3MO3A

Investigation of global and local effects of radiation damage on porcine pancreatic elastase. fifth stage of radiation damage
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mo3A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mo3A01
2EA3A 4DURA 4NFFA 5K0HA 3LH1A 2BM2A 4JYVH 3A80A 4A1VA 1T32A 2PTCE 3A83A 4MPVA 1GI6A 2TIOA 3GCTF 3MTYA 2M5TA 1HAIH 4FU7A 4A6LA 2QXJA 1ZRBA 1TLDA 2XCFA 1DS2E 1KIGH 3RUOA 1GBFA 2V6NA 2DE9A 1IQIA 3CS0A 4K1EA 3PTNA 3EA8A 3VGCC 1W10U 1NN6A 3GYMA 3QLPH 1GJAB 3I78A 4RKOB 3MNXA 5LPEA 1AVGH 1AY6H 3KNXA 1DXWA 4KTUA 1GWAA 2P95A 1NM6A 1NT1A 3TJVA 5GJ4B 3MO3A 1C1RA 1LMWB 3AASA 3U8RH 4E7NA 1K1IA 1C5OH 1TONA 4CREA 5EW1H 1DM4B 1O5EH 1MBMA 3A89A 3A86A 1UCYE 2I6QA 1G3EA 1A0LA 1SL3A 2D2DA 2EI6A 4YZUA 3SNAA 3EA7A 5F8TA 3O8DA 1SOZA 2Z9KA 1BZXE 3KQCA 3ODDA 3UOPA 1IQGA 2G5NA 1O32A 2ZCLP 1BTZA 1OWIA 3MHWU 1HAVA 3RXSA 2Y6TA 3RP2A 1CBWC 2A4QA 5C20A 1ZTJA 3RXEA 1NO9H 1P2KA 1VCWA 3N7OA 1GGDB 1GJ8B 1QJ6B 1ZGVA 5GCHG 2P3TB 5C3NA 2ZTZA 3EDXB 2QA9E 5FCKA 3OY6U 1ABJH 3KN2A 4GLYA 1G3BA 1SGQE 3MU4A 5DP6A 4UEHH 1ELVA 1ZPBA 3BG4B 1PPZA 4FUEA 1LVBA 1UTPA 3SUGA 5HYOA 4JCNA 4Q7YA 2BDAA 2BOHB 3I77A 1ZSJA 2XBWA 4Y0YE 5E0GA 2FTMA 3M3TA 8KME2 1A5GH 3B8JA 6GCHG 5JB9S 5C1UA 1O5FH 4CH8B 1JWTA 3LIWA 2PLXA 2PV9B 3O8CA 4XFQA 2QC2A 2PSYA 1V2QT 1WU1A 1XUHA 1UHBB 4J1YA 3ZV8A 1SGCA 7GCHG 4FU9A 1A5HA 3A85A 4RKJB 1BRAA 2ZFPH 3SJ8A 4MQAA 2J92A 3HK6B 2PGQB 2YOLA 1NFYA 2SGEE 2R0KA 5CHAC 1TABE 5E2OA 1XUJA 1Z1IA 2Y5GA 1FAXA 1PJPA 3PLPA 3ZVAA 1SPJA 2W3IA 1NROH 4MDSA 1BTWA 1EPTB 3TNTA 2ZHWH 1AUTC 2BD3A 1DWDH 5FBEA 2CXVA 2ZDVH 3K6YA 3SJKA 1YP9A 1F5KU 3TGIE 1G3DA 1YPGH 3UREA 1MH0A 1P02A 1W0YH 1BMLA 3RXRA 1AUJA 4K8BA 3QGNB 3TH3H 3GY5A 2ZDAH 3OTJE 2A2XH 4OGYA 3M61U 4X2VA 4ZHLU 4K2YA 1OWDA 9LPRA 4ABBA 2BTCE 2SGPE 3RLYH 1L1NA 4AFZA 1CE5A 3VPKA 1YCPH 4KKDA 2QCYA 1YGCH 2AMPA 1K21H 5ESTE 3MH7A 3M5MA 4X1PU 3PMAB 1BMNH 3ZYDA 5EW2H 5DP5A 3A7ZA 3VXEH 1RJXB 2FDAA 2J95A 1FPCH 2EI7A 1TNIA 1W8BH 2ZWLH 3TJUA 2ESTE 1KXCA 3TJOA 2BD4A 4M7GA 4ESTE 1E0FD 1S85A 1E34B 1THSH 1TRNA 3M3VA 4D9QA 1FIWA 2A4OA 1NRRH 1RTKA 1S84A 1F5RA 1SGEE 1OS8A 1G36A 4WF8A 1PQ5A 1MTNB 1HAPH 5A8ZA 5FBIA 2Q6DA 8LPRA 5C1XA 1GJ5H 4YTAA 1VGCB 2SGDE 4K3JA 1XX9A 2XNIA 4X8VH 3SN8A 1UVSH 1P3CA 4VGCC 3M5LA 2Z94A 3L33A 3S69A 4Y79A 4HGCA 3LJJA 1NFWA 1GGDC 4FXGH 1OPHB 4AFUA 2ZGJA 1O5BB 1MTUA 3EAJA 1SGPE 3BN9A 1DPOA 4ZROA 2QY0B 4LK4A 4NWKA 2G51A 1P9SA 1FY5A 5DJ7A 1ELBA 1GHBG 1D3PB 1QY6A 1T8MA 2QGRA 3SU4A 3E1XB 2Q1JA 3ZVDA 3ATLA 1NU9A 1ABIH 1H4WA 2OBQA 3SJ9A 2BD5A 4Y7BA 1MD7A 2FO9A 5DP4A 2Z9JA 1ESTA 1TB6H 1GHXH 3SQHE 2HRVA 3LKWA 1AQ7A 1V2OT 1SMFE 1ZHPA 3PMBB 2ANKH 3TH4H 1LTOA 2J94A 1OOKB 1P06A 3PMHB 3KL6A 4F4OC 2H9EH 1HAYB 1UK2A 1QBVH 2FWWA 5J4SA 4K69A 2GCTC 3T28A 3U8OH 4ABHA 2P59A 4JZDH 4ZKNU 2JH0D 2ZA5A 3Q77A 1FONA 1CHGA 4DW2U 2V3OH 3ZZAA 3MNSA 1AO5A 3SJIA 1GHVH 1UVPA 3A84A 1TAWA 1C1NA 4YM9A 2G8TA 1OYQA 1W3CA 1C4U2 3AAVA 3TH2H 2LNCA 3TNSA 1TPSA 1B0EA 2QAAA 2GCHG 4IMZA 1Z6JH 1C5LH 3O8BA 4YLUA 1FAKH 4CRBA 1IOEA 3EE0B 1GBAA 1E35B 3BTGE 1AVXA 3R0FA 2Y81A 4HI3A 2G81E 1T7CA 2HPPH 4B73A 3DFJA 1V2RT 1A7SA 1IQKA 3E0NB 1SQOA 2ZDLA 4X6MA 1C5SA 1P3EA 4TY7A 3S9CA 4NSVA 1C1VH 1PFXC 3VB6A 1EASA 1F2SE 4IGDA 3PWCA 3FP7E 3M36A 3Q3KA 1C5ZB 3RU4E 3W95A 4DJZB 3SQEE 2B0FA 1C1WH 2FYRA 2ZNKH 1W7XH 1GJ4H 3BG8A 3BTKE 3UPEA 1RIWB 4GCHF 1G3CA 1HAZB 4Q7ZA 1O3DA 1YLCA 3KGPA 3GY4A 8GCHG 1SHHB 4NIYA 2ZGBH 1QRWA 2OD3B 3DFLA 2A5KA 3UNSA 1BUIA 3A81A 1EZXC 4ZKOU 2ZEBA 1NY22 1A3BH 1O34A 3M35A 1UTQA 2VH0A 2V3HH 3MNBA 1ANDA 3QTOH 4DGJA 5A0BA 1P2NA 3MWIU 1AVWA 4BTTB 1GVZA 1LPGB 1TYNA 1GMDG 1RD3B 1YPJH 3SNBA 4IN2A 4RN6A 4NA9H 1O30A 1VGCC 2PSXA 1HNEE 4B74A 2GZ9A 2OP9A 3MH5A 1HV7A 2FODA 2IPHA 3UNQA 1O37A 1O2QA 2CN0H 1P11E 1EUFA 2OC7A 4X6NA 1F0TA 1QJ1B 1L4ZA 1GBMA 2WINI 3Q3YA 1ZHMA 3P8OA 1FMGA 3PMJA 2IOTA 2O8LA 1A61H 1KDQA 1P2QA 1QCPA 2PR3A 2LPRA 4AOQA 1HXEH 2NU1E 1MQ6A 2BLVA 1ELTA 1N8OB 2ZFSA 1TX8A 4LZ1H 2O9QA 2ZU1A 3U9AH 1O3BA 3P17H 3SNEA 5JBBS 1HIAA 1SGFG 2H9TH 2RG3A 2J2UA 2WV5A 3UY9A 4CBOA 1NRPH 1UTLM 3PTBA 1O5GH 1GMCF 2FOHA 2XC4A 5EXLA 5HMAA 1MZAA 4NWLA 3UQVA 4AB8A 2JETB 2NU4E 1IQLA 1O3CA 2A5IA 2XTTB 5EGMA 1B5GH 3BTEE 4AX9H 4CRDA 1Z6EA 1GHWH 3M5NA 1ZTKA 2Y7ZA 5TJXA 1O2SA 2TPIZ 1EZSC 3QX5H 4ISNA 3ZZCA 3TGJE 4BAKB 3A7YA 1T8OA 3MYWA 1GHAG 1XUIA 3ZZDA 3TITA 5GWZA 2HALA 1ZJKA 4GVUA 3KIDU 4YO9A 3A7TA 1ARBA 1K9OE 3MMGA 3TVJB 4O9VA 1HAVB 5IYTA 2C8ZB 2BX3A 1D3DB 3S0NA 1DFPA 1P05A 3LPRA 1SVPA 2UWOA 5FAHA 1ZLRA 4YESB 1O3GA 1MAXA 1AGJA 2FS8A 3E16B 5L2ZH 1NFXA 2F9OA 1SLVB 2D1JA 2GV7A 2D8WA 2FZZA 3VB3A 4X2YA 3E90B 1V2PT 1Z1JA 1BITA 2ZPRA 2B8OH 4H6TA 4XBBA 1KSNA 1DE7H 3MU0A 3ZZ9A 1IAUA 4DY7B 1TA2A 1YPHC 4D7GA 4NCYA 1FV9A 3GYLB 5EODA 2ZI2H 2BZ6H 1WV7H 2V0BA 1PPCE 1A1RA 4Q7XA 1EAXA 4AGKA 1KYNA 2JH5D 2H5CA 1GVLA 4A1XA 4DOQA 4X0WU 1SHYA 2PKSB 1RS0A 4B2BA 1TMTH 3F9EA 4Y0ZE 1YCPM 1Y8TA 1GPZA 3ZYEA 1TA6A 3CS7A 1GMHG 2G4TA 3Q00A 1S0RA 1Z8RA 1PQ7A 2XRCA 3BEIB 4ABGA 1UVOA 4ZHMU 1KXFA 1LO6A 3QTVH 3P8GA 2OC1A 3RXDA 1P2JA 1CBWB 1MU6B 1O3AA 