GPZA 3AAVA 2XW9A 1GI7B 2ZU3A 5DK1A 1PPHE 1MQ5A 1GI6A 1UCYK 1Y5BT 1EZUC 2G55A 2FWWA 1GL1A 2GT8A 5GCHF 3SO3A 3O8BA 1BZXE 1V2PT 1O2UA 1D9IA 3UREA 2BVSH 1NO9H 1D3QB 2ZI2H 4ABDA 3GY7A 1XVMA 2A2QH 2ZECA 4J1YA 2DUCA 3SU0A 2O8MA 2Y7XA 1O3AA 4K2YA 1AFEH 3P8GA 1YPLH 4B2CA 3RLWH 2G51A 5JBCS 1C5QA 3TJNA 1CHOF 1P9SA 1LQEA 1XKBC 1SVPA 1ZZZA 1NFUA 2EI8A 1KXDA 3SW2B 4IN2A 1Z1JA 1TQ7B 4JZ1A 1WTGH 3L6PA 3ESTA 5FPTA 2WYGA 2R0KA 4ABBA 1BMLA 3ZZ8A 1XKAC 2YNAA 1FIWA 2VIQA 4XDEA 3E16B 3VXFH 4D76A 4ABJA 2SGQE 4D9RA 2BDBA 3SQEE 5EW2H 4AFUA 1IHSH 2AIQA 2WUCA 3D49H 3W95A 3Q76A 1P01A 1JRTA 5AFYH 3ZVEA 3H7OA 2STBE 3PWCA 3SORA 2ZGJA 2ESTE 4INLA 3TNSA 2C8XB 3VXEH 4TWYA 3CP7A 2VVCA 3RXOA 1AFQC 3OY5U 2J4IA 1INCA 3UR6A 1O2LA 4JYVH 2QIQA 3BIUH 2FIRH 1V2UT 4IW4E 3KHVA 1O5DH 4LZ1H 1P3EA 1A0HB 2KAIA 1DPOA 1QJ6B 4WXVA 2PWXA 1O39A 1IQKA 1SGYE 2F9OA 2V0BA 5HMAA 2VGCB 1O2MA 4OGXA 1PPGE 5BRRE 4ZKNU 3SV9A 3GY6A 1AN1E 1GBAA 1KTTB 1EZSC 5EU8A 1HAGE 3UR9A 1EP5A 3ZVBA 1Q2WA 1GJDB 2ZQ2A 2GV7A 1UO6A 1FY4A 1ETSH 5EXNA 1QBVH 5T3HA 8GCHG 2OLGA 1NRPH 4Y7BA 1SGFG 1EATA 3FZZA 2FX4A 1PQAA 4K60A 4ZHLU 1GHAF 4FVDA 3QO6A 3BTWE 2FOHA 2ZHEH 3HGPA 2A2XH 2QCYA 1SQTA 6GCHG 3SQHE 5HM9A 1SGPE 3SGAE 1SG8B 3FVFB 3SU5A 1RIWC 4ZROA 3RUOA 1KXFA 2FOMB 3I29A 1CA0C 4OS4A 3PO1B 2VH6A 3P8FA 5I25A 4YM9A 3OX7U 2ULLA 1SL3A 3GY8A 1AI8H 4D7GA 2AYWA 1LTOA 2BZ6H 1QA0A 1HGTH 2W7SA 1TONA 2XCNA 3SHCH 2WINI 4MVNA 5DP5A 1ZJDA 2FTMA 1WV7H 3GCOA 2C8WB 1V2ST 1Y59T 3MNBA 1AKSB 1T32A 3A80A 4YOGA 1FJSA 1V2VT 3U98H 4UFDH 5GXPA 3U8OH 3UQOA 1OWEA 1UJ1A 3V12A 1GHWH 4B74A 1GGDB 1DWCH 1O5EH 1TBZH 2ZQ1A 1V2JT 3ZVAA 5EG4A 1MTNB 2EA3A 4HI3A 1FQ3A 1O2KA 5C2ZA 3ZZ3A 4ABAA 1T7CA 1BRAA 2V35A 1O3IA 1KLIH 1C4V2 2C3SA 3KF2A 4NIVA 2VWNA 5FHTA 3ATMA 4Y0YE 4CH8B 1LPZB 1TNGA 1JWTA 1TB6H 1ELEE 2J92A 1TNIA 3ZVGA 1GI5A 1EZQA 2I6SA 4ZXYH 2H9TH 2OC0A 2IN2A 2WPMS 3SI4H 1NN6A 1UVUH 3SV8A 1HYLA 1BRUP 3LKWA 4UD9H 1FIZA 1T4UH 4UEHH 1IQGA 2AGEX 2J95A 3D62A 5IDKA 1G3EA 1QURH 3FP7E 1SQAA 3UY9A 5ETXA 3UWJH 2ODYB 4A92A 1E37B 3I78A 2BYAX 1MCVA 3RC6A 1AHTH 1ZMLA 3D23A 1GI8B 3E6PH 1PFXC 3BTDE 1A5GH 4X2WA 5C1UA 2BQWB 3A83A 1TX8A 4H6TA 2ZZUH 5JDUB 1C5TA 1AO5A 3P6ZB 1UTPA 1LVYA 2R3YA 4X6MA 2A5KA 2CF9H 1P2JA 2BY6X 3D65E 5LPRA 2GV6A 1HLTH 3F6UH 2ANKH 1EXFA 3BTGE 3TITA 3L33A 2H9HA 3PYHA 2V6NA 1IQFA 5GIBA 2R9PA 1QGFA 4CBNA 1G2LA 1ANDA 1HAIH 1ZR0A 5LGOA 1QR3E 1ELAA 1O31A 4WMEA 3P95A 1SGIB 5GJ4B 4H4FA 2A4RA 2CHAB 3R3GB 1MAYA 1O3CA 2BY8X 1P2NA 1C1OA 1GJ8B 1RGQA 2F9UA 5A0BA 5FAHA 4HFPB 4XE4A 1VGCB 3RXGA 1TA6A 3LIWA 1O2VA 2XBXA 3QN7A 4SGBE 3RXPA 4H6SB 1LDTT 2TGAA 1QRXA 2F83A 2Z3DA 2OUAA 4OS1A 1CSOE 3SJ9A 1LHEH 1ANBA 1DY9A 1D6WA 2GKVE 2H5DA 5FBIA 5CMXH 3K6ZA 4FU7A 2CGAA 5BPEA 1O3EA 1TNKA 1GCDA 1TPOA 3BG4B 1DT2A 3KQBA 3B23B 1HNEE 4IMZA 1FAXA 3A7ZA 5JBBS 3PLPA 2STAE 1W3CA 2FX6A 1THRH 1S5SA 1AMHA 2OD3B 2VGCC 1XUFA 5K0HA 1AU8A 1GBEA 1UTQA 3SI3H 1H8IH 2QYIA 3LGWA 4Y11E 5HXFA 3A86A 5ESBA 3KNXA 1TRYA 2BD8A 1NFYA 1S6FA 3IITA 3MTYA 3QTOH 2ALPA 5C5NA 2OBOA 4ABGA 1GJAB 1FMGA 2D1JA 3E8LA 3RLYH 1GMCG 1FUJA 1MTWA 4NZQA 1XXFA 1HIAB 4Y8XA 1ELDE 4R8TB 3STIA 2FEQH 2FI4E 4NWKA 1SGTA 2W3IA 3STJA 3BG8A 2BLQA 1Z6EA 1QQUA 3ODFA 3AVZA 4TYDA 5HGGA 4ZKOU 1C5RA 2M5TA 3PO1C 1ARCA 3MOCA 1UHBA 4YO9A 2B7DH 3RMNH 1EQ9A 1W13U 3BTME 1HAVB 1DANH 4NCYA 1LKBA 1VCPA 2QXJA 3S9CA 4AG2A 1O32A 1O3BA 4GLYA 5GWZA 1F5LA 4DURA 1MU8B 2WPKS 3VGCB 1JOUB 5B6OA 4D8NA 1TBQH 1Y3YA 3ZYEA 1GBBA 1BBRH 3ZZ4A 1FV9A 2ZNKH 3A7VA 3RXKA 2QGRA 3SNAA 4XSKU 2PR3A 5DP8A 3AAUA 4U2WA 1D3TB 4BNRA 2OC1A 1Z1IA 3BTEE 3ATWA 3C1KA 5A0CA 1NPMA 1GGDC 3U1IB 1C9TA 1TNJA 5C67A 2BVRH 1SLXB 2A5AA 3GISB 1F0RA 1MTNC 4HTCH 3M5MA 1EKBB 2RA0A 1O2SA 5A8ZA 1QRWA 3TJUA 1YPGH 2BXTH 1ZJKA 2BHGA 4Y79A 1SI5H 4Q2KA 1LVMA 1ZPZA 1KIGH 3KL6A 3B9FH 1Z8RA 3MU8A 4MNXA 1PYTC 1UVOA 4JZFH 1HPGA 3LC3A 1QY6A 1DS2E 3A85A 2BVXH 4GAWA 1UTJA 2PGQB 3LOXA 1O2TA 1D3PB 2LPRA 1ELBA 5GPIB 1EPTB 4X8TH 5E8EH 3TIUA 1WYKA 2ZCKP 1HDTH 2H6MA 1SGFA 1Y5AT 1QL8A 1T8OA 2PSYA 4ZKSU 1V2OT 5FCKA 3B8JA 2EI7A 4BAMB 3TGIE 1HAOH 2BZAA 2QXGA 4LK4A 3K9XB 3A7YA 2BOHB 3F9HA 3C27B 4AORA 2A0QB 2FZZA 1C1RA 1ESTA 4ZMAH 2ZHWH 4I8KA 2BQ6B 2AS9A 1VITG 4MQAA 4IS5A 1FPHH 1V2WT 3LGYA 4MPXA 4U32A 4DW2U 1IQEA 1YF4A 1LPGB 1MTSA 5L2YH 1EAIA 3MHWU 1LVBA 1WQSA 2C93B 3ODDA 2GZ7A 3UQVA 1T4VH 1WTHD 1GJCB 2BLWA 2H1UA 1VJAU 5DPAA 1SLVB 2G5NA 1IOEA 1D6RA 1H8DH 2ZU4A 1LPKB 1SGCA 2P93A 3LJJA 4K5ZA 3SNDA 1S85A 1BT7A 1G3DA 1H4WA 2PTCE 2CHAC 2GGVB 3BTQE 1HUTH 1AQ7A 2OQUA 4BXWA 3FP8E 1P05A 6ESTA 1MTUA 2EC9H 3SU4A 1C1TA 1VGCC 1CGHA 1VCQA 