4DG4A

Human mesotrypsin-s39y complexed with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGYHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRSS3 protein
publication title Presence versus absence of hydrogen bond donor Tyr-39 influences interactions of cationic trypsin and mesotrypsin with protein protease inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 224
sequence length 224
chains with identical sequence B, D, G
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4dg4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4dg4A02
3RMMH 4E05H 1SGDE 3MHWU 1FNIA 1RIWB 2FM2A 3SNBA 4AFUA 1TMUH 1LVYA 2TPIZ 1C5VA 4MDSA 2O9QA 1TOCB 2PFEA 1GVZA 2SFAA 4YOJA 1TONA 2OC7A 3U69H 1TABE 2IJOB 4CRDA 2HNTF 2ZO3H 1QL8A 4I8KA 2HGTH 3SO3A 5DPAA 3VB4A 4X8VH 4JCNA 3SU5A 1S81A 1S5SA 2XW9A 4U2WA 4FUBA 1G9IE 2FI3E 1WTHD 1AU8A 2OBOA 1RTFB 4X1SU 1NU7B 2ZHWH 1O3OA 3NKKA 4AYYB 2FX4A 2H5CA 1ZGIA 7GCHF 1NFYA 1J8AA 8ESTE 1C1SA 1VJ9U 2F9NA 1GVLA 4X2VA 3DFLA 3I29A 1QJ1B 4FUFA 1O3AA 1ACBE 3NCLA 4I31A 1UVOA 3MTYA 4UD9H 1OYQA 4ZH8A 4CH8B 2XBWA 4ISOA 3RXAA 1O2MA 1KXDA 2Q6DA 1BCUH 3M36A 1ZSJA 3SJ9A 1XKBC 2JH5D 3MO9A 2ZHQH 1YP9A 1ZRKA 2CF8H 3MU5A 4FUJA 2Q6FA 3TGIE 3F9EA 1C5PA 4K1EA 1C5QA 1GMDF 4B71A 1OP8A 3GCHC 5GCHG 1HXFH 1IQFA 1GL1A 5AVDA 1OX1A 4IC5A 1GJ8B 5DK1A 1J9CH 3SJIA 2EI8A 4D76A 1EB2A 4NGAH 1E37B 2C8YB 1F0TA 1HUTH 1Y3VA 1YC0A 2HRVA 1C4V2 2FXRA 1CGIE 1MTNB 2QC2A 3GY6A 4FUIA 1Y5UT 5F03A 1SLWB 2ZFRH 2VWMA 2G5VA 3TJUA 3RM2H 1LVBA 4FU7A 4X0WU 5FPYA 1GI2A 4DGJA 1O3PB 3RXHA 1JBUH 3QK1A 1VCWA 2VH6A 1YPLH 1C1NA 5B6OA 4BAKB 2G52A 1NZQH 3TH3H 4ZXXH 1SG8B 5JB9S 1Q3XA 5AHGH 1CHOG 4OGXA 3UREA 2J4IA 2FOMB 4Q7ZA 5G4BA 3SV8A 2W3KA 3GCNA 3VEQB 2R2WU 1G36A 8GCHG 5LPFA 3U1JB 4JYVH 1AB9C 1N8OC 1ELAA 1EJNA 4BOHA 1QJ7B 4GAWA 3SV9A 3AW0A 4WXIA 5HXFA 1HBTH 1YLCA 4TY6A 1HGTH 3CP7A 3M61U 1C5RA 4JZFH 2XBYA 4WMFA 2QN5T 4BXSA 1C2KA 1ZMNA 2GCTC 4FU9A 1BTZA 1W8BH 2TGAA 3DA9B 3MNBA 4B1TA 5DG6A 1L1JA 1OSSA 1TPPA 2P93A 7LPRA 2BM2A 1J16A 4Y0YE 1LKAA 2FZZA 2VIDA 1A61H 1P8VC 2GP9B 2PUQH 4K8YA 4OS7A 2ILNA 1EJMA 1O3HA 2AYWA 5FX6A 2TIOA 1PPEE 1A5GH 1TNHA 1LVMA 3WY8A 4H6TA 2FP7B 2AMPA 1D6WA 2ZNKH 5C1YA 5T6DA 4ISLA 1D6RA 3G01A 1SI5H 1Z8RA 2C4FH 1PQ7A 5JBTA 2W7UA 3SOSA 1VGCC 4KTUA 5JBBS 2D2DA 1DVAH 2YNAA 3SI3H 3A80A 1AKSA 2WPMS 3SORA 2QXIA 2FI5E 2BDGA 1FDPA 3GY5A 3GY3A 1EP5A 3VB3A 1NFXA 1HAZB 3RXFA 3UPEA 4AG2A 4GVUA 1FN6A 1WU1A 3Q76A 1TBRH 3UWIA 2VWOA 1AWFH 1MZAA 1EP6A 2FX6A 3T2NA 1H8DH 1BRAA 1L2EA 1RTLA 4WXVA 1ZTLA 4AFSA 3GDUA 2XTTB 1W3CA 1SGQE 3H7OA 2PHBA 1ANCA 3EE0B 1H4WA 2XC0A 4ASHA 2R3UA 3OTJE 1SQTA 1B0EA 4CRCA 3W94A 2AEIH 1IQNA 1P3CA 4A6LA 2O8WA 2Y5HA 3KF2A 2XBVA 2CHAB 3ODFA 1O5CB 4ESTE 1DWCH 4X2YA 3SUEA 2Y81A 1WTGH 1NO9H 2JKHA 1OXGA 1TYNA 2VIWA 3E8LA 1LKBA 4ABAA 1FIZA 1GMHG 4I8LA 1C5ZB 2XRCA 3A84A 3LPRA 1J17T 2QXGA 3BTWE 2BY6X 5DP9A 1GG6B 3QZQA 1L4ZA 3Q00A 2ZWLH 2ZF0H 2THFB 2Z9GA 2SGEE 3NZIA 2RA0A 3BSQA 2WUBA 4BNRA 1IQEA 2PR3A 2Y82A 3PWBA 3KGPA 3RXPA 3LDXH 1DICA 3RC4A 1P3EA 1SHHB 4MG3A 4MPWA 1W12U 1C4Y2 1ZLRA 1GVKB 4CRBA 2SNWA 2BDAA 2BOHB 1SGCA 2P16A 2BTCE 4THNH 1D3TB 3TK6A 5LGOA 4O03A 2OD3B 3ZZ3A 3QGJA 9ESTA 1QBVH 2GT8A 3M3SA 7ESTE 4K8BA 1IQLA 5EQSA 2EEKA 8KME2 1U6QA 1MH0A 2FLRH 4CHAB 2BLVA 1SGYE 4INKA 3ZZCA 1GBTA 4CRAA 1E0FD 2BZAA 1GI8B 1V2RT 3DFJA 2BXTH 1TA2A 4UFDH 2F9BH 1EJAA 2GMTC 2FODA 2NU1E 3TNSA 3EA8A 4U32A 1TMTH 2V35A 1QY6A 1UTKA 3SQHE 4B74A 2BQ6B 3ZYEA 3LGVA 4TWYA 4ABBA 2KAIA 4AX9H 3A83A 1G2LA 3ENSB 1ESBA 3SQEE 1MU6B 3GYMA 1F5LA 3M5MA 2ALPA 3GYLB 1TGTA 5JBAS 2VU8E 1C5MD 4WF8A 1W7GH 2QV1A 2VVCA 4YO9A 1C2EA 1SOZA 2FOBA 2RA3A 2ZGCA 1ZPCA 4X8TH 2A32A 4X6MA 1TRNA 2ZU2A 1C5XB 2AGIX 3A7VA 1X7AC 1QGFA 4NIVA 1YBWA 2DE8A 3K6YA 1O5EH 2KAIB 4Y71A 5E8EH 4ZKOU 2AFQB 1WYKA 3MO6A 2QIQA 5GCHF 2PGBB 5AFZH 1UMAH 2GZ8A 4ABJA 2PWXA 2W3IA 3KQBA 2Z9KA 1IQMA 1WSSH 4CREA 1RTKA 1GJDB 4CH2B 1BHXB 2BMGB 1PQ8A 5FCKA 1HYLA 2ZU3A 1TX8A 2HNTC 1MKWK 4AB9A 4GCHG 1AFQC 1O3KA 5FBEA 4UFFH 3IITA 3F6UH 4WMDA 2HNTE 2FWWA 1ELGA 1AUTC 3TITA 1OOKB 2XXLA 2EC9H 1UVUH 2R3YA 4FUHA 4HFPB 1ELCA 1AGJA 4ZMAH 1DUAA 1ZZZA 3AVZA 3HGNA 3TVJB 2HPPH 1S6HA 1HJAC 4INHA 4IS5A 1EQ9A 4A1TA 4PROA 1F0UA 1GGDC 1Z1JA 2ULLA 1TGNA 4SGBE 1T8MA 3TGKE 1E38B 3BN9A 3EDXB 2R0LA 3ZYDA 2P3FH 1UVPA 2C8XB 2BLQA 1O5BB 2BLOA 1FZZA 3LH1A 1DUEA 2A7JA 1S0QA 3NXPA 5A0AE 1DWBH 4CR9A 2M5TA 1JMOH 2BY7X 3A8AA 1P2MA 5E2OA 3MO3A 4Z6AH 1TB6H 2Y80A 4U01A 5C3NA 1PPGE 1DDJA 2B9LA 1GWAA 4ZUHA 3EGKH 1ZSKA 2UUJB 1MTUA 1WUNH 3MNCA 3QUMP 3K9XB 2AS9A 2ALVA 1QBOA 4AGJA 3U8TH 1Q31A 3HKIB 1S6FA 3PLKA 1A3EH 2AGGX 3SBKA 3UTUH 4ZHLU 2AIPA 4GSOA 1UCYH 3AW1A 2CV3A 4D7FA 1QQUA 1VJAU 4K1TA 3F68H 1OWEA 1YPHE 2WUCA 1Y3YA 3B8JA 3FP6E 3PYHA 1RGQA 2ZPQA 1LHCH 3DT0H 4KTCA 1O31A 1FPCH 2QXJA 1UCYK 3RXRA 2BYAX 4MPVA 3BTQE 4JZIA 4CR5A 3SHAH 5FHTA 1SB1H 4FUCA 2TGPZ 2WPHS 5IYTA 2NU0E 2QGRA 2H2ZA 3A8DA 2HOBA 3UNSA 3A7ZA 3SGBE 1A0HB 1ELFA 3RXLA 3A87A 3T25A 4H42U 1ABJH 1TA6A 1TNGA 1W7XH 2Q6GA 2OINA 2ZU5A 1V2WT 1FV9A 3QGNB 1Z6EA 1AFEH 1UTOA 1FLEE 1P12E 1V2QT 1MD7A 5ESBA 1O2GH 1DLEA 2CGAA 3Q3YA 