2SGFE 1AZ8A 1ELFA 4MNXA 3BTWE 3BTQE 1P09A 2W26A 3F6UH 1Q31A 1WTGH 4DT7B 4UFGH 1C5VA 3ENSB 1YCPK 2PFEA 1GDNA 1DOJA 2Y80A 1SFQB 1MUEB 1W0ZU 1TNGA 3LJOA 1J14A 1YF4A 2BQWB 2PUXB 1C1SA 1BIOA 4XSKU 3RMOH 1M9UA 4AYVB 1DITH 1D4PB 1PPHE 4B1TA 5L6NH 4Q80A 1UK4A 1CA0B 1N8OC 1NPMA 5H4IB 4MPWA 3RXUA 2J38A 2KAIB 3LC3A 1NFUA 1JBUH 2BDIA 1C2EA 1JXPA 3QWCH 1CT0E 3S9AA 1EP5A 2EC9H 2G55A 1LHFH 2PKAA 2BY7X 2VINA 3IG6B 1V2LT 4RSPA 5TCCA 1O3LA 3RLWH 2F9VA 3RU4T 4AYYB 4WMFA 5A2MH 3M37A 1YYY1 1MZDA 1TPPA 3KQBA 1XKAC 1GJCB 1HFDA 5I25A 1JRTA 4NZQA 1BRBE 1HAOH 1OSSA 5CHAB 2FXRA 1GI9B 2ZG0H 3A8AA 2TGDA 1BJUA 2AGEX 2P3UB 3RM2H 3SW2B 4ABEA 1AU8A 5DKMA 2Z3DA 2YNAA 2GP9B 2OQ5A 3SHAH 4IBLH 1JIRA 1F92A 1DWEH 3SORA 1TWXB 1LPZB 4HZHA 1Y5BT 2HGTH 4UFDH 1CHOG 1CVWH 3KEEA 1GJ7B 1HUTH 2H2ZA 1XXDA 3PWBA 1GI0A 3GISB 4D8NA 2C4FH 5L30H 4IW4E 5GDSH 2O8MA 2P93A 3ZV9A 1K22H 3BIUH 2BVSH 4ZHAA 2FX6A 1XXFA 1QB1A 1DDJA 2FOGA 5LPRA 1T8NA 3A7WA 3T26A 2ZECA 1DX5M 3K6ZA 1TX6A 3P92A 2C8XB 2CMYA 5F03A 3B23B 3M7UA 2PKSC 2HVXA 1S83A 2AIQA 1RTLA 4ABAA 1HXFH 4XBCA 3Q76A 2QV1A 1TOCB 1UMAH 3U1IB 1NZQH 4KP0A 1UJ1A 1JMOH 2AMQA 1QTFA 4KTCA 1ACBE 1HJ8A 3IWMA 4LOYH 4R0IA 1EB1H 1DWCH 1FQ3A 1RGQA 3AW1A 2C8YB 1YPHE 3TGKE 4VGCB 5EQQA 2WYJA 1DLKB 4INLA 4FUFA 2OTVA 1PPGE 1VCQA 4OS6A 2FOFA 1TNHA 1BTYA 2VB0A 3LDXH 3RMMH 1KY9A 4ISIH 4JZFH 3SV9A 1O2UA 3ZVEA 1BTXA 1V2WT 1SGDE 5EQSA 3RXKA 5J4QA 2CJIA 1O3NA 2F9PA 3ATIA 3LGUA 1EB2A 2HLCA 1CA0C 1MAYA 1PQAA 2VIDA 4B76A 1ETTH 3W94A 1Z8GA 3E8LA 1F0RA 1V2MT 1MTWA 3S7KB 1L4DA 1QL8A 2BMGB 2VIPA 1BBRH 4B71A 3UFAA 1GBBA 1ZGIA 2F3CE 8ESTE 3GY6A 4SGBE 1AHTH 2NU2E 2GCTB 2VWNA 4FUBA 2ZFFH 4CHAB 2OUAA 1GVKB 1NRQH 1WCZA 1OP2A 6CHAB 3S9BA 3OSYA 4CR9A 2ANYA 2C3SA 3PROA 4OGXA 1YC0A 1EXFA 1F0UA 1TBZH 1TQ7B 1GJ9B 1VITH 1EZQA 3ZZBA 3AVZA 3KCGH 5GIBA 3EYDA 2AFQB 2ZIQH 4Y8XA 3PLBA 4BNRA 1SGIB 1BHXF 3BTFE 1YPEH 2ZKSA 3MNCA 1YM0A 1EKBB 3RC6A 1C2HA 2G4UA 3RU4D 3VB4A 1YPLH 1V2UT 1O2WA 1KLIH 3SU3A 4D7FA 2FI3E 1D6RA 2ALPA 2PUQH 2ANMH 1LPKB 3NKKA 2WPHS 4I7YH 1ELEE 2W7UA 1BB0B 1K1JA 3ATWA 1C2DA 3HKIB 3H7OA 1DXPA 3RXPA 2VVVA 1T4UH 3ZZ3A 4I33A 1S81A 4Y8ZA 3RXBA 1KDQB 3FP8E 3VXFH 2VH6A 3BF6H 2FM2A 2GX4A 5LH8A 3UIRA 2OCVB 1OYTH 3SI3H 2SFAA 5JPMH 3UWIA 2A32A 2FMJA 4Z0KA 1A46H 1O3KA 5DGJA 4AB9A 2XWBI 3RXOA 1HAGE 2SNVA 2IN2A 1HAHH 1HBTH 3STJA 1QRZA 2F9NA 1BCUH 1O2KA 1OP8A 1TPOA 3RM0H 2QN5T 3WY8A 1L1GA 1OKXA 1P12E 4TWWA 2I6SA 4IC5A 1IQNA 3PYHA 1G32B 1Y5AT 2BVRH 3EQ0H 4BAQB 3MO9A 2ANWA 4UFEH 3ELAH 4IC6A 2F83A 1HAXB 4FUDA 1VITG 1FPHH 3TLOA 1ZMLA 2BQ7B 2V35A 2VIVA 3F9GA 1CO7E 1Q3XA 2ZDNA 3L3TA 3SBKA 4F49A 1W12U 5F6MA 2AS9A 5C2ZA 3GCTG 1EQ9A 1S82A 3F1SB 1SC8U 5FCRA 5FX5A 1SGNE 3U1JB 1IQEA 2Z9LA 3Q3XA 3PO1B 3TK5A 1QA0A 2CHAC 1OWEA 1O2IA 2BD9A 1B7XB 1LKAA 1C1OA 1G37A 1Y3XA 3R3GB 2GV6A 1LHDH 4A92A 1J9CH 3RXCA 1TFXA 2A4GA 1HLTH 2GDEH 1N1LA 1D6WA 3BTTE 1C2GA 2EEKA 5DK1A 2ILNA 1DLEA 3B9FH 1MTSA 4CHAC 6LPRA 1YPMH 1V2NT 1ZR0A 2TGTA 6CHAC 1Z71A 2H6MA 3BTHE 4Y10E 2HPQH 1THPB 2UWPA 4YT6H 4BAOB 3RXIA 5DP8A 3LC5A 1GI2A 3SNDA 4NA8A 2O8WA 4UFFH 4INHA 1ZSKA 1LVYA 1TRYA 4QT8C 1PPEE 1ZYOA 1HGTH 2PGBB 2BDYA 1AIXH 2TGPZ 1L2EA 6ESTA 1W11U 3ZVFA 2AYWA 1W14U 4WH6A 2ODQA 1WSSH 3U69H 2B9LA 1OP0A 4ZKSU 1GCTB 1YLDA 3MOCA 4H42U 3GDUA 4SGAE 4GPGA 2O8TA 5BRRE 2P94A 4WXIA 1CGIE 1EJAA 1ESBA 1UK3A 1HRTH 1QRXA 3LOXA 2BD7A 1AE8H 1LHEH 4MNWA 2A2QH 4FUHA 5E0JA 2FEQH 3URCA 1CA8B 4MNYA 1H9HE 4A1TA 2PKAB 4GUXA 4YOGA 4Z6AH 1Y3VA 5DO4H 2VIWA 1VR1H 3LH3A 1AFQC 1H9IE 1MU8B 1ZTLA 2Z7FE 4FVDA 1P2IA 1WUNH 1F0SA 4OS1A 2AERH 1GL0E 3A87A 1AWFH 4K5ZA 1VJ9U 2A7HA 4MG3A 2A7JA 1SR5C 4I8LA 1WYKA 1BMAA 1BHXB 3V3MA 4DVAU 4X8TH 3TK6A 3K9XB 1MBQA 3NK8A 2OXSA 4X1SU 1C5RA 1FLEE 1QJ7B 2GDDA 2NU0E 2CGAA 1SOTA 4CRAA 1EPTA 1O3EA 1QIXB 1RRKA 2BX4A 1UVUH 3MH6A 1LVMA 1XM1A 3PO1C 4K1TA 2A4RA 1KTTB 3GDVA 3UWJH 1ANCA 1SFIA 1WBGB 2THFB 1V2VT 4CRCA 7LPRA 2ZQ1A 1FUJA 1FIZA 2P8OB 2B7DH 2XCNA 1FNIA 1GJDB 1ELAA 1O2ZA 3LGVA 1UTOA 4D76A 2GTBA 3BV9B 3P8NA 1VZQH 1SLUB 4JMYA 4CH2B 1PPFE 2ZP0H 4B75A 1QNJA 1TIOA 5EOKA 3E91A 5E0HA 1A5IA 5EXNA 1O2HA 1E36B 4ZXXH 1P8VC 1FXYA 1P04A 3F9HA 1XUKA 1QQUA 3LU9B 4UONA 1O3MA 4BTUB 1C5PA 3SU6A 1C4V2 3CENA 1P03A 3ZZ4A 2QXIA 4PROA 3ZVGA 2J4IA 1GBCA 3HGNA 4XBDA 2HNTF 4Y71A 2ZC9H 5C67A 1FDPA 3E6PH 4MPUA 1T8LA 3NXPA 2Q6FA 1U6QA 3RXJA 1GDQA 1TGTA 4A7IB 3KQEA 2BYAX 1FY4A 5TCAA 1C5XB 1K2I1 2R0LA 2W3KA 2R3UA 4X6OA 1TMUH 4DCDA 1QR3E 2GKVE 1K1OA 2PWXA 2VWLA 3SJOA 5EXMA 1BT7A 1ZZZA 4K8YA 2QXHA 4ASHA 4AFSA 4ZH8A 4E06H 1GCTC 4TYDA 1DUAA 2WYGA 1VCPA 1YKTA 4X1RU 3SU1A 1BBRK 4E7RG 3ATKA 1BTUA 3V7TA 4ABIA 3DHKH 3SUEA 1T4VH 3EA9A 1OWKA 3SO3A 6GCHF 2BXTH 1Z8IB 1IQHA 3QZRA 1P9UA 2C90B 2C93B 5DP7A 3SV6A 3TPIZ 1C1TA 3ZVCA 2BDGA 1O5AB 4DG4A 4ISHH 2PTNA 1DUEA 1BDAA 1TGNA 2B5TB 2JH6D 3G01A 5F8ZA 2ZPSA 7GCHF 1V2JT 1GI1A 2RA3A 4X8UH 1AKSA 3SI4H 3FZDA 1DSUA 3UR6A 1K1PA 1FJSA 2ODPA 3DT0H 1Y3WA 1XKBC 1ELCA 3SV7A 1EZUC 1KXEA 2BDBA 4Y8YA 4WVPE 2Y5HA 5ABWA 3A8DA 5ETXA 1X7AC 3P70B 1BBRE 2J34A 2VGCB 1SGTA 3EGKH 2ZHFH 2AMDA 5DG6A 1ID5H 2EI8A 4HFPB 1QFKH 