2F9NA 9LPRA 5J4QA 2ZWLH 5HM2A 1MU6B 1BUIA 2G4TA 1BJVA 1QJ7B 5E2PA 1GDQA 1XUIA 3DFJA 2RA3A 3DT0H 4A6LA 2A45B 1C4Y2 4Z6AH 1YPHE 3GCHB 3UOPA 1ELFA 4LXBH 4TPIZ 4X1QU 4NIXA 1L0ZA 4I8GA 5DKMA 5FX6A 3A88A 2G81E 1UK2A 2ZTXA 4JK6A 3N7OA 5JPMH 1KY9A 2BQ7B 2FOCA 1AIXH 1C5YB 1DE7H 3BEIB 1FNIA 3BG4C 2ZA5A 4CRDA 5JYIA 5A2MH 2B8OH 3NCLA 1KDQB 1GBMA 4X6OA 1C5UA 2XC5A 3ZVCA 2XC4A 2Z94A 5EPYA 2ZO3H 3GCTF 1Q31A 1HFDA 1QL9A 2J94A 4GPGA 1SGRE 1E35B 1QBNA 2Q6GA 1C2JA 1AZ8A 1L1NA 1ZOMA 1GI1A 1O38A 1C5OH 1ELCA 2P3UB 3ZZ7A 1VZQH 4THNH 1TFXA 5DJ7A 2ZHDA 1XUJA 1GDUA 4Y8ZA 1TPSA 3TJOA 1TAWA 4YT7H 1PPFE 3URCA 1ANCA 1KSNA 1GHVH 3BSQA 2WV5A 3ATKA 1C1MA 4NSVA 3E90B 4ISOA 4X8UH 2FS8A 1AKSA 2IOTA 1LHCH 2PSXA 2F9VA 3SJKA 1S6HA 3GDUA 1TGBA 1ESAA 3S9BA 3BEFB 3GICB 1ANEA 2VIDA 1TX7A 2Q6DA 3RU4T 1HJ9A 1M9UA 1E0FD 3GY4A 2IPHA 4AGJA 3F1SB 1F5KU 1DUAA 4AGKA 3DA9B 1F7ZA 1GJ7B 2XBVA 4O9VA 2YNBA 4MG3A 2CJIA 4B76A 1HAXB 4E05H 5F03A 3VGCC 3ZVDA 2P16A 4UFFH 4LOYH 3BV9B 2Y5GA 2FYRA 1GVKB 1C2GA 1OYQA 1UCYH 4K1SA 1OS8A 4IGDA 4NSYA 1CQQA 3MH4A 4SGAE 5LPFA 2O8LA 1ZGIA 3SGQE 3MH6A 2J38A 4CBOA 2GD4B 2VNTA 4FUJA 3ITIA 3QWCH 1RRKA 4INKA 3E1XB 3TGKE 1YPKH 1BHXB 1O2WA 2AERH 5E0JA 1Y3WA 1BRBE 4HGCA 4AZ2B 4IBLH 4MLFB 1O3KA 5ABWA 1O2NA 1V2LT 3NKKA 1P04A 4CRGA 1THSH 1TNHA 2FXRA 3ZZAA 3FFGA 3SUDA 2OXSA 1ETRH 2HNTF 3KEEA 3VB4A 2BY7X 1WCZA 1BTYA 5DGJA 1KLJH 1S81A 3M5OA 1P2IA 4X1SU 1AY6H 5GCHG 1EPTC 2XNIA 1O3PB 3BIVH 1PJPA 1DSUA 5JBTA 2Y5FA 1CVWH 1EASA 2FOGA 4D9QA 2O8UA 1HBTH 2ZFTA 4JCNA 5SGAE 1P11E 1CE5A 3EA9A 3HKJB 4OS5A 2QF3A 4NIYA 8LPRA 2XBYA 7KMEH 1CO7E 2A7CA 1AVXA 2BLVA 2OBQA 6CHAB 2P95A 1CHOG 2RG3A 3LT3A 4MPWA 3ZV8A 1YCPM 2J2UA 1AGJA 2XWBI 1RTLA 2F9PA 4GCHF 1OWJA 1G3BA 3LH3A 4ABIA 4U01A 5DP7A 1HAHH 1KYNA 1VR1H 2CV3A 5PTPA 1C4U2 4BTUB 1MAXA 1P0SH 3QK1A 6LPRA 2ZGCA 5EQRA 1RFNA 1NC6A 1ARBA 1IQHA 2QN5T 2W7UA 4I31A 2TGTA 2ZGXH 4OGYA 1FN6A 1LHGH 3RXQA 3MO6A 1C1VH 1ZRKA 4K3JA 4X2XA 2HRVA 5DP6A 1P57B 3HK3B 3MI4A 1ZHMA 1H9LB 2ZC9H 3Q3YA 3SNCA 4KELA 3RMMH 4KGAA 1K9OE 4FUBA 3OSYA 2BOKA 1HAYB 2G4UA 2SNVA 2VH0A 2GCTB 3GCHC 2WYJA 1T8LA 1P09A 1BJUA 1YLDA 1QL7A 2ZDKA 1GVZA 1W0YH 2Z9LA 1J17T 4BAHB 1HIAA 4K8YA 1PQ8A 1GJBB 3SUGA 1B0FA 1A3BH 1ZTLA 1W11U 3P70B 4CR9A 4CRFA 4WY3A 2GCHF 2FLBH 2PKSB 1E38B 3NUMA 1O3DA 1S0QA 2SGFE 1VCWA 1J15A 1EOLA 5DO4H 2ZDVH 3QDZB 1DX5M 2Z3CA 3SGBE 1GHAG 3LGIA 1HAVA 3RXAA 1ZSJA 2GX4A 3T27A 3QTVH 2VB0A 1O2OA 1DVAH 4ABFA 3LDXH 3MU5A 2A5IA 4BTTB 5T6GA 2ZTYA 3S0NA 1MKXK 2G00A 4JZIA 1YC0A 5L30H 1EOJA 3PLBA 5C1YA 1DITH 2BD7A 2Q6FA 3TVJB 1C2KA 1QNJA 2A7JA 2ZKSA 1C1SA 2ZGHA 3M3VA 1O3NA 3M5LA 1NRNH 3MYWA 3E0PB 3SJIA 4X6PA 4Z0KA 3TPIZ 1AUJA 1QB9A 3TK9A 3QZQA 1MBQA 2PW8H 1DXWA 1GHXH 1XXDA 2CN0H 1GI4A 1OP8A 1MKXH 1ZMJA 4UFEH 4YLQH 3M3SA 3T62A 2CMYA 2ANMH 4A5TS 1L4ZA 2H2ZA 1NFWA 1BMAA 2W26A 1O3FA 5J4SA 3RXBA 3A87A 4TWWA 2SGEE 7LPRA 4K69A 1BB0B 3NWUA 3TLOA 2XTTB 1JIMA 5L2ZH 5A09A 1TIOA 1OX1A 1F92A 2GCHG 3U1JB 1Z6JH 2ODPA 1DUEA 5T6DA 3UWIA 4RKJB 1UTMA 2ZHFH 1BTPA 3HATH 4B2AA 1EPTA 2OCVB 1IQJA 2FOFA 2UWPA 4D7FA 1SSXA 1NFXA 3V13A 4MNVA 2BX4A 1Z7KA 1J16A 1KXAA 1FN8A 2ASUB 1UVSH 4B71A 2QXIA 3EDXB 1N1LA 1RXPA 1FLEE 2JH6D 2HNTE 2XWAA 1K1MA 2SGPE 4BOHA 4BAQB 3LU9B 2AGGX 2R0LA 3L3TA 1MH0A 2H5CA 1ESBA 1K22H 4JZEH 1C9PA 4XBCA 3VFEA 1FDPA 1GJ5H 1UTOA 3PB1E 3EAJA 2PKAB 2A4GA 1EUFA 1A1RA 3GY5A 3I77A 1S84A 1QB1A 1E34B 5E2OA 1GDNA 3SUFA 4ISHH 2KAIB 4AOQA 1ZLRA 3SU3A 1GJ9B 1ZHRA 4KTCA 3M37A 4NG9H 1JRSA 1XMNB 4Y7AA 1GG6B 3MU4A 1AVWA 5TCAA 4E7NA 1MMJN 2Y82A 5FPSA 1AUTC 3ATLA 1W7XH 3MMGA 3CS0A 4WXIA 1C5SA 3A8DA 4INHA 1YPMH 1O3JA 1K28D 2J34A 1GI9B 6CHAC 1CT4E 3O8RA 1AVGH 3V0XA 1BQYA 4XBDA 2C4FH 1OOKB 1K1NA 4AYVB 3AW0A 1J8AA 1AWFH 2WPLS 1NRQH 1FPCH 3VB3A 1GHBF 3U8RH 2AMDA 1HV7A 3PMBB 1O2XA 2D2DA 5F8XA 5F8ZA 1PPCE 3RM2H 1ABIH 1Y8TA 1Z8JB 3SUEA 1BTUA 3KQCA 5GDSH 1C5WB 1FONA 1KDQA 3MO9A 5G4BA 1O2IA 2WPHS 1C5PA 2CXVA 2BY5X 1A2CH 4KKDA 1YCPK 5EPNA 4MPUA 2OQ5A 1YYY1 1K1JA 4DIHH 2GCTC 4FU9A 4O97A 1UTNA 3SJOA 4BAKB 4KTUA 1C2LA 2OC8A 2THFB 3SV7A 3MU0A 1V2MT 4MTBA 2QV1A 1W14U 1C2EA 2P3FH 2AMQA 1C5VA 4HZHA 2ZDLA 2BXUH 1GMHF 3GOVB 1L4DA 1G37A 5C5OA 2PKSC 3UNQA 4FUEA 4Y8YA 1HJAB 3E0NB 2VIOA 1TRNA 1BTXA 1HXFH 3TH2H 2VU8E 4TY6A 1O3OA 2FS9A 2BMGB 1VITH 2PV9B 1FXYA 2NU4E 1GBHA 4E7RG 1V2NT 5FXLA 2ZF0H 2Y7ZA 3SZNA 2PLXA 5F6MA 1Y5UT 2ZFSA 5CHAB 3SBKA 2BTCE 1SGDE 1XM1A 1IHTH 1MZAA 2ANWA 1AWHB 1T31A 1MKWK 1KXEA 1G36A 1A4WH 5CE1A 4O03A 2GDEH 5K7RA 4ISIH 1AZZA 2VIPA 2JH0D 1D4PB 4Q7XA 3PMJA 3ZZCA 4ZAEA 1IAUA 4FUGA 3WY8A 4AYYB 5EOKA 1GMDF 1TA2A 