3D62A

Development of broad-spectrum halomethyl ketone inhibitors against coronavirus main protease 3clpro
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
299
structure length
299
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Development of broad-spectrum halomethyl ketone inhibitors against coronavirus main protease 3CL(pro).
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 65
structure length 299
sequence length 299
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3d62A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3d62A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3d62A02
4WXVA 1H9IE 3HK3B 1XUGA 1Z6EA 3IG6B 4X8TH 2BM2A 1V2VT 1OWIA 1XUJA 3T29A 5LPRA 2FLBH 3HGPA 1NRQH 2Z3CA 3MO6A 1P2JA 1CHOG 4OGYA 2C8XB 1HAIH 5DG6A 1UO6A 3TH3H 1F5RA 3RUOA 1LPGB 2J94A 1ARBA 2ILNA 3GY7A 1NFUA 1HAZB 2PGBB 2QXGA 4BXSA 5A2MH 1J14A 4RSPA 3A88A 1Q3XA 3WY8A 1A46H 3A82A 3A7VA 5DO4H 4MPUA 3MU5A 3RXGA 5LPFA 1Y3VA 1TGNA 1ELFA 1IQGA 2UUFB 1K1IA 5CMXH 2VGCB 1J8AA 1QIXB 4IN1A 1C1PA 1EB1H 2RA0A 1CT0E 4X8UH 4NA9H 4R8TB 5A0AE 2ZDNA 1T8MA 1D3QB 6ESTA 1NRSH 1W3CA 3MNXA 4FUCA 7LPRA 3SHAH 3VB5A 5L30H 4I32A 1P8VC 1V2OT 3NXPA 3T25A 1O2KA 4YTAA 4NA7A 3HK6B 4JMYA 2PKAA 1GCDA 1O5BB 1MZDA 2ZU5A 1E35B 2OC8A 1SQAA 4JZEH 1D9IA 2CF9H 1FY4A 5E0JA 4WMEA 3VGCC 2ZCLP 1GMHF 1UHBA 2XBYA 1W7XH 3GOVB 2GCTB 5HYOA 2NWNA 2ZFPH 1PQ5A 5I25A 3A80A 2GX4A 1O2WA 2QV1A 1Y5AT 3QZRA 1AY6H 1C2JA 3H7OA 1FXYA 1HJAC 5C5OA 5I46H 1KY9A 3UR6A 3NWUA 4KTUA 3FP8E 1Z1JA 1FY3A 3ZZ5A 3D62A 1K22H 2FMJA 3I78A 1WTGH 3SJKA 3EA9A 1GVKB 1YP9A 3D49H 2HNTC 2AGIX 3EBNA 4I8KA 5DP4A 5J4SA 1ZJDA 3S0NA 1NRPH 5ETXA 1TABE 1LPKB 3P92A 1E37B 1QTFA 1FN6A 1S5SA 2FOEA 3MNBA 4TPIZ 2BLVA 4B73A 4XE4A 2BLOA 2BLWA 1EZQA 1C2MA 4BAOB 1UTKA 2GCHF 2GDDA 1SG8B 4Q7ZA 3VGCB 3RMMH 3F1SB 3DUXH 1O5EH 1DLEA 1O3CA 2OQ5A 1O2XA 1CSOE 4WWYA 1ZR0A 1OYQA 2GZ7A 1QL9A 4NCYA 1QHRB 3A7TA 4ABFA 1HJAB 2QXJA 2VB0A 1PPCE 3ODDA 2Z3EA 2AGEX 2A0QB 1S82A 3E6PH 1HGTH 1J15A 2A7HA 4CRAA 3R3GB 3EGKH 1TYNA 3UUZA 1DWDH 1NPMA 1UCYK 2BVRH 5DKMA 1JRSA 3MO9A 1GJ4H 2ZGXH 4RN6A 3E3TA 4O03A 1QL7A 1BBRK 1IOEA 1JWTA 3BTME 1YPGH 2Q6FA 2A5IA 1SGIB 1GBCA 3RC4A 1O36A 2C90B 4K3JA 3BTDE 1TNGA 2QY0B 4FU9A 1C5MD 1H8DH 4YOJA 2Y7ZA 1UTOA 1BHXF 2K7XA 2XC5A 4E05H 3GCTF 5FPTA 3V13A 3V3MA 3C1KA 3ODFA 1MU6B 1GL0E 2P16A 1JIRA 2ZHQH 2ZFQH 1TGSZ 3UQOA 1OWHA 5JBTA 4X6OA 4ZKNU 1TRYA 3IITA 3SU2A 4GUXA 1TIOA 1GBTA 4U2WA 1DS2E 4LK4A 3SNCA 2TRMA 4IMQA 3ZVCA 1YPMH 2F91A 4GHQA 1BOQA 2ZG0H 2FX4A 3D23A 1NT1A 1HAGE 2Y6TA 1EZXC 3SU3A 3ZVGA 2BHGA 1G2LA 1Z7KA 3ZVFA 1C2DA 1GJAB 1KTTB 2PTCE 4RKJB 1V2ST 1EJMA 2AMPA 1PPEE 2NU2E 2UUJB 2ZHEH 3DFLA 3I77A 2V35A 2PUQH 1T7CA 1A3EH 2ZCKP 1PQ7A 1HAXB 3Q00A 4KELA 