4YTAA 1CT4E 1P04A 3P6ZB 1FN8A 3A85A 1GL0E 4A5TS 2F83A 4AOQA 5ETXA 4IGDA 1TNJA 5JBCS 3VGCB 1P02A 1OYTH 3Q3KA 3GCTG 1GBKA 1ELVA 2C3SA 1C1VH 4CRFA 1K1MA 2ANYA 2NU4E 3KIDU 3MNXA 1HJ9A 2EI7A 1K21H 2ZTXA 1QL7A 2BDBA 3NPSA 1ARCA 2BD7A 3UUZA 4K69A 1FXYA 1IQKA 1V2NT 3ZZ8A 5GWZA 1P2OA 2ZFFH 4O9VA 5EU8A 3RXEA 3EAJA 1H9HE 1C5UA 2B0FA 5LPRA 3QTVH 1WOFA 1FAXA 1HDTH 2FOEA 3Q77A 1KXEA 2FYQA 5HMAA 1G30B 1C1MA 1C2JA 2ZKSA 3D49H 1GBEA 1O2UA 1P10A 3L3TA 1NRSH 1O33A 1TGCA 1F7ZA 1YCPH 1O2QA 4FUGA 1E34B 4JYTA 3V3MA 2GT7A 1GI5A 2UWLA 4OS4A 2CMYA 5F8TA 3ATKA 1QB6A 3BG4B 4NA8A 1MAXA 4ZXYH 1YCPK 1P09A 4BAOB 4ABEA 5C67A 1B5GH 1D4PB 5T6FA 1JRSA 1S82A 4K2YA 1GJBB 1K28D 1F5RA 3RMLH 2P8OC 2BD9A 3TJVA 4YLQH 3RLWH 4WWYA 5DO4H 2QF0A 4I32A 3M37A 2XYAA 1HLTH 1O5GH 1KYNA 3R3GB 1TX7A 4I8HA 1SQAA 3RXCA 4DY7B 1MAYA 2FOGA 2QCYA 2P95A 4NA7A 4NG9H 4OS6A 5EXMA 3S9CA 3RXGA 1QRXA 1XUFA 1UK2A 2A45B 1J14A 1KSNA 1O3IA 3ZZ9A 2F9OA 3EA7A 1G3CA 1O3GA 3M7TA 3GOVB 3RXOA 1KXAA 1BQYA 3S69A 1BRBE 1AI8H 4Y0ZE 5EQQA 2ZGJA 1BRUP 4XE4A 3A7YA 3RU4D 5SGAE 4NWKA 3QN7A 5BRRE 1GJ4H 3E0NB 2HPQH 2GTBA 4TYDA 2FLBH 4LOYH 3RMNH 3BF6H 2J95A 3P95A 3TJOA 1MQ5A 1JIMA 1O30A 1S0RA 3FZZA 2GCHG 5HGGA 4DJZB 1INCA 4DIHH 3UY9A 3PTNA 3RC6A 2ZQ1A 5C20A 5EPNA 1DY9A 1GJ5H 3PO1C 2Y7XA 3KQEA 5HM9A 3LGWA 4Y7AA 3MU0A 1HAVA 2VH0A 3RMOH 1MKXK 4Y8XA 4AN7A 4GCHF 3URDA 1WQSA 1GBIA 3B9FH 1PPBH 1NT1A 1WCZA 4FUDA 1F0SA 6CHAC 1UTLM 1Y5AT 2Z94A 1KIGH 1JWTA 3RU4E 3RXKA 3GCOA 1SR5C 3M35A 1TPOA 1EPTA 1NRPH 1XVMA 2QAAA 2GDDA 4NWLA 1XXDA 5C2ZA 1GBMA 2H9EH 1ZPZA 5K7RA 4NZLA 1CBWB 2ZEBA 3MH7A 4YT7H 1TNKA 1HAVB 3GISB 1SBWA 2B7DH 3RU4T 1BBRE 1THSH 4LK4A 1SSXA 3LONA 4NFFA 3RM0H 1UVTH 1QBNA 1BTXA 1CVWH 4ISIH 3MFJA 1C1UH 1P57B 2TRMA 1GCTC 1GPZA 3QLPH 2J9NA 3KQCA 1O3NA 2Y5FA 3QX5H 1EPTB 2F91A 1ESTA 1TGSZ 1KTSB 1L4DA 2IPHA 2V6NA 1O2KA 2GX4A 3ATLA 1ANBA 4XFQA 3BTFE 1A5HA 1YPMH 1VITH 2A5KA 1HRTH 2ZGBH 4OS1A 3TNTA 2AIQA 1O2RA 4A1XA 5EW1H 1BTWA 4FU8A 2I6SA 4AYVB 1V2OT 1NN6A 1V2ST 2BD8A 1LPGB 1THPB 3ATWA 1EATA 2Z6BD 1O3JA 2FEQH 2H6MA 1Z1IA 1Y3XA 1EOJA 2FS8A 3MI4A 4QT8C 5JB8S 4SGAE 2Z3DA 1N6YA 1FIWA 5CMXH 1XM1A 3VPKA 1LMWB 3HK6B 1NRQH 5CHAB 1N6XA 3KL6A 2BHGA 2FIRH 2VGCC 2R2MB 3LJJA 1PQ5A 1H9IE 1E35B 1OWKA 2A4RA 2O8MA 1LQEA 4U30A 1ETSH 2WYJA 4MQAA 1SLXB 1H9LB 2VWNA 4GUXA 4KKDA 3BTTE 2FTLE 4OGYA 2BD3A 1TRYA 2A4OA 2FOCA 1T7CA 1AE5A 2J94A 5C1UA 1FUJA 3ZVAA 1F5KU 2FTMA 1C1WH 2ZHFH 1C5YB 2SGQE 3LU9B 4ABDA 2A4QA 3MU1A 2GGVB 1P11E 1ZGVA 5FAHA 4X2XA 1W2KH 4VGCC 2JETC 2PKSC 3MU8A 1VITG 2BVRH 3A81A 2SGPE 1EXFA 4LZ4B 1NPMA 3UQOA 1ID5H 3MH5A 2FI4E 3PM3A 4BTTB 2ZFSA 3STJA 5ABWA 3ZZ6A 1C2DA 2UWOA 2F9PA 4YLUA 5EPYA 1SGRE 1O2NA 1BTUA 3TJNA 1O2JA 5GIBA 4ABIA 4B2AA 3W95A 2ZFTA 3UIRA 1Z8GA 5BPEA 3RLYH 1ORFA 3M5OA 3JZ1B 3T62A 1BITA 1BMNH 1LDTT 1FPHH 1XUIA 2FESH 3TPIZ 3UR6A 3Q3XA 3KHVA 3TGJE 3MU4A 2QY0B 1F0RA 4IN2A 2HLCA 3VFEA 1FQ3A 1FY5A 3TK5A 4YOIA 2C93B 3GCHB 1A2CH 1YF4A 1QJ6B 3CENA 2UUYA 1O2PA 3D62A 2BD5A 1KDQB 1GBHA 3ELAH 4YESB 1G3DA 3SZNA 2ESTE 1S83A 3ZZDA 3L6PA 1CT2E 4Q2KA 2GKVE 1AVGH 1WBGB 2STAE 2PKAB 5F8XA 1ZOMA 3ZVDA 2A31A 1FY8E 2VB0A 3U98H 1LPZB 2Z9IA 4HZHA 2Z3CA 4B76A 3PMJA 2ZDVH 2WV5A 4OS5A 1ELTA 3K6ZA 4KTSA 2C90B 4RSPA 2OXSA 4K1SA 1QURH 2BQ7B 4BTIB 3UR9A 4XSKU 3K65B 1MUEB 1AB9B 1N8OB 3TH4H 4CBNA 1XUKA 2XC4A 3TK9A 4D9RA 3A7XA 1EOLA 4I33A 3SUFA 1HAOH 1G3EA 5GXPA 2A7CA 2BY8X 1WQVH 1DS2E 1W14U 4JMYA 2ZHDA 3ZVFA 2H5DA 1IQIA 1GDQA 5J4SA 2A5AA 1SFQB 2BDHA 1SLVB 1GJ6A 4D8NA 2GCTB 1TBZH 2OC8A 2OQUA 2VIVA 3M5LA 1K2I1 5EGMA 1GHYH 1GI0A 2ZCKP 1C2LA 2GCHF 4ZROA 2FDAA 1ELBA 4BTUB 1KLIH 1C5TA 1O2YA 2ZPSA 2PTCE 3HGPA 2ZG0H 4I8JA 2I6QA 2FS9A 1O3LA 1F92A 3MWIU 2OC1A 2ZHEH 1MKWH 5ESTE 3RXBA 2F9UA 4WH6A 3L33A 1XXFA 3RXQA 2ZDMA 3A86A 3MH6A 1LCYA 5AF9H 1VGCB 3M3VA 1DT2A 1A3BH 3OY5U 1AVXA 1KLTA 5A8ZA 1A46H 1FY4A 1KXBA 1ESAA 3FVFB 1ZJDA 3PLBA 1V6DA 3SV6A 2NU3E 1EZXC 3ATIA 4MNWA 1CHOF 3UFAA 3D65E 4KP0A 1MTWA 1GJAB 4X6PA 3ZZ5A 3LC3A 3V12A 1ZMJA 8GCHF 1HV7A 2RG3A 2VVVA 4Y10E 1O2IA 1KY9A 2PSXA 4JZDH 1RIWC 1IHSH 2J38A 2AMDA 2R9PA 3SU4A 4DIIH 1TBQH 3RXUA 1GCDA 3SGAE 3GY2A 4D7GA 1BHXF 6GCHG 1QQ4A 1KTTB 1TPSA 4NIXA 1T8LA 1GI3A 1A0JA 3LKWA 1H1BA 3AAUA 3U9AH 1O3CA 1BMAA 2ZDNA 4IN1A 2IOTA 4AORA 2WPJS 1FMGA 4X6NA 3BTGE 3S0NA 1O38A 1SGNE 1K1NA 4IBLH 1C2MA 1UJ1A 4Q80A 1T4VH 4B2BA 1O36A 1EZQA 1P2QA 3OYPA 3GY4A 3S7KB 3LGYA 5I46H 2TGDA 2OLGA 4LZ1H 1OWDA 1EZSC 1HAPH 1B7XB 1BUIA 5AFYH 4DW2U 2ZU1A 2D1JA 4ZKRU 4Y8YA 1O2SA 1Z71A 1TNIA 2BD4A 3LJOA 1SFIA 1SGIB 4JYUH 4BAQB 1O3MA 1T32A 1YPHC 3SNAA 3SNDA 1O2VA 3H5CB 1EZUC 1GBDA 2A2XH 1ELEE 1GBAA 1GMCG 3ESTA 2VINA 3U1IB 1CSOE 1O0DH 2GZ7A 3FANA 4DCDA 1QFKH 4B75A 3ODDA 2GV7A 4UFEH 3V0XA 4XDEA 4ABHA 1MCTA 1FONA 2XWBI 3LIWA 4X8SH 5L6NH 4HTCH 3UQVA 1GI6A 3JZ2B 1D3QB 2OQ5A 3V13A 1SOTA 2OCVB 3T28A 1BJUA 1C1QA 1LVOA 2G8TA 1RFNA 2B5TB 1OWHA 2Y6TA 1L0ZA 2D26C 3HPTB 1AN1E 1O2HA 2BY9X 1GI9B 2UUFB 1EAIA 3QDZB 3S7HB 1EX3A 2H9HA 1MTNC 3A8BA 3BTEE 3STIA 2F9VA 2ZQ2A 2ZFPH 2K1QA 1BZXE 1C5SA 4X8UH 2UWPA 4I8GA 1ZJKA 2GMTB 1AZZA 1GDNA 1GJ9B 1GBCA 1OPHB 3O8DA 5K0HA 4RN6A 1QB1A 