2ZPRA 2NU1E 1TPPA 1TALA 3PMHB 5FBEA 1THPB 2VWOA 3PM3A 1LHDH 2ZGBH 3RXUA 5LH8A 1SPJA 2GP9B 1OWDA 3SU6A 1B5GH 3ELAH 3BEUA 4I32A 2WV4A 3RP2A 2FMJA 2Q1JA 3ZZ5A 1F0UA 1SLWB 1T8MA 1EB2A 1QTFA 1OWKA 1EB1H 1OPHB 1EJNA 3PMAB 3RC4A 1BA8B 1TGSZ 1SMFE 2FI3E 2QF0A 3FZDA 1RTKA 1W0ZU 3ZYDA 3OYPA 3K65B 1W12U 1UVTH 2A32A 2W5EA 3A84A 1KLTA 1YGCH 1ZPCA 3LGVA 4AFZA 1O2GH 2ZCHP 1TOCB 2QXHA 3SN8A 1P2OA 2XRCA 2B0FA 1WU1A 1HCGA 1DLEA 1SGEE 2AMPA 1QB6A 1IQMA 2AEIH 3QLPH 3S7KB 1L1GA 1MZDA 1QA7A 4ZUHA 2O8TA 1SFIA 1TMBH 3A82A 3V3MA 3BTTE 5IYTA 5EODA 4I33A 4I8JA 1HXEH 1GBIA 4X1RU 3KQDA 1DDJA 1PQ5A 5A8YA 1YPHC 2F3CE 3RXRA 1GVLA 2ZFRH 1SC8U 2BY9X 2TGDA 4X6NA 1DM4B 1AB9B 1PPEE 4Y0ZE 3SJ8A 4X8VH 3ATIA 1YLCA 1GG6C 2WPJS 1QRZA 1XUGA 2ZU2A 2JH5D 3MWIU 3MNSA 1OP2A 2G8TA 2NU0E 3LONA 3LGTA 4A7IB 2QY0B 3UTUH 5ESTE 4FUDA 3RDZA 4NFEA 3Q77A 1JMOH 1PPZA 3TGJE 2TPIZ 4NA9H 4AFQA 3OY6U 3S69A 3RXEA 1ZMNA 2D26C 3ZZ6A 2H9EH 2OP9A 1HJ8A 3DFLA 4YZUA 2HLCA 1EJAA 1K2I1 3ZZDA 1P06A 4BXSA 1ORFA 2Z7FE 1C2HA 3SOSA 1QBOA 5EQSA 4MDSA 5TCCA 5EGMA 4WVPE 2ZIQH 3VB5A 2OINA 3P17H 1C2DA 1MBMA 1TPAE 1RS0A 1BDAA 1K21H 5DP3A 1WBGB 1G2MA 1LQDB 4BTIB 2HWLB 1QQ4A 2EEKA 1FY8E 2QA9E 4XOJA 4NA7A 1O5AB 3A8AA 4ZH8A 3A89A 1OWHA 1O3LA 3F9FA 3MNXA 2JKHA 3PV4A 1EAXA 1MUEB 4JMYA 1F0TA 1JBUH 2HALA 3SNBA 4QT8C 2BDHA 2A1DB 2O9QA 4B75A 4RKOB 1O2ZA 5EXMA 3GCTG 1BMMH 4ASHA 1BBRE 1D3DB 1FY3A 3P92A 8ESTE 4DGJA 4FVBA 2V3HH 2B9LA 1GI0A 2ILNA 5H4IB 1RTFB 1DWBH 1G3CA 2BD9A 2O8WA 2W3KA 2G52A 4Y71A 4Y6DA 1FI8A 3EA8A 4YLUA 4Y76A 3QZRA 4NA8A 1HJAC 1CHGA 1YM0A 3SU2A 2UWOA 3PTBA 1G32B 2P3TB 5F8TA 2BD3A 4B73A 1ELGA 1Y3VA 4IMQA 4FUHA 1W2KH 1OYTH 4UFGH 1TYNA 1C2FA 2BDIA 3U69H 8KME2 1C5NH 2XXLA 3KQEA 5I46H 3S9AA 2BD4A 1BTZA 2P94A 2J9NA 1J14A 1O35A 2FPZA 1A0JA 2VVVA 5CHAC 1EAWA 2GDDA 2BDCA 4YESB 4JYTA 1TBRH 2ZPQA 1HAPH 1W10U 8GCHF 3RXSA 2Z9JA 1BHXF 1BRCE 3RU4E 1SQOA 4J2YB 1CGJE 1C5LH 5A8XA 1P3CA 2ZDMA 1GBJA 1HB0B 2BDGA 1BCUH 6GCHF 4YTAA 1SB1H 5C1XA 3KIDU 1NU7B 1WAYB 4YT6H 1PPBH 1GWAA 3BTKE 5AVDA 5LPEA 1O2YA 1U6QA 4XBBA 1UK4A 4BANB 2GVFA 3SNEA 2AH4X 1XUKA 1P2QA 2PKAA 1QJ1B 2SFAA 2NU3E 1P9UA 1P10A 3KCGH 2PUXB 5FX5A 1SR5C 4LZ4B 3EYDA 4AB9A 9ESTA 1O36A 1A0LA 2AGIX 1Q3XA 1UTKA 1C1WH 3DUXH 1V2TT 2P8OB 2BLOA 3URDA 3HPTB 3MNCA 3TK6A 4K1TA 3GDSA 5AFZH 2ZFPH 1A46H 1CBWB 3GCNA 2ZPSA 5C20A 1DFPA 1P03A 3CENA 2SGDE 3F68H 1TNLA 3A8CA 1NROH 3P8NA 7GCHF 1PYTD 1KTSB 4VGCB 1YPEH 1BTHH 3LGUA 3QUMP 3F9EA 5TJXA 3K6YA 1Z8GA 1CU1A 3M61U 1NT1A 1TGNA 4I8LA 2JETB 1AB9C 1EP6A 2Z9KA 2UWLA 2FLRH 1WOFA 1TE0A 1O34A 5A0AE 2F91A 4KP0A 3M35A 4GCHG 3M7QA 2SGAA 2ZFQH 1ZSKA 5E0GA 1TABE 1SLUB 1UVPA
chains in the Genus database with same CATH superfamily
4BAOB 1IQNA 4MNWA 4AN7A 4XFQA 2ANYA 1C5ZB 2Y6TA 1DWEH 4A1TA 4RN6A 1K1LA 1WXRA 1N8OB 4IC5A 1K1PA 1YWUA 3ZZ9A 1T8NA 1H9IE 1O2JA 1WQVH 3LC5A 4M7GA 3OU0A 2IJD1 4P00A 2A4QA 1TOMH 3GY3A 3ZV9A 3FAOA 4X2YA 3DHKH 4KTSA 4JZDH 2GT7A 1ELVA 1H9HE 2R2WU 3TU7H 2TIOA 1MTVA 7GCHG 2Z3EA 3RXFA 1B0EA 1LCYA 1YP9A 1XX9A 3HK6B 1V2RT 4WJG2 3VPKA 4WMDA 1B7XB 4ISLA 1JIRA 3GYLB 3MH5A 2LELA 2FOEA 3RXIA 2UUFB 1FZZA 2HVXA 1NRSH 2WPIS 3KGPA 5DP9A 2HOBA 3PWBA 3NPSA 1LO6A 1FAKH 2PHBA 2ZDNA 4GUXA 4GSOA 2A7HA 4AFSA 2K8IA 2YMSD 2ZU5A 1K1IA 4ISNA 1K1OA 3JZ2B 3GDVA 1G30B 1QFKH 1HRTH 1UCYE 2R2MB 1UMAH 3RXJA 4M9FA 1O2QA 2F43B 3OFND 1OWIA 2GMTB 2BDYA 2DE8A 3KYFA 4B2BA 3JZ1B 3PROA 1NS3A 2SNWA 4RSPA 4O3TA 3SV2H 2XBWA 2VJ1A 1MD8A 1V6DA 1VJ9U 1ZTJA 1CA8B 2HPPH 2QF4A 3KN2A 1AD8H 3U8TH 2FP7B 2V3MA 2FODA 1OKXA 2FTLE 4H42U 2C90B 1TGTA 1MCTA 3VB7A 2ZU1A 4DT7B 2B5TB 3H7TA 3SHAH 2BM2A 2HNTC 4NFFA 1QCPA 4R0IA 4YOIA 1F2SE 1GHYH 3NXPA 3HGNA 3T5FH 1GCTB 1UTLM 5EJZA 2KCPA 1YPJH 1O3MA 3OTJE 1Z71A 3Q3KA 1P2MA 3MH7A 1O33A 1EJMA 4ZHAA 2Y80A 1BMNH 3M3TA 3PTNA 4X1PU 4FU8A 3TH3H 1RD3B 2QF5A 4CRAA 1GMCF 2CF8H 2ZEBA 2Z9IA 3UUZA 4A1VA 2VWLA 1A7SA 3PV2A 4K1EA 1GBDA 3RXTA 3UNSA 4DJZB 3LPRA 2XNDD 4ZHMU 4ASUD 2RDLA 1AE5A 3TJVA 3UOUA 5KECA 2RCEA 4Q7YA 1ZRBA 4OS6A 3GYMA 2GTBA 1O5FH 4ZCNA 5JB9S 1IQLA 1BITA 4JK5A 3U9AH 3AW1A 1OP0A 3G01A 2ZHQH 1NU9A 1C2IA 4IN1A 1A3EH 3A7TA 2PTNA 4Q63A 1G9IE 4NGAH 3AASA 3UFAA 3T2NA 2TBSA 1W8BH 1GJ4H 1MQ6A 3RXMA 4CREA 1NY22 2ZCLP 1O2RA 2P8OC 1LMWB 1O30A 4AB8A 3RM0H 2ZG0H 1A5IA 1PQ7A 1TMTH 2XYAA 4ESTE 1CT2E 3A7WA 4JYUH 4CHAB 3GY2A 1CBWC 3RMOH 2BD5A 3TH4H 7ESTE 2FESH 1ZSLA 4X1NU 1C1QA 2XC0A 1EZXC 4Y10E 2FO9A 1IQIA 3Q00A 4ZKRU 2Z9GA 3NZIA 4PROA 3RU4D 5T6FA 3F3BA 1GBKA 4CH2B 2UUYA 1F5RA 4VGCC 3M36A 1SFQB 1S0RA 2ZFFH 3S7HB 1GBTA 1TX6A 4IC6A 3P8OA 4X0WU 1NZQH 4MPVA 2Y5HA 3BF6H 