4UFEH 3SW2B 1FIZA 1HAPH 3RXTA 1P06A 3MNCA 1HAVA 1C1QA 1MTSA 4H4FA 4H42U 3VB4A 2A5AA 5FPYA 1YKTA 1E36B 5F8TA 2OD3B 1C2EA 3URDA 3SV6A 4NA8A 1OS8A 1MUEB 1BRCE 1FZZA 3SUFA 7ESTE 1ELDE 1KXDA 3S9AA 4K1SA 4CRGA 4Y0ZE 3LGTA 1ETSH 1LQEA 1SGFA 4RKOB 1XKAC 4Y7AA 1MAXA 1THPB 2OP9A 1AU8A 2Y82A 1TLDA 1EPTA 3RLWH 4X1RU 2EI7A 1AE8H 1TGBA 1HFDA 1BTPA 3E0NB 4XSKU 3UWIA 4ZROA 2BLQA 3JZ2B 2A2XH 3LH1A 1QB1A 5E2PA 1C5RA 1Y3XA 1EP6A 1XUKA 2GV7A 2WPLS 4Y71A 3DT0H 5C3NA 1ZPCA 2PUXB 4JCNA 2G4UA 1L1NA 1RD3B 4ISNA 4K69A 2V6NA 1BB0B 3SUEA 1YLCA 1HAHH 3BSQA 3ZZ8A 4CBNA 1TFXA 3TK5A 4X6PA 2V0BA 1LHGH 4AORA 1EASA 1V2LT 1V3XA 3K6YA 1GBBA 2SGPE 1ESAA 5AF9H 2ESTE 4NZQA 3FANA 3E16B 1VR1H 4E7NA 2ZEBA 3HGNA 1YPLH 2R3UA 1T32A 2R3YA 1EJNA 1ZTLA 2P3FH 3RXEA 4K5ZA 4D9QA 2GKVE 5EQRA 4UE7H 3KF2A 1DXWA 1SLXB 1NO9H 5EQQA 1LTOA 4B75A 4BAQB 1GJ5H 2UWPA 4XOJA 2NU0E 1MD8A 1SGQE 1Y3YA 2VWLA 2XWAA 2ZFSA 2Y80A 2VIOA 4AYYB 1ZJKA 3GY4A 1GJDB 4ZXYH 1O3MA 1HYLA 2VWOA 2P3TB 1ZPZA 2ZDVH 4PROA 4ZKOU 2ZNKH 3PWBA 3MI4A 1GI7B 3BTKE 3LC3A 4I31A 1O32A 1V2NT 3UFAA 3RXMA 4THNH 1C1NA 1KXAA 4OS4A 1HRTH 1QRZA 1O2LA 3NZIA 2ZU1A 2FS9A 1GDUA 1DVAH 3SU5A 4ASHA 1GHBG 5LGOA 5E8EH 1C5LH 4D9RA 1DWEH 1MKWH 1KSNA 2XRCA 3IWMA 3F6UH 1A0LA 1OWKA 3QDZB 1A5GH 2FEQH 4WH6A 2PWXA 8GCHG 2Q6GA 1GHWH 3LGVA 2QC2A 4IGDA 2ZDKA 3P8OA 3LU9B 1UMAH 7GCHF 2Z9JA 2C93B 4ZKSU 4J2YB 3ATLA 4IW4E 5C1XA 1BT7A 1FNIA 5DP5A 2V3OH 3ZVBA 2A5KA 5HGGA 4B2AA 2Y5HA 2FTLE 1C5NH 2BD9A 1DPOA 3OTJE 3PROA 1AGJA 1DXPA 1EQ9A 1V2KT 3CS7A 2HPPH 3LKWA 2ZECA 1L1JA 1EZUC 3SJIA 1C2LA 6GCHG 3NPSA 1T4VH 4JYTA 1YCPK 2BZAA 2QF3A 4HGCA 2SNVA 4FUIA 4JZFH 4X6MA 2O8UA 2BDCA 1EAWA 5L6NH 2NU1E 1IQMA 1ACBE 1P03A 1ARCA 3G01A 1SL3A 4CRFA 1G32B 4MLFB 1HBTH 2UUYA 1BJVA 1OOKB 5ESBA 3RXBA 3VPKA 1CGIE 4U01A 2BY5X 2FO9A 3SUGA 3U8TH 4XBDA 1N8OB 1AD8H 5EU8A 2ZGHA 1C5ZB 2STBE 3UNQA 2OTVA 3ZYEA 2ZU3A 2BYAX 3W95A 3R0FA 1OWDA 5HMAA 1C2HA 2QIQA 2EI8A 2FP7B 3PM3A 1NFXA 2O9QA 1DDJA 4D7FA 2GT8A 5DP6A 3BIUH 5T3HA 1ZSKA 3Q77A 1UCYE 1BTUA 2ZHDA 3PV4A 1AZ8A 1O5DH 4JZIA 3T26A 1VITH 1FPCH 5A09A 2FDAA 1BBRE 2IJOB 1GVZA 3VB7A 4AOQA 1C5XB 1ZHRA 1AKSA 2AFQB 1O3NA 1GHYH 4YLUA 4FUJA 1GMCF 2BDHA 3Q3KA 3KGPA 1ZGIA 2GP9B 4DY7B 1SLWB 1XUIA 3BV9B 1O2GH 1LHCH 2XYAA 2WINI 4X2VA 2QXHA 1CBWC 1NFYA 2Z9GA 1A61H 4AX9H 3DA9B 4MG3A 1AVGH 1GJ9B 2W7SA 1ELAA 1OPHB 1O2MA 2P59A 3ZZ9A 3EQ0H 1ESBA 3QO6A 3GCHB 1HB0B 1GPZA 4ZKRU 3MHWU 2J95A 1QCPA 3RXSA 3GY8A 1E34B 2SGAA 1TNJA 2ZU4A 2Y5GA 5EQSA 4AZ2B 2VVCA 1WV7H 2Y81A 3BTGE 1TRMA 3PMAB 3MFJA 1C5YB 2TGDA 1F0SA 4TYDA 2ZIQH 1SHYA 1C5PA 1A7SA 2C4FH 2P95A 3P17H 1W2KH 2KAIB 1BTXA 2SGQE 1SLVB 4DW2U 5FAHA 2ZTXA 2H9HA 4FUEA 1GI2A 3NUMA 4X1QU 2ZHFH 3S7KB 1GI6A 2ZDAH 1BRBE 2B8OH 1PFXC 5GCHF 5J4QA 3TNTA 2P94A 