3FANA 2O8UA 2W5EA 1O5DH 1C1PA 2FYQA 1A2CH 1ANBA 1LCYA 3SOSA 3LGYA 1O36A 2SGAA 1C1QA 1BQYA 1ELDE 4AFQA 3T2NA 3RMLH 5A8XA 1ZPZA 2P8OC 2XBXA 2FP7B 2XBVA 2GZ8A 2ZFTA 3NCLA 2TBSA 4FU8A 1EOJA 4JK6A 4CRFA 2R3YA 3MO6A 5A09A 5HM2A 1NESE 5F8XA 3M7TA 1J8AA 4Y76A 2XWAA 3D62A 1C5WB 1Y3YA 1PPBH 5A0AE 5L2YH 2AIPA 5GXPA 1SGYE 4CR5A 2BDHA 1L0ZA 2F91A 3FZZA 1AE5A 5FPSA 3PV4A 1GJBB 4AZ2B 2FIRH 2R2WU 1FZZA 1QL9A 1O2NA 5AF9H 3PM3A 4GCHG 4X1QU 1DANH 1LQEA 3MU1A 1WAYB 2ZO3H 1K1NA 1GI7B 4ZUHA 4YOIA 4ZMAH 7ESTE 2A7CA 1LHCH 1O39A 2FOAA 1G9IE 2JKHA 4ZKRU 3GDSA 3RXFA 4NA7A 3ZVBA 1MMJN 4KTSA 3V13A 3E3TA 1SSXA 1O2MA 4AG1A 4BAMB 1DSTA 4JZEH 1IQMA 1CQQA 2ZCHP 3SUFA 4MNVA 1KLJH 4X8SH 2UUJB 4O3TA 2ZU2A 1QGFA 1GHYH 1CT4E 2BD2A 3URDA 1O3IA 1CT2E 2H1UA 1BMMH 1GHBF 1S5SA 2FI5E 4I8HA 4O3UA 1AB9B 1K1LA 3PB1E 2OC0A 2GMTB 3BEFB 1C5YB 5A8YA 1UCYK 3RXAA 2BHGA 5CMXH 2P16A 2H5DA 1SGFA 1HJ9A 3A8BA 4CRGA 4GSOA 4IMQA 1MQ5A 1J17T 3QGJA 1E38B 1P57B 5EU8A 5JBCS 1C5MD 1JIMA 1GBLA 5T6GA 1DWBH 3VB5A 2K1QA 1C4Y2 3TJNA 4NIXA 3RXLA 2A45B 1XVOA 5C1YA 1HCGA 1ZHRA 4H6SB 4R8TB 2BXUH 1V2ST 3QDZB 2IJOB 5FHTA 4X2XA 2WV4A 5BPEA 4I32A 4NIVA 3STIA 5G4BA 1MKWK 1TRMA 2ZCKP 3JZ1B 3AAUA 3E0PB 2F9BH 1ZMNA 2WPKS 2G00A 1O2PA 1DT2A 1LHGH 4H4FA 2SNWA 2QYIA 2A31A 2BQ6B 2PW8H 2WPIS 5JBTA 1V2KT 2VGCC 3P8FA 4NZLA 2BDCA 2FS9A 1GMCG 1EAWA 3GCOA 1XUFA 1TMBH 2ZHEH 3RXGA 4WXVA 4BXSA 2GCHF 1C1MA 1D3QB 1WQVH 2XXLA 3H7TA 4IS5A 1S6FA 3KHVA 4OS5A 2AH4X 1UO6A 3A8CA 4UD9H 4D9RA 3TIUA 3UR9A 1SLWB 4UE7H 3FVFB 5AFZH 1ELGA 1EJMA 1V2TT 3LGTA 1NTPA 1C2MA 2CHAB 2CF9H 1GI8B 3U8TH 4FUJA 1C2KA 4MVNA 1WQSA 1GBEA 1O3JA 1O33A 2OINA 5T6DA 3SUDA 3T62A 4GAWA 3RXVA 2BVXH 2ZGXH 3GCHC 1HPGA 1FY1A 2OC8A 1D3TB 3KQDA 1GI5A 1Z8JB 1TQ0B 1HJAB 3ESTA 8GCHF 4YT7H 2BLOA 1O3FA 1HB0B 1PQ8A 1O0DH 2ZTXA 1AWHB 1S0QA 3QN7A 3P95A 3M7QA 1CU1A 1O2YA 2G52A 3RXMA 4O97A 5AHGH 1BTPA 4B2CA 1J15A 1S6HA 2ZFQH 1V6DA 1ZRKA 1FN6A 1GMDF 5B6OA 1ZOMA 1QBOA 1C5UA 4O03A 4DIHH 2STAE 1SLXB 1O2JA 3QK1A 3DA9B 4JZIA 2Y7XA 4XDEA 1NC6A 1UTMA 2FX4A 1G2LA 4UDWH 1AZZA 1AI8H 5PTPA 4TWYA 2XC5A 1EOLA 1TBRH 1W7GH 2VWMA 4NSYA 1HYLA 3FAOA 3P6ZB 4JYTA 3K65B 2GVFA 3RC4A 2NU3E 2GD4B 2HWLB 2Y5FA 3D65E 1AB9C 5FPYA 4Y7AA 4AN7A 2R9PA 3GY2A 2GMTC 3V12A 3SU0A 3RC5A 4BAHB 1IHSH 1AN1E 2ZDMA 1UTJA 1JOUB 1CGHA 4XE4A 1O2RA 1TOMH 1J16A 3T25A 2SGQE 1MTVA 2GT7A 1FY3A 4WMEA 1HIAB 1GG6B 2QXGA 4J2YB 2KAIA 3M3SA 3UOUA 2GT8A 3O8RA 2QIQA 1AFQB 1OWJA 3SV8A 2VU8E 3OY5U 1QURH 2BLQA 1TX7A 3C27B 1ETRH 2P3FH 2W7SA 2HNTC 4LZ4B 1GHAF 1G30B 2ZGCA 1LVOA 1QL7A 4U32A 3FP6E 2UUYA 4GHQA 1GDUA 9ESTA 1JRSA 2RCEA 1TGBA 2BB4A 2XW9A 2Y82A 4ABDA 3KF2A 1OXGA 1GI4A 1O2XA 1KXBA 1EJNA 3M5OA 1FN8A 1XUGA 1YPKH 1O2LA 2OBOA 1PYTC 2DUCA 4KELA 2VVCA 3QO6A 4OS4A 1RTFB 3QZQA 4CBNA 3RMNH 1SG8B 1C2FA 1OX1A 1TNKA 1P2OA 1SGRE 2TGAA 5DP9A 4Y11E 1TGCA 2ZHDA 3LGIA 1GBIA 1C5TA 5JDUB 2BD8A 1O38A 3T29A 2UWLA 3LONA 4GHTA 1UCYH 2OQUA 1DVAH 1HJAC 4U2WA 1PYTD 1LKBA 3L6PA 3BG4C 4XOJA 5EPYA 4ABJA 2CV3A 3K2UA 2Q6GA 1O3PB 2TRMA 1CGJE 3C1KA 2OLGA 1N6XA 3HPTB 1EAUA 1QB9A 1G2MA 3UTUH 3U98H 5SGAE 4BTIB 2BY6X 1GMHF 2UUFB 4MPXA 2Z9IA 1AKSB 2AGIX 1P01A 1K1MA 4ZAEA 4YLQH 5FPTA 3SU5A 3UQOA 2DE8A 1MKWH 2F9UA 2ZPQA 1H9LB 3NZIA 2FTLE 4ISLA 1MD8A 2FLRH 3QUMP 1C9PA 2ZU4A 2BY5X 4BXWA 5T6FA 1FI8A 2FI4E 1GCDA 4TY6A 2RDLA 3JZ2B 1NRSH 4WWYA 1BA8B 3VFEA 3HGPA 4ISOA 4FUCA 3NWUA 3VEQB 1EPTC 3AW0A 4HTCH 1ZMJA 4OS7A 5E2PA 1GHZA 1YBWA 2VJ1A 3RDZA 3NUMA 2BZAA 2FOCA 1EP6A 1EATA 1BRCE 4FUIA 1NS3A 1INCA 1AMHA 3BSQA 1C2IA 2H9HA 3BEUA 4I8GA 2A1DB 3MFJA 2Z6BD 1IHTH 1D9IA 1O5CB 2BOKA 3ZZ8A 1P2MA 2PHBA 3DD2H 1SQAA 3A82A 1WOFA 3F9FA 1GBTA 1V3XA 2XBYA 1KTSB 1O2OA 2C8WB 1GG6C 1KXAA 1MKXK 4OS2A 5DPAA 5FXLA 3PLKA 1ZPCA 2Z9GA 1T31A 4I31A 1F5LA 4NFEA 4I8KA 3HK3B 5CE1A 7KMEH 2FOEA 3OX7U 1DY8A 2RA0A 5EPNA 2ALVA 2Z3EA 3ODFA 1UHBA 2FESH 1C9TA 3CP7A 1Y3UA 3F68H 1LDTT 1MCVA 4KGAA 5I46H 1H1BA 4YOJA 5EQRA 1NU7B 1Y59T 3GCNA 1C2LA 1Z7KA 3DUXH 4NGAH 2D26C 1E37B 2ASUB 4WJG2 1CHOF 2FOMB 1SQTA 2AEIH 1GBKA 1C5NH 4K60A 2Z3CA 3ZZ7A 3BTDE 3T27A 2FOBA 1MTNC 1C2JA 1UTKA 4X1NU 4E05H 1ARCA 3SV2H 4U01A 5JB8S 4MLFB 2ZZUH 1A0HB 4TPIZ 1O3OA 3LT3A 1TPAE 4AG2A 4ABFA 2HNTE 1IQFA 4AORA 3SGBE 2FLBH 3HATH 1GBHA 3SU2A 2WPMS 4U30A 3A7XA 3SGQE 4THNH 1DICA 1GBDA 1ETSH 2ZFRH 1Y5UT 1QBNA 1AFEH 1ANEA 3RXQA 5EG4A 1Q2WA 1TBQH 4Y6DA 1K28D 5JBAS 4NIWA 2R2MB 3MU8A 3NPSA 4I8JA 2VVUA 3V0XA 5A0CA 1TNJA 3GY3A 2GZ7A 5C5NA 1QQ4A 1KLTA 3MU5A 4JK5A 2FPZA 5AFYH 3SGAE 5C5OA 3ZZ5A 4LXBH 5LGOA 1SBWA 3H5CB 1TNLA 2VWOA 1GBJA 4A5TS 2XYAA 2ZQ2A 3MH4A 4ZXYH 3BTME 2STBE 1H8DH 4INKA 1DY9A 4BANB 1O2VA 1O2TA 1BOQA 5DP3A 5GCHF 1B0FA 1AD8H 1GJ6A 3FFGA 3ZZ6A 1ZSLA 1W13U 3HKJB 2ZU3A 1QHRB 1QB6A 1W2KH 1OWHA 5HXFA 1GI3A 1EX3A 1XVMA 2ULLA 3GOVB 3VGCB 1SB1H 1NRNH 2A0QB 5ESBA 1O31A 1HDTH 2VIOA 1GL1A 1RXPA 5IDKA 5JYIA 1P0SH 3GICB 4JYUH 3OYPA 1TE0A 3RXTA 4K1SA 2ZTYA 1N6YA 1MCTA 1ZJDA 1ORFA 1A4WH 1QA7A 4TPYA 3TU7H 3UUZA 1RIWC 1LQDB 4NG9H 4WMDA 2QF0A 2ZHQH 5AVDA 5FX6A 2WUBA 3D23A 1BTHH 1THRH 1O35A 1FY8E 1SI5H 2BY9X 2J9NA 1L1JA 1F7ZA 3A7VA 2ODYB 1XMNB 1C1UH 1IQJA 1BJVA 2WPJS 3ITIA 2ZF0H 3SNCA 5E8EH 1A0JA 3BIVH 4B2AA 2CF8H 3OU0A 1RFNA 1O3HA 2VIQA 3D49H 2XC0A 3RXHA 2GGVB 2A5AA 3UNRA 1KXDA 4X6PA 2WUCA 4FVBA 2QF3A 1ESAA 2NWNA 1VJAU 4FUGA 2UUKB 5HM9A 1C5QA 4WY3A 4BOHA 3A88A 3GY8A 3GCHB 3IITA 3SHCH 5HGGA 1CSOE 4JZ1A 1WTHD 1A3EH 3ATMA 3GY7A 2BLWA 2YNBA 4Q2KA 5LPFA 3VB7A 2WPLS 3TK9A 2HOBA 4IN1A 1H8IH 2ZGHA 4AGJA 2G5VA 2ZU5A 3I29A 4MTBA 3S7HB 4X2WA 2AGGX 1UVTH 1O2GH 3LGWA 5K7RA 1MKXH 2VNTA 1UTNA 3MI4A 1TGSZ 1EAIA 2BY8X 5T3HA 3T5FH 1TALA 4WH8A 2ZDKA 1BRUP 1P10A 3SZNA 2JETC 5GPIB 1VITF 4DIIH