1YCPH 2JETC 1YBWA 3M7UA 3FN8A 5FCRA 1O0DH 1SOZA 1BBRK 4TY7A 2LNCA 3UNRA 1TQ0B 1Z8IB 3RXDA 2FYQA 1BTWA 2VINA 4E06H 4RT1A 1GI2A 2HPQH 4WH6A 2OTVA 4YOJA 4DG4A 1GHBG 3EQ0H 3FOAA 1WUNH 2EI6A 3QGNB 1O5GH 3NK8A 2K1QA 4X2VA 2Z6BD 1TRMA 1GBFA 1O2HA 2UUJB 2A31A 1N8OC 1UK3A 2PGBB 1S83A 1A5HA 1ABJH 4I7YH 1DICA 2OC7A 1W7GH 1GJ6A 3BTFE 4AG1A 3PRDA 2WV9A 2BB4A 4FXGH 2QAAA 1SOTA 2C8ZB 2KCAA 1VITF 1KXCA 3T28A 1GI3A 2BDAA 1QIXB 4ZXXH 4NWLA 3FKSD 3E3TA 4O3UA 3EGKH 1QHRB 3FANA 4FUFA 4U30A 2IJOB 2DE9A 4DVAU 4MNYA 1O2PA 3MFJA 2XCFA 1OXGA 1DOJA 5EQQA 3RXVA 2WSSD 3ZVFA 1MD7A 2V3OH 4WH8A 1SGQE 3F2FA 3K2UA 2JJ2D 1N6YA 3Q3XA 1TGCA 3RMLH 1O5CB 4CR5A 1GMHG 1MKWH 1C1NA 1XVOA 3UIRA 4NZLA 2P59A 2Y81A 2ZDAH 4WF8A 3BTHE 5C3NA 4F4OC 1AFQB 1F0SA 1L2EA 1LHFH 1SGNE 1NTPA 3T25A 1GL0E 1EX3A 3HKIB 2A4OA 1W0KD 3M7TA 2FDAA 4CRCA 1TMUH 1O37A 3A8BA 1KXBA 2GMTC 1Y3UA 1V2QT 3A81A 1GBCA 4GVUA 3V7TA 1GBLA 3F0PA 1BIOA 1ZYOA 3W94A 3R0FA 4GHTA 4FUCA 2TGPZ 3F2HA 1DXPA 4K8BA 3RXHA 1LKAA 1P12E 4DCDA 3ENSB 3MO3A 1X7AC 2QC2A 1NESE 3LH1A 1DLKB 3A7XA 2FM2A 4ABEA 1A61H 3CS7A 1Y3XA 1SHYA 1C1PA 1C1UH 2WUBA 4CRBA 3VEQB 4I8HA 1GCTC 2HGTH 3BN9A 2JJ1D 3T29A 5DP4A 5EXLA 4DY7B 1S82A 5HYOA 4A1XA 3H5CB 4OS2A 1GMDG 3E91A 1RIWB 2D8WA 5L6NH 1CA0B 2ALVA 3ZIAD 3SV6A 2C8YB 1ELTA 1OSSA 2GZ8A 4WMFA 3M5NA 4Q80A 5C94A 3DD2H 1C5XB 3IWMA 3EA7A 2ZTZA 1C2MA 1ZHPA 2NU2E 4WWYA 1XUHA 1SBWA 1JXPA 1FY5A 2VVUA 3LJOA 3VB6A 4DIIH 4AX9H 1S6LA 1ACBE 2TRMA 5E0HA 1SHHB 2CK3D 2VIWA 4UE7H 5EIYA 2ZP0H 4FUIA 1E36B 3RC5A 1CGIE 1V2KT 3FP6E 4F49A 2G5VA 1ZGVA 3TNTA 3VG8A 5AHGH 4UDWH 1KMHB 5JBAS 2KM0A 3IG6B 1H1BA 1AE8H 1V3XA 2FOBA 1C5MD 1N6XA 3QX5H 1RJXB 2AFQB 4Q7ZA 1TWXB 5EW1H 3MU1A 5JB8S 1ETTH 1YKTA 2L74A 3F9GA 3RXCA 1LVOA 1O3GA 2R3UA 4OS7A 1DY8A 3ZZBA 4NIWA 2FI5E 3QGJA 1UHBB 2UUKB 2PUQH 2VWMA 4ABHA 4UONA 1WSSH 2AIPA 4GHQA 4CHAC 1CT0E 2ODQA 5FPYA 3OE7D 2PFEA 3PV5A 3RXLA 1P2KA 1TLDA 4X8SH 1ZTKA 2FOAA 1ZPBA 2BD2A 1BOQA 1L1JA 1DWDH 1GHZA 2F9BH 2KX4A 2BX3A 2YOLA 2VIVA 3O8CA 5DG6A 3UPEA 2I6QA 1HAZB 3TK5A 3EE0B 1EAUA 1NRRH 1P8VC 5AF9H 2NWNA 1DSTA 3PLKA 4DOQA 1J9CH 1ID5H 3O8DA 3SU1A 2GZ9A 4B1TA 1P02A 1O5BB 3T26A 4TPYA 1FY1A 1O3HA 1NM6A 1GPZA 3AAVA 2XW9A 1GI7B 2ZU3A 5DK1A 1PPHE 1MQ5A 1GI6A 1UCYK 1Y5BT 1EZUC 2G55A 2FWWA 1GL1A 2GT8A 2XOKD 5GCHF 3SO3A 3O8BA 1BZXE 2GJGA 2JIZD 1V2PT 1O2UA 1D9IA 3UREA 2BVSH 1NO9H 1D3QB 2ZI2H 4ABDA 3GY7A 1XVMA 2A2QH 2ZECA 4J1YA 2DUCA 3SU0A 2O8MA 2Y7XA 1O3AA 3H09A 4K2YA 1AFEH 3P8GA 1YPLH 4B2CA 3RLWH 2G51A 5JBCS 1C5QA 3TJNA 1CHOF 1P9SA 1LQEA 1XKBC 1SVPA 1ZZZA 1NFUA 2EI8A 1KXDA 3SW2B 4IN2A 1Z1JA 1TQ7B 4JZ1A 1WTGH 3L6PA 3ESTA 5FPTA 2WYGA 2R0KA 4ABBA 1BMLA 3ZZ8A 1XKAC 2YNAA 1FIWA 2VIQA 4XDEA 3E16B 3VXFH 4D76A 4ABJA 2SGQE 4D9RA 2BDBA 3SQEE 3UAIC 5EW2H 4AFUA 1IHSH 2AIQA 2WUCA 3D49H 3W95A 3Q76A 4FETA 1P01A 1JRTA 5AFYH 3ZVEA 3H7OA 2STBE 3PWCA 3SORA 2ZGJA 2ESTE 4INLA 3TNSA 2C8XB 3VXEH 4TWYA 3CP7A 2VVCA 3RXOA 1AFQC 3OY5U 2J4IA 1INCA 3UR6A 1O2LA 4JYVH 2QIQA 3BIUH 2FIRH 1V2UT 4IW4E 3KHVA 1O5DH 4LZ1H 1P3EA 1A0HB 2KAIA 1DPOA 1QJ6B 4WXVA 2PWXA 1O39A 1IQKA 1SGYE 2F9OA 2V0BA 5HMAA 2VGCB 1O2MA 4OGXA 1SQRA 1PPGE 2WPDD 5BRRE 4ZKNU 3SV9A 3GY6A 1AN1E 1GBAA 1KTTB 1EZSC 5EU8A 1HAGE 3UR9A 1EP5A 3ZVBA 4ACAA 1Q2WA 1GJDB 2ZQ2A 2GV7A 1UO6A 1FY4A 1ETSH 5EXNA 1QBVH 5T3HA 8GCHG 2OLGA 1NRPH 4Y7BA 1SGFG 1EATA 2LP6A 3FZZA 2FX4A 1PQAA 4K60A 4ZHLU 1GHAF 3SZEA 4FVDA 3QO6A 3BTWE 2FOHA 2PP6A 1YY3A 2ZHEH 3HGPA 2A2XH 2QCYA 1SQTA 5DN6D 6GCHG 3SQHE 5HM9A 1SGPE 3SGAE 1SG8B 3FVFB 3SU5A 1RIWC 4ZROA 3RUOA 1KXFA 2FOMB 3I29A 1CA0C 4OS4A 3PO1B 2VH6A 3P8FA 5I25A 4YM9A 3OX7U 2ULLA 1SL3A 3GY8A 1AI8H 4D7GA 2AYWA 1LTOA 2BZ6H 1QA0A 1HGTH 5DSFA 2W7SA 2KCOA 1TONA 2XCNA 3SHCH 2WINI 4MVNA 5DP5A 1ZJDA 2FTMA 1WV7H 3GCOA 2C8WB 1V2ST 1Y59T 3MNBA 1AKSB 1T32A 3A80A 4YOGA 1FJSA 1V2VT 3U98H 4UFDH 5GXPA 3U8OH 3UQOA 1OWEA 1UJ1A 3V12A 1GHWH 4B74A 1GGDB 1DWCH 1O5EH 1TBZH 2ZQ1A 1V2JT 1FX0B 3ZVAA 5EG4A 1MTNB 2EA3A 2HLDD 1E1RD 4HI3A 1FQ3A 1O2KA 5C2ZA 3ZZ3A 4ABAA 1T7CA 1BRAA 3OEHD 2V35A 4TSFD 1O3IA 1KLIH 1C4V2 1EFRD 2C3SA 3KF2A 4NIVA 2VWNA 5FHTA 3ATMA 4Y0YE 1SKYE 4CH8B 1LPZB 1TNGA 1JWTA 1TB6H 1ELEE 2J92A 1TNIA 3ZVGA 1GI5A 1EZQA 2I6SA 4ZXYH 2H9TH 2OC0A 2IN2A 4TT3D 2WPMS 3SI4H 1NN6A 1UVUH 3N7EA 3SV8A 1HYLA 1BRUP 3LKWA 4UD9H 1FIZA 1T4UH 4UEHH 1IQGA 2AGEX 2J95A 3D62A 5IDKA 1G3EA 1QURH 3FP7E 1SQAA 3UY9A 5ETXA 3UWJH 2ODYB 4AC9A 4A92A 1E37B 3I78A 2BYAX 5HKKD 1MCVA 3RC6A 1AHTH 1YLNA 1ZMLA 3D23A 1GI8B 3E6PH 1PFXC 4DT4A 3BTDE 1A5GH 4X2WA 5C1UA 2BQWB 3A83A 1TX8A 4H6TA 2ZZUH 5JDUB 1C5TA 5T1VA 1AO5A 3P6ZB 