1VITF 1C9TA 5E0JA 3PROA 1QIXB 4ISHH 3EQ0H 1ETRH 2J92A 2FOAA 2ZP0H 2OBQA 1YPEH 2LNCA 2G51A 1O2XA 1O2TA 1GMHF 1V2MT 4F4OC 1RXPA 3FAOA 2ZU4A 4MPXA 5A09A 3ZVBA 1GHVH 2A4GA 1HB0B 1EAUA 4B73A 1XKAC 2NU2E 2OTVA 2A7HA 4KGAA 2J2UA 1DM4B 2A5IA 3SN8A 3SHCH 3P8FA 1HFDA 2BY5X 1OKXA 3P17H 1Y3UA 5A8XA 1FAKH 1EUFA 1SC8U 2QA9E 2P3UB 4HGCA 1IOEA 1SQOA 4TWWA 1EAXA 1DWEH 3KEEA 4O3UA 4ABFA 1QA0A 5J4QA 1MCVA 1PFXC 2BOKA 2CXVA 1V3XA 3GY8A 1TQ0B 4UEHH 3IG6B 1SGPE 1AFQB 5C5NA 2EA3A 2GDEH 3A82A 1O2WA 3SNEA 1ZPBA 4JK5A 1DWDH 2BQWB 3SJKA 1C1RA 1N1LA 3NUMA 2GZ9A 1TMBH 2W26A 1YM0A 4RKJB 1NFWA 1VR1H 3P8GA 3ZV9A 4B2CA 1DX5M 5EXLA 1MQ6A 1ZR0A 4NSVA 3N7OA 1HJAB 3S9BA 1GGDB 5LH8A 2ODQA 1GHAG 1QNJA 4MTBA 1AWHB 3QO6A 2ZECA 4X1PU 1DY8A 1Z8IB 1EASA 3DD2H 1LHEH 1GHBG 4X1NU 5T6GA 1IHTH 5C5OA 1TAWA 1ZMLA 3SI4H 1QRWA 1NU9A 5A0CA 1MTVA 1OWJA 4A92A 1T8OA 3O8RA 3CS7A 1UCYE 3D23A 1OP2A 3SU2A 2CHAC 1C9PA 1RS0A 2VIPA 1O34A 3LC5A 5GPIB 2QF3A 1LHFH 3MMGA 3GDSA 6LPRA 3DUXH 1KXCA 4Y7BA 3LGTA 1AO5A 2BDYA 3C27B 3LH3A 4O3TA 1E36B 2G00A 2YOLA 3PMHB 1T8NA 1GHXH 2A1DB 2EI6A 4WJG2 1O5AB 2NWNA 1MKXH 4UFGH 2WV4A 1IAUA 3B23B 1HXEH 4H6SB 1SGEE 1QTFA 1TWXB 2ZCHP 2C8WB 3BTKE 5T3HA 4NZQA 4UONA 1GG6C 3BIUH 4JZ1A 1DXPA 3URCA 4LXBH 1DANH 1TPAE 3QWCH 4INLA 3GY7A 1W0ZU 3P8OA 2CF9H 4AG1A 1UK4A 1CA8B 1BTPA 1A4WH 2G4TA 2OUAA 1AUJA 1HAHH 1Y3WA 1DOJA 1Y5BT 1SMFE 1P06A 1C4U2 5DP3A 3SNCA 3FP8E 1Y8TA 2PSYA 5A2MH 1SHYA 2STBE 1PPZA 5EG4A 3UWJH 1D9IA 5L30H 1P0SH 3NWUA 3T5FH 2G4UA 4AFZA 1XX9A 3MH4A 6GCHF 1CGJE 1S84A 1YPJH 1WV7H 4NFEA 4E7RG 2V0BA 2HWLB 2CN0H 2V3OH 4HI3A 3VXFH 3TH2H 4CHAC 1B0FA 3SU1A 1XUHA 1GJ7B 3PMAB 1RJXB 4YT6H 4Z0KA 1FI8A 1W13U 1P9SA 1OP0A 3HKJB 4X2WA 4MPUA 2A0QB 2Y7ZA 1ZSLA 2H1UA 1V2JT 5DP7A 4UDWH 2WYGA 1V2LT 5DJ7A 5DP8A 1ZHRA 2SGDE 1G37A 1BTHH 1ARBA 4BAMB 4J1YA 5H4IB 1SGFG 1YPGH 1GDUA 3TIUA 2FO9A 1CA0B 3SU0A 2FPZA 1ZHMA 4Q7YA 2XNIA 3R0FA 1LPKB 1UO6A 2AGEX 2FMJA 1UK3A 1KXFA 3FZDA 1W0YH 3PV4A 3V7TA 3VXEH 1HCGA 1O3EA 7KMEH 1AE8H 1JOUB 5EOKA 1O32A 1PYTD 1GMCF 2ODYB 4YM9A 4I7YH 3UOPA 3M5NA 1CU1A 1YPKH 4IMZA 2V3HH 3E0PB 2ZDLA 1XVOA 2XWAA 5JYIA 4A1VA 5A8YA 1OWIA 1TE0A 2SGAA 1UTPA 1Q2WA 1G32B 1AMHA 1IQGA 1SGTA 1PJPA 1P01A 1K1PA 1C1PA 5E0HA 3AAVA 3O8BA 1PQAA 3LGIA 1UVSH 1V2PT 4ZKSU 3RXJA 3SUGA 2C8ZB 2FOFA 3MYWA 3QTOH 3RXTA 3ZVEA 3OU0A 1K9OE 3E90B 4IC6A 4UE7H 1PYTC 1BOQA 3P70B 2ZGHA 1A0LA 4MLFB 1CQQA 5HM2A 4TPYA 2P59A 3SU3A 1O39A 1TNLA 3E6PH 3MNSA 1FY3A 2FYRA 4YZUA 2CJIA 2ZTZA 4TPIZ 2P8OB 4ZHMU 4D9QA 2JH6D 1W11U 1Z7KA 1C1TA 1NESE 1TOMH 4F49A 1MMJN 5DGJA 4J2YB 3SU6A 1V2TT 3ZVGA 1GBBA 3GCTF 3A88A 3K2UA 2DUCA 1UTJA 1O3BA 1TLDA 1O3FA 2H9TH 1AKSB 3OX7U 1A5IA 3E1XB 3CS0A 1BT7A 1UTNA 5TJXA 1GHWH 1J15A 3ITIA 2RDLA 1JIRA 1MU8B 2ZA5A 4GHQA 1KDQA 4ABGA 1NFUA 2IN2A 1HAIH 2R0KA 2WPIS 1NS3A 5F6MA 2FOHA 2PKAA 4BANB 3IWMA 1TALA 2BD2A 4WMEA 1XUGA 3RXMA 1BDAA 4DURA 1BMLA 1GI7B 1IQHA 2PW8H 1A1RA 1HAGE 1MBMA 1TRMA 3RDZA 2ZTYA 2XBXA 1RRKA 3PO1B 1P05A 1L1NA 2BB4A 1QRZA 1K1JA 3FP7E 2GVFA 1HPGA 1K1OA 1BMMH 1Z8JB 1XUJA 1C2IA 5PTPA 6CHAB 1UTQA 2BZ6H 3LGUA 1AQ7A 1CGHA 2SNVA 1QCPA 3KCGH 3OSYA 4IW4E 1OS8A 1YCPM 1DLKB 3U8OH 4BAHB 2OC0A 1FY1A 4GHTA 2ZIQH 3LT3A 1GHAF 1ZHPA 1K22H 5CE1A 5EODA 1GI1A 3RXDA 4DOQA 1ZYOA 5GDSH 4BXWA 4E06H 3E3TA 1GHBF 1SPJA 4Y11E 1NROH 2BLWA 4TY7A 3BV9B 3RC5A 3PTBA 2ANMH 3SGQE 3SUDA 1GCTB 1ZRBA 1W10U 1C1OA 2SGFE 3UNQA 4ZHAA 2ZDAH 3HK3B 1DPOA 2O8UA 1T4UH 1V2KT 3M3TA 3ZZAA 5E0GA 1P03A 5FX5A 5EQRA 4A7IB 1D3DB 3RXSA 1C2FA 1O3DA 5DP5A 1C5WB 1HJ8A 4X1QU 1PPFE 1C5OH 3VGCC 2ZI2H 4IMQA 2JH0D 3RP2A 2VNTA 3ZZ7A 4CBOA 1THRH 1MBQA 3PLPA 1K1LA 4KELA 4NIWA 7GCHG 1SGFA 5GJ4B 1TX6A 3I77A 1AHTH 2F3CE 5EXNA 2Y5GA 4AFQA 1NRRH 2XCFA 1TQ7B 4GPGA 1RD3B 2Z9JA 5I25A 3ATMA 1DSTA 1EKBB 4RKOB 1MTSA 1PPCE 1NRNH 1ANDA 1ANEA 3E91A 3P8NA 4K5ZA 1A7SA 4GLYA 1JXPA 3TLOA 1JRTA 3A7TA 1D3PB 4DG4A 4MVNA 2AERH 1O37A 2VGCB 2RCEA 3BTHE 2G5NA 2BXUH 1BJVA 1V2VT 1ABIH 1BB0B 1YYY1 1TIOA 5DP4A 1GMDG 1CHGA 5JPMH 4OS2A 3EYDA 4DT7B 2D8WA 2PUXB 1QB9A 1GI4A 4JZEH 1O5FH 2ZC9H 1ZTKA 1LTOA 1GHZA 3VB7A 2ZFQH 1VCPA 1K1IA 3SV2H 8LPRA 1KLJH 4K3JA 3P92A 3BG4C 4XOJA 1FJSA 1P2KA 1SVPA 2XCNA 3S9AA 2GV6A 4M7GA 2W7SA 4JK6A 1G3BA 1M9UA 3AASA 1QR3E 3BTME 3DHKH 5C1XA 1S85A 2VIOA 6ESTA 2ZPRA 3SJ8A 2Z7FE 3A8CA 4FXGH 3F1SB 4VGCB 5EW2H 2VWLA 4XBDA 3M7QA 4Y79A 2JETB 2PKSB 2ZZUH 3SJOA 5IDKA 1PPHE 2Q1JA 1NTPA 4FVBA 1LHGH 5F8ZA 2TBSA 1BIOA 5FCRA 3SV7A 4WY3A 3RXIA 3UOUA 3ZZBA 1F2SE 1DE7H 1TFXA 3BEFB 3F9HA 3QZRA 5TCCA 2BX4A 2QXHA 2YNBA 3KN2A 2ZCLP 1O2ZA 2P3TB 5LPEA 4AZ2B 2GD4B 1CE5A 2O8TA 1IQJA 3BEIB 4FUEA 3NK8A 2BX3A 1MD8A 2WPLS 1AZ8A 2G55A 3KQDA 1NY22 1P2JA 2AMQA 1MZDA 3ZZ4A 4AB8A 2ZGXH 1AY6H 1BRCE 1EAWA 2Z3EA 4WH8A 5L2YH 1HIAA 2UUKB 5FPSA 3A7WA 4MNYA 1LHDH 3GICB 1GBFA 4NIYA 5HYOA 1C5NH 3VB5A 1CT0E 3GDVA 1UHBA 2PLXA 2B8OH 2BDCA 3ZVCA 3F9FA 4NA9H 4ZKNU 3H7TA 1QA7A 1DFPA 5TCAA 4XBCA 1HAYB 2Z9LA 1YKTA 4NSYA 1G2MA 4CRGA 1TGBA 2WPKS 4ISNA 3PMBB 1AVWA 3T26A 1C5LH 1DSUA 1HIAB 1YLDA 3TU7H 2LPRA 2VJ1A 1NM6A 2ANWA 3I78A 4R8TB 4MNXA 2ANKH 1CBWC 1L1GA 1HNEE 1O2OA 1DITH 1WAYB 1O5DH 1UHBB 5DP6A 1Y59T 