chains in the Genus database with same CATH superfamily
2EA3A 4DURA 1NBME 4NFFA 5K0HA 3LH1A 2BM2A 4JYVH 3A80A 4A1VA 1T32A 2PTCE 3A83A 4MPVA 1GI6A 2TIOA 3GCTF 3MTYA 2M5TA 1HAIH 4FU7A 4A6LA 2QXJA 1ZRBA 1TLDA 2XCFA 1DS2E 1KIGH 3RUOA 1GBFA 2V6NA 2DE9A 1IQIA 3CS0A 4K1EA 4XRNA 3PTNA 3EA8A 3VGCC 1W10U 1NN6A 3GYMA 3QLPH 1GJAB 3I78A 4RKOB 3MNXA 5LPEA 1AVGH 1AY6H 3KNXA 1DXWA 4KTUA 1GWAA 2P95A 1NM6A 1NT1A 3TJVA 5GJ4B 3MO3A 1C1RA 1LMWB 3AASA 3U8RH 4E7NA 1K1IA 1C5OH 1TONA 2K8IA 4CREA 5EW1H 1DM4B 1O5EH 1MBMA 3A89A 3A86A 1UCYE 2I6QA 1G3EA 1A0LA 1SL3A 2D2DA 2EI6A 4YZUA 3SNAA 3EA7A 5F8TA 3O8DA 1SOZA 2Z9KA 1BZXE 3KQCA 4Q4LA 2WSSD 3ODDA 3UOPA 1IQGA 2G5NA 1O32A 2ZCLP 1BTZA 1OWIA 3MHWU 2J98B 1HAVA 3RXSA 2Y6TA 3RP2A 1CBWC 2A4QA 5C20A 1ZTJA 3RXEA 1NO9H 1P2KA 1VCWA 3N7OA 2GJGA 1GGDB 1GJ8B 1QJ6B 1ZGVA 5GCHG 2P3TB 4B6EA 5C3NA 2ZTZA 3EDXB 2QA9E 5FCKA 3OY6U 1ABJH 3KN2A 4GLYA 1G3BA 1SGQE 3MU4A 5DP6A 4UEHH 1ELVA 1ZPBA 3BG4B 1PPZA 5HKKD 4FUEA 1LVBA 1UTPA 3SUGA 5HYOA 4JCNA 4Q7YA 2BDAA 2BOHB 3I77A 1ZSJA 2XBWA 4Y0YE 5E0GA 5EJ1A 2FTMA 3M3TA 8KME2 1A5GH 3B8JA 6GCHG 5JB9S 5C1UA 1O5FH 4CH8B 1JWTA 3LIWA 2PLXA 2PV9B 3O8CA 4XFQA 2QC2A 2PSYA 1V2QT 1WU1A 1XUHA 1UHBB 4J1YA 3ZV8A 1SGCA 2PP6A 7GCHG 4FU9A 1A5HA 3A85A 4RKJB 1BRAA 2ZFPH 3SJ8A 4MQAA 2J92A 3HK6B 2PGQB 2YOLA 1NFYA 2SGEE 2R0KA 5CHAC 1TABE 5E2OA 1XUJA 1Z1IA 2KCOA 2Y5GA 1FAXA 1PJPA 3PLPA 3ZVAA 1SKYE 1SPJA 2W3IA 1NROH 4MDSA 2WV9A 1BTWA 1EPTB 3TNTA 2ZHWH 1AUTC 2BD3A 1DWDH 5FBEA 4P02A 2CXVA 2ZDVH 3K6YA 3SJKA 1YP9A 3EE7A 1F5KU 3SYJA 3TGIE 1G3DA 1YPGH 3UREA 1MH0A 1P02A 1W0YH 1BMLA 3RXRA 2JJ1D 1AUJA 1COWD 3QGNB 4K8BA 3GY5A 2ZDAH 3OTJE 2A2XH 3TH3H 4OGYA 3M61U 4X2VA 4ZHLU 4K2YA 4M9FA 1OWDA 9LPRA 4ABBA 2BTCE 2SGPE 3RLYH 1L1NA 4AFZA 5KEDA 1CE5A 3VPKA 1YCPH 4KKDA 2QCYA 1YGCH 2AMPA 1K21H 5ESTE 3MH7A 3M5MA 4X1PU 3PMAB 1BMNH 3ZYDA 5EW2H 5DP5A 3A7ZA 3VXEH 1RJXB 2FDAA 2J95A 1FPCH 2EI7A 1TNIA 1W8BH 2ZWLH 3TJUA 2ESTE 1KXCA 3TJOA 2BD4A 4M7GA 4ESTE 1E0FD 1S85A 1E34B 1THSH 1TRNA 3M3VA 4D9QA 2WZQA 1FIWA 2A4OA 1NRRH 1RTKA 1S84A 1F5RA 1SGEE 1OS8A 1G36A 4WF8A 3GS9A 1PQ5A 1MTNB 1HAPH 5A8ZA 5FBIA 2Q6DA 8LPRA 5C1XA 1GJ5H 4YTAA 1VGCB 2SGDE 4K3JA 1XX9A 2XNIA 4X8VH 3SN8A 1UVSH 1P3CA 4VGCC 3M5LA 2Z94A 3L33A 3S69A 4Y79A 4HGCA 3LJJA 5C17A 1NFWA 1GGDC 4FXGH 1OPHB 4AFUA 2ZGJA 1O5BB 1MTUA 3EAJA 1SGPE 3BN9A 1DPOA 4ZROA 5T1VA 2QY0B 4LK4A 4NWKA 2G51A 1P9SA 1FY5A 5DJ7A 1ELBA 1GHBG 1D3PB 1QY6A 1T8MA 2QGRA 2QE7D 3SU4A 3E1XB 2Q1JA 3DCLA 4XD7D 3ZVDA 3ATLA 4RT1A 1NU9A 1ABIH 1H4WA 2OBQA 3SJ9A 2BD5A 4Y7BA 1MD7A 2FO9A 5DP4A 2Z9JA 1ESTA 1TB6H 1GHXH 3SQHE 2HRVA 3LKWA 1AQ7A 1V2OT 1SMFE 4F55A 1ZHPA 3PMBB 2ANKH 3TH4H 1LTOA 2J94A 1OOKB 1P06A 3PMHB 3KL6A 4F4OC 2H9EH 1HAYB 1UK2A 1QBVH 2FWWA 5J4SA 4K69A 2GCTC 3T28A 3U8OH 4ABHA 2P59A 4JZDH 4ZKNU 2JH0D 2ZA5A 3Q77A 1FONA 1CHGA 4DW2U 2V3OH 3ZZAA 3MNSA 1AO5A 3SZEA 3SJIA 1GHVH 1MABB 1UVPA 3A84A 1TAWA 1C1NA 4YM9A 2G8TA 1OYQA 1W3CA 1C4U2 3AAVA 3TH2H 2LNCA 3TNSA 1TPSA 1B0EA 2QAAA 2GCHG 4IMZA 1Z6JH 1C5LH 3O8BA 4YLUA 1FAKH 4CRBA 1IOEA 3EE0B 1GBAA 1E35B 3BTGE 1AVXA 3R0FA 2Y81A 4HI3A 3WWBA 2G81E 1T7CA 2HPPH 4B73A 3DFJA 1V2RT 1A7SA 1IQKA 3E0NB 1SQOA 2ZDLA 4X6MA 1C5SA 1P3EA 4TY7A 3S9CA 4NSVA 1C1VH 1PFXC 3VB6A 1EASA 1F2SE 4IGDA 3PWCA 3FP7E 3M36A 3Q3KA 1C5ZB 3RU4E 3W95A 4DJZB 3SQEE 2B0FA 1C1WH 2FYRA 2ZNKH 1W7XH 1GJ4H 3BG8A 3BTKE 3UPEA 1RIWB 4GCHF 1G3CA 1HAZB 4Q7ZA 1O3DA 1YLCA 4DT4A 3KGPA 3GY4A 8GCHG 1SHHB 4NIYA 2ZGBH 1QRWA 2OD3B 3DFLA 2A5KA 3UNSA 1BUIA 3A81A 1EZXC 4ZKOU 2ZEBA 1NY22 1A3BH 1O34A 3M35A 1UTQA 2VH0A 2V3HH 3MNBA 1ANDA 3QTOH 1E79D 4DGJA 5A0BA 1P2NA 3MWIU 1AVWA 4BTTB 1GVZA 1LPGB 1TYNA 1GMDG 1RD3B 1YPJH 3SNBA 4IN2A 4FOUC 4NA9H 4RN6A 1O30A 1VGCC 2PSXA 1HNEE 4B74A 2GZ9A 2OP9A 3MH5A 1HV7A 2FODA 1OHHD 2IPHA 4TT3D 3UNQA 1E1RD 1O37A 1O2QA 2CN0H 2AHME 1P11E 1EUFA 2OC7A 4X6NA 1F0TA 1QJ1B 1L4ZA 1GBMA 2WINI 3Q3YA 1ZHMA 3P8OA 1FMGA 3PMJA 2IOTA 2O8LA 1A61H 1KDQA 1P2QA 1QCPA 2PR3A 2LPRA 4AOQA 1HXEH 2NU1E 1MQ6A 2BLVA 1ELTA 1N8OB 2ZFSA 1TX8A 4LZ1H 2O9QA 2ZU1A 3U9AH 1O3BA 3P17H 3SNEA 5JBBS 1HIAA 1SGFG 2H9TH 2RG3A 2J2UA 2WV5A 3UY9A 4CBOA 1NRPH 1UTLM 3PTBA 1O5GH 1GMCF 2FOHA 2XC4A 5EXLA 5HMAA 1MZAA 4NWLA 3UQVA 4AB8A 2JETB 2NU4E 1IQLA 1O3CA 2A5IA 2XTTB 5EGMA 1B5GH 3BTEE 4AX9H 4CRDA 1Z6EA 1GHWH 3M5NA 1ZTKA 2Y7ZA 4FETA 5TJXA 1O2SA 2TPIZ 1EZSC 3QX5H 4ISNA 3ZZCA 3TGJE 4BAKB 3A7YA 1T8OA 3MYWA 4ASUD 1GHAG 1XUIA 3ZZDA 3TITA 5GWZA 2KCPA 2HALA 1ZJKA 2CK3D 4GVUA 3KIDU 4YO9A 3A7TA 1ARBA 1K9OE 