1UTPA 1LVYA 2R3YA 4X6MA 2A5KA 2CF9H 1P2JA 2BY6X 3D65E 5LPRA 2GV6A 1HLTH 3F6UH 2ANKH 1EXFA 3BTGE 3TITA 3L33A 2H9HA 3PYHA 2V6NA 1IQFA 5GIBA 2R9PA 1QGFA 4CBNA 1G2LA 1ANDA 1HAIH 1ZR0A 5LGOA 1QR3E 1ELAA 1O31A 4WMEA 3P95A 4FOUC 1SGIB 5GJ4B 4H4FA 2A4RA 2CHAB 3R3GB 1MAYA 1O3CA 2BY8X 1P2NA 1C1OA 1GJ8B 1RGQA 2F9UA 5A0BA 5FAHA 4HFPB 4XE4A 1VGCB 3RXGA 1TA6A 3LIWA 1O2VA 2XBXA 3QN7A 4SGBE 3RXPA 5KEDA 4H6SB 4YXWD 1LDTT 2TGAA 2YMSB 1QRXA 2F83A 2Z3DA 2OUAA 4OS1A 1CSOE 3SJ9A 1LHEH 1ANBA 1DY9A 1D6WA 2GKVE 2H5DA 5FBIA 5CMXH 3K6ZA 4FU7A 2CGAA 5BPEA 1O3EA 1TNKA 1GCDA 3KQ5A 1TPOA 3BG4B 1DT2A 3KQBA 3B23B 1HNEE 4IMZA 1FAXA 3A7ZA 5JBBS 3PLPA 2STAE 1W3CA 2FX6A 1THRH 1S5SA 1AMHA 2OD3B 2VGCC 1XUFA 5K0HA 1AU8A 1GBEA 1UTQA 3SI3H 1H8IH 2QYIA 3LGWA 4Y11E 5HXFA 3A86A 5ESBA 3KNXA 1TRYA 2EY4C 2BD8A 1NFYA 1S6FA 3IITA 3MTYA 3QTOH 2ALPA 5C5NA 5FL7D 2KCYA 2OBOA 4ABGA 1GJAB 1H8ED 1FMGA 2D1JA 3E8LA 3RLYH 1GMCG 1FUJA 1MTWA 4NZQA 1XXFA 2F4LA 1HIAB 1H8HD 4Y8XA 5F53A 1ELDE 4R8TB 3STIA 2FEQH 2FI4E 4NWKA 1SGTA 2W3IA 3STJA 3BG8A 2BLQA 1Z6EA 1QQUA 3ODFA 3AVZA 4TYDA 5HGGA 1W0JD 4ZKOU 1C5RA 2M5TA 3W1EA 3PO1C 1ARCA 3MOCA 1UHBA 4YO9A 2B7DH 3RMNH 1EQ9A 1W13U 3BTME 1HAVB 1DANH 4NCYA 1LKBA 3KYGA 1VCPA 2QXJA 2V7QD 3S9CA 4AG2A 1O32A 1O3BA 4GLYA 5GWZA 1F5LA 4DURA 1MU8B 2WPKS 3VGCB 1JOUB 5B6OA 4D8NA 1TBQH 1Y3YA 3ZYEA 1GBBA 1BBRH 3ZZ4A 1FV9A 2ZNKH 3A7VA 3RXKA 2QGRA 3SNAA 4XSKU 2PR3A 5DP8A 3AAUA 4U2WA 1D3TB 4BNRA 2OC1A 1Z1IA 3WWFA 3BTEE 3ATWA 1MABB 3C1KA 5A0CA 1NPMA 3GS9A 1GGDC 3U1IB 1C9TA 1TNJA 5C67A 2BVRH 1SLXB 2A5AA 3GISB 1F0RA 1MTNC 4HTCH 3M5MA 1EKBB 2RA0A 1O2SA 5A8ZA 1QRWA 3TJUA 1YPGH 4Q4LA 4B6EA 2BXTH 1ZJKA 2BHGA 4Y79A 1SI5H 4Q2KA 1LVMA 1ZPZA 1KIGH 3KL6A 3B9FH 1Z8RA 2KZ4A 3MU8A 4MNXA 1PYTC 1UVOA 1K0HA 4JZFH 1HPGA 3LC3A 1QY6A 1DS2E 3A85A 2BVXH 4GAWA 1UTJA 2PGQB 3LOXA 1O2TA 1D3PB 2LPRA 1ELBA 5GPIB 1EPTB 4X8TH 5E8EH 3TIUA 1WYKA 2ZCKP 1HDTH 2H6MA 1SGFA 1Y5AT 1QL8A 1T8OA 2PSYA 4ZKSU 1V2OT 5FCKA 3B8JA 2EI7A 4BAMB 3TGIE 1HAOH 4Z1MD 2BZAA 2QXGA 4LK4A 3K9XB 1VKYA 3A7YA 5HIZA 2BOHB 2W6JD 3F9HA 3C27B 4AORA 2A0QB 2FZZA 1C1RA 1ESTA 4ZMAH 2ZHWH 4I8KA 2BQ6B 2AS9A 2WHXA 1VITG 4MQAA 4IS5A 1FPHH 1V2WT 3LGYA 4MPXA 4U32A 4DW2U 1IQEA 1YF4A 1LPGB 1MTSA 5L2YH 4XRNA 1EAIA 3MHWU 1LVBA 1WQSA 2C93B 3ODDA 2GZ7A 3UQVA 1T4VH 5KGOA 1WTHD 1GJCB 2BLWA 2H1UA 1VJAU 5DPAA 1SLVB 2G5NA 1IOEA 1D6RA 1H8DH 2ZU4A 5EJ1A 1LPKB 1SGCA 2P93A 3LJJA 4K5ZA 3SNDA 1S85A 1BT7A 1G3DA 1H4WA 2PTCE 2CHAC 2GGVB 3BTQE 1HUTH 1AQ7A 4F48B 2OQUA 4BXWA 3FP8E 1P05A 6ESTA 1MTUA 2EC9H 3SU4A 1C1TA 1VGCC 1CGHA 1VCQA 2F9NA 9LPRA 5J4QA 2ZWLH 5HM2A 1MU6B 1BUIA 2G4TA 1BJVA 1QJ7B 5E2PA 1GDQA 1XUIA 3DFJA 2RA3A 3DT0H 4A6LA 2A45B 1C4Y2 4Z6AH 1YPHE 3GCHB 3UOPA 1ELFA 4LXBH 4TPIZ 4X1QU 2YMSC 4NIXA 1L0ZA 4I8GA 5DKMA 5FX6A 3A88A 2G81E 1UK2A 2ZTXA 4JK6A 3DCLA 3N7OA 5JPMH 1KY9A 2BQ7B 2FOCA 1AIXH 1C5YB 1DE7H 3BEIB 3NRLA 1FNIA 3BG4C 2ZA5A 4CRDA 5JYIA 5A2MH 2B8OH 3NCLA 1KDQB 1GBMA 4X6OA 1C5UA 2XC5A 3ZVCA 2XC4A 2Z94A 5EPYA 2ZO3H 3GCTF 1Q31A 1HFDA 1QL9A 2J94A 4GPGA 1SGRE 1E35B 1QBNA 2Q6GA 5HIYA 1C2JA 1AZ8A 1L1NA 1ZOMA 1GI1A 1O38A 3UB0A 1C5OH 1ELCA 2P3UB 3ZZ7A 1VZQH 4THNH 1TFXA 5DJ7A 2QE7D 2ZHDA 1XUJA 1GDUA 4Y8ZA 1TPSA 3TJOA 1TAWA 4YT7H 1PPFE 3URCA 3OTPA 1ANCA 1KSNA 1GHVH 3BSQA 2WV5A 3ATKA 1C1MA 4NSVA 3E90B 4ISOA 4X8UH 2FS8A 1AKSA 2IOTA 1LHCH 2PSXA 2F9VA 3SJKA 1S6HA 3GDUA 1TGBA 1ESAA 2J5UA 3S9BA 3BEFB 3GICB 1ANEA 2VIDA 1TX7A 2Q6DA 3RU4T 1HJ9A 1M9UA 1E0FD 3GY4A 2IPHA 4AGJA 3F1SB 1F5KU 1DUAA 4AGKA 3DA9B 1F7ZA 1GJ7B 2XBVA 4O9VA 2YNBA 4MG3A 2CJIA 4B76A 1HAXB 4E05H 4ACBA 5F03A 3VGCC 3ZVDA 2P16A 4UFFH 4LOYH 3BV9B 2Y5GA 2FYRA 1GVKB 1C2GA 1OYQA 1UCYH 4K1SA 5C0TA 1OS8A 4IGDA 4NSYA 1CQQA 3MH4A 3N99A 4SGAE 5LPFA 2O8LA 1ZGIA 3SGQE 3AK5A 3MH6A 2J38A 4CBOA 2GD4B 2VNTA 4FUJA 3ITIA 3QWCH 1RRKA 4INKA 3E1XB 3TGKE 1YPKH 1BHXB 1O2WA 2AERH 5E0JA 1Y3WA 1BRBE 4HGCA 4AZ2B 3DSOA 4IBLH 4MLFB 1O3KA 5ABWA 1O2NA 1V2LT 3NKKA 1P04A 4CRGA 1THSH 1TNHA 2FXRA 3ZZAA 3DSGA 3FFGA 3SUDA 2OXSA 1ETRH 2HNTF 3KEEA 3VB4A 2BY7X 1WCZA 1BTYA 5DGJA 1KLJH 1S81A 3M5OA 1P2IA 4X1SU 1AY6H 5GCHG 1EPTC 2XNIA 1O3PB 3BIVH 1PJPA 1DSUA 3N7DA 2Y5FA 1CVWH 5JBTA 1EASA 2FOGA 4D9QA 2O8UA 1HBTH 2ZFTA 4JCNA 5SGAE 1P11E 1CE5A 3EA9A 3HKJB 4OS5A 2QF3A 4NIYA 8LPRA 2XBYA 2EQNA 7KMEH 1CO7E 2A7CA 1AVXA 2BLVA 2OBQA 6CHAB 2P95A 1CHOG 2RG3A 3LT3A 4MPWA 3ZV8A 1YCPM 2J2UA 1AGJA 2XWBI 1RTLA 2F9PA 4GCHF 4RI0A 1OWJA 1G3BA 3LH3A 4ABIA 4U01A 5DP7A 1HAHH 1KYNA 1VR1H 2CV3A 5PTPA 1C4U2 4BTUB 1MAXA 1P0SH 3QK1A 6LPRA 2ZGCA 5EQRA 1RFNA 1NC6A 1ARBA 1IQHA 2QN5T 5GNDA 