1ETTH 1VZQH 5L2ZH 1BTYA 4YOGA 1QL9A 3A89A 3F9GA 3MOCA 2VVUA 3OY6U 1LQDB 1AIXH 5A0BA 1AD8H 4X6OA 4NCYA 1NC6A 2BDIA 3KNXA 3EA9A 2W5EA 1HAXB 1EPTC 3E16B 2BVXH 4K60A 1O2LA 3T29A 3BIVH 1EB1H 2ODPA 1DXWA 4AGKA 3UNRA 1P9UA 2J34A 2ZDKA 5FBIA 1GBLA 1GJCB 3C1KA 1BA8B 3RXVA 2PV9B 3PWCA 1ELDE 3T27A 4XBBA 3VB6A 1T31A 3BG8A 1BBRH 2OP9A 3FFGA 9LPRA 1P2IA 4WVPE 1CA0C 4H4FA 4O97A 4X1RU 3PB1E 1CO7E 2WINI 4ZAEA 2DE9A 5E2PA 2BVSH 1C2GA 1YGCH 2VIQA 3SW2B 5JDUB 4Y8ZA 1BBRK 3ZV8A 2PTNA 2P94A 1GBJA 4R0IA 1LO6A 3M7UA 1SL3A 1P2NA 1ZTJA 5FPTA 3HATH 3BEUA 3BTDE 3O8CA 2HVXA 1Z6JH 1O35A 1VCQA 1V2UT 2XC5A 2HALA 4Y6DA 1UTMA 4Y76A 5DKMA 2G81E 1XMNB 1QHRB 2AH4X 3LOXA 1C2HA 1H8IH 3U8RH 2ASUB 1SLUB 2PGQB 2O8LA 2A2QH 4Q7XA 5CHAC 2TGTA 4FVDA 5FXLA 4DVAU 4MNVA 2QYIA 3RUOA 4E7NA
chains in the Genus database with same CATH superfamily
3RMMH 4E05H 1SGDE 3MHWU 1FNIA 1RIWB 2FM2A 3SNBA 4AFUA 1TMUH 1LVYA 2TPIZ 1C5VA 4MDSA 2O9QA 1TOCB 2PFEA 1GVZA 2SFAA 4YOJA 1TONA 2OC7A 3U69H 1TABE 2IJOB 4CRDA 2HNTF 2ZO3H 1QL8A 4I8KA 2XNDD 2HGTH 3SO3A 5DPAA 3VB4A 4X8VH 4JCNA 2JDID 3SU5A 1S81A 1S5SA 2XW9A 4U2WA 2RDEA 4FUBA 1G9IE 2FI3E 1WTHD 1AU8A 2OBOA 1RTFB 4X1SU 1NU7B 2ZHWH 1O3OA 3NKKA 4AYYB 2FX4A 2H5CA 1ZGIA 7GCHF 1NFYA 1J8AA 8ESTE 1C1SA 1VJ9U 2F9NA 1GVLA 4X2VA 2V3MA 3DFLA 3I29A 1QJ1B 4FUFA 1O3AA 3MQKC 1ACBE 3NCLA 4I31A 1UVOA 3MTYA 4UD9H 1OYQA 4ZH8A 4CH8B 2XBWA 4ISOA 3RXAA 1O2MA 1KXDA 2Q6DA 1BCUH 3M36A 1ZSJA 3SJ9A 1XKBC 2JH5D 3MO9A 2ZHQH 1YP9A 1ZRKA 2CF8H 3MU5A 4FUJA 2Q6FA 3TGIE 3F9EA 1C5PA 4K1EA 3OEED 1C5QA 1GMDF 4B71A 1OP8A 3GCHC 5GCHG 1HXFH 1IQFA 1GL1A 5AVDA 1OX1A 4IC5A 1GJ8B 5DK1A 1J9CH 3SJIA 2EI8A 4D76A 1EB2A 4NGAH 1E37B 2C8YB 1F0TA 1HUTH 1Y3VA 1YC0A 2HRVA 1C4V2 2FXRA 1CGIE 1MTNB 2QC2A 3GY6A 4FUIA 1Y5UT 5F03A 1SLWB 2ZFRH 2VWMA 2G5VA 3TJUA 3RM2H 1LVBA 4FU7A 4X0WU 5FPYA 1GI2A 4DGJA 1O3PB 3RXHA 1JBUH 3QK1A 1VCWA 2VH6A 1YPLH 1C1NA 5B6OA 4BAKB 2G52A 1NZQH 3TH3H 4ZXXH 1SG8B 5JB9S 1Q3XA 5AHGH 1CHOG 4OGXA 3N99A 3UREA 2J4IA 2FOMB 4Q7ZA 5G4BA 3SV8A 2W3KA 3GCNA 3VEQB 2R2WU 1G36A 8GCHG 5LPFA 3U1JB 3W1EA 4JYVH 1AB9C 1N8OC 1ELAA 1EJNA 5HIYA 4BOHA 1QJ7B 4GAWA 3SV9A 3AW0A 4WXIA 5HXFA 1HBTH 1YLCA 1YY3A 4TY6A 1HGTH 3CP7A 3M61U 1C5RA 4JZFH 2XBYA 1YLNA 4WMFA 2QN5T 4BXSA 1C2KA 1ZMNA 2GCTC 4FU9A 1BTZA 1W8BH 2TGAA 3DA9B 3MNBA 4B1TA 5DG6A 1L1JA 1OSSA 1TPPA 2P93A 7LPRA 2BM2A 2JIZD 1J16A 4Y0YE 1LKAA 2FZZA 2VIDA 1A61H 1P8VC 2GP9B 2PUQH 4K8YA 4OS7A 2ILNA 2KZ4A 1EJMA 1O3HA 2AYWA 5FX6A 2TIOA 1PPEE 1A5GH 1TNHA 1LVMA 3WY8A 4H6TA 2FP7B 2AMPA 1D6WA 2ZNKH 5C1YA 5T6DA 4ISLA 1D6RA 3G01A 2LELA 1SI5H 1Z8RA 2C4FH 1PQ7A 3UB0A 5JBTA 2W7UA 3SOSA 1VGCC 2J98A 4KTUA 5JBBS 2D2DA 1DVAH 2YNAA 3SI3H 3A80A 1AKSA 2WPMS 3SORA 2QXIA 2FI5E 2BDGA 1FDPA 3GY5A 3GY3A 1EP5A 1S6LA 3VB3A 1NFXA 1HAZB 3RXFA 3UPEA 4AG2A 4GVUA 1FN6A 1WU1A 3Q76A 1TBRH 3UWIA 2VWOA 1AWFH 1MZAA 1EP6A 2FX6A 3T2NA 1H8DH 1BRAA 1L2EA 1RTLA 4WXVA 1ZTLA 4AFSA 3GDUA 2XTTB 1W3CA 1SGQE 3H7OA 2PP6A 2PHBA 1ANCA 3EE0B 1H4WA 2XC0A 4ASHA 2R3UA 4HG6A 3OTJE 1SQTA 1B0EA 4CRCA 3W94A 2AEIH 1IQNA 1P3CA 4A6LA 2O8WA 2Y5HA 3KF2A 2XBVA 2CHAB 3ODFA 1O5CB 4ESTE 1DWCH 4X2YA 3SUEA 3OAAD 2Y81A 1WTGH 1NO9H 2JKHA 1OXGA 1TYNA 2VIWA 2KFWA 1LKBA 3E8LA 4ABAA 1FIZA 1GMHG 4I8LA 1C5ZB 2XRCA 3A84A 3LPRA 1J17T 2QXGA 3BTWE 2BY6X 5DP9A 5C0UA 5DN6D 1GG6B 3QZQA 1L4ZA 3Q00A 2ZWLH 2ZF0H 2THFB 2JJ1D 2Z9GA 2SGEE 3NZIA 2RA0A 3BSQA 2WUBA 4BNRA 1IQEA 2PR3A 2Y82A 3PWBA 3KGPA 3RXPA 2YMSC 3LDXH 1DICA 3RC4A 1P3EA 1SHHB 4MG3A 4MPWA 1W12U 1C4Y2 1ZLRA 1GVKB 4CRBA 3DSPA 2SNWA 4P02A 2BDAA 2BOHB 1SGCA 2P16A 2BTCE 4THNH 1D3TB 3TK6A 5LGOA 4O03A 2OD3B 3ZZ3A 3QGJA 9ESTA 1QBVH 2GT8A 3M3SA 7ESTE 4K8BA 1IQLA 5EQSA 2EEKA 3OTPA 8KME2 1U6QA 1MH0A 2FLRH 4CHAB 2BLVA 5CDFE 1SGYE 4INKA 3ZZCA 1GBTA 4CRAA 1E0FD 2BZAA 1GI8B 1V2RT 3DFJA 2BXTH 1TA2A 4UFDH 2F9BH 1EJAA 2GMTC 2FODA 2NU1E 3TNSA 3EA8A 4U32A 2WSSD 1TMTH 2V35A 1QY6A 1UTKA 3SQHE 4B74A 2BQ6B 3ZYEA 3CNRA 3LGVA 4TWYA 4ABBA 2KAIA 4AX9H 3A83A 1G2LA 3ENSB 1ESBA 3SQEE 1MU6B 3GYMA 1F5LA 3M5MA 2ALPA 3GYLB 1TGTA 5JBAS 2VU8E 1C5MD 4WF8A 1W7GH 1MABB 2QV1A 2VVCA 4YO9A 1C2EA 1SOZA 2FOBA 2RA3A 2ZGCA 1ZPCA 4X8TH 2A32A 4X6MA 1TRNA 2ZU2A 1C5XB 2AGIX 3A7VA 1X7AC 2QE7D 5F53A 1H8ED 1QGFA 4F55A 4NIVA 1YBWA 2DE8A 3K6YA 1O5EH 2KAIB 4Y71A 5E8EH 4ZKOU 2AFQB 1WYKA 3MO6A 2QIQA 5GCHF 2PGBB 5AFZH 1UMAH 2GZ8A 4ABJA 2PWXA 2W3IA 3KQBA 2Z9KA 1IQMA 1WSSH 4CREA 4B6EA 1RTKA 1GJDB 4CH2B 1BHXB 2BMGB 1PQ8A 5FCKA 1HYLA 2ZU3A 1TX8A 2HNTC 1MKWK 4AB9A 4GCHG 1AFQC 1O3KA 5FBEA 4UFFH 3IITA 3F6UH 4WMDA 2HNTE 2FWWA 1ELGA 1AUTC 3N7DA 3TITA 1OOKB 2XXLA 2EC9H 1UVUH 2R3YA 4FUHA 4HFPB 1ELCA 1AGJA 4ZMAH 1DUAA 1ZZZA 3AVZA 3HGNA 2K8IA 3TVJB 2HPPH 1S6HA 1HJAC 4INHA 4IS5A 1EQ9A 4XD7D 4PROA 4A1TA 1F0UA 1GGDC 1Z1JA 2ULLA 1TGNA 4SGBE 4ACAA 1T8MA 3TGKE 1E38B 3BN9A 3EDXB 2R0LA 3ZYDA 2P3FH 1UVPA 2C8XB 2BLQA 1O5BB 2BLOA 1FZZA 1E79D 3LH1A 1DUEA 2A7JA 1S0QA 3NXPA 5A0AE 1DWBH 4CR9A 2M5TA 1JMOH 2BY7X 2IJD1 3A8AA 1P2MA 1COWD 1E1QD 5E2OA 3MO3A 3WWBA 4Z6AH 1TB6H 2Y80A 4U01A 5C3NA 1PPGE 1DDJA 2B9LA 1GWAA 4ZUHA 3EGKH 1ZSKA 2UUJB 1MTUA 1WUNH 3MNCA 3QUMP 3K9XB 2AS9A 