3MMGA 3TVJB 4O9VA 1HAVB 5IYTA 2C8ZB 2BX3A 1D3DB 3S0NA 1DFPA 1P05A 3LPRA 1SVPA 2UWOA 5FAHA 1ZLRA 4YESB 1O3GA 1MAXA 1AGJA 2FS8A 3E16B 5L2ZH 1NFXA 2F9OA 1SLVB 2D1JA 2GV7A 2D8WA 2FZZA 3VB3A 4X2YA 3E90B 1V2PT 1Z1JA 1BITA 2ZPRA 2B8OH 4H6TA 4XBBA 1KSNA 1DE7H 3MU0A 3ZZ9A 1IAUA 4DY7B 1TA2A 1YPHC 4D7GA 4NCYA 1FV9A 3GYLB 5EODA 2ZI2H 3U28C 2BZ6H 1WV7H 2V0BA 1PPCE 1A1RA 4Q7XA 1EAXA 4AGKA 1KYNA 2JH5D 2H5CA 1GVLA 4A1XA 4DOQA 4X0WU 1SHYA 2PKSB 3F0OA 1RS0A 4B2BA 4Q63A 1TMTH 3F9EA 4Y0ZE 1YCPM 1Y8TA 1GPZA 3ZYEA 1TA6A 3CS7A 3UB0A 1GMHG 2G4TA 3Q00A 1S0RA 1Z8RA 1PQ7A 2XRCA 3BEIB 4ABGA 3KYGA 1UVOA 4ZHMU 1KXFA 1LO6A 3QTVH 3P8GA 2OC1A 3RXDA 1P2JA 1CBWB 1MU6B 1O3AA 2SGFE 1AZ8A 1ELFA 4MNXA 3BTWE 3BTQE 1P09A 2W26A 3F6UH 1Q31A 1WTGH 4DT7B 4UFGH 4Z1MD 2OK5A 1C5VA 3ENSB 1YCPK 2PFEA 1GDNA 3OTPA 1DOJA 2Y80A 1SFQB 1MUEB 1W0ZU 1TNGA 3LJOA 2JJ2D 1J14A 1YF4A 2BQWB 2PUXB 1C1SA 1BIOA 4XSKU 3RMOH 1M9UA 4AYVB 5HIYA 1DITH 1D4PB 1PPHE 4B1TA 5L6NH 4Q80A 1UK4A 1CA0B 1N8OC 1NPMA 5H4IB 4MPWA 3RXUA 2J38A 2KAIB 3WWFA 3LC3A 1NFUA 1JBUH 2BDIA 1C2EA 1JXPA 3QWCH 1CT0E 4P00A 3S9AA 5C94A 1EP5A 2EC9H 2G55A 1LHFH 2PKAA 2BY7X 2VINA 5B6LA 3IG6B 1V2LT 4RSPA 5TCCA 1O3LA 3RLWH 2W6JD 2L74A 2F9VA 3RU4T 4AYYB 4I86A 4WMFA 5A2MH 3M37A 1YYY1 1MZDA 1TPPA 3KQBA 1SQRA 1XKAC 1GJCB 1HFDA 5I25A 1JRTA 5KGOA 2WPDD 4NZQA 1BRBE 1HAOH 1OSSA 5CHAB 5CHBA 2FXRA 1GI9B 2ZG0H 3A8AA 2TGDA 1BJUA 2AGEX 2P3UB 3RM2H 3SW2B 4ABEA 1AU8A 4ACAA 5DKMA 2Z3DA 2YNAA 2GP9B 2OQ5A 3SHAH 4IBLH 1JIRA 1F92A 1DWEH 1EFRD 3SORA 1TWXB 1LPZB 4HZHA 1Y5BT 2HGTH 4UFDH 1CHOG 1CVWH 3KEEA 3MQKC 1GJ7B 1HUTH 2H2ZA 1XXDA 3PWBA 1GI0A 3GISB 3PRBA 4D8NA 2C4FH 5L30H 4IW4E 5GDSH 2O8MA 2P93A 3ZV9A 1K22H 3BIUH 2BVSH 4ZHAA 2FX6A 1XXFA 1QB1A 1DDJA 2FOGA 5LPRA 1T8NA 3A7WA 3T26A 2ZECA 1DX5M 3K6ZA 1TX6A 3P92A 2C8XB 2CMYA 5F03A 3B23B 2QF5A 3M7UA 2PKSC 3DSGA 2HVXA 2EY4C 1S83A 2AIQA 1RTLA 4ABAA 1HXFH 4XBCA 3Q76A 2QV1A 1TOCB 1UMAH 3U1IB 1NZQH 4KP0A 1UJ1A 1JMOH 2AMQA 1QTFA 4KTCA 1ACBE 1HJ8A 3IWMA 4LOYH 4R0IA 1EB1H 1DWCH 1FQ3A 1RGQA 3AW1A 2C8YB 1YPHE 3TGKE 4VGCB 5EQQA 2WYJA 1DLKB 4INLA 4FUFA 1PPGE 2OTVA 1VCQA 4OS6A 2FOFA 1TNHA 1BTYA 3N7DA 2VB0A 3LDXH 3RMMH 1KY9A 4ISIH 4JZFH 3W1EA 3SV9A 1O2UA 3ZVEA 1BTXA 1V2WT 1SGDE 5EQSA 3RXKA 5J4QA 2CJIA 1O3NA 2F9PA 3ATIA 3LGUA 1H8HD 1EB2A 2HLCA 1CA0C 1MAYA 1PQAA 2VIDA 4B76A 1ETTH 3W94A 3F2HA 1Z8GA 3E8LA 1F0RA 1V2MT 1MTWA 3S7KB 1L4DA 1QL8A 2BMGB 3KQ5A 2VIPA 1BBRH 4B71A 3UFAA 3F2GA 1GBBA 1ZGIA 3NRLA 2F3CE 8ESTE 3GY6A 3KYFA 4SGBE 1AHTH 2NU2E 2GCTB 2VWNA 4FUBA 2ZFFH 4CHAB 2OUAA 1GVKB 1NRQH 1WCZA 1OP2A 6CHAB 3S9BA 3OSYA 4CR9A 2ANYA 2C3SA 3PROA 4OGXA 1YC0A 1EXFA 1F0UA 1TBZH 1TQ7B 1GJ9B 1VITH 1EZQA 3ZZBA 1W0JD 3AVZA 3KCGH 5GIBA 3EYDA 2AFQB 2ZIQH 4Y8XA 3PLBA 4BNRA 1SGIB 1BHXF 3BTFE 1YPEH 2ZKSA 3MNCA 1YM0A 1EKBB 3RC6A 1C2HA 2G4UA 3RU4D 3VB4A 1YPLH 2F43B 2K0QA 1V2UT 1O2WA 1KLIH 3SU3A 4D7FA 2FI3E 1D6RA 2ALPA 2PUQH 2ANMH 1LPKB 3NKKA 2WPHS 4I7YH 1ELEE 2W7UA 1BB0B 1K1JA 3ATWA 1C2DA 2KM0A 3HKIB 3H7OA 1DXPA 3RXPA 2VVVA 1T4UH 3ZZ3A 4I33A 1S81A 4Y8ZA 3RXBA 1KDQB 3FP8E 3VXFH 2VH6A 3BF6H 2FM2A 2GX4A 5LH8A 3UIRA 2OCVB 1OYTH 3OFND 3SI3H 2SFAA 5JPMH 3UWIA 2A32A 2FMJA 4Z0KA 2KCAA 1A46H 1O3KA 3OEED 5DGJA 4AB9A 2XWBI 3RXOA 1HAGE 2SNVA 2XNDD 2IN2A 1HAHH 1HBTH 3STJA 1QRZA 2F9NA 1BCUH 1O2KA 1OP8A 1TPOA 3RM0H 2QN5T 3WY8A 1L1GA 1OKXA 1P12E 4TWWA 2I6SA 4IC5A 1IQNA 3PYHA 1G32B 1Y5AT 2KX4A 2BVRH 3EQ0H 4BAQB 3MO9A 2ANWA 4UFEH 3ELAH 4IC6A 2F83A 1HAXB 4FUDA 1VITG 1FPHH 3TLOA 1ZMLA 2BQ7B 2V35A 2VIVA 3F9GA 1CO7E 1Q3XA 2ZDNA 3L3TA 3SBKA 4F49A 1W12U 5F6MA 2AS9A 5C2ZA 3GCTG 1EQ9A 1S82A 3F1SB 1SC8U 5FCRA 5FX5A 1SGNE 3U1JB 1IQEA 2Z9LA 3Q3XA 3PO1B 3TK5A 1QA0A 2CHAC 1OWEA 1O2IA 2BD9A 1B7XB 1LKAA 1C1OA 1G37A 1Y3XA 3R3GB 2GV6A 1LHDH 4A92A 1J9CH 3RXCA 1TFXA 2A4GA 3AK5A 1HLTH 2GDEH 1N1LA 1D6WA 3BTTE 1C2GA 2EEKA 5DK1A 2ILNA 1DLEA 3B9FH 1MTSA 4CHAC 6LPRA 1YPMH 1V2NT 1ZR0A 2TGTA 6CHAC 1Z71A 2H6MA 3BTHE 4Y10E 2HPQH 1THPB 2UWPA 4YT6H 4BAOB 3RXIA 5DP8A 3LC5A 1GI2A 3SNDA 4NA8A 2O8WA 4UFFH 4INHA 1ZSKA 1LVYA 1TRYA 4QT8C 1PPEE 2XOKD 2YMSC 1ZYOA 1HGTH 2IJD1 1KMHB 2PGBB 2BDYA 3N99A 1AIXH 2TGPZ 2J98A 1L2EA 5F53A 6ESTA 1W11U 3ZVFA 2AYWA 1W14U 4WH6A 2ODQA 1WSSH 3U69H 3ZIAD 2B9LA 1OP0A 4ZKSU 1GCTB 1YLDA 2YMSD 3MOCA 4H42U 3GDUA 4SGAE 4GPGA 2O8TA 5BRRE 2EQNA 2P94A 4WXIA 1CGIE 1EJAA 1ESBA 1UK3A 1HRTH 1QRXA 3LOXA 2BD7A 1AE8H 1LHEH 4MNWA 2A2QH 4FUHA 5E0JA 2FEQH 3URCA 1CA8B 4MNYA 1YLNA 1H9HE 4A1TA 2PKAB 4GUXA 4YOGA 4Z6AH 1Y3VA 5DO4H 2VIWA 1VR1H 3LH3A 1AFQC 1H9IE 1MU8B 1ZTLA 2Z7FE 4FVDA 1P2IA 1WUNH 1F0SA 4OS1A 2AERH 1GL0E 3A87A 1AWFH 4K5ZA 1VJ9U 2A7HA 4MG3A 2A7JA 1SR5C 4I8LA 1WYKA 1BMAA 1BHXB 3V3MA 4DVAU 4X8TH 3TK6A 3K9XB 1WDIA 1MBQA 3NK8A 2OXSA 4X1SU 1C5RA 1FLEE 1QJ7B 2GDDA 2V7QD 2NU0E 2CGAA 1SOTA 4CRAA 1EPTA 1O3EA 1QIXB 1RRKA 2BX4A 1UVUH 3MH6A 1LVMA 1XM1A 3PO1C 4K1TA 2A4RA 1KTTB 3GDVA 3UWJH 1ANCA 1SFIA 1WBGB 2THFB 1V2VT 4CRCA 3FN8A 7LPRA 2ZQ1A 1FUJA 1FIZA 2P8OB 2B7DH 2XCNA 1FNIA 1GJDB 1ELAA 1O2ZA 3LGVA 1UTOA 4D76A 2GTBA 3BV9B 3P8NA 2KFWA 1VZQH 1SLUB 4JMYA 4CH2B 1PPFE 