2W7UA 4I31A 2TGTA 2ZGXH 4OGYA 1FN6A 1LHGH 3RXQA 3MO6A 1C1VH 1ZRKA 5EJLA 4K3JA 4X2XA 2HRVA 5DP6A 1P57B 3HK3B 3MI4A 1ZHMA 1H9LB 2ZC9H 3Q3YA 3SNCA 4KELA 3RMMH 4KGAA 1K9OE 4FUBA 3OSYA 2BOKA 1HAYB 2G4UA 2SNVA 2VH0A 2GCTB 3GCHC 2WYJA 1T8LA 1P09A 1BJUA 1YLDA 1QL7A 2ZDKA 1GVZA 1W0YH 2Z9LA 1J17T 4BAHB 1HIAA 4K8YA 1PQ8A 1GJBB 3CNRA 3SUGA 4F55A 1B0FA 1A3BH 3MQKC 1ZTLA 1W11U 3U28C 3P70B 2IPQX 4CR9A 4CRFA 4WY3A 2GCHF 2FLBH 2PKSB 1E38B 3NUMA 1O3DA 1S0QA 2SGFE 1VCWA 1J15A 1EOLA 5DO4H 2ZDVH 3QDZB 1DX5M 2Z3CA 3SGBE 1GHAG 3LGIA 1HAVA 3RXAA 1ZSJA 2GX4A 3T27A 3QTVH 2VB0A 1O2OA 1DVAH 2K0QA 4ABFA 3LDXH 3MU5A 2A5IA 4BTTB 5T6GA 2ZTYA 3S0NA 1MKXK 2G00A 4JZIA 1YC0A 5L30H 1EOJA 3PLBA 5C1YA 1DITH 2BD7A 2Q6FA 3TVJB 1C2KA 1QNJA 2A7JA 2ZKSA 1C1SA 2ZGHA 3M3VA 1O3NA 3M5LA 1NRNH 3MYWA 3F2GA 3E0PB 3SJIA 4X6PA 4Z0KA 3TPIZ 1AUJA 1QB9A 3TK9A 3QZQA 1MBQA 2PW8H 1DXWA 1GHXH 1XXDA 2CN0H 1GI4A 1OP8A 1MKXH 4HG6A 1ZMJA 4UFEH 4YLQH 3M3SA 3T62A 2CMYA 2ANMH 4A5TS 1NBME 1OHHD 1L4ZA 4P02A 2H2ZA 1NFWA 1BMAA 2W26A 1O3FA 5J4SA 3RXBA 3A87A 4TWWA 2SGEE 7LPRA 4K69A 1BB0B 3NWUA 3TLOA 2XTTB 1JIMA 5L2ZH 5A09A 1TIOA 1OX1A 1F92A 2GCHG 3U1JB 1Z6JH 2ODPA 1DUEA 5CHBA 5T6DA 3UWIA 4RKJB 1UTMA 2ZHFH 1BTPA 3HATH 4B2AA 1EPTA 2OCVB 1IQJA 2FOFA 2UWPA 1E1QD 4D7FA 1SSXA 1NFXA 3V13A 4MNVA 2BX4A 1Z7KA 1J16A 1KXAA 1FN8A 2ASUB 5CDFE 1UVSH 4B71A 2QXIA 3EDXB 1N1LA 1RXPA 1FLEE 2JH6D 2HNTE 2XWAA 1K1MA 2SGPE 4BOHA 4BAQB 3LU9B 2AGGX 2R0LA 3L3TA 1MH0A 2H5CA 1ESBA 1K22H 4JZEH 1C9PA 4XBCA 3VFEA 1FDPA 1GJ5H 1UTOA 3PB1E 3EAJA 2PKAB 2A4GA 1EUFA 1A1RA 3GY5A 3I77A 1S84A 1QB1A 1E34B 5E2OA 1GDNA 3SUFA 4ISHH 2KAIB 2J98B 1ZLRA 3SU3A 4AOQA 4B6FA 1GJ9B 1ZHRA 4KTCA 3M37A 4NG9H 1JRSA 1XMNB 2W6ID 4Y7AA 1GG6B 3MU4A 1AVWA 5TCAA 4E7NA 1MMJN 2Y82A 5FPSA 1AUTC 3ATLA 1W7XH 3MMGA 3CS0A 4WXIA 1C5SA 3A8DA 4INHA 1YPMH 1O3JA 1K28D 2J34A 1GI9B 6CHAC 1CT4E 3O8RA 1AVGH 3V0XA 1BQYA 4XBDA 2C4FH 1OOKB 1K1NA 4AYVB 3AW0A 1J8AA 1AWFH 2WPLS 1NRQH 1FPCH 3VB3A 1GHBF 3U8RH 5B6LA 2AMDA 1HV7A 3PMBB 1O2XA 2D2DA 5F8XA 5F8ZA 1PPCE 3RM2H 1ABIH 1Y8TA 1Z8JB 3SUEA 1BTUA 3KQCA 5GDSH 1C5WB 1FONA 1KDQA 3MO9A 5G4BA 1O2IA 2WPHS 1C5PA 2CXVA 2BY5X 1A2CH 4KKDA 3EE7A 1YCPK 5C0UA 5EPNA 4MPUA 2OQ5A 1YYY1 1K1JA 4DIHH 2GCTC 4FU9A 4O97A 3OEED 1UTNA 3SJOA 4BAKB 4KTUA 1C2LA 2OC8A 2THFB 3SV7A 3MU0A 1V2MT 2L6OA 4MTBA 2RFKC 2QV1A 1W14U 1COWD 1C2EA 2P3FH 2AMQA 1C5VA 4HZHA 2ZDLA 2BXUH 1GMHF 3GOVB 1L4DA 1G37A 5C5OA 2PKSC 3UNQA 4FUEA 4Y8YA 1HJAB 3E0NB 2J97A 2VIOA 1TRNA 1BTXA 1HXFH 3TH2H 2VU8E 4TY6A 1O3OA 2FS9A 3DSPA 2BMGB 1VITH 2PV9B 1FXYA 2NU4E 1GBHA 4E7RG 5IK2D 1V2NT 5FXLA 2ZF0H 2Y7ZA 3SZNA 2PLXA 5F6MA 1Y5UT 2ZFSA 5CHAB 3SBKA 2BTCE 1SGDE 1XM1A 1IHTH 1MZAA 2ANWA 1AWHB 1T31A 1MKWK 1KXEA 1G36A 1A4WH 5CE1A 4O03A 1WDIA 2GDEH 5K7RA 4ISIH 1AZZA 2VIPA 2JH0D 1D4PB 4Q7XA 3PMJA 3ZZCA 4ZAEA 1IAUA 4FUGA 3WY8A 4AYYB 5EOKA 1GMDF 1TA2A 2ZPRA 2NU1E 1TPPA 1TALA 3PMHB 5FBEA 1THPB 2VWOA 3PM3A 1LHDH 2ZGBH 3RXUA 5LH8A 1SPJA 4OM9A 2GP9B 1OWDA 3SU6A 1B5GH 3ELAH 3BEUA 4I32A 2WV4A 3RP2A 2FMJA 2Q1JA 3ZZ5A 1F0UA 1SLWB 1T8MA 1EB2A 3WWBA 1QTFA 1OWKA 1EB1H 1OPHB 1EJNA 3PMAB 3RC4A 1BA8B 1TGSZ 1SMFE 2FI3E 2QF0A 3FZDA 1RTKA 1W0ZU 3ZYDA 3OYPA 3K65B 1W12U 1UVTH 2A32A 2W5EA 3A84A 1KLTA 1YGCH 1ZPCA 3LGVA 4AFZA 1O2GH 2ZCHP 1TOCB 2QXHA 2M2AA 1P2OA 3SN8A 2XRCA 2B0FA 1WU1A 1HCGA 1DLEA 1SGEE 2AMPA 1QB6A 1IQMA 2AEIH 3QLPH 3S7KB 1L1GA 1MZDA 1QA7A 4ZUHA 2O8TA 1SFIA 1TMBH 3A82A 3V3MA 3BTTE 5IYTA 5EODA 4I33A 4I8JA 1HXEH 1NBMD 1GBIA 4X1RU 3KQDA 1DDJA 1PQ5A 5A8YA 1YPHC 2F3CE 3RXRA 1GVLA 2ZFRH 1SC8U 2BY9X 2TGDA 4X6NA 1DM4B 1AB9B 1PPEE 4Y0ZE 3SJ8A 4X8VH 3ATIA 1YLCA 1GG6C 2WPJS 1QRZA 1XUGA 2ZU2A 2JH5D 3MWIU 3MNSA 1OP2A 2AHME 2G8TA 2NU0E 3LONA 3LGTA 4A7IB 2QY0B 3UTUH 5ESTE 4FUDA 3RDZA 4NFEA 3Q77A 1JMOH 1QZ8A 1PPZA 3TGJE 2TPIZ 4NA9H 4AFQA 3OY6U 3S69A 3RXEA 3F0OA 1ZMNA 2D26C 3ZZ6A 2H9EH 2OP9A 1HJ8A 3DFLA 4YZUA 2HLCA 1EJAA 1K2I1 3ZZDA 1P06A 4BXSA 1ORFA 2Z7FE 2WZQA 1C2HA 3SOSA 1QBOA 5EQSA 4MDSA 5TCCA 5EGMA 4WVPE 2ZIQH 3VB5A 2OINA 3OAAD 2JDID 3P17H 1C2DA 1MBMA 1TPAE 1RS0A 1BDAA 1K21H 5DP3A 3WW7A 1WBGB 1G2MA 1LQDB 4BTIB 2HWLB 1QQ4A 2EEKA 1FY8E 2QA9E 4XD7D 4XOJA 4NA7A 1O5AB 3A8AA 4ZH8A 3A89A 1OWHA 1O3LA 3F9FA 3MNXA 2JKHA 3SYJA 3PV4A 1EAXA 1MUEB 4JMYA 1F0TA 1JBUH 2HALA 4I86A 3SNBA 4QT8C 2BDHA 2A1DB 2O9QA 1UW7A 4B75A 4RKOB 1O2ZA 5EXMA 3GCTG 1BMMH 4RT0A 1BBRE 1D3DB 1FY3A 3P92A 4ASHA 8ESTE 4DGJA 4FVBA 2V3HH 2B9LA 1GI0A 2ILNA 1E79D 1RTFB 5H4IB 1DWBH 1G3CA 2BD9A 2O8WA 2W3KA 3FO8D 2G52A 4Y71A 4Y6DA 1FI8A 3EA8A 4YLUA 4Y76A 3QZRA 4NA8A 1HJAC 1CHGA 1YM0A 