2ALVA 1QBOA 4AGJA 3U8TH 1Q31A 3HKIB 1S6FA 3PLKA 1A3EH 2AGGX 3SBKA 3UTUH 4ZHLU 2AIPA 4GSOA 1SQRA 1UCYH 3AW1A 3GS9A 2CV3A 4D7FA 1QQUA 1VJAU 4K1TA 3F68H 1OWEA 3NRLA 1YPHE 2WUCA 1Y3YA 3B8JA 3FP6E 3PYHA 1RGQA 2ZPQA 1LHCH 3DT0H 4KTCA 2KCAA 1O31A 1FPCH 2QXJA 1UCYK 3RXRA 2BYAX 4MPVA 3BTQE 4JZIA 4CR5A 3SHAH 5FHTA 1SB1H 4FUCA 2TGPZ 2WPHS 5IYTA 2NU0E 2QGRA 2H2ZA 3A8DA 2HOBA 3UNSA 3A7ZA 3SGBE 1A0HB 1ELFA 3RXLA 3A87A 3T25A 4H42U 1ABJH 1TA6A 1TNGA 3F2FA 1W7XH 2Q6GA 2OINA 2ZU5A 1V2WT 1FV9A 3QGNB 1Z6EA 1AFEH 1UTOA 1FLEE 1P12E 1V2QT 1MD7A 5ESBA 1O2GH 1DLEA 2CGAA 3Q3YA 4YTAA 1CT4E 1P04A 1YWUA 3P6ZB 1FN8A 3A85A 1GL0E 4A5TS 2WPDD 2F83A 4AOQA 5ETXA 4IGDA 1TNJA 5JBCS 3VGCB 1P02A 1OYTH 3Q3KA 3GCTG 1GBKA 1ELVA 2C3SA 1C1VH 4CRFA 1K1MA 2ANYA 2NU4E 3KIDU 3MNXA 1HJ9A 2EI7A 1K21H 2ZTXA 1QL7A 2BDBA 3NPSA 1ARCA 2BD7A 3UUZA 4K69A 1FXYA 1IQKA 1V2NT 3ZZ8A 5GWZA 1P2OA 2ZFFH 4O9VA 5EU8A 3RXEA 3EAJA 1H9HE 1C5UA 5DSFA 2B0FA 5LPRA 3QTVH 1WOFA 1FAXA 1HDTH 2FOEA 3Q77A 1KXEA 2FYQA 4RI0A 5HMAA 1G30B 1C1MA 1C2JA 2ZKSA 3D49H 1GBEA 1O2UA 1P10A 3WWFA 3L3TA 1NRSH 1O33A 1TGCA 1F7ZA 1YCPH 1O2QA 4FUGA 1E34B 4JYTA 2WZQA 3V3MA 2GT7A 1GI5A 2UWLA 4OS4A 2CMYA 5F8TA 3ATKA 5B6LA 1QB6A 3BG4B 4NA8A 1MAXA 4ZXYH 1YCPK 1P09A 2VBCA 4BAOB 4ABEA 2RFKC 5C67A 4M9FA 1B5GH 1D4PB 5T6FA 1JRSA 1S82A 4K2YA 1GJBB 1K28D 1F5RA 1KMHB 3N7EA 3RMLH 2P8OC 2BD9A 3TJVA 4YLQH 3RLWH 4WWYA 5DO4H 2QF0A 4I32A 3M37A 2XYAA 1HLTH 1O5GH 1KYNA 3R3GB 1TX7A 4I8HA 1SQAA 3RXCA 4DY7B 1MAYA 2FOGA 2QCYA 2P95A 4NA7A 4NG9H 4OS6A 5EXMA 3S9CA 3RXGA 1QRXA 1XUFA 1UK2A 2A45B 1J14A 1KSNA 1O3IA 3ZZ9A 2F9OA 3EA7A 1G3CA 1O3GA 3M7TA 3GOVB 3RXOA 1KXAA 1BQYA 3S69A 1BRBE 1AI8H 4Y0ZE 5EQQA 2ZGJA 1BRUP 4XE4A 3A7YA 3RU4D 5SGAE 4NWKA 3QN7A 5BRRE 1GJ4H 3E0NB 2HPQH 2GTBA 5C17A 4TYDA 2FLBH 4LOYH 3RMNH 3BF6H 2J95A 3P95A 3TJOA 1MQ5A 1JIMA 1O30A 1S0RA 3FZZA 3KQ5A 2GCHG 5HGGA 4DJZB 1INCA 4DIHH 3UY9A 3PTNA 3RC6A 2ZQ1A 5C20A 5EPNA 1DY9A 1GJ5H 3PO1C 2Y7XA 3KQEA 5HM9A 3LGWA 4Y7AA 3MU0A 1HAVA 2VH0A 3RMOH 1MKXK 4Y8XA 4AN7A 4GCHF 3URDA 1WQSA 1GBIA 3B9FH 1PPBH 1NT1A 1WCZA 4FUDA 1F0SA 6CHAC 1UTLM 1Y5AT 2Z94A 1KIGH 1JWTA 3RU4E 3RXKA 3GCOA 1SR5C 2EQNA 3M35A 1TPOA 1EPTA 1NRPH 1XVMA 2QAAA 2GDDA 4NWLA 1XXDA 5C2ZA 1GBMA 2H9EH 1ZPZA 5K7RA 4NZLA 1CBWB 2ZEBA 3MH7A 4YT7H 1TNKA 1HAVB 3GISB 1SBWA 2B7DH 3RU4T 1BBRE 1THSH 4LK4A 1SSXA 3LONA 4NFFA 3F2GA 3RM0H 1UVTH 1QBNA 1BTXA 1CVWH 2K0QA 4ISIH 3MFJA 1C1UH 1P57B 2W6JD 2TRMA 1GCTC 1GPZA 3QLPH 2J9NA 3KQCA 3FOAA 1O3NA 3PV5A 2Y5FA 3QX5H 1EPTB 2F91A 1ESTA 1TGSZ 1KTSB 1L4DA 2IPHA 2V6NA 1O2KA 2GX4A 3ATLA 1ANBA 4XFQA 3BTFE 1A5HA 1YPMH 1VITH 2A5KA 1HRTH 2ZGBH 4OS1A 3TNTA 2AIQA 1O2RA 4A1XA 5EW1H 1BTWA 4FU8A 2I6SA 4AYVB 1V2OT 1NN6A 1V2ST 2BD8A 1LPGB 1THPB 3ATWA 1EATA 2Z6BD 1O3JA 2FEQH 2H6MA 1Z1IA 1Y3XA 4TT3D 1EOJA 2FS8A 3EE7A 3MI4A 4QT8C 5KEDA 5JB8S 1UW7A 4SGAE 1H8HD 2Z3DA 1N6YA 1FIWA 5CMXH 1XM1A 3VPKA 1LMWB 3HK6B 1NRQH 5CHAB 1N6XA 3KL6A 2BHGA 2FIRH 3PRBA 2VGCC 2R2MB 3LJJA 1PQ5A 5EJZA 1H9IE 5EIYA 1E35B 1OWKA 3F0OA 2A4RA 2O8MA 1LQEA 4U30A 1ETSH 2WYJA 4MQAA 1SLXB 1H9LB 2VWNA 4GUXA 4KKDA 3BTTE 2FTLE 4OGYA 2BD3A 1TRYA 2A4OA 2FOCA 4YXWD 1T7CA 1AE5A 2J94A 5C1UA 1FUJA 3ZVAA 1F5KU 2FTMA 1C1WH 2ZHFH 1C5YB 2SGQE 3LU9B 4ABDA 2A4QA 3MU1A 2GGVB 1P11E 3OE7D 1ZGVA 5FAHA 4X2XA 1W2KH 4VGCC 2JETC 2PKSC 3MU8A 1VITG 2BVRH 3A81A 2SGPE 1EXFA 3KYFA 4LZ4B 1NPMA 3UQOA 1ID5H 3MH5A 2FI4E 3PM3A 4BTTB 2ZFSA 3STJA 5ABWA 3ZZ6A 1C2DA 2UWOA 2F9PA 4YLUA 5EPYA 1SGRE 1O2NA 1BTUA 3TJNA 1O2JA 5GIBA 4ABIA 4B2AA 3W95A 2ZFTA 3UIRA 1Z8GA 5BPEA 3RLYH 1ORFA 3M5OA 3JZ1B 3T62A 1BITA 1BMNH 1LDTT 1FPHH 1XUIA 2FESH 3TPIZ 3UR6A 3Q3XA 3KHVA 3TGJE 3MU4A 2QY0B 1F0RA 4IN2A 2HLCA 3VFEA 1FQ3A 1FY5A 3TK5A 4YOIA 2C93B 3GCHB 1A2CH 1YF4A 1QJ6B 3CENA 2UUYA 1O2PA 3D62A 2BD5A 1KDQB 1GBHA 3ELAH 4YESB 1G3DA 2JJ2D 3SZNA 2ESTE 1S83A 3ZZDA 3L6PA 1CT2E 4Q2KA 2GKVE 1AVGH 1WBGB 2STAE 2PKAB 5F8XA 1ZOMA 3ZVDA 2A31A 1FY8E 5C0TA 2VB0A 3U98H 1LPZB 2Z9IA 3FKSD 4HZHA 2Z3CA 4B76A 3PMJA 2ZDVH 2WV5A 4OS5A 1ELTA 3K6ZA 4KTSA 2C90B 4RSPA 2OXSA 4K1SA 1QURH 2BQ7B 4BTIB 3UR9A 4XSKU 3SZEA 3K65B 1MUEB 1AB9B 1N8OB 3TH4H 4CBNA 1XUKA 2XC4A 3TK9A 4D9RA 2KCYA 3A7XA 1EOLA 4I33A 3SUFA 1HAOH 1G3EA 5GXPA 2A7CA 2BY8X 1WQVH 1DS2E 1W14U 4JMYA 2ZHDA 3ZVFA 4ZCNA 2H5DA 1IQIA 1GDQA 5J4SA 2A5AA 1SFQB 2BDHA 1SLVB 1GJ6A 4D8NA 2GCTB 1TBZH 2OC8A 2OQUA 2VIVA 3M5LA 1K2I1 5EGMA 1GHYH 3U28C 1GI0A 2ZCKP 1SKYE 1C2LA 2GCHF 4ZROA 2FDAA 5KECA 1ELBA 4BTUB 1KLIH 1C5TA 1O2YA 4Z1MD 2ZPSA 2PTCE 2M2AA 3HGPA 2ZG0H 4I8JA 2I6QA 2FS9A 1O3LA 1F92A 3MWIU 2OC1A 2ZHEH 1MKWH 5ESTE 3RXBA 2F9UA 4WH6A 3L33A 1WDIA 1XXFA 3RXQA 2ZDMA 3A86A 3MH6A 1LCYA 5AF9H 1VGCB 3M3VA 1DT2A 4Q63A 1A3BH 3OY5U 1AVXA 3PRDA 1KLTA 5A8ZA 1A46H 5EJLA 1FY4A 1KXBA 1ESAA 3FVFB 1ZJDA 3PLBA 1V6DA 3SV6A 2NU3E 1EZXC 3ATIA 4MNWA 1CHOF 3UFAA 3D65E 4KP0A 1MTWA 1GJAB 4X6PA 3ZZ5A 3LC3A 3V12A 1ZMJA 8GCHF 5C94A 1HV7A 2RG3A 2WV9A 2VVVA 4RT1A 4Y10E 1O2IA 1KY9A 2PSXA 4JZDH 1RIWC 1IHSH 2J38A 2AMDA 2KCOA 2R9PA 3SU4A 4DIIH 1TBQH 3RXUA 1GCDA 3SGAE 3GY2A 4D7GA 3FO8D 1BHXF 6GCHG 1QQ4A 1KTTB 1TPSA 4NIXA 1T8LA 1GI3A 1A0JA 