2XTTB 2FTMA 1AB9C 2BDBA 3EE0B 3H7TA 1NU7B 1DFPA 1V2UT 1MCVA 1P2KA 2ZI2H 1T4UH 4SGBE 1V2TT 1YPHC 1NM6A 2XCNA 3AW1A 1UTJA 2F9OA 2ZCHP 1SPJA 3SNDA 1QURH 1MKXH 5ABWA 1ELBA 1P9SA 1GHVH 1SQTA 4GCHG 1FDPA 2Y5FA 3KEEA 2HGTH 2FLRH 1WYKA 5JPMH 3E91A 2W3IA 1V2PT 3ZZ7A 3B8JA 1AVWA 4K2YA 4UFFH 1X7AC 1GHAF 4A6LA 2XBWA 4GHTA 1KDQA 1P2QA 1RTKA 2WUCA 4K60A 2B5TB 2ZWLH 2ZQ1A 3TK6A 3GY3A 1SGCA 3ZZBA 4JZDH 3BTQE 5CHAB 1D3PB 3A86A 1DE7H 4Q7XA 3M7TA 2A7JA 2HVXA 1DICA 1K1MA 1ZSJA 2ZGBH 8LPRA 1MBQA 2FOGA 3SJOA 4X2YA 1CVWH 1AB9B 1DANH 4CH2B 1B0EA 1SR5C 1IHSH 1O3JA 3RXIA 2TGAA 3P8NA 1WUNH 5TCCA 4AB9A 1LMWB 2XXLA 4NIYA 1O2RA 1PPHE 1O3IA 1S0QA 3GY5A 3BTTE 1LCYA 1RTFB 4AGJA 1GGDC 1D6RA 3ZVDA 2GDEH 2HLCA 2ZDMA 2G8TA 1ZYOA 1C4Y2 1C5VA 4DCDA 1LHEH 1QBOA 2BQWB 2FI4E 1FV9A 2VINA 4O3UA 1SGFG 1HXFH 3UPEA 3MH4A 4B71A 1Y59T 5JB8S 5TCAA 5BRRE 1O3KA 3VEQB 3RM2H 3TJVA 1BUIA 3AAVA 3O8RA 1C5QA 2G4TA 1KXFA 4WF8A 1WQSA 2B7DH 1PQ8A 1O3LA 4YM9A 3GDVA 1M9UA 1KLIH 4XBBA 3VXFH 4DG4A 5T6GA 2FODA 1XVOA 3KHVA 4ZUHA 4BOHA 2UWLA 3ATMA 4O9VA 3PMHB 1P0SH 2H9TH 3OY6U 2GGVB 1QRWA 1MAYA 4ESTE 1F0RA 1IHTH 2C8ZB 4O97A 1AI8H 4DGJA 3PLPA 3M5MA 1ORFA 3M37A 4I8HA 4BTIB 1BRAA 1GCTC 3RXQA 3RP2A 1O2VA 4TY6A 1DY8A 1RFNA 5L2ZH 4F4OC 1PPFE 2F9BH 4DOQA 3V0XA 1BMNH 3HPTB 1MCTA 4YOIA 5FCKA 1K28D 3SU6A 2ZU2A 1K1PA 2BB4A 1BDAA 3NKKA 1FI8A 3F9GA 2QCYA 1BZXE 3SQEE 1T8OA 4A1VA 4DIHH 1UTLM 1W0YH 2ZFFH 1UK2A 3MU0A 2VWMA 5F6MA 2FX6A 2WPMS 1IQNA 2R0KA 4ZH8A 1HUTH 4GVUA 2JKHA 4WMDA 3O8CA 1ZHMA 1GI4A 1EOLA 2BZ6H 1Z1IA 1ZLRA 1HIAB 4Y76A 2HOBA 3M61U 3RXUA 1MMJN 1BMAA 2ZTYA 1ETTH 1XUFA 1QJ6B 1GCTB 2JH5D 1BJUA 1ZRBA 4AFZA 3KL6A 3HKIB 2BY8X 1C1RA 1Y5BT 1JOUB 4K1TA 2BOHB 4AG1A 1AZZA 1A2CH 1AHTH 1B0FA 2BDGA 3KCGH 1O2UA 3SV2H 2RDLA 1T8NA 3BEIB 1SGEE 5A0BA 1MKWK 2Z6BD 4FUDA 3GCNA 2A1DB 1QA0A 4ABBA 1GMHG 1PPBH 7KMEH 2FYRA 5F03A 3FZZA 1UK4A 1TQ7B 3PLKA 4X6NA 3SU4A 1VCWA 4WH8A 4YESB 3BN9A 3ATIA 3KQCA 1G3DA 1DX5M 2WUBA 1GI8B 1PYTD 2ZO3H 1AO5A 1S83A 2WPJS 4OS1A 4H6SB 1VITG 5GIBA 1ANCA 1XVMA 1Z8GA 2FESH 4INHA 1TNLA 1V6DA 1XKBC 3TNSA 1XX9A 1TGCA 3RU4E 4X2XA 1ZGVA 3HATH 1O3PB 1OWEA 4BAHB 3NK8A 3MH5A 1OX1A 3PTNA 3A89A 3D65E 1BTHH 3QLPH 1DM4B 1JRTA 4GPGA 4Z0KA 1BITA 4WY3A 1ELCA 1YBWA 1O3HA 5CE1A 3SHCH 2Z9LA 4DURA 2ZZUH 3LGUA 1IAUA 1RGQA 2VIQA 5C20A 5IDKA 3MYWA 4ABHA 2H5CA 2AS9A 1XUHA 2ODPA 3SBKA 2AIPA 4KGAA 3T27A 1QA7A 2BDAA 1GBKA 2GCHG 1MQ6A 2HNTF 3MO3A 1LO6A 2D2DA 1QQ4A 1SGNE 2ALVA 2VVVA 3MNSA 3F68H 1CU1A 3A7XA 1BTWA 1KLJH 2P3UB 3UIRA 5K7RA 2GMTC 1ZMLA 1TX7A 4CRDA 1TA2A 5F8ZA 3U98H 1C2KA 1ZTKA 2VH0A 1O3GA 1VJAU 3Q3XA 2ZPSA 4ABDA 2CV3A 3LGYA 3MMGA 3UY9A 1UK3A 1AFEH 1PQAA 1CA0C 1C5TA 1TNIA 5LH8A 1P2IA 4A1XA 5JDUB 5JYIA 1O33A 4TWWA 3ATKA 4IBLH 3SQHE 2A32A 1TAWA 