3SU2A 1BMFD 2UWOA 3PTBA 1G32B 2P3TB 5F8TA 2BD3A 4B73A 1ELGA 1Y3VA 4IMQA 4FUHA 1W2KH 1OYTH 4UFGH 1TYNA 1C2FA 2BDIA 3U69H 8KME2 1C5NH 2XXLA 3KQEA 5I46H 3S9AA 2BD4A 1BTZA 2P94A 2J9NA 2KR7A 1J14A 1O35A 2FPZA 1A0JA 2VVVA 5CHAC 1EAWA 2GDDA 2BDCA 4YESB 4JYTA 1TBRH 2ZPQA 1HAPH 1W10U 8GCHF 3RXSA 2Z9JA 1BHXF 1BRCE 3RU4E 1SQOA 4J2YB 1CGJE 1C5LH 5A8XA 1P3CA 2ZDMA 1GBJA 1HB0B 2KFWA 2BDGA 1BCUH 6GCHF 4YTAA 1SB1H 5C1XA 3KIDU 1NU7B 1WAYB 4YT6H 1PPBH 1GWAA 3BTKE 5AVDA 5LPEA 1O2YA 1U6QA 4XBBA 1UK4A 4BANB 2HVYB 2GVFA 3SNEA 2AH4X 1XUKA 1P2QA 2PKAA 1QJ1B 2VBCA 5C17A 2SFAA 2NU3E 1P9UA 1P10A 3KCGH 2PUXB 5FX5A 1SR5C 4LZ4B 3EYDA 4AB9A 2J98A 9ESTA 1O36A 1A0LA 2AGIX 1Q3XA 1UTKA 3PRBA 1C1WH 3DUXH 1V2TT 2P8OB 2BLOA 3URDA 3HPTB 3MNCA 3TK6A 4K1TA 3GDSA 5AFZH 2OK5A 2ZFPH 1A46H 1CBWB 3GCNA 2ZPSA 5C20A 1DFPA 1P03A 3CENA 2SGDE 2RDEA 3F68H 1TNLA 3A8CA 1NROH 3P8NA 7GCHF 1PYTD 1KTSB 4VGCB 1YPEH 1BTHH 3LGUA 3QUMP 3F9EA 5TJXA 3K6YA 1Z8GA 1CU1A 3M61U 1NT1A 1TGNA 4I8LA 2JETB 1AB9C 1EP6A 2Z9KA 2UWLA 2FLRH 1WOFA 1TE0A 1O34A 5A0AE 2F91A 4KP0A 3M35A 4GCHG 3M7QA 2SGAA 2ZFQH 1ZSKA 5E0GA 1TABE 1SLUB 1UVPA
chains in the Genus database with same CATH topology
4BAOB 1IQNA 4MNWA 4AN7A 4XFQA 2ANYA 1C5ZB 2Y6TA 1DWEH 4A1TA 4RN6A 1K1LA 1N8OB 4IC5A 1K1PA 3ZZ9A 1T8NA 1H9IE 1O2JA 1WQVH 3LC5A 4M7GA 3OU0A 2A4QA 1TOMH 3GY3A 3ZV9A 3FAOA 4X2YA 3DHKH 4KTSA 4JZDH 2GT7A 1ELVA 1H9HE 2R2WU 3TU7H 2TIOA 1MTVA 7GCHG 2Z3EA 3RXFA 1B0EA 1LCYA 1YP9A 1XX9A 3HK6B 1V2RT 4WJG2 3VPKA 4WMDA 1B7XB 4ISLA 1JIRA 3GYLB 3MH5A 2FOEA 3RXIA 2UUFB 1FZZA 2HVXA 1NRSH 2WPIS 3KGPA 5DP9A 2HOBA 3PWBA 3NPSA 1LO6A 1FAKH 2PHBA 2ZDNA 4GUXA 4GSOA 2A7HA 4AFSA 2ZU5A 1K1IA 4ISNA 1K1OA 3JZ2B 3GDVA 1G30B 1QFKH 1HRTH 1UCYE 2R2MB 1UMAH 3RXJA 1O2QA 1OWIA 2GMTB 2BDYA 2DE8A 4B2BA 3JZ1B 3PROA 1NS3A 2SNWA 4RSPA 4O3TA 3SV2H 2XBWA 2VJ1A 1MD8A 1V6DA 1VJ9U 1ZTJA 1CA8B 2HPPH 3KN2A 1AD8H 3U8TH 2FP7B 2FODA 1OKXA 2FTLE 4H42U 2C90B 1TGTA 1MCTA 3VB7A 2ZU1A 4DT7B 2B5TB 3H7TA 3SHAH 2BM2A 2HNTC 4NFFA 1QCPA 4R0IA 4YOIA 1F2SE 1GHYH 3NXPA 3HGNA 3T5FH 1GCTB 1UTLM 1YPJH 1O3MA 3OTJE 1Z71A 3Q3KA 1P2MA 3MH7A 1O33A 1EJMA 4ZHAA 2Y80A 1BMNH 3M3TA 3PTNA 4X1PU 4FU8A 3TH3H 1RD3B 4CRAA 1GMCF 2CF8H 2ZEBA 2Z9IA 3UUZA 4A1VA 2VWLA 1A7SA 4K1EA 1GBDA 3RXTA 3UNSA 4DJZB 3LPRA 4ZHMU 2RDLA 1AE5A 3TJVA 3UOUA 2RCEA 4Q7YA 1ZRBA 4OS6A 3GYMA 2GTBA 1O5FH 5JB9S 1IQLA 1BITA 4JK5A 3U9AH 3AW1A 1OP0A 3G01A 2ZHQH 1NU9A 1C2IA 4IN1A 1A3EH 3A7TA 2PTNA 1G9IE 4NGAH 3AASA 3UFAA 3T2NA 2TBSA 1W8BH 1GJ4H 1MQ6A 3RXMA 4CREA 1NY22 2ZCLP 1O2RA 2P8OC 1LMWB 1O30A 4AB8A 3RM0H 2ZG0H 1A5IA 1PQ7A 1TMTH 2XYAA 4ESTE 1CT2E 3A7WA 4JYUH 4CHAB 3GY2A 1CBWC 3RMOH 2BD5A 3TH4H 7ESTE 2FESH 1ZSLA 4X1NU 1C1QA 2XC0A 1EZXC 4Y10E 2FO9A 1IQIA 3Q00A 4ZKRU 2Z9GA 3NZIA 4PROA 3RU4D 5T6FA 1GBKA 4CH2B 2UUYA 1F5RA 4VGCC 3M36A 1SFQB 1S0RA 2ZFFH 3S7HB 1GBTA 1TX6A 4IC6A 3P8OA 4X0WU 1NZQH 4MPVA 2Y5HA 3BF6H 1YCPH 2JETC 1YBWA 3M7UA 5FCRA 1O0DH 1SOZA 1BBRK 4TY7A 2LNCA 3UNRA 1TQ0B 1Z8IB 3RXDA 2FYQA 1BTWA 2VINA 4E06H 1GI2A 2HPQH 4WH6A 2OTVA 4YOJA 4DG4A 1GHBG 3EQ0H 1WUNH 2EI6A 3QGNB 1O5GH 3NK8A 2K1QA 4X2VA 2Z6BD 1TRMA 1GBFA 1O2HA 2UUJB 2A31A 1N8OC 1UK3A 2PGBB 1S83A 1A5HA 1ABJH 4I7YH 1DICA 2OC7A 1W7GH 1GJ6A 3BTFE 4AG1A 2BB4A 4FXGH 2QAAA 1SOTA 2C8ZB 1VITF 1KXCA 3T28A 1GI3A 2BDAA 1QIXB 4ZXXH 4NWLA 3E3TA 4O3UA 3EGKH 1QHRB 3FANA 4FUFA 4U30A 2IJOB 2DE9A 4DVAU 4MNYA 1O2PA 3MFJA 2XCFA 1OXGA 1DOJA 5EQQA 3RXVA 3ZVFA 1MD7A 2V3OH 4WH8A 1SGQE 3K2UA 1N6YA 3Q3XA 1TGCA 3RMLH 1O5CB 4CR5A 1GMHG 1MKWH 1C1NA 1XVOA 3UIRA 4NZLA 2P59A 2Y81A 2ZDAH 4WF8A 3BTHE 5C3NA 4F4OC 1AFQB 1F0SA 1L2EA 1LHFH 1SGNE 1NTPA 3T25A 1GL0E 1EX3A 3HKIB 2A4OA 3M7TA 2FDAA 4CRCA 1TMUH 1O37A 3A8BA 1KXBA 2GMTC 1Y3UA 1V2QT 3A81A 1GBCA 4GVUA 3V7TA 1GBLA 1BIOA 1ZYOA 3W94A 3R0FA 4GHTA 4FUCA 2TGPZ 1DXPA 4K8BA 3RXHA 1LKAA 1P12E 4DCDA 3ENSB 3MO3A 1X7AC 2QC2A 1NESE 3LH1A 1DLKB 3A7XA 2FM2A 4ABEA 1A61H 3CS7A 1Y3XA 1SHYA 1C1PA 1C1UH 2WUBA 4CRBA 3VEQB 4I8HA 1GCTC 2HGTH 3BN9A 3T29A 5DP4A 5EXLA 4DY7B 1S82A 5HYOA 4A1XA 3H5CB 4OS2A 1GMDG 3E91A 1RIWB 2D8WA 5L6NH 1CA0B 2ALVA 3SV6A 2C8YB 1ELTA 1OSSA 2GZ8A 4WMFA 3M5NA 4Q80A 3DD2H 1C5XB 3IWMA 3EA7A 2ZTZA 1C2MA 1ZHPA 2NU2E 4WWYA 1XUHA 1SBWA 1JXPA 1FY5A 2VVUA 3LJOA 3VB6A 4DIIH 4AX9H 1ACBE 2TRMA 5E0HA 1SHHB 2VIWA 4UE7H 2ZP0H 4FUIA 1E36B 3RC5A 1CGIE 1V2KT 3FP6E 4F49A 2G5VA 1ZGVA 3TNTA 5AHGH 4UDWH 5JBAS 3IG6B 1H1BA 1AE8H 1V3XA 2FOBA 1C5MD 1N6XA 3QX5H 1RJXB 2AFQB 4Q7ZA 1TWXB 5EW1H 3MU1A 5JB8S 1ETTH 1YKTA 3F9GA 3RXCA 1LVOA 1O3GA 2R3UA 4OS7A 1DY8A 3ZZBA 4NIWA 2FI5E 3QGJA 1UHBB 2UUKB 