2ZP0H 4B75A 1QNJA 1TIOA 5EOKA 3E91A 5E0HA 1A5IA 5EXNA 1O2HA 1E36B 4ZXXH 1P8VC 1FXYA 1P04A 3F9HA 3H09A 1XUKA 1QQUA 3LU9B 4UONA 1O3MA 4BTUB 1C5PA 3FOAA 3SU6A 1C4V2 3CENA 1P03A 3ZZ4A 2QXIA 4PROA 3ZVGA 2J4IA 1GBCA 3HGNA 4XBDA 2HNTF 4Y71A 2ZC9H 5C67A 1FDPA 3E6PH 4MPUA 1T8LA 3NXPA 2Q6FA 1U6QA 3RXJA 1GDQA 1TGTA 4A7IB 3KQEA 2BYAX 1FY4A 5TCAA 1C5XB 1K2I1 2R0LA 2W3KA 2R3UA 4X6OA 1TMUH 3PV5A 4DCDA 1QR3E 2GKVE 1K1OA 2PWXA 2VWLA 3SJOA 3F2FA 5EXMA 1BT7A 1ZZZA 4K8YA 2QXHA 4ASHA 4AFSA 4ZH8A 4E06H 1GCTC 2W6ID 4TYDA 1DUAA 2HVYB 2WYGA 1VCPA 1YKTA 4X1RU 3SU1A 1BBRK 4E7RG 3ATKA 1BTUA 3V7TA 4ABIA 3DHKH 3SUEA 1T4VH 3EA9A 5IK2D 1OWKA 3SO3A 6GCHF 1VKYA 2BXTH 1Z8IB 1IQHA 3QZRA 1P9UA 2C90B 2C93B 5DP7A 3SV6A 3TPIZ 1C1TA 3ZVCA 2BDGA 1O5AB 4DG4A 4ISHH 2PTNA 1DUEA 1BDAA 1TGNA 2B5TB 2JH6D 3G01A 5F8ZA 2ZPSA 7GCHF 1V2JT 1GI1A 2IPQX 2RA3A 4X8UH 1AKSA 3SI4H 3FZDA 1DSUA 3UR6A 1K1PA 1FJSA 2ODPA 3DT0H 1Y3WA 1XKBC 1ELCA 3SV7A 1EZUC 1KXEA 2BDBA 4Y8YA 4WVPE 2Y5HA 5ABWA 3A8DA 5ETXA 1X7AC 3P70B 1BBRE 2J34A 2VGCB 5GNDA 1SGTA 5HIZA 3EGKH 2ZHFH 3OE7D 2AMDA 5DG6A 1ID5H 2EI8A 4HFPB 1QFKH 4TSFD 3FANA 2O8UA 2W5EA 1O5DH 1C1PA 2FYQA 1A2CH 1ANBA 1LCYA 3SOSA 3LGYA 1O36A 2SGAA 1C1QA 1BQYA 1ELDE 4AFQA 3T2NA 3RMLH 5A8XA 1ZPZA 2P8OC 2XBXA 2FP7B 2XBVA 3F0PA 2GZ8A 2ZFTA 3NCLA 2TBSA 4FU8A 1EOJA 4JK6A 4CRFA 2R3YA 3MO6A 5A09A 5HM2A 1NESE 5F8XA 3M7TA 1J8AA 4Y76A 2XWAA 3D62A 1C5WB 1Y3YA 1PPBH 5A0AE 5L2YH 2AIPA 5GXPA 1SGYE 4CR5A 2BDHA 1L0ZA 2F91A 5DSFA 3FZZA 1AE5A 5FPSA 3PV4A 1GJBB 4AZ2B 2FIRH 2R2WU 1FZZA 1QL9A 1O2NA 5AF9H 3PM3A 4GCHG 4X1QU 1DANH 1LQEA 1YWUA 3MU1A 1WAYB 2ZO3H 1K1NA 1GI7B 4ZUHA 4YOIA 4ZMAH 7ESTE 2A7CA 1LHCH 1O39A 2FOAA 2KZ4A 1G9IE 2JKHA 4ZKRU 3GDSA 3RXFA 4NA7A 3ZVBA 1MMJN 4KTSA 3V13A 3E3TA 1SSXA 1O2MA 4AG1A 4BAMB 1DSTA 4JZEH 1IQMA 1CQQA 2ZCHP 3SUFA 4MNVA 1KLJH 4X8SH 2UUJB 4O3TA 2ZU2A 1QGFA 1GHYH 1CT4E 2BD2A 3URDA 1O3IA 1CT2E 2H1UA 1BMMH 1GHBF 1S5SA 2FI5E 4I8HA 4O3UA 1AB9B 1K1LA 2LELA 3PB1E 2V3MA 2GMTB 2OC0A 3BEFB 1C5YB 5A8YA 1UCYK 3RXAA 2BHGA 5CMXH 2P16A 4RI0A 2H5DA 1SGFA 1HJ9A 3A8BA 4CRGA 4GSOA 4IMQA 1MQ5A 1J17T 3QGJA 1E38B 1P57B 5EU8A 5JBCS 1C5MD 1JIMA 1GBLA 5T6GA 1DWBH 3VB5A 2K1QA 1C4Y2 3PV2A 3TJNA 4NIXA 3RXLA 2A45B 1XVOA 5C1YA 1HCGA 1ZHRA 4H6SB 4R8TB 2BXUH 1V2ST 3QDZB 2IJOB 5FHTA 4X2XA 2WV4A 5BPEA 4I32A 4NIVA 3STIA 3DSPA 5G4BA 1MKWK 1TRMA 2ZCKP 3JZ1B 3AAUA 3E0PB 2F9BH 1ZMNA 2WPKS 2G00A 1O2PA 1DT2A 1LHGH 4H4FA 2SNWA 2QYIA 2A31A 2BQ6B 2PW8H 2WPIS 5JBTA 1V2KT 2VGCC 2JDID 3P8FA 2BDCA 2FS9A 1GMCG 1EAWA 3DSOA 2J5UA 3GCOA 4NZLA 1XUFA 1TMBH 2ZHEH 3RXGA 4WXVA 4BXSA 2GCHF 1C1MA 1D3QB 1WQVH 2XXLA 3H7TA 4IS5A 1S6FA 3KHVA 4OS5A 2AH4X 1UO6A 3A8CA 4UD9H 4D9RA 3TIUA 3UR9A 1SLWB 4UE7H 4YXWD 3FVFB 4RT0A 5AFZH 1ELGA 1EJMA 1V2TT 3LGTA 1NTPA 1C2MA 2CHAB 2CF9H 1GI8B 3U8TH 2J97A 4FUJA 1C2KA 4ACBA 4MVNA 1WQSA 1GBEA 3OEHD 5EJZA 1O3JA 1O33A 2OINA 5T6DA 3SUDA 3T62A 4GAWA 3RXVA 2BVXH 2ZGXH 3GCHC 1HPGA 1FY1A 2OC8A 1D3TB 3KQDA 1GI5A 1Z8JB 1TQ0B 1HJAB 3ESTA 8GCHF 4YT7H 2BLOA 1O3FA 1HB0B 1PQ8A 1O0DH 2ZTXA 1AWHB 1S0QA 3QN7A 3P95A 3M7QA 1CU1A 1O2YA 2G52A 3RXMA 4O97A 5AHGH 1BTPA 4B2CA 1J15A 1S6HA 2ZFQH 1V6DA 1ZRKA 1FN6A 1GMDF 5B6OA 1ZOMA 1QBOA 1C5UA 5FL7D 4O03A 4DIHH 2STAE 1SLXB 1O2JA 3QK1A 2YMSB 3DA9B 4JZIA 3WW7A 2Y7XA 4XDEA 1NC6A 1UTMA 2FX4A 1G2LA 4UDWH 1AZZA 1AI8H 5PTPA 4TWYA 2XC5A 1EOLA 1TBRH 1W7GH 2VWMA 4NSYA 1HYLA 3FAOA 3P6ZB 4JYTA 3K65B 2GVFA 3RC4A 2NU3E 2GD4B 2HWLB 2Y5FA 3D65E 1AB9C 5FPYA 4Y7AA 4AN7A 2R9PA 3GY2A 2GMTC 3V12A 3SU0A 3RC5A 4BAHB 1IHSH 1AN1E 2ZDMA 1UTJA 1JOUB 1CGHA 4XE4A 1O2RA 1TOMH 1J16A 3T25A 2SGQE 1MTVA 2GT7A 1FY3A 4WMEA 1HIAB 1GG6B 2QXGA 4J2YB 2KAIA 3M3SA 3UOUA 4OM9A 2GT8A 3O8RA 2QIQA 1AFQB 1OWJA 3SV8A 2VU8E 3OY5U 1QURH 2BLQA 1TX7A 3C27B 1ETRH 2P3FH 2W7SA 2HNTC 2L6OA 4LZ4B 1GHAF 1G30B 2ZGCA 1LVOA 1QL7A 4U32A 3FP6E 2UUYA 4GHQA 1GDUA 9ESTA 1JRSA 2RCEA 1TGBA 1QZ8A 2BB4A 2XW9A 2Y82A 4ABDA 3KF2A 1OXGA 1GI4A 1O2XA 1KXBA 1EJNA 3M5OA 1FN8A 1XUGA 1YPKH 1O2LA 2OBOA 1PYTC 2DUCA 4KELA 2VVCA 3QO6A 4OS4A 1RTFB 3QZQA 4CBNA 3RMNH 1SG8B 1C2FA 1OX1A 1TNKA 1P2OA 1SGRE 2TGAA 5DP9A 4F48B 4Y11E 1TGCA 2ZHDA 3LGIA 1GBIA 1C5TA 5JDUB 5EIYA 2BD8A 1O38A 3T29A 2UWLA 3LONA 4GHTA 1UCYH 2OQUA 1H8ED 1DVAH 1HJAC 4U2WA 1PYTD 1LKBA 3L6PA 3BG4C 4XOJA 5EPYA 4ABJA 2CV3A 3K2UA 2Q6GA 1O3PB 2TRMA 1CGJE 3C1KA 2OLGA 1N6XA 3HPTB 1EAUA 1QB9A 1G2MA 3UTUH 3U98H 5SGAE 3PRDA 3N7EA 4BTIB 2BY6X 1GMHF 2UUFB 4MPXA 2Z9IA 1AKSB 2AGIX 1P01A 1K1MA 4ZAEA 4YLQH 5FPTA 3SU5A 3UQOA 2DE8A 1MKWH 2F9UA 2ZPQA 1H9LB 3NZIA 2FTLE 4ISLA 1MD8A 2FLRH 3QUMP 1C9PA 2ZU4A 2BY5X 4BXWA 5T6FA 1FI8A 2FI4E 1GCDA 4TY6A 2RDLA 3JZ2B 1NRSH 1W0KD 4WWYA 1BA8B 3VFEA 1BMFD 3HGPA 4ISOA 4FUCA 3NWUA 3VEQB 1EPTC 3AW0A 4HTCH 1ZMJA 4OS7A 5E2PA 1GHZA 1YBWA 2VJ1A 3FO8D 3NUMA 3RDZA 2BZAA 2FOCA 1EP6A 2M2AA 1EATA 1BRCE 4FUIA 1NS3A 1INCA 1AMHA 3BSQA 1C2IA 2H9HA 3BEUA 4I8GA 2A1DB 3MFJA 2Z6BD 5EJLA 1IHTH 1D9IA 1O5CB 2BOKA 3ZZ8A 1P2MA 2PHBA 3DD2H 1SQAA 3A82A 1WOFA 3F9FA 1GBTA 1V3XA 2XBYA 1KTSB 1O2OA 2C8WB 1GG6C 1KXAA 1MKXK 4OS2A 5DPAA 5FXLA 3PLKA 1ZPCA 2Z9GA 