3LT3A 3SOSA 3JZ1B 3GCTG 1K9OE 1ZOMA 1GJCB 2G51A 4NFEA 2PKSC 2BY6X 1LDTT 1GBAA 1NESE 3U69H 2GMTB 2LIZA 1GMDF 2VWNA 4IC5A 3SI3H 5JB9S 2H5DA 4Q80A 3CENA 2NU3E 1S85A 6CHAC 1O2TA 2D26C 2ZHWH 2GT7A 1IQHA 1SHHB 4LOYH 3RXPA 1P11E 2A2QH 3QN7A 3ZZ4A 1F0UA 1J16A 3TIUA 3U8RH 3C27B 1WAYB 1IQLA 1JBUH 2PSYA 1IQIA 2AEIH 1O39A 1AMHA 1N1LA 3U9AH 1W11U 3KQDA 4UONA 2PKAB 4AB8A 1RJXB 5DPAA 4CRBA 1C4V2 3QWCH 1Z6JH 2DUCA 1UHBB 1C1MA 4MDSA 4BTUB 3OU0A 5SGAE 1BTZA 1L4DA 1UJ1A 1FY5A 2J38A 1BA8B 2PKSB 1MH0A 3A8CA 2Z3DA 1O5FH 1O2HA 4GSOA 1AN1E 4JYUH 3QX5H 3OX7U 1AQ7A 4MNYA 2F9PA 4O3TA 1P3CA 1IQFA 1DITH 3EA7A 4MNXA 1LVBA 1GBEA 1C9PA 2C8WB 3STIA 3B23B 1MU8B 1LHFH 1UTMA 3AVZA 1SGDE 2TBSA 3E90B 4AFUA 2ZPRA 4D8NA 1W14U 1D3TB 2VJ1A 1MKXK 3A7WA 4Y79A 3RMOH 1V2JT 2FOBA 3BTWE 4XBCA 3PMBB 1PYTC 1VJ9U 1YGCH 2BD2A 2FOMB 4Q7YA 3UNRA 1AUJA 1C1OA 3DD2H 2B9LA 4Y0YE 2R2WU 3V7TA 1QNJA 3LH3A 2ZGCA 4WVPE 1HNEE 1UCYH 1UVSH 4YOGA 1O38A 1FLEE 3TITA 4YZUA 3SUDA 1L0ZA 4FU8A 4FVBA 1QBVH 1BBRH 4NIXA 3PMJA 1O2QA 1WOFA 3UQVA 1FPHH 5ESTE 1KIGH 1F7ZA 5EGMA 3MOCA 1GI5A 1GJ7B 1MBMA 3LGIA 1GHXH 3VB3A 1AFQC 1PPZA 3FZDA 2ZGJA 4YLQH 3ZZ3A 3QZQA 4OS5A 3FP6E 3FP7E 4I33A 4X0WU 4BAMB 2SGDE 3MTYA 4TPYA 1AIXH 2OCVB 4NFFA 4B2CA 4Z6AH 1G3EA 3T2NA 1S84A 5FX5A 3MH7A 1OKXA 4IC6A 1K1LA 4I8LA 4TY7A 1BMLA 2Z9KA 1UVTH 1SVPA 1YYY1 5AFZH 1HLTH 1F2SE 1P2MA 5FHTA 3E1XB 3MH6A 1C9TA 4IS5A 3TLOA 5A0CA 1LHDH 2F3CE 3T5FH 3Q3YA 2I6QA 1ZSLA 3M7QA 3SNBA 3ZYDA 5DP7A 1TPSA 1C2IA 4CHAC 1Y5UT 4AN7A 2HPQH 2VIDA 6LPRA 1GBJA 2LNCA 2VNTA 2IPHA 1O2SA 2RA3A 1O34A 2O8TA 2YNAA 2YNBA 2BTCE 2A4GA 3A7ZA 2BVSH 2XWBI 1EKBB 1EPTC 4NSVA 2ZPQA 4ZHAA 3SN8A 4HFPB 2J92A 2OQUA 2ZFTA 2BD5A 4Y8ZA 1QRXA 4YT6H 5DP8A 3VFEA 2PLXA 2H6MA 3A7YA 4HZHA 3RC5A 2OINA 4WMFA 1ABIH 2AMQA 1HAVB 5TJXA 2HRVA 5EXLA 2OC1A 1ZRKA 3LIWA 2EEKA 4Y10E 1NC6A 4MPWA 5C2ZA 5C1UA 2O8LA 3KQBA 4ABAA 3A84A 2AGGX 1YPJH 1DWCH 1TMUH 1F5KU 4CHAB 2QXIA 5PTPA 2PR3A 1P2OA 7GCHG 1FUJA 1LQDB 9ESTA 3GY2A 2GZ8A 4ABGA 3L3TA 1HJ9A 1TQ0B 3RDZA 5L2YH 4AG2A 1L4ZA 3O8DA 3PTBA 2OXSA 3TGJE 1LKAA 3K9XB 4X8VH 2JH6D 2BVXH 3OYPA 4U30A 3GCOA 3L33A 2FIRH 1OP8A 5GDSH 1UTNA 1BRUP 2QA9E 3CS0A 4X1NU 3EA8A 2R9PA 3ENSB 1G2MA 1CHOF 1SSXA 4ZXXH 3P95A 1GHZA 4KTSA 3QUMP 1V2WT 4NG9H 1JIMA 2WPIS 1GDNA 5LPEA 3KQEA 1TONA 5EPYA 3TVJB 2CJIA 5EODA 3W94A 1GJ8B 3HKJB 1SGRE 1RRKA 2BXUH 3BF6H 1C5UA 3I29A 4WXIA 1EX3A 1QR3E 1EP5A 2PFEA 2EI6A 1E38B 2OBOA 4I8JA 3SV7A 2EA3A 3A83A 4E7RG 2ZFRH 3ITIA 2A7CA 1CGHA 1Q2WA 1P2NA 1O3OA 2P8OC 1SQOA 2PV9B 4ABIA 1CBWB 1Z8IB 1DUEA 1ABJH 1OSSA 4ISOA 1Z8RA 1FONA 2G5VA 3RMNH 2QYIA 1EUFA 1TBRH 1OYTH 1DLKB 1KXCA 2FOAA 2C3SA 2BD7A 4E06H 5HM9A 1A3BH 1GVLA 1K1OA 3M36A 1P02A 1FAKH 1SOTA 3UWJH 5FPSA 3M5OA 3SZNA 4H6TA 1G37A 1YCPM 1CGJE 1NU9A 4GLYA 1PJPA 3LONA 4KTCA 1OP0A 1SGPE 1OWJA 1HV7A 4X8SH 4ZAEA 1QJ1B 1A4WH 1P01A 3LGWA 1O3EA 1EAIA 2A4RA 1GMCG 1YC0A 1DY9A 1SC8U 2FXRA 2BY7X 5EW2H 2ZDLA 1ZHPA 3P70B 1K21H 1HJ8A 2ZA5A 2P8OB 1INCA 1WBGB 1O2ZA 1QQUA 1TX6A 1MTVA 2ULLA 1AUTC 3F9FA 2ZP0H 3SV8A 2SFAA 1S0RA 3RU4D 5FBIA 3SNEA 1P04A 1O3BA 2W26A 1O3DA 2WV5A 4LXBH 2QF0A 3SNAA 2G81E 4QT8C 3O8BA 1H9HE 2OUAA 2VIWA 1AE5A 2AMDA 1CO7E 4MPVA 1TOMH 1TMTH 1ELEE 4A7IB 1GDQA 1A0HB 5DGJA 2GCTC 1GL1A 2XBXA 2B0FA 3BG4C 5EOKA 4BAKB 3ZZCA 3N7OA 2H9EH 4UFGH 2PSXA 1SOZA 1MTNC 2SGFE 3LJOA 5H4IB 1K1NA 1UTPA 4VGCC 4INKA 1C2FA 5E2OA 4GAWA 5A8YA 1DUAA 1CQQA 1ELTA 1TX8A 5GCHG 1GBDA 3M3SA 2PHBA 5C1YA 4X1PU 4ZMAH 3PWCA 3TGIE 4I8GA 1YCPH 5JBAS 3SGBE 5GWZA 1W12U 2WPKS 1D4PB 3LOXA 5JBBS 2ZC9H 2RG3A 2UWOA 3UREA 1S81A 3BTHE 4Y8XA 2CGAA 4MPXA 1LVYA 1WSSH 2OC7A 4DT7B 2A31A 1Q31A 4MVNA 4NWKA 2K1QA 2STAE 2TGTA 3SJ8A 4CR9A 9LPRA 1THRH 3A8AA 1NZQH 4LZ4B 4M7GA 1Z71A 4A92A 1QFKH 1GGDB 8ESTE 4FUGA 2ZKSA 1GHAG 4MTBA 5AHGH 3P8GA 1TA6A 4JYVH 3BTFE 3BG4B 1GBLA 3MU4A 2WYJA 4ZHMU 4NIVA 1ZPBA 2F83A 1MTNB 3RXLA 2TPIZ 4VGCB 1VITF 1XMNB 1Y3WA 1D3DB 3STJA 1FY1A 4KKDA 1O37A 1NRNH 2V3HH 2O8WA 5AVDA 2HNTE 1W7GH 3QK1A 1O31A 1MQ5A 2XC4A 1H1BA 4K1EA 5FX6A 1BHXB 5E0GA 2FYQA 1RIWC 1ZZZA 2ASUB 3SI4H 3VB6A 1SFIA 3TGKE 5IYTA 3GICB 1TALA 1TNHA 1TNKA 2R2MB 1C5SA 1F5LA 4NSYA 2CMYA 1KLTA 4SGAE 2FOFA 2H1UA 1AVXA 4ISLA 1FMGA 1AKSB 4FVDA 1HPGA 5FCRA 3PO1C 2TGPZ 2Y7XA 4FUHA 4ZHLU 1F92A 2BX4A 4B74A 1JXPA 2HWLB 1GI9B 2G55A 2BD8A 1D6WA 1QB6A 3RC6A 1T8LA 1O5CB 1GI1A 2W7UA 3P8FA 1PPGE 1C1TA 1TOCB 1P10A 5C67A 5K0HA 1A1RA 4R0IA 4NWLA 2QGRA 3RXVA 2AERH 1HAOH 3UOUA 1C1WH 3QGNB 1WTHD 1TB6H 1RIWB 1JMOH 2Z94A 1ELGA 1AWFH 1HXEH 1F0TA 1C2GA 1SMFE 3U8OH 2P93A 5EXMA 2ANYA 1L2EA 4OS7A 1U6QA 1YM0A 3SJ9A 4MNVA 2AH4X 5DK1A 3TK9A 2JETC 3RXDA 1A5HA 1T31A 1TWXB 2QN5T 3AW0A 3PO1B 1HCGA 3TJNA 1VGCC 4IMZA 4BTTB 3DFJA 1DSTA 2BOKA 1IQKA 1EAXA 2ANMH 3S9CA 2BY9X 2F9UA 3KNXA 2CXVA 4A1TA 3B9FH 4K8YA 3KIDU 3UOPA 4FXGH 3RXRA 3S69A 4B2BA 1KYNA 2PW8H 3RMLH 1NTPA 4DIIH 2BDIA 1SLUB 4LZ1H 1TBQH 3OSYA 3RU4T 5EW1H 4WJG2 4CREA 3U1IB 4IN2A 1G9IE 1KTSB 4X1SU 2F9NA 2IN2A 1J9CH 2M5TA 1ETRH 2Q1JA 1ANEA 2FS8A 1FY8E 2WYGA 2Q6DA 3F9HA 4F49A 2FWWA 3ESTA 2FOCA 1ESTA 1KDQB 2LPRA 1ANBA 1C5OH 1TPPA 2JETB 1H8IH 1C1UH 4NZLA 3RXCA 4AFQA 4UFDH 3BEFB 1VGCB 1P09A 4K8BA 5FXLA 3LC5A 1QGFA 3L6PA 3SORA 3SGAE 2XBVA 4JK5A 1UVOA 1NROH 1E0FD 1QL8A 3A8DA 2BX3A 1TBZH 2GV6A 2BD4A 2Z7FE 3ZV9A 3TH4H 3ZZAA 2VIVA 2NU4E 5G4BA 5AFYH 3RXAA 1MTUA 3A8BA 4D76A 1SFQB 2ODYB 5T6FA 1W13U 2OBQA 4NGAH 4CBOA 1DSUA 1B7XB 1CA8B 1C4U2 5GJ4B 5T6DA 2YOLA 1EJAA 3GYLB 1GHBF 3M5LA 1G3BA 1NS3A 2J34A 2XCFA 5HM2A 2A4QA 1S6FA 4MQAA 2F9VA 4UD9H 2ALPA 1YLDA 2FI5E 