2PUQH 2VWMA 4ABHA 4UONA 1WSSH 2AIPA 4GHQA 4CHAC 1CT0E 2ODQA 5FPYA 2PFEA 3RXLA 1P2KA 1TLDA 4X8SH 1ZTKA 2FOAA 1ZPBA 2BD2A 1BOQA 1L1JA 1DWDH 1GHZA 2F9BH 2BX3A 2YOLA 2VIVA 3O8CA 5DG6A 3UPEA 2I6QA 1HAZB 3TK5A 3EE0B 1EAUA 1NRRH 1P8VC 5AF9H 2NWNA 1DSTA 3PLKA 4DOQA 1J9CH 1ID5H 3O8DA 3SU1A 2GZ9A 4B1TA 1P02A 1O5BB 3T26A 4TPYA 1FY1A 1O3HA 1NM6A 1GPZA 3AAVA 2XW9A 1GI7B 2ZU3A 5DK1A 1PPHE 1MQ5A 1GI6A 1UCYK 1Y5BT 1EZUC 2G55A 2FWWA 1GL1A 2GT8A 5GCHF 3SO3A 3O8BA 1BZXE 1V2PT 1O2UA 1D9IA 3UREA 2BVSH 1NO9H 1D3QB 2ZI2H 4ABDA 3GY7A 1XVMA 2A2QH 2ZECA 4J1YA 2DUCA 3SU0A 2O8MA 2Y7XA 1O3AA 4K2YA 1AFEH 3P8GA 1YPLH 4B2CA 3RLWH 2G51A 5JBCS 1C5QA 3TJNA 1CHOF 1P9SA 1LQEA 1XKBC 1SVPA 1ZZZA 1NFUA 2EI8A 1KXDA 3SW2B 4IN2A 1Z1JA 1TQ7B 4JZ1A 1WTGH 3L6PA 3ESTA 5FPTA 2WYGA 2R0KA 4ABBA 1BMLA 3ZZ8A 1XKAC 2YNAA 1FIWA 2VIQA 4XDEA 3E16B 3VXFH 4D76A 4ABJA 2SGQE 4D9RA 2BDBA 3SQEE 5EW2H 4AFUA 1IHSH 2AIQA 2WUCA 3D49H 3W95A 3Q76A 1P01A 1JRTA 5AFYH 3ZVEA 3H7OA 2STBE 3PWCA 3SORA 2ZGJA 2ESTE 4INLA 3TNSA 2C8XB 3VXEH 4TWYA 3CP7A 2VVCA 3RXOA 1AFQC 3OY5U 2J4IA 1INCA 3UR6A 1O2LA 4JYVH 2QIQA 3BIUH 2FIRH 1V2UT 4IW4E 3KHVA 1O5DH 4LZ1H 1P3EA 1A0HB 2KAIA 1DPOA 1QJ6B 4WXVA 2PWXA 1O39A 1IQKA 1SGYE 2F9OA 2V0BA 5HMAA 2VGCB 1O2MA 4OGXA 1PPGE 5BRRE 4ZKNU 3SV9A 3GY6A 1AN1E 1GBAA 1KTTB 1EZSC 5EU8A 1HAGE 3UR9A 1EP5A 3ZVBA 1Q2WA 1GJDB 2ZQ2A 2GV7A 1UO6A 1FY4A 1ETSH 5EXNA 1QBVH 5T3HA 8GCHG 2OLGA 1NRPH 4Y7BA 1SGFG 1EATA 3FZZA 2FX4A 1PQAA 4K60A 4ZHLU 1GHAF 4FVDA 3QO6A 3BTWE 2FOHA 2ZHEH 3HGPA 2A2XH 2QCYA 1SQTA 6GCHG 3SQHE 5HM9A 1SGPE 3SGAE 1SG8B 3FVFB 3SU5A 1RIWC 4ZROA 3RUOA 1KXFA 2FOMB 3I29A 1CA0C 4OS4A 3PO1B 2VH6A 3P8FA 5I25A 4YM9A 3OX7U 2ULLA 1SL3A 3GY8A 1AI8H 4D7GA 2AYWA 1LTOA 2BZ6H 1QA0A 1HGTH 2W7SA 1TONA 2XCNA 3SHCH 2WINI 4MVNA 5DP5A 1ZJDA 2FTMA 1WV7H 3GCOA 2C8WB 1V2ST 1Y59T 3MNBA 1AKSB 1T32A 3A80A 4YOGA 1FJSA 1V2VT 3U98H 4UFDH 5GXPA 3U8OH 3UQOA 1OWEA 1UJ1A 3V12A 1GHWH 4B74A 1GGDB 1DWCH 1O5EH 1TBZH 2ZQ1A 1V2JT 3ZVAA 5EG4A 1MTNB 2EA3A 4HI3A 1FQ3A 1O2KA 5C2ZA 3ZZ3A 4ABAA 1T7CA 1BRAA 2V35A 1O3IA 1KLIH 1C4V2 2C3SA 3KF2A 4NIVA 2VWNA 5FHTA 3ATMA 4Y0YE 4CH8B 1LPZB 1TNGA 1JWTA 1TB6H 1ELEE 2J92A 1TNIA 3ZVGA 1GI5A 1EZQA 2I6SA 4ZXYH 2H9TH 2OC0A 2IN2A 2WPMS 3SI4H 1NN6A 1UVUH 3SV8A 1HYLA 1BRUP 3LKWA 4UD9H 1FIZA 1T4UH 4UEHH 1IQGA 2AGEX 2J95A 3D62A 5IDKA 1G3EA 1QURH 3FP7E 1SQAA 3UY9A 5ETXA 3UWJH 2ODYB 4A92A 1E37B 3I78A 2BYAX 1MCVA 3RC6A 1AHTH 1ZMLA 3D23A 1GI8B 3E6PH 1PFXC 3BTDE 1A5GH 4X2WA 5C1UA 2BQWB 3A83A 1TX8A 4H6TA 2ZZUH 5JDUB 1C5TA 1AO5A 3P6ZB 1UTPA 1LVYA 2R3YA 4X6MA 2A5KA 2CF9H 1P2JA 2BY6X 3D65E 5LPRA 2GV6A 1HLTH 3F6UH 2ANKH 1EXFA 3BTGE 3TITA 3L33A 2H9HA 3PYHA 2V6NA 1IQFA 5GIBA 2R9PA 1QGFA 4CBNA 1G2LA 1ANDA 1HAIH 1ZR0A 5LGOA 1QR3E 1ELAA 1O31A 4WMEA 3P95A 1SGIB 5GJ4B 4H4FA 2A4RA 2CHAB 3R3GB 1MAYA 1O3CA 2BY8X 1P2NA 1C1OA 1GJ8B 1RGQA 2F9UA 5A0BA 5FAHA 4HFPB 4XE4A 1VGCB 3RXGA 1TA6A 3LIWA 1O2VA 2XBXA 3QN7A 4SGBE 3RXPA 4H6SB 1LDTT 2TGAA 1QRXA 2F83A 2Z3DA 2OUAA 4OS1A 1CSOE 3SJ9A 1LHEH 1ANBA 1DY9A 1D6WA 2GKVE 2H5DA 5FBIA 5CMXH 3K6ZA 4FU7A 2CGAA 5BPEA 1O3EA 1TNKA 1GCDA 1TPOA 3BG4B 1DT2A 3KQBA 3B23B 1HNEE 4IMZA 1FAXA 3A7ZA 5JBBS 3PLPA 2STAE 1W3CA 2FX6A 1THRH 1S5SA 1AMHA 2OD3B 2VGCC 1XUFA 5K0HA 1AU8A 1GBEA 1UTQA 3SI3H 1H8IH 2QYIA 3LGWA 4Y11E 5HXFA 3A86A 5ESBA 3KNXA 1TRYA 2BD8A 1NFYA 1S6FA 3IITA 3MTYA 3QTOH 2ALPA 5C5NA 2OBOA 4ABGA 1GJAB 1FMGA 2D1JA 3E8LA 3RLYH 1GMCG 1FUJA 1MTWA 4NZQA 1XXFA 1HIAB 4Y8XA 1ELDE 4R8TB 3STIA 2FEQH 2FI4E 4NWKA 1SGTA 2W3IA 3STJA 3BG8A 2BLQA 1Z6EA 1QQUA 3ODFA 3AVZA 4TYDA 5HGGA 4ZKOU 1C5RA 2M5TA 3PO1C 1ARCA 3MOCA 1UHBA 4YO9A 2B7DH 3RMNH 1EQ9A 1W13U 3BTME 1HAVB 1DANH 4NCYA 1LKBA 1VCPA 2QXJA 3S9CA 4AG2A 1O32A 1O3BA 4GLYA 5GWZA 1F5LA 4DURA 1MU8B 2WPKS 3VGCB 1JOUB 5B6OA 4D8NA 1TBQH 1Y3YA 3ZYEA 1GBBA 1BBRH 3ZZ4A 1FV9A 2ZNKH 3A7VA 3RXKA 2QGRA 3SNAA 4XSKU 2PR3A 5DP8A 3AAUA 4U2WA 1D3TB 4BNRA 2OC1A 1Z1IA 3BTEE 3ATWA 3C1KA 5A0CA 1NPMA 1GGDC 3U1IB 1C9TA 1TNJA 5C67A 2BVRH 1SLXB 2A5AA 3GISB 1F0RA 1MTNC 4HTCH 3M5MA 1EKBB 2RA0A 1O2SA 5A8ZA 1QRWA 3TJUA 1YPGH 2BXTH 1ZJKA 2BHGA 4Y79A 1SI5H 4Q2KA 1LVMA 1ZPZA 1KIGH 3KL6A 3B9FH 1Z8RA 3MU8A 4MNXA 1PYTC 1UVOA 4JZFH 1HPGA 3LC3A 1QY6A 1DS2E 3A85A 2BVXH 4GAWA 1UTJA 2PGQB 3LOXA 1O2TA 1D3PB 2LPRA 1ELBA 5GPIB 1EPTB 4X8TH 5E8EH 3TIUA 1WYKA 2ZCKP 1HDTH 2H6MA 1SGFA 1Y5AT 1QL8A 1T8OA 2PSYA 4ZKSU 1V2OT 5FCKA 3B8JA 2EI7A 4BAMB 3TGIE 1HAOH 2BZAA 2QXGA 4LK4A 3K9XB 3A7YA 2BOHB 3F9HA 3C27B 4AORA 2A0QB 2FZZA 1C1RA 1ESTA 4ZMAH 2ZHWH 4I8KA 2BQ6B 2AS9A 1VITG 4MQAA 4IS5A 1FPHH 1V2WT 3LGYA 4MPXA