3LKWA 1H1BA 3AAUA 3U9AH 1O3CA 1BMAA 2ZDNA 4IN1A 2IOTA 4AORA 2WPJS 1FMGA 4X6NA 3BTGE 3S0NA 1O38A 1SGNE 1K1NA 4IBLH 1C2MA 1UJ1A 4Q80A 3DSGA 1T4VH 4B2BA 1O36A 1EZQA 1P2QA 3OYPA 3GY4A 3S7KB 3LGYA 3SYJA 5I46H 2TGDA 2OLGA 4LZ1H 2HVYB 1OWDA 1EZSC 1HAPH 1B7XB 1BUIA 5AFYH 2QF5A 4DW2U 2ZU1A 2D1JA 4ZKRU 4Y8YA 1O2SA 1Z71A 1TNIA 2BD4A 3LJOA 1SFIA 1WXRA 1SGIB 4JYUH 4BAQB 1O3MA 1T32A 1YPHC 3SNAA 3SNDA 1O2VA 3H5CB 1EZUC 1GBDA 2A2XH 1ELEE 1GBAA 1GMCG 3ESTA 2VINA 3U1IB 1CSOE 1O0DH 2GZ7A 3FANA 2YMSB 4DCDA 1QFKH 4B75A 3ODDA 2GV7A 4UFEH 3V0XA 4XDEA 4ABHA 1MCTA 1FONA 2F4LA 2XWBI 3LIWA 4X8SH 5L6NH 4HTCH 3UQVA 1GI6A 3JZ2B 1D3QB 2OQ5A 3V13A 1SOTA 2OCVB 3T28A 1BJUA 1C1QA 1LVOA 2G8TA 1RFNA 2B5TB 1OWHA 2Y6TA 1L0ZA 2D26C 3HPTB 1AN1E 1O2HA 2BY9X 1GI9B 2UUFB 1EAIA 3QDZB 3F0PA 3S7HB 1EX3A 2H9HA 1MTNC 3A8BA 3BTEE 3STIA 2F9VA 2ZQ2A 2ZFPH 2K1QA 5GNDA 1BZXE 1C5SA 4X8UH 2UWPA 4I8GA 1ZJKA 2GMTB 4ASUD 1AZZA 1GDNA 1GJ9B 1GBCA 1OPHB 3O8DA 5K0HA 4RN6A 1QB1A 1K0HA 1VITF 1C9TA 5E0JA 3PROA 1QIXB 4ISHH 3EQ0H 1ETRH 2J92A 2FOAA 2ZP0H 2OBQA 1YPEH 2LNCA 2G51A 1O2XA 1O2TA 1GMHF 1V2MT 4F4OC 1RXPA 3FAOA 2ZU4A 4MPXA 5IK2D 5A09A 3ZVBA 1GHVH 2A4GA 1HB0B 1EAUA 4B73A 1XKAC 2NU2E 2OTVA 2A7HA 4KGAA 2J2UA 1DM4B 2A5IA 3SN8A 3SHCH 3P8FA 1HFDA 2BY5X 1OKXA 3P17H 1Y3UA 5A8XA 1FAKH 1EUFA 1NBMD 1SC8U 2QA9E 2P3UB 2EY4C 1IOEA 4HGCA 1SQOA 4TWWA 1EAXA 1DWEH 3KEEA 4O3UA 4ABFA 1QA0A 5J4QA 1MCVA 1PFXC 2BOKA 2CXVA 1V3XA 3GY8A 1TQ0B 4UEHH 3IG6B 2GJGA 5KGOA 1SGPE 1AFQB 5C5NA 2EA3A 2GDEH 3A82A 1O2WA 3SNEA 1ZPBA 4JK5A 1DWDH 2BQWB 3SJKA 1C1RA 1N1LA 3NUMA 4P00A 2GZ9A 1TMBH 2W26A 1YM0A 4RKJB 1NFWA 1VR1H 3P8GA 3ZV9A 4B2CA 1NBME 1DX5M 5EXLA 1MQ6A 1ZR0A 4NSVA 3N7OA 1HJAB 3S9BA 1GGDB 5LH8A 2ODQA 1GHAG 1QNJA 4MTBA 1AWHB 3QO6A 2ZECA 4X1PU 1DY8A 1Z8IB 1EASA 3DD2H 1LHEH 1GHBG 4X1NU 3H09A 5T6GA 1IHTH 3F3BA 5C5OA 1TAWA 1ZMLA 3SI4H 1QRWA 1NU9A 5A0CA 1MTVA 1OWJA 4A92A 1T8OA 3O8RA 3CS7A 1UCYE 3D23A 1OP2A 3SU2A 2CHAC 1C9PA 1RS0A 2VIPA 1O34A 3LC5A 5GPIB 2QF3A 1LHFH 3MMGA 3GDSA 6LPRA 3DUXH 1KXCA 4Y7BA 1QZ8A 3LGTA 1AO5A 2BDYA 3C27B 3LH3A 4O3TA 1E36B 2G00A 2YOLA 3PMHB 2KM0A 3ZIAD 1T8NA 1GHXH 2A1DB 2EI6A 4WJG2 1O5AB 2NWNA 1MKXH 4UFGH 2WV4A 1IAUA 3B23B 1HXEH 4H6SB 1SGEE 1QTFA 1TWXB 2ZCHP 2C8WB 3BTKE 5T3HA 4NZQA 4UONA 1GG6C 3BIUH 4JZ1A 1DXPA 3URCA 4LXBH 1DANH 4I86A 1TPAE 3QWCH 4INLA 3GY7A 1W0ZU 3P8OA 2CF9H 4AG1A 1UK4A 1CA8B 1BTPA 1A4WH 2G4TA 1AUJA 1HAHH 1Y3WA 1Y5BT 1DOJA 2OUAA 1SMFE 1P06A 1C4U2 5DP3A 3SNCA 3FP8E 1Y8TA 2PSYA 5A2MH 1SHYA 2STBE 1PPZA 5EG4A 3UWJH 1D9IA 5L30H 1P0SH 3NWUA 3T5FH 2G4UA 4AFZA 1XX9A 3MH4A 6GCHF 1CGJE 1S84A 1YPJH 1WV7H 3PV2A 4NFEA 4E7RG 2V0BA 2HWLB 2CN0H 2V3OH 4HI3A 3VXFH 3TH2H 4CHAC 1B0FA 3SU1A 1XUHA 1GJ7B 3PMAB 1RJXB 4YT6H 4Q4LA 4Z0KA 1FI8A 1W13U 1P9SA 1OP0A 3HKJB 4X2WA 4MPUA 2A0QB 2Y7ZA 1ZSLA 2H1UA 1V2JT 5DP7A 4UDWH 2WYGA 1V2LT 5DJ7A 5DP8A 1VKYA 1ZHRA 2SGDE 1G37A 1BTHH 1ARBA 4FOUC 2IPQX 4BAMB 1W0JD 4J1YA 5H4IB 1SGFG 1YPGH 1GDUA 3TIUA 2FO9A 1CA0B 2QF4A 2FPZA 1ZHMA 4Q7YA 3SU0A 2XNIA 3R0FA 1LPKB 1UO6A 2AGEX 2FMJA 1UK3A 1KXFA 2KX4A 1W0YH 3FZDA 3PV4A 3V7TA 3VXEH 1HCGA 1O3EA 7KMEH 1AE8H 1JOUB 5EOKA 2CK3D 1O32A 1PYTD 1GMCF 2ODYB 4YM9A 4I7YH 2J5UA 3UOPA 3M5NA 1CU1A 1YPKH 4IMZA 2V3HH 3E0PB 2ZDLA 1XVOA 2XWAA 5JYIA 4A1VA 5A8YA 1OWIA 1TE0A 2HLDD 2SGAA 2LP6A 1UTPA 1Q2WA 1G32B 1AMHA 1IQGA 1SGTA 1PJPA 1P01A 1K1PA 1C1PA 5E0HA 3AAVA 3O8BA 1PQAA 3LGIA 1UVSH 1EFRD 1V2PT 4ZKSU 3RXJA 2C8ZB 2FOFA 3MYWA 3QTOH 3RXTA 3SUGA 3ZVEA 3OU0A 1K9OE 3E90B 4IC6A 4UE7H 1PYTC 1BOQA 3P70B 2ZGHA 1A0LA 4MLFB 1CQQA 3F2HA 5HM2A 3OEHD 4TPYA 2P59A 2V7QD 3SU3A 1O39A 1TNLA 3E6PH 3MNSA 1FY3A 2FYRA 4YZUA 2CJIA 2ZTZA 4TPIZ 2P8OB 4ZHMU 4D9QA 3UAIC 2JH6D 1W11U 1Z7KA 1C1TA 1NESE 1TOMH 4F49A 1MMJN 5DGJA 4J2YB 3SU6A 1V2TT 3ZVGA 5EJ1A 1GBBA 3GCTF 2J98B 3A88A 3K2UA 2DUCA 1UTJA 1O3BA 1TLDA 1O3FA 2F43B 2H9TH 1AKSB 3OX7U 1A5IA 3E1XB 3CS0A 1BT7A 1UTNA 5TJXA 1GHWH 1J15A 3ITIA 2RDLA 1JIRA 1MU8B 2ZA5A 4GHQA 1KDQA 4ABGA 1OHHD 1BMFD 1NFUA 2IN2A 1HAIH 2R0KA 2WPIS 1NS3A 2L74A 5F6MA 2FOHA 2PKAA 4BANB 3IWMA 1TALA 2BD2A 2YMSD 4WMEA 1XUGA 3RXMA 1BDAA 4DURA 1BMLA 1GI7B 1IQHA 2PW8H 1A1RA 1HAGE 1MBMA 2AHME 1TRMA 3RDZA 2ZTYA 2XBXA 1RRKA 3PO1B 1P05A 1L1NA 2BB4A 4ACBA 1QRZA 1K1JA 3FP7E 2GVFA 1HPGA 3AK5A 1K1OA 1BMMH 4XRNA 1Z8JB 1XUJA 1C2IA 5PTPA 6CHAB 2XOKD 1UTQA 2BZ6H 3LGUA 1AQ7A 1CGHA 2SNVA 1QCPA 3KCGH 3OSYA 4IW4E 1OS8A 1YCPM 1DLKB 3U8OH 4BAHB 2OC0A 1FY1A 4GHTA 2ZIQH 3LT3A 1GHAF 1ZHPA 1K22H 5CE1A 5EODA 1GI1A 3RXDA 4DOQA 1ZYOA 5GDSH 4BXWA 4E06H 3E3TA 1GHBF 1SPJA 4Y11E 1NROH 2BLWA 4TY7A 3BV9B 3RC5A 3PTBA 2ANMH 3SGQE 3SUDA 1GCTB 1ZRBA 1W10U 1C1OA 2SGFE 3UNQA 4ZHAA 2ZDAH 3HK3B 1DPOA 2O8UA 1T4UH 1V2KT 3M3TA 5CHBA 2KR7A 3ZZAA 5E0GA 1P03A 4AC9A 5FX5A 4DT4A 5EQRA 4A7IB 1D3DB 4OM9A 1C2FA 3RXSA 1O3DA 5DP5A 1C5WB 1HJ8A 4X1QU 1PPFE 1C5OH 3VGCC 2ZI2H 4IMQA 2JH0D 3RP2A 2VNTA 3ZZ7A 4CBOA 1THRH 1MBQA 3PLPA 2J97A 1K1LA 4KELA 4NIWA 7GCHG 1SGFA 5GJ4B 1TX6A 3I77A 1AHTH 2F3CE 3DSOA 2Y5GA 5EXNA 4AFQA 5HKKD 1NRRH 2XCFA 1TQ7B 4GPGA 1RD3B 2Z9JA 5I25A 3ATMA 4FETA 1DSTA 1EKBB 4RKOB 1MTSA 1PPCE 1NRNH 1ANDA 1ANEA 