8GCHF 1ZTJA 3CP7A 1CA0B 4B76A 4BXWA 5F8XA 4DJZB 2HALA 3K6ZA 5EPNA 1P3EA 3P6ZB 1GBIA 2KAIA 3V12A 1MZAA 1EB2A 3ZZ6A 2FI3E 1G30B 3AAUA 1AWHB 1BIOA 3GYMA 4JZ1A 1CE5A 1O5GH 2G5NA 3DHKH 5JBCS 8KME2 4FUBA 1WCZA 1THSH 3FAOA 1H4WA 3ZVEA 3GY6A 1MTWA 2FM2A 1NN6A 1BTYA 1BMMH 3QGJA 4AYVB 2G52A 1H9LB 1V2RT 1C5WB 4FU7A 1O2YA 3M3VA 4Y11E 3LPRA 6CHAB 3A85A 2CF8H 3E8LA 6GCHF 4Q2KA 5A8XA 1SB1H 1IQEA 4J1YA 1DOJA 3UNSA 1EOJA 3E0PB 2DE8A 1O0DH 1O3AA 3BTEE 2SNWA 2BXTH 1VZQH 3FVFB 3URCA 1K2I1 3T28A 1WQVH 4ISIH 1YF4A 1LVMA 4AGKA 4I7YH 1NY22 2FZZA 2ZF0H 1O2JA 4CRCA 2VIPA 3M3TA 1KXBA 1YPKH 1YPEH 1KXEA 1CT2E 3S7HB 1FQ3A 4D7GA 1Y3UA 1BCUH 1MD7A 3RXHA 2BQ7B 1O30A 2OLGA 2D8WA 2O8MA 3FFGA 4YO9A 5GPIB 3QTOH 1J17T 1GMDG 4HI3A 3K65B 4ISHH 1GBHA 1EATA 3M7UA 3GISB 3QTVH 1TRNA 5C5NA 2OC0A 1RTLA 3RXOA 1TPOA 2A4OA 2EC9H 2CN0H 1GI0A 5DP9A 2J2UA 1O5AB 1OXGA 3TU7H 2ANKH 2AYWA 2Z9IA 3ZVAA 4Y8YA 3TH2H 1RS0A 2WV4A 3TJUA 1A0JA 4B1TA 5FBEA 5DJ7A 2FOHA 4NIWA 4AFSA 1SGYE 1N6XA 2GVFA 1N8OC 1O2IA 3SU0A 1W8BH 1GBFA 2FPZA 1RXPA 3M5NA 1GWAA 5BPEA 3SO3A 2ZTZA 2VVUA 3ZV8A 3Q76A 4XDEA 4OS6A 2GD4B 1S6HA 3RXFA 1EXFA 1O3FA 3UR9A 2CHAC 2XC0A 3F9EA 4OS2A 2XNIA 4OGXA 1QY6A 1EZSC 3EYDA 3SGQE 1K1JA 1B5GH 1V2QT 5GXPA 4ABEA 1GBMA 1Y8TA 3A81A 3EAJA 1P12E 1FAXA 1HDTH 1ANDA 2RCEA 1AFQB 3OY5U 4TWYA 4INLA 2J9NA 1N6YA 4HTCH 1EAUA 1P05A 2W5EA 2ZQ2A 2JH0D 3TPIZ 3ELAH 1OP2A 1NFWA 4X2WA 3K2UA 1UVPA 3BEUA 2BD3A 2BDYA 2AIQA 3VXEH 3KN2A 4XFQA 2VU8E 1CHGA 1XXDA 4U32A 2CHAB 1G3CA 5E0HA 3EDXB 5EG4A 1O2PA 1TMBH 4YT7H 3GCHC 3NCLA 5HXFA 2ODQA 3GDUA 2GZ9A 3MU8A 2BQ6B 4GCHF 1UTQA 1V2MT 1ZMJA 1ID5H 2I6SA 5EXNA 1ELVA 3RXJA 1QBNA 1ZMNA 5B6OA 4UDWH 3ATWA 1HIAA 1TGTA 1C1VH 1GI3A 1EPTB 3AASA 4MNWA 4DVAU 2IOTA 3LDXH 1HAYB 2G00A 2R0LA 1VCPA 4A5TS 3MU1A 3RLYH 1C1SA 2QAAA 1TE0A 2BMGB 3PLBA 1O2OA 1LKBA 1TPAE 1FIWA 1Z8JB 1CT4E 3PB1E 1SI5H 1VCQA 1BQYA 3U1JB 3BG8A 1GG6C 1SGTA 3GDSA 1IQJA 1FJSA 1LPZB 2ANWA 2WPHS 1UVUH 2SGEE 2PTNA 1W10U 3UTUH 1G36A 1QJ7B 4KP0A 2W3KA 4UEHH 1P57B 1XXFA 1SBWA 1XM1A 1LVOA 4ABJA 4Y7BA 4CR5A 1DT2A 2XW9A 1L1GA 2GTBA 3BIVH 1QB9A 3T62A 1GJ6A 3RM0H 3SV9A 2H2ZA 2VH6A 3S9BA 1GJBB 2DE9A 5CHAC 2A45B 2J4IA 1WU1A 2THFB 3PYHA 4JK6A 4CH8B 1NRRH 4Y6DA 2UUKB 3H5CB 3A87A 5A8ZA 3ZZDA 1A5IA 1YPHE 3MWIU 2D1JA 1GG6B 1O2NA 2TIOA 2PGQB 4BNRA 3SU1A 2C8YB 4FUFA 4BANB 1FN8A 3LJJA 3RXKA 1DWBH 3TJOA 1O35A 1W0ZU 1P9UA 3M35A 2VGCC 5DP3A
chains in the Genus database with same CATH superfamily
4WXVA 1H9IE 3HK3B 1XUGA 1Z6EA 3IG6B 4X8TH 2BM2A 1V2VT 1OWIA 1XUJA 3T29A 5LPRA 2FLBH 3HGPA 1NRQH 2Z3CA 3MO6A 1P2JA 1CHOG 4OGYA 2C8XB 2WPDD 1HAIH 5DG6A 1UO6A 3TH3H 1F5RA 3RUOA 1LPGB 3N99A 2J94A 1ARBA 2ILNA 3GY7A 1NFUA 1HAZB 2PGBB 2QXGA 5EJ1A 4BXSA 5A2MH 1J14A 4RSPA 3A88A 1Q3XA 3WY8A 1A46H 3A82A 3A7VA 5DO4H 4MPUA 3MU5A 3KQ5A 3RXGA 5LPFA 1Y3VA 1TGNA 1ELFA 1IQGA 2UUFB 1K1IA 5CMXH 2VGCB 1J8AA 2EQNA 1QIXB 4IN1A 1C1PA 1EB1H 2J5UA 2RA0A 1CT0E 3F2GA 4NA9H 4X8UH 4R8TB 5A0AE 2ZDNA 1T8MA 1D3QB 6ESTA 1NRSH 1W3CA 3MNXA 4FUCA 7LPRA 3SHAH 3VB5A 5L30H 4I32A 1P8VC 1V2OT 3NXPA 3T25A 1O2KA 4YTAA 4NA7A 3HK6B 4JMYA 2PKAA 1GCDA 1O5BB 1MZDA 2ZU5A 1E35B 2OC8A 1SQAA 4JZEH 1D9IA 2CF9H 3OEHD 1FY4A 5E0JA 4WMEA 3VGCC 2ZCLP 1GMHF 1UHBA 2XBYA 5C0UA 1W7XH 3GOVB 2GCTB 5HYOA 2NWNA 2ZFPH 1PQ5A 5I25A 3A80A 2GX4A 1O2WA 2QV1A 1Y5AT 3QZRA 1AY6H 1C2JA 3H7OA 4ASUD 1FXYA 1HJAC 5C5OA 5I46H 1KY9A 3UR6A 3NWUA 4KTUA 3FP8E 1Z1JA 1FY3A 3ZZ5A 3D62A 1K22H 2FMJA 3I78A 1WTGH 3SJKA 3OEED 3EA9A 1GVKB 1YP9A 3D49H 2HNTC 2AGIX 3EBNA 4I8KA 5DP4A 5J4SA 1ZJDA 3S0NA 1NRPH 5ETXA 3AK5A 1TABE 1LPKB 3P92A 1E37B 1QTFA 1FN6A 1S5SA 2FOEA 3MNBA 4TPIZ 2BLVA 4B73A 4XE4A 2BLOA 2BLWA 1EZQA 1C2MA 4BAOB 1UTKA 2GCHF 2GDDA 1SG8B 4Q7ZA 3VGCB 2QF4A 3RMMH 3F1SB 3DUXH 1O5EH 1DLEA 1O3CA 2OQ5A 1O2XA 4P02A 1CSOE 4WWYA 1ZR0A 1OYQA 2GZ7A 1QL9A 4NCYA 1QHRB 3A7TA 4ABFA 1WDIA 1HJAB 2QXJA 2VB0A 1PPCE 3ODDA 2Z3EA 2AGEX 2A0QB 1S82A 3E6PH 1HGTH 1J15A 2A7HA 4CRAA 3R3GB 3EGKH 1TYNA 3UUZA 1DWDH 1NPMA 1UCYK 2BVRH 5DKMA 1JRSA 3MO9A 1GJ4H 2ZGXH 4RN6A 3E3TA 4O03A 1QL7A 1BBRK 1IOEA 1JWTA 3BTME 1YPGH 2Q6FA 2A5IA 1SGIB 1GBCA 3RC4A 1O36A 2C90B 4K3JA 3BTDE 1TNGA 4B6FA 2QY0B 4FU9A 1C5MD 1H8DH 4YOJA 2Y7ZA 1UTOA 1BHXF 2K7XA 2XC5A 4E05H 3GCTF 5FPTA 3V13A 3V3MA 3C1KA 5F53A 3ODFA 1MU6B 1GL0E 2P16A 1JIRA 2ZHQH 2ZFQH 1TGSZ 3UQOA 1OWHA 5JBTA 4X6OA 4ZKNU 1TRYA 3IITA 3SU2A 4GUXA 1TIOA 1GBTA 4U2WA 1DS2E 2KX4A 4P00A 5EJZA 4LK4A 3SNCA 2TRMA 4IMQA 3ZVCA 1YPMH 2F91A 4GHQA 1BOQA 2ZG0H 3F0OA 2FX4A 3D23A 1NT1A 1HAGE 2Y6TA 1EZXC 3SU3A 3ZVGA 2BHGA 1G2LA 1Z7KA 3ZVFA 1C2DA 1GJAB 1KTTB 2PTCE 4RKJB 1V2ST 1EJMA 2AMPA 1PPEE 2NU2E 2UUJB 2ZHEH 3DFLA 2WZQA 3I77A 2V35A 2PUQH 1T7CA 1A3EH 2ZCKP 1PQ7A 1HAXB 3Q00A 4KELA 4UFEH 3SW2B 1FIZA 1HAPH 3RXTA 1P06A 3MNCA 1HAVA 1C1QA 1MTSA 4H4FA 4XRNA 4H42U 3VB4A 2A5AA 5FPYA 1YKTA 1E36B 5F8TA 2OD3B 1C2EA 3URDA 3SV6A 4NA8A 1OS8A 1MUEB 1BRCE 1FZZA 3SUFA 7ESTE 1ELDE 1KXDA 3S9AA 4K1SA 4CRGA 4Y0ZE 3LGTA 1ETSH 1LQEA 1SGFA 4RKOB 1XKAC 4Y7AA 1MAXA 1THPB 2OP9A 1AU8A 2Y82A 4XD7D 1TLDA 1EPTA 3RLWH 4X1RU 2EI7A 1AE8H 1TGBA 1HFDA 1BTPA 3E0NB 4XSKU 3UWIA 4ZROA 4Q4LA 2BLQA 3JZ2B 2A2XH 3LH1A 1QB1A 5E2PA 1C5RA 2KCAA 1Y3XA 2JIZD 1EP6A 1XUKA 2GV7A 2WPLS 4Y71A 2KFWA 3DT0H 5C3NA 1ZPCA 2PUXB 4JCNA 2G4UA 1L1NA 1RD3B 4ISNA 4K69A 2V6NA 1BB0B 3SUEA 1YLCA 1HAHH 3BSQA 3ZZ8A 4CBNA 1MABB 1TFXA 3TK5A 4X6PA 2V0BA 1LHGH 4AORA 1EASA 5FL7D 1V2LT 1V3XA 3K6YA 1GBBA 2SGPE 1ESAA 5AF9H 2ESTE 3SZEA 4NZQA 3FANA 3E16B 1VR1H 4E7NA 2ZEBA 3HGNA 4TSFD 1YPLH 2R3UA 1T32A 2R3YA 1EJNA 2L74A 1ZTLA 2P3FH 3RXEA 4K5ZA 2KCPA 4D9QA 2GKVE 5EQRA 4UE7H 3KF2A 1DXWA 1SLXB 1NO9H 5EQQA 1LTOA 4B75A 4BAQB 1GJ5H 3OTPA 2UWPA 4XOJA 2NU0E 1MD8A 1SGQE 5GNDA 1Y3YA 2VWLA 2XWAA 2ZFSA 2Y80A 2VIOA 4AYYB 1ZJKA 3GY4A 1GJDB 4ZXYH 1O3MA 1HYLA 2VWOA 2P3TB 3WWBA 1ZPZA 2ZDVH 4PROA 4ZKOU 2ZNKH 3PWBA 3MI4A 1GI7B 3BTKE 3ZIAD 3LC3A 4I31A 1O32A 1V2NT 3UFAA 3RXMA 4THNH 1C1NA 1KXAA 4OS4A 1HRTH 1QRZA 5HKKD 3PRBA 1O2LA 3NZIA 2ZU1A 2FS9A 1GDUA 4Q63A 1DVAH 3SU5A 4ASHA 1GHBG 5LGOA 5E8EH 1C5LH 4D9RA 1DWEH 1MKWH 1KSNA 2XRCA 3IWMA 3F6UH 1A0LA 1OWKA 3QDZB 1A5GH 2FEQH 4WH6A 2PWXA 8GCHG 1NBMD 2Q6GA 1GHWH 3LGVA 2QC2A 4IGDA 2ZDKA 3P8OA 3LU9B 1UMAH 5C17A 7GCHF 2Z9JA 2C93B 4ZKSU 4J2YB 3ATLA 4IW4E 5C1XA 1BT7A 1FNIA 5DP5A 2V3OH 3ZVBA 2A5KA 5HGGA 3DSOA 4B2AA 3F2FA 2Y5HA 2FTLE 1C5NH 2BD9A 1DPOA 3OTJE 3PROA 1YLNA 1AGJA 1DXPA 1EQ9A 1V2KT 3CS7A 2HPPH 3LKWA 2ZECA 1L1JA 1EZUC 3SJIA 1C2LA 6GCHG 3NPSA 1T4VH 4JYTA 1YCPK 2BZAA 2QF3A 4HGCA 2SNVA 4FUIA 4JZFH 4X6MA 2O8UA 2BDCA 1EAWA 2V7QD 5L6NH 2NU1E 1IQMA 1ACBE 1P03A 1ARCA 3G01A 1SL3A 4CRFA 1G32B 4MLFB 1HBTH 2UUYA 1BJVA 1OOKB 5ESBA 3RXBA 3VPKA 1CGIE 4U01A 2BY5X 2FO9A 3SUGA 3U8TH 4XBDA 1N8OB 2W6JD 1AD8H 5EU8A 2ZGHA 1C5ZB 2STBE 3UNQA 2OTVA 3ZYEA 2ZU3A 1EFRD 2BYAX 3W95A 3VG8A 3R0FA 1OWDA 5HMAA 1C2HA 2QIQA 2EI8A 2FP7B 3PM3A 1NFXA 2O9QA 1DDJA 4D7FA 2GT8A 5DP6A 3BIUH 5T3HA 1ZSKA 3Q77A 1UCYE 1BTUA 2ZHDA 3PV4A 1AZ8A 1O5DH 4JZIA 1E1QD 1VITH 3T26A 1FPCH 5A09A 4FETA 2FDAA 1BBRE 2KZ4A 2IJOB 1GVZA 3VB7A 4AOQA 1C5XB 2J97A 1ZHRA 1AKSA 2AFQB 1O3NA 1GHYH 1W0KD 4YLUA 4FUJA 1GMCF 2BDHA 3Q3KA 3KGPA 1ZGIA 2GP9B 4DY7B 1SLWB 1XUIA 3BV9B 1O2GH 1LHCH 2XYAA 2WINI 4X2VA 2QXHA 1CBWC 1NFYA 2Z9GA 1A61H 4AX9H 3DA9B 4MG3A 1AVGH 1GJ9B 2W7SA 1ELAA 1OPHB 1O2MA 2J98B 2P59A 3ZZ9A 3EQ0H 1ESBA 3QO6A 3GCHB 1HB0B 1GPZA 4ZKRU 3MHWU 2J95A 1QCPA 3RXSA 3GY8A 1E34B 2SGAA 1TNJA 2ZU4A 2Y5GA 5EQSA 2WV9A 4AZ2B 2VVCA 1WV7H 2Y81A 3BTGE 2GJGA 1TRMA 3PMAB 3MFJA 1C5YB 2TGDA 1COWD 1F0SA 2ZIQH 4TYDA 1SHYA 2LP6A 1C5PA 1A7SA 2KCOA 2C4FH 2P95A 3P17H 1W2KH 4ACAA 2KAIB 1BTXA 2SGQE 1SLVB 4DW2U 5FAHA 2ZTXA 2H9HA 4FUEA 1GI2A 3NUMA 4X1QU 2ZHFH 3S7KB 1GI6A 2ZDAH 1BRBE 2B8OH 1PFXC 5GCHF 5J4QA 3TNTA 2P94A 2XTTB 2FTMA 1AB9C 2BDBA 3EE0B 3H7TA 1NU7B 1DFPA 1V2UT 1MCVA 1P2KA 2ZI2H 1T4UH 4SGBE 1V2TT 1YPHC 1NM6A 2XCNA 3AW1A 1UTJA 2F9OA 2ZCHP 1SPJA 3SNDA 1QURH 1MKXH 5ABWA 1ELBA 1P9SA 1GHVH 1SQTA 4GCHG 1FDPA 2Y5FA 3KEEA 2HGTH 2FLRH 1WYKA 5JPMH 3E91A 2W3IA 1V2PT 3ZZ7A 3B8JA 1AVWA 4K2YA 4UFFH 1X7AC 1GHAF 4A6LA 2XBWA 4GHTA 1KDQA 1P2QA 1RTKA 2WUCA 4K60A 2B5TB 2ZWLH 2ZQ1A 3TK6A 3GY3A 1SGCA 3ZZBA 4JZDH 3BTQE 5CHAB 1D3PB 3A86A 1DE7H 4Q7XA 3M7TA 2A7JA 3OAAD 2HVXA 1DICA 1K1MA 1ZSJA 2ZGBH 8LPRA 1MBQA 2FOGA 3SJOA 4X2YA 2JDID 1CVWH 1AB9