1T31A 4I31A 1F5LA 4NFEA 4I8KA 3HK3B 5CE1A 7KMEH 1YY3A 2FOEA 3OX7U 1DY8A 2RA0A 5EPNA 2ALVA 2LP6A 2Z3EA 3ODFA 2VBCA 1UHBA 2FESH 1E1QD 1C9TA 3CP7A 1Y3UA 3F68H 1LDTT 1MCVA 4KGAA 5I46H 1H1BA 4YOJA 2JIZD 5EQRA 1NU7B 1Y59T 3GCNA 1C2LA 1Z7KA 3DUXH 4NGAH 1K0HA 2D26C 1E37B 2ASUB 3OAAD 1CHOF 4WJG2 5CDFE 2FOMB 1SQTA 2AEIH 2QF4A 1GBKA 1C5NH 4K60A 2Z3CA 3ZZ7A 3BTDE 3T27A 2FOBA 1MTNC 1S6LA 1C2JA 1UTKA 4X1NU 4E05H 1ARCA 3SV2H 4U01A 3FKSD 5JB8S 4MLFB 2ZZUH 1A0HB 4TPIZ 1O3OA 3LT3A 1TPAE 4AG2A 2RDEA 2HNTE 4ABFA 1IQFA 4AORA 3SGBE 2FLBH 3HATH 1GBHA 3SU2A 2WPMS 4U30A 3A7XA 3SGQE 4THNH 1DICA 1GBDA 1ETSH 5KECA 2ZFRH 1Y5UT 1QBNA 1AFEH 1ANEA 3RXQA 5EG4A 1Q2WA 1TBQH 1NBMD 4Y6DA 1K28D 5JBAS 1WXRA 4NIWA 2R2MB 3F3BA 3MU8A 3NPSA 4I8JA 2VVUA 3V0XA 5A0CA 1TNJA 3GY3A 2GZ7A 2F4LA 5C5NA 1QQ4A 1KLTA 3MU5A 4JK5A 2FPZA 5AFYH 3SGAE 5C5OA 3ZZ5A 4LXBH 5LGOA 1SBWA 3H5CB 1TNLA 2VWOA 1GBJA 4A5TS 2XYAA 2ZQ2A 3MH4A 4ZXYH 3BTME 2STBE 4HG6A 1H8DH 4INKA 1DY9A 4BANB 1O2VA 1O2TA 1BOQA 5DP3A 5GCHF 1B0FA 1AD8H 1GJ6A 3FFGA 3ZZ6A 1ZSLA 1W13U 3HKJB 2ZU3A 1QHRB 4AC9A 1QB6A 1W2KH 1OWHA 5HXFA 4B6FA 1GI3A 1EX3A 1XVMA 2ULLA 3GOVB 5C0TA 3VGCB 2RFKC 1SB1H 1NRNH 2A0QB 5ESBA 5C0UA 1O31A 1HDTH 2VIOA 1GL1A 1RXPA 5IDKA 5JYIA 1P0SH 3GICB 4JYUH 3OYPA 1TE0A 3RXTA 1UW7A 4K1SA 2ZTYA 1N6YA 1MCTA 1ZJDA 1ORFA 1A4WH 1QA7A 4TPYA 3TU7H 3UUZA 1RIWC 1LQDB 4NG9H 4WMDA 2QF0A 2ZHQH 5AVDA 5FX6A 2WUBA 3D23A 1BTHH 1THRH 1O35A 1FY8E 1SI5H 2BY9X 3CNRA 2J9NA 1L1JA 1F7ZA 3UAIC 3A7VA 2ODYB 1XMNB 1C1UH 1IQJA 1BJVA 2WPJS 3ITIA 2ZF0H 3SNCA 5E8EH 1A0JA 3BIVH 4B2AA 2CF8H 3OU0A 1RFNA 1O3HA 2VIQA 3D49H 2XC0A 3RXHA 4ZCNA 2GGVB 2A5AA 3UNRA 1KXDA 4X6PA 2WUCA 2KR7A 4FVBA 2QF3A 1ESAA 1FX0B 2NWNA 2HLDD 1VJAU 4FUGA 2UUKB 5HM9A 2WHXA 3VG8A 1C5QA 4WY3A 4BOHA 3A88A 3GY8A 3GCHB 3IITA 3SHCH 5HGGA 1CSOE 4JZ1A 1WTHD 1A3EH 3ATMA 3GY7A 2BLWA 2YNBA 4Q2KA 2KCYA 3VB7A 2WPLS 3TK9A 5LPFA 2HOBA 4IN1A 1H8IH 2ZGHA 4AGJA 2G5VA 2ZU5A 3I29A 4MTBA 3S7HB 4X2WA 2AGGX 1UVTH 5DN6D 1O2GH 3LGWA 5K7RA 1MKXH 2VNTA 1UTNA 3MI4A 1TGSZ 1EAIA 2BY8X 5T3HA 3T5FH 1TALA 4WH8A 2ZDKA 1BRUP 1P10A 3SZNA 2JETC 5GPIB 1VITF 4DIIH
chains in the Genus database with same CATH topology
2EA3A 4DURA 4NFFA 5K0HA 3LH1A 2BM2A 4JYVH 3A80A 4A1VA 1T32A 2PTCE 3A83A 4MPVA 1GI6A 2TIOA 3GCTF 3MTYA 2M5TA 1HAIH 4FU7A 4A6LA 2QXJA 1ZRBA 1TLDA 2XCFA 1DS2E 1KIGH 3RUOA 1GBFA 2V6NA 2DE9A 1IQIA 3CS0A 4K1EA 3PTNA 3EA8A 3VGCC 1W10U 1NN6A 3GYMA 3QLPH 1GJAB 3I78A 4RKOB 3MNXA 5LPEA 1AVGH 1AY6H 3KNXA 1DXWA 4KTUA 1GWAA 2P95A 1NM6A 1NT1A 3TJVA 5GJ4B 3MO3A 1C1RA 1LMWB 3AASA 3U8RH 4E7NA 1K1IA 1C5OH 1TONA 4CREA 5EW1H 1DM4B 1O5EH 1MBMA 3A89A 3A86A 1UCYE 2I6QA 1G3EA 1A0LA 1SL3A 2D2DA 2EI6A 4YZUA 3SNAA 3EA7A 5F8TA 3O8DA 1SOZA 2Z9KA 1BZXE 3KQCA 3ODDA 3UOPA 1IQGA 2G5NA 1O32A 2ZCLP 1BTZA 1OWIA 3MHWU 1HAVA 3RXSA 2Y6TA 3RP2A 1CBWC 2A4QA 5C20A 1ZTJA 3RXEA 1NO9H 1P2KA 1VCWA 3N7OA 1GGDB 1GJ8B 1QJ6B 1ZGVA 5GCHG 2P3TB 5C3NA 2ZTZA 3EDXB 2QA9E 5FCKA 3OY6U 1ABJH 3KN2A 4GLYA 1G3BA 1SGQE 3MU4A 5DP6A 4UEHH 1ELVA 1ZPBA 3BG4B 1PPZA 4FUEA 1LVBA 1UTPA 3SUGA 5HYOA 4JCNA 4Q7YA 2BDAA 2BOHB 3I77A 1ZSJA 2XBWA 4Y0YE 5E0GA 2FTMA 3M3TA 8KME2 1A5GH 3B8JA 6GCHG 5JB9S 5C1UA 1O5FH 4CH8B 1JWTA 3LIWA 2PLXA 2PV9B 3O8CA 4XFQA 2QC2A 2PSYA 1V2QT 1WU1A 1XUHA 1UHBB 4J1YA 3ZV8A 1SGCA 7GCHG 4FU9A 1A5HA 3A85A 4RKJB 1BRAA 2ZFPH 3SJ8A 4MQAA 2J92A 3HK6B 2PGQB 2YOLA 1NFYA 2SGEE 2R0KA 5CHAC 1TABE 5E2OA 1XUJA 1Z1IA 2Y5GA 1FAXA 1PJPA 3PLPA 3ZVAA 1SPJA 2W3IA 1NROH 4MDSA 1BTWA 1EPTB 3TNTA 2ZHWH 1AUTC 2BD3A 1DWDH 5FBEA 2CXVA 2ZDVH 3K6YA 3SJKA 1YP9A 1F5KU 3TGIE 1G3DA 1YPGH 3UREA 1MH0A 1P02A 1W0YH 1BMLA 3RXRA 1AUJA 4K8BA 3QGNB 3TH3H 3GY5A 2ZDAH 3OTJE 2A2XH 4OGYA 3M61U 4X2VA 4ZHLU 4K2YA 1OWDA 9LPRA 4ABBA 2BTCE 2SGPE 3RLYH 1L1NA 4AFZA 1CE5A 3VPKA 1YCPH 4KKDA 2QCYA 1YGCH 2AMPA 1K21H 5ESTE 3MH7A 3M5MA 4X1PU 3PMAB 1BMNH 3ZYDA 5EW2H 5DP5A 3A7ZA 3VXEH 1RJXB 2FDAA 2J95A 1FPCH 2EI7A 1TNIA 1W8BH 2ZWLH 3TJUA 2ESTE 1KXCA 3TJOA 2BD4A 4M7GA 4ESTE 1E0FD 1S85A 1E34B 1THSH 1TRNA 3M3VA 4D9QA 1FIWA 2A4OA 1NRRH 1RTKA 1S84A 1F5RA 1SGEE 1OS8A 1G36A 4WF8A 1PQ5A 1MTNB 1HAPH 5A8ZA 5FBIA 2Q6DA 8LPRA 5C1XA 1GJ5H 4YTAA 1VGCB 2SGDE 4K3JA 1XX9A 2XNIA 4X8VH 3SN8A 1UVSH 1P3CA 4VGCC 3M5LA 2Z94A 3L33A 3S69A 4Y79A 4HGCA 3LJJA 1NFWA 1GGDC 4FXGH 1OPHB 4AFUA 2ZGJA 1O5BB 1MTUA 3EAJA 1SGPE 3BN9A 1DPOA 4ZROA 2QY0B 4LK4A 4NWKA 2G51A 1P9SA 1FY5A 5DJ7A 1ELBA 1GHBG 1D3PB 1QY6A 1T8MA 2QGRA 3SU4A 3E1XB 2Q1JA 3ZVDA 3ATLA 1NU9A 1ABIH 1H4WA 2OBQA 3SJ9A 2BD5A 4Y7BA 1MD7A 2FO9A 5DP4A 2Z9JA 1ESTA 1TB6H 1GHXH 3SQHE 2HRVA 3LKWA 1AQ7A 1V2OT 1SMFE 1ZHPA 3PMBB 2ANKH 3TH4H 1LTOA 2J94A 1OOKB 1P06A 3PMHB 3KL6A 4F4OC 2H9EH 1HAYB 1UK2A 1QBVH 2FWWA 5J4SA 4K69A 2GCTC 3T28A 3U8OH 4ABHA 2P59A 4JZDH 4ZKNU 2JH0D 2ZA5A 3Q77A 1FONA 1CHGA 4DW2U 2V3OH 3ZZAA 3MNSA 1AO5A 3SJIA 1GHVH 1UVPA 3A84A 1TAWA 1C1NA 4YM9A 2G8TA 1OYQA 1W3CA 1C4U2 3AAVA 3TH2H 2LNCA 3TNSA 1TPSA 1B0EA 2QAAA 2GCHG 4IMZA 1Z6JH 1C5LH 3O8BA 4YLUA 1FAKH 4CRBA 1IOEA 3EE0B 1GBAA 1E35B 3BTGE 1AVXA 3R0FA 2Y81A 4HI3A 2G81E 1T7CA 2HPPH 4B73A 3DFJA 1V2RT 1A7SA 1IQKA 3E0NB 1SQOA 2ZDLA 4X6MA 1C5SA 1P3EA 4TY7A 3S9CA 4NSVA 1C1VH 1PFXC 3VB6A 1EASA 1F2SE 4IGDA 3PWCA 3FP7E 3M36A 3Q3KA 1C5ZB 3RU4E 3W95A 4DJZB 3SQEE 2B0FA 1C1WH 2FYRA 2ZNKH 1W7XH 1GJ4H 3BG8A 3BTKE 3UPEA 1RIWB 4GCHF 1G3CA 1HAZB 4Q7ZA 1O3DA 1YLCA 3KGPA 3GY4A 8GCHG 1SHHB 4NIYA 2ZGBH 1QRWA 2OD3B 3DFLA 2A5KA 3UNSA 1BUIA 3A81A 1EZXC 4ZKOU 2ZEBA 1NY22 1A3BH 1O34A 3M35A 1UTQA 2VH0A 2V3HH 3MNBA 1ANDA 3QTOH 4DGJA 5A0BA 1P2NA 3MWIU 1AVWA 4BTTB 1GVZA 1LPGB 1TYNA 1GMDG 1RD3B 1YPJH 3SNBA 4IN2A 4RN6A 4NA9H 1O30A 1VGCC 2PSXA 1HNEE 4B74A 2GZ9A 2OP9A 3MH5A 1HV7A 2FODA 2IPHA 3UNQA 1O37A 1O2QA 2CN0H 1P11E 1EUFA 2OC7A 4X6NA 1F0TA 1QJ1B 1L4ZA 1GBMA 2WINI 3Q3YA 1ZHMA 3P8OA 1FMGA 3PMJA 2IOTA 2O8LA 1A61H 1KDQA 1P2QA 1QCPA 2PR3A 2LPRA 4AOQA 1HXEH 2NU1E 1MQ6A 2BLVA 1ELTA 1N8OB 2ZFSA 1TX8A 4LZ1H 2O9QA 2ZU1A 3U9AH 1O3BA 3P17H 3SNEA 5JBBS 1HIAA 1SGFG 2H9TH 2RG3A 2J2UA 2WV5A 3UY9A 4CBOA 1NRPH 1UTLM 3PTBA 1O5GH 1GMCF 2FOHA 2XC4A 5EXLA 5HMAA 1MZAA 4NWLA 3UQVA 4AB8A 2JETB 2NU4E 1IQLA 1O3CA 2A5IA 2XTTB 5EGMA 1B5GH 3BTEE 4AX9H 4CRDA 1Z6EA 1GHWH 3M5NA 1ZTKA 2Y7ZA 5TJXA 1O2SA 2TPIZ 1EZSC 3QX5H 4ISNA 3ZZCA 3TGJE 4BAKB 3A7YA 1T8OA 3MYWA 1GHAG 1XUIA 3ZZDA 3TITA 5GWZA 2HALA 1ZJKA 4GVUA 3KIDU 4YO9A 3A7TA 1ARBA 1K9OE 3MMGA 3TVJB 4O9VA 1HAVB 5IYTA 2C8ZB 2BX3A 1D3DB 3S0NA 1DFPA 1P05A 3LPRA 1SVPA 2UWOA 5FAHA 1ZLRA 4YESB 1O3GA 1MAXA 1AGJA 2FS8A 3E16B 5L2ZH 1NFXA 2F9OA 1SLVB 2D1JA 2GV7A 2D8WA 2FZZA 3VB3A 4X2YA 3E90B 1V2PT 1Z1JA 1BITA 2ZPRA 2B8OH 4H6TA 4XBBA 1KSNA 1DE7H 3MU0A 3ZZ9A 1IAUA 4DY7B 1TA2A 1YPHC 4D7GA 4NCYA 1FV9A 3GYLB 5EODA 2ZI2H 2BZ6H 1WV7H 2V0BA 1PPCE 1A1RA 4Q7XA 1EAXA 4AGKA 1KYNA 2JH5D 2H5CA 1GVLA 4A1XA 4DOQA 4X0WU 1SHYA 2PKSB 1RS0A 4B2BA 1TMTH 3F9EA 4Y0ZE 1YCPM 1Y8TA 1GPZA 3ZYEA 1TA6A 3CS7A 1GMHG 2G4TA 3Q00A 1S0RA 1Z8RA 1PQ7A 2XRCA 3BEIB 4ABGA 1UVOA 4ZHMU 1KXFA 1LO6A 3QTVH 3P8GA 2OC1A 3RXDA 1P2JA 1CBWB 1MU6B 1O3AA 2SGFE 1AZ8A 1ELFA 4MNXA 3BTWE 3BTQE 1P09A 2W26A 3F6UH 1Q31A 1WTGH 4DT7B 4UFGH 1C5VA 3ENSB 1YCPK 2PFEA 1GDNA 1DOJA 2Y80A 1SFQB 1MUEB 1W0ZU 1TNGA 3LJOA 1J14A 1YF4A 2BQWB 2PUXB 1C1SA 1BIOA 4XSKU 3RMOH 1M9UA 4AYVB 1DITH 1D4PB 1PPHE 4B1TA 5L6NH 4Q80A 1UK4A 1CA0B 1N8OC 1NPMA 5H4IB 4MPWA 3RXUA 2J38A 2KAIB 3LC3A 1NFUA 1JBUH 2BDIA 1C2EA 1JXPA 3QWCH 1CT0E 3S9AA 1EP5A 2EC9H 2G55A 1LHFH 2PKAA 2BY7X 2VINA 3IG6B 1V2LT 4RSPA 5TCCA 1O3LA 3RLWH 2F9VA 3RU4T 4AYYB 4WMFA 5A2MH 3M37A 1YYY1 1MZDA 1TPPA 3KQBA 1XKAC 1GJCB 1HFDA 5I25A 1JRTA 4NZQA 1BRBE 1HAOH 1OSSA 5CHAB 2FXRA 1GI9B 2ZG0H 3A8AA 2TGDA 1BJUA 2AGEX 2P3UB 3RM2H 3SW2B 4ABEA 1AU8A 5DKMA 2Z3DA 2YNAA 2GP9B 2OQ5A 3SHAH 4IBLH 1JIRA 1F92A 1DWEH 3SORA 1TWXB 1LPZB 4HZHA 1Y5BT 2HGTH 4UFDH 1CHOG 1CVWH 3KEEA 1GJ7B 1HUTH 2H2ZA 1XXDA 3PWBA 1GI0A 3GISB 4D8NA 2C4FH 5L30H 4IW4E 5GDSH 2O8MA 2P93A 3ZV9A 1K22H 3BIUH 2BVSH 4ZHAA 2FX6A 1XXFA 1QB1A 1DDJA 2FOGA 5LPRA 1T8NA 3A7WA 3T26A 2ZECA 1DX5M 3K6ZA 1TX6A 3P92A 2C8XB 2CMYA 5F03A 3B23B 3M7UA 2PKSC 2HVXA 1S83A 2AIQA 1RTLA 4ABAA 1HXFH 4XBCA 3Q76A 2QV1A 1TOCB 1UMAH 3U1IB 1NZQH 4KP0A 1UJ1A 1JMOH 2AMQA 1QTFA 4KTCA 1ACBE 1HJ8A 3IWMA 4LOYH 4R0IA 1EB1H 1DWCH 1FQ3A 1RGQA 3AW1A 2C8YB 1YPHE 3TGKE 4VGCB 5EQQA 2WYJA 1DLKB 4INLA 4FUFA 2OTVA 1PPGE 1VCQA 4OS6A 2FOFA 1TNHA 1BTYA 2VB0A 3LDXH 3RMMH 1KY9A 4ISIH 4JZFH 3SV9A 1O2UA 3ZVEA 1BTXA 1V2WT 1SGDE 5EQSA 3RXKA 5J4QA 2CJIA 1O3NA 2F9PA 3ATIA 3LGUA 1EB2A 2HLCA 1CA0C 1MAYA 1PQAA 2VIDA 4B76A 1ETTH 3W94A 1Z8GA 3E8LA 1F0RA 1V2MT 1MTWA 3S7KB 1L4DA 1QL8A 2BMGB 2VIPA 1BBRH 4B71A 3UFAA 1GBBA 1ZGIA 2F3CE 8ESTE 3GY6A 4SGBE 1AHTH 2NU2E 2GCTB 2VWNA 4FUBA 2ZFFH 4CHAB 2OUAA 1GVKB 1NRQH 1WCZA 1OP2A 6CHAB 3S9BA 3OSYA 4CR9A 2ANYA 2C3SA 3PROA 4OGXA 1YC0A 1EXFA 1F0UA 1TBZH 1TQ7B 1GJ9B 1VITH 1EZQA 3ZZBA 3AVZA 3KCGH 5GIBA 3EYDA 2AFQB 2ZIQH 4Y8XA 3PLBA 4BNRA 1SGIB 1BHXF 3BTFE 1YPEH 2ZKSA 3MNCA 1YM0A 1EKBB 3RC6A 1C2HA 2G4UA 3RU4D 3VB4A 1YPLH 1V2UT 1O2WA 1KLIH 3SU3A 4D7FA 2FI3E 1D6RA 2ALPA 2PUQH 2ANMH 1LPKB 3NKKA 2WPHS 4I7YH 1ELEE 2W7UA 1BB0B 1K1JA 3ATWA 1C2DA 3HKIB 3H7OA 1DXPA 3RXPA 2VVVA 1T4UH 3ZZ3A 4I33A 1S81A 4Y8ZA 3RXBA 1KDQB 3FP8E 3VXFH 2VH6A 3BF6H 2FM2A 2GX4A 5LH8A 3UIRA 2OCVB 1OYTH 3SI3H 2SFAA 5JPMH 3UWIA 2A32A 2FMJA 4Z0KA 1A46H 1O3KA 5DGJA 4AB9A 2XWBI 3RXOA 1HAGE 2SNVA 2IN2A 1HAHH 1HBTH 3STJA 1QRZA 2F9NA 1BCUH 1O2KA 1OP8A 1TPOA 3RM0H 2QN5T 3WY8A 1L1GA 1OKXA 1P12E 4TWWA 2I6SA 4IC5A 1IQNA 3PYHA 1G32B 1Y5AT 2BVRH 3EQ0H 4BAQB 3MO9A 2ANWA 4UFEH 3ELAH 4IC6A 2F83A 1HAXB 4FUDA 1VITG 1FPHH 3TLOA 1ZMLA 2BQ7B 2V35A 2VIVA 3F9GA 1CO7E 1Q3XA 2ZDNA 3L3TA 3SBKA 4F49A 1W12U 5F6MA 2AS9A 5C2ZA 3GCTG 1EQ9A 1S82A 3F1SB 1SC8U 5FCRA 5FX5A 1SGNE 3U1JB 1IQEA 2Z9LA 3Q3XA 3PO1B 3TK5A 1QA0A 2CHAC 1OWEA 1O2IA 2BD9A 1B7XB 1LKAA 1C1OA 1G37A 1Y3XA 3R3GB 2GV6A 1LHDH 4A92A 1J9CH 3RXCA 1TFXA 2A4GA 1HLTH 2GDEH 1N1LA 1D6WA 3BTTE 1C2GA 2EEKA 5DK1A 2ILNA 1DLEA 3B9FH 1MTSA 4CHAC 6LPRA 1YPMH 1V2NT 1ZR0A 2TGTA 6CHAC 1Z71A 2H6MA 3BTHE 4Y10E 2HPQH 1THPB 2UWPA 4YT6H 4BAOB 3RXIA 5DP8A 3LC5A 1GI2A 3SNDA 4NA8A 2O8WA 4UFFH 4INHA 1ZSKA 1LVYA 1TRYA 4QT8C 1PPEE 1ZYOA 1HGTH 2PGBB 2B