3E91A 3P8NA 4K5ZA 1A7SA 4GLYA 1JXPA 3TLOA 1JRTA 3A7TA 1D3PB 4DG4A 4MVNA 2AERH 1O37A 2VGCB 2RCEA 3BTHE 2G5NA 2BXUH 1BJVA 1V2VT 1ABIH 1BB0B 3WW7A 1YYY1 1TIOA 5DP4A 1GMDG 1CHGA 5JPMH 4OS2A 3EYDA 4DT7B 2D8WA 2PUXB 1QB9A 1GI4A 4JZEH 1O5FH 2ZC9H 1W0KD 1ZTKA 1LTOA 1GHZA 3VB7A 2ZFQH 1VCPA 1K1IA 3SV2H 8LPRA 1KLJH 2L6OA 4K3JA 3P92A 3BG4C 4XOJA 1FJSA 1P2KA 1SVPA 2XCNA 3S9AA 2GV6A 4M7GA 2W7SA 4JK6A 1G3BA 1M9UA 3AASA 1QR3E 3BTME 3DHKH 5C1XA 1S85A 2VIOA 3OFND 6ESTA 2ZPRA 3SJ8A 2Z7FE 3A8CA 4FXGH 3F1SB 4VGCB 5EW2H 2VWLA 4XBDA 3M7QA 4Y79A 2JETB 2PKSB 2ZZUH 3SJOA 5IDKA 1PPHE 2Q1JA 1NTPA 4FVBA 1LHGH 5F8ZA 2TBSA 1BIOA 1E1RD 5FCRA 3SV7A 4WY3A 3RXIA 3UOUA 3ZZBA 1F2SE 1DE7H 1TFXA 3BEFB 3F9HA 3QZRA 5TCCA 2BX4A 2QXHA 2YNBA 3KN2A 2ZCLP 1O2ZA 2P3TB 5LPEA 1FX0B 4AZ2B 2GD4B 1CE5A 2O8TA 1IQJA 3BEIB 4FUEA 3NK8A 2BX3A 1MD8A 2WPLS 1AZ8A 2G55A 3KQDA 1NY22 1P2JA 2AMQA 1MZDA 3ZZ4A 4AB8A 2ZGXH 1AY6H 1BRCE 1EAWA 2Z3EA 4WH8A 4RT0A 5L2YH 2OK5A 4TSFD 1HIAA 2UUKB 5FPSA 3A7WA 4MNYA 1LHDH 3GICB 1GBFA 4NIYA 5HYOA 1C5NH 3VB5A 1CT0E 3GDVA 1UHBA 3VG8A 2PLXA 2B8OH 2BDCA 3ZVCA 3F9FA 4NA9H 4ZKNU 3H7TA 1QA7A 1DFPA 5TCAA 5T1VA 4XBCA 1HAYB 2Z9LA 1YKTA 4NSYA 1G2MA 4CRGA 1TGBA 2WPKS 4ISNA 3PMBB 1AVWA 3T26A 1C5LH 1DSUA 1HIAB 1YLDA 3TU7H 2LPRA 2VJ1A 1NM6A 2ANWA 3I78A 4R8TB 4MNXA 2ANKH 1CBWC 1L1GA 1HNEE 1O2OA 1DITH 1WAYB 1O5DH 1UHBB 5DP6A 1Y59T 1ETTH 1VZQH 5L2ZH 1BTYA 4YOGA 1QL9A 3A89A 3F9GA 3MOCA 2VVUA 3OY6U 5HIZA 1LQDB 1AIXH 5A0BA 1AD8H 4X6OA 4NCYA 1NC6A 2BDIA 4F48B 3KNXA 3EA9A 2W5EA 1HAXB 1EPTC 3E16B 2BVXH 4K60A 1O2LA 3T29A 3BIVH 1EB1H 2ODPA 1DXWA 4AGKA 3UNRA 1P9UA 2J34A 2ZDKA 5FBIA 1GBLA 1GJCB 3C1KA 1BA8B 3RXVA 2PV9B 3PWCA 1ELDE 3T27A 4XBBA 3VB6A 1T31A 3DCLA 3BG8A 1BBRH 2OP9A 3FFGA 9LPRA 1P2IA 4WVPE 1CA0C 4H4FA 4O97A 4X1RU 3PB1E 1CO7E 2WINI 4ZAEA 2DE9A 5E2PA 2BVSH 1C2GA 1YGCH 2VIQA 3SW2B 5JDUB 4Y8ZA 1BBRK 3ZV8A 2PTNA 3FN8A 2P94A 1GBJA 4R0IA 1LO6A 3M7UA 1SL3A 1P2NA 1ZTJA 2WHXA 5FPTA 3HATH 3BEUA 5FL7D 3BTDE 3O8CA 2HVXA 1Z6JH 1O35A 1VCQA 1V2UT 2XC5A 2HALA 4Y6DA 1UTMA 4Y76A 5DKMA 2G81E 1XMNB 1QHRB 2AH4X 2KCPA 3LOXA 1C2HA 1H8IH 3U8RH 2ASUB 1SLUB 2PGQB 2O8LA 2A2QH 4Q7XA 5CHAC 2TGTA 4FVDA 5FXLA 4B6FA 4DVAU 2W6ID 4MNVA 2QYIA 3KYGA 3RUOA 4E7NA
chains in the Genus database with same CATH topology
3RMMH 4E05H 1SGDE 3MHWU 1FNIA 1RIWB 2FM2A 3SNBA 4AFUA 1TMUH 1LVYA 2TPIZ 1C5VA 4MDSA 2O9QA 1TOCB 2PFEA 1GVZA 2SFAA 4YOJA 1TONA 2OC7A 3U69H 1TABE 2IJOB 4CRDA 2HNTF 2ZO3H 1QL8A 4I8KA 2HGTH 3SO3A 5DPAA 3VB4A 4X8VH 4JCNA 3SU5A 1S81A 1S5SA 2XW9A 4U2WA 4FUBA 1G9IE 2FI3E 1WTHD 1AU8A 2OBOA 1RTFB 4X1SU 1NU7B 2ZHWH 1O3OA 3NKKA 4AYYB 2FX4A 2H5CA 1ZGIA 7GCHF 1NFYA 1J8AA 8ESTE 1C1SA 1VJ9U 2F9NA 1GVLA 4X2VA 3DFLA 3I29A 1QJ1B 4FUFA 1O3AA 1ACBE 3NCLA 4I31A 1UVOA 3MTYA 4UD9H 1OYQA 4ZH8A 4CH8B 2XBWA 4ISOA 3RXAA 1O2MA 1KXDA 2Q6DA 1BCUH 3M36A 1ZSJA 3SJ9A 1XKBC 2JH5D 3MO9A 2ZHQH 1YP9A 1ZRKA 2CF8H 3MU5A 4FUJA 2Q6FA 3TGIE 3F9EA 1C5PA 4K1EA 1C5QA 1GMDF 4B71A 1OP8A 3GCHC 5GCHG 1HXFH 1IQFA 1GL1A 5AVDA 1OX1A 4IC5A 1GJ8B 5DK1A 1J9CH 3SJIA 2EI8A 4D76A 1EB2A 4NGAH 1E37B 2C8YB 1F0TA 1HUTH 1Y3VA 1YC0A 2HRVA 1C4V2 2FXRA 1CGIE 1MTNB 2QC2A 3GY6A 4FUIA 1Y5UT 5F03A 1SLWB 2ZFRH 2VWMA 2G5VA 3TJUA 3RM2H 1LVBA 4FU7A 4X0WU 5FPYA 1GI2A 4DGJA 1O3PB 3RXHA 1JBUH 3QK1A 1VCWA 2VH6A 1YPLH 1C1NA 5B6OA 4BAKB 2G52A 1NZQH 3TH3H 4ZXXH 1SG8B 5JB9S 1Q3XA 5AHGH 1CHOG 4OGXA 3UREA 2J4IA 2FOMB 4Q7ZA 5G4BA 3SV8A 2W3KA 3GCNA 3VEQB 2R2WU 1G36A 8GCHG 5LPFA 3U1JB 4JYVH 1AB9C 1N8OC 1ELAA 1EJNA 4BOHA 1QJ7B 4GAWA 3SV9A 3AW0A 4WXIA 5HXFA 1HBTH 1YLCA 4TY6A 1HGTH 3CP7A 3M61U 1C5RA 4JZFH 2XBYA 4WMFA 2QN5T 4BXSA 1C2KA 1ZMNA 2GCTC 4FU9A 1BTZA 1W8BH 2TGAA 3DA9B 3MNBA 4B1TA 5DG6A 1L1JA 1OSSA 1TPPA 2P93A 7LPRA 2BM2A 1J16A 4Y0YE 1LKAA 2FZZA 2VIDA 1A61H 1P8VC 2GP9B 2PUQH 4K8YA 4OS7A 2ILNA 1EJMA 1O3HA 2AYWA 5FX6A 2TIOA 1PPEE 1A5GH 1TNHA 1LVMA 3WY8A 4H6TA 2FP7B 2AMPA 1D6WA 2ZNKH 5C1YA 5T6DA 4ISLA 1D6RA 3G01A 1SI5H 1Z8RA 2C4FH 1PQ7A 5JBTA 2W7UA 3SOSA 1VGCC 4KTUA 5JBBS 2D2DA 1DVAH 2YNAA 3SI3H 3A80A 1AKSA 2WPMS 3SORA 2QXIA 2FI5E 2BDGA 1FDPA 3GY5A 3GY3A 1EP5A 3VB3A 1NFXA 1HAZB 3RXFA 3UPEA 4AG2A 4GVUA 1FN6A 1WU1A 3Q76A 1TBRH 3UWIA 2VWOA 1AWFH 1MZAA 1EP6A 2FX6A 3T2NA 1H8DH 1BRAA 1L2EA 1RTLA 4WXVA 1ZTLA 4AFSA 3GDUA 2XTTB 1W3CA 1SGQE 3H7OA 2PHBA 1ANCA 3EE0B 1H4WA 2XC0A 4ASHA 2R3UA 3OTJE 1SQTA 1B0EA 4CRCA 3W94A 2AEIH 1IQNA 1P3CA 4A6LA 2O8WA 2Y5HA 3KF2A 2XBVA 2CHAB 3ODFA 1O5CB 4ESTE 1DWCH 4X2YA 3SUEA 2Y81A 1WTGH 1NO9H 2JKHA 1OXGA 1TYNA 2VIWA 3E8LA 1LKBA 4ABAA 1FIZA 1GMHG 4I8LA 1C5ZB 2XRCA 3A84A 3LPRA 1J17T 2QXGA 3BTWE 2BY6X 5DP9A 1GG6B 3QZQA 1L4ZA 3Q00A 2ZWLH 2ZF0H 2THFB 2Z9GA 2SGEE 3NZIA 2RA0A 3BSQA 2WUBA 4BNRA 1IQEA 2PR3A 2Y82A 3PWBA 3KGPA 3RXPA 3LDXH 1DICA 3RC4A 1P3EA 1SHHB 4MG3A 4MPWA 1W12U 1C4Y2 1ZLRA 1GVKB 4CRBA 2SNWA 2BDAA 2BOHB 1SGCA 2P16A 2BTCE 4THNH 1D3TB 3TK6A 5LGOA 4O03A 2OD3B 3ZZ3A 3QGJA 9ESTA 1QBVH 2GT8A 3M3SA 7ESTE 4K8BA 1IQLA 5EQSA 2EEKA 8KME2 1U6QA 1MH0A 2FLRH 4CHAB 2BLVA 1SGYE 4INKA 3ZZCA 1GBTA 4CRAA 1E0FD 2BZAA 1GI8B 1V2RT 3DFJA 2BXTH 1TA2A 4UFDH 2F9BH 1EJAA 2GMTC 2FODA 2NU1E 3TNSA 3EA8A 4U32A 1TMTH 2V35A 1QY6A 1UTKA 3SQHE 4B74A 2BQ6B 3ZYEA 3LGVA 4TWYA 4ABBA 2KAIA 4AX9H 3A83A 1G2LA 3ENSB 1ESBA 3SQEE 1MU6B 3GYMA 1F5LA 3M5MA 2ALPA 3GYLB 1TGTA 5JBAS 2VU8E 1C5MD 4WF8A 1W7GH 2QV1A 2VVCA 4YO9A 1C2EA 1SOZA 2FOBA 2RA3A 2ZGCA 1ZPCA 4X8TH 2A32A 4X6MA 1TRNA 2ZU2A 1C5XB 2AGIX 3A7VA 1X7AC 1QGFA 4NIVA 1YBWA 2DE8A 3K6YA 1O5EH 2KAIB 4Y71A 5E8EH 4ZKOU 2AFQB 1WYKA 3MO6A 2QIQA 5GCHF 2PGBB 5AFZH 1UMAH 2GZ8A 4ABJA 2PWXA 2W3IA 3KQBA 2Z9KA 1IQMA 1WSSH 4CREA 1RTKA 1GJDB 4CH2B 1BHXB 2BMGB 1PQ8A 5FCKA 1HYLA 2ZU3A 1TX8A 2HNTC 1MKWK 4AB9A 4GCHG 1AFQC 1O3KA 5FBEA 4UFFH 3IITA 3F6UH 4WMDA 2HNTE 2FWWA 1ELGA 1AUTC 3TITA 1OOKB 2XXLA 2EC9H 1UVUH 2R3YA 4FUHA 4HFPB 1ELCA 1AGJA 4ZMAH 1DUAA 1ZZZA 3AVZA 3HGNA 3TVJB 2HPPH 1S6HA 1HJAC 4INHA 4IS5A 1EQ9A 4A1TA 4PROA 1F0UA 1GGDC 1Z1JA 2ULLA 1TGNA 4SGBE 1T8MA 3TGKE 1E38B 3BN9A 3EDXB 2R0LA 3ZYDA 2P3FH 1UVPA 2C8XB 2BLQA 1O5BB 2BLOA 1FZZA 3LH1A 1DUEA 2A7JA 1S0QA 3NXPA 5A0AE 1DWBH 4CR9A 2M5TA 1JMOH 2BY7X 3A8AA 1P2MA 5E2OA 3MO3A 4Z6AH 1TB6H 2Y80A 4U01A 5C3NA 1PPGE 1DDJA 2B9LA 1GWAA 4ZUHA 3EGKH 1ZSKA 2UUJB 1MTUA 1WUNH 3MNCA 3QUMP 3K9XB 2AS9A 2ALVA 1QBOA 4AGJA 3U8TH 1Q31A 3HKIB 1S6FA 3PLKA 1A3EH 2AGGX 3SBKA 3UTUH 4ZHLU 2AIPA 4GSOA 1UCYH 3AW1A 2CV3A 4D7FA 1QQUA 1VJAU 4K1TA 3F68H 1OWEA 1YPHE 2WUCA 1Y3YA 3B8JA 3FP6E 3PYHA 1RGQA 2ZPQA 1LHCH 3DT0H 4KTCA 1O31A 1FPCH 2QXJA 1UCYK 3RXRA 2BYAX 4MPVA 3BTQE 4JZIA 4CR5A 3SHAH 5FHTA 1SB1H 4FUCA 2TGPZ 2WPHS 5IYTA 2NU0E 2QGRA 2H2ZA 3A8DA 2HOBA 3UNSA 3A7ZA 3SGBE 1A0HB 1ELFA 3RXLA 3A87A 3T25A 4H42U 1ABJH 1TA6A 1TNGA 1W7XH 2Q6GA 2OINA 2ZU5A 1V2WT 1FV9A 3QGNB 1Z6EA 1AFEH 1UTOA 1FLEE 1P12E 1V2QT 1MD7A 5ESBA 1O2GH 1DLEA 2CGAA 3Q3YA 4YTAA 1CT4E 1P04A 3P6ZB 1FN8A 3A85A 1GL0E 4A5TS 2F83A 4AOQA 5ETXA 4IGDA 1TNJA 5JBCS 3VGCB 1P02A 1OYTH 3Q3KA 3GCTG 1GBKA 1ELVA 2C3SA 1C1VH 4CRFA 1K1MA 2ANYA 2NU4E 3KIDU 3MNXA 1HJ9A 2EI7A 1K21H 2ZTXA 1QL7A 2BDBA 3NPSA 1ARCA 2BD7A 3UUZA 4K69A 1FXYA 1IQKA 1V2NT 3ZZ8A 5GWZA 1P2OA 2ZFFH 4O9VA 5EU8A 3RXEA 3EAJA 1H9HE 1C5UA 2B0FA 5LPRA 3QTVH 1WOFA 1FAXA 1HDTH 2FOEA 3Q77A 1KXEA 2FYQA 5HMAA 1G30B 1C1MA 1C2JA 2ZKSA 3D49H 1GBEA 1O2UA 1P10A 3L3TA 1NRSH 1O33A 1TGCA 1F7ZA 1YCPH 1O2QA 4FUGA 1E34B 4JYTA 3V3MA 2GT7A 1GI5A 2UWLA 4OS4A 2CMYA 5F8TA 3ATKA 1QB6A 3BG4B 4NA8A 1MAXA 4ZXYH 1YCPK 1P09A 4BAOB 4ABEA 5C67A 1B5GH 1D4PB 5T6FA 1JRSA 1S82A 4K2YA 1GJBB 1K28D 1F5RA 3RMLH 2P8OC 2BD9A 3TJVA 4YLQH 3RLWH 4WWYA 5DO4H 2QF0A 4I32A 3M37A 2XYAA 1HLTH 1O5GH 1KYNA 3R3GB 1TX7A 4I8HA 1SQAA 3RXCA 4DY7B 1MAYA 2FOGA 2QCYA 2P95A 4NA7A 4NG9H 4OS6A 5EXMA 3S9CA 3RXGA 1QRXA 1XUFA 1UK2A 2A45B 1J14A 1KSNA 1O3IA 3ZZ9A 2F9OA 3EA7A 1G3CA 1O3GA 3M7TA 3GOVB 3RXOA 1KXAA 1BQYA 3S69A 1BRBE 1AI8H 4Y0ZE 5EQQA 2ZGJA 1BRUP 4XE4A 3A7YA 3RU4D 5SGAE 4NWKA 3QN7A 5BRRE 1GJ4H 3E0NB 2HPQH 2GTBA 4TYDA 2FLBH 4LOYH 3RMNH 3BF6H 2J95A 3P95A 3TJOA 1MQ5A 1JIMA 1O30A 1S0RA 3FZZA 2GCHG 5HGGA 4DJZB 1INCA 4DIHH 3UY9A 3PTNA 3RC6A 2ZQ1A 5C20A 5EPNA 1DY9A 1GJ5H 3PO1C 2Y7XA 3KQEA 5HM9A 3LGWA 4Y7AA 3MU0A 1HAVA 2VH0A 3RMOH 1MKXK 4Y8XA 4AN7A 4GCHF 3URDA 1WQSA 1GBIA 3B9FH 1PPBH 1NT1A 1WCZA 4FUDA 1F0SA 6CHAC 1UTLM 1Y5AT 2Z94A 1KIGH 1JWTA 3RU4E 3RXKA 3GCOA 1SR5C 3M35A 1TPOA 1EPTA 1NRPH 1XVMA 2QAAA 2GDDA 4NWLA 1XXDA 5C2ZA 1GBMA 2H9EH 1ZPZA 5K7RA 4NZLA 1CBWB 2ZEBA 3MH7A 4YT7H 1TNKA 1HAVB 3GISB 1SBWA 2B7DH 3RU4T 1BBRE 1THSH 4LK4A 1SSXA 3LONA 4NFFA 3RM0H 1UVTH 1QBNA 1BTXA 1CVWH 4ISIH 3MFJA 1C1UH 1P57B 2TRMA 1GCTC 1GPZA 3QLPH 2J9NA 3KQCA 1O3NA 2Y5FA 3QX5H 1EPTB 2F91A 1ESTA 1TGSZ 1KTSB 1L4DA 2IPHA 2V6NA 1O2KA 2GX4A 3ATLA 1ANBA 4XFQA 3BTFE 1A5HA 1YPMH 1VITH 2A5KA 1HRTH 2ZGBH 4OS1A 3TNTA 2AIQA 1O2RA 4A1XA 5EW1H 1BTWA 4FU8A 2I6SA 4AYVB 1V2OT 1NN6A 1V2ST 2BD8A 1LPGB 1THPB 3ATWA 1EATA 2Z6BD 1O3JA 2FEQH 2H6MA 1Z1IA 1Y3XA 1EOJA 2FS8A 3MI4A 4QT8C 5JB8S 4SGAE 2Z3DA 1N6YA 1FIWA 5CMXH 1XM1A 3VPKA 1LMWB 3HK6B 1NRQH 5CHAB 1N6XA 3KL6A 2BHGA 2FIRH 2VGCC 2R2MB 3LJJA 1PQ5A 1H9IE 1E35B 1OWKA 2A4RA 2O8MA 1LQEA 4U30A 1ETSH 2WYJA 4MQAA 1SLXB 1H9LB 2VWNA 4GUXA 4KKDA 3BTTE 2FTLE 4OGYA 2BD3A 1TRYA 2A4OA 2FOCA 1T7CA 1AE5A 2J94A 5C1UA 1FUJA 3ZVAA 1F5KU 2FTMA 1C1WH 2ZHFH 1C5YB 2SGQE 3LU9B 4ABDA 2A4QA 3MU1A 2GGVB 1P11E 1ZGVA 5FAHA 4X2XA 1W2KH 4VGCC 2JETC 2PKSC 3MU8A 1VITG 2BVRH 3A81A 2SGPE 1EXFA 4LZ4B 1NPMA 3UQOA 1ID5H 3MH5A 2FI4E 3PM3A 4BTTB 2ZFSA 3STJA 5ABWA 3ZZ6A 1C2DA 2UWOA 2F9PA 4YLUA 5EPYA 1SGRE 1O2NA 1BTUA 3TJNA 1O2JA 5GIBA 4ABIA 4B2AA 3W95A 2ZFTA 3UIRA 1Z8GA 5BPEA 3RLYH 1ORFA 3M5OA 3JZ1B 3T62A 1BITA 1BMNH 1LDTT 1FPHH 1XUIA 2FESH 3TPIZ 3UR6A 3Q3XA 3KHVA 3TGJE 3MU4A 2QY0B 1F0RA 4IN2A 2HLCA 3VFEA 1FQ3A 1FY5A 3TK5A 4YOIA 2C93B 3GCHB 1A2CH 1YF4A 1QJ6B 3CENA 2UUYA 1O2PA 3D62A 2BD5A 1KDQB 1GBHA 3ELAH 4YESB 1G3DA 3SZNA 2ESTE 1S83A 3ZZDA 3L6PA 1CT2E 4Q2KA 2GKVE 1AVGH 1WBGB 2STAE 2PKAB 5F8XA 1ZOMA 3ZVDA 2A31A 1FY8E 2VB0A 3U98H 1LPZB 2Z9IA 4HZHA 2Z3CA 4B76A 3PMJA 2ZDVH 2WV5A 4OS5A 1ELTA 3K6ZA 4KTSA 2C90B 4RSPA 2OXSA 4K1SA 1QURH 2BQ7B 4BTIB 3UR9A 4XSKU 3K65B 1MUEB 1AB9B 1N8OB 3TH4H 4CBNA 1XUKA 2XC4A 3TK9A 4D9RA 3A7XA 1EOLA 4I33A 3SUFA 1HAOH 1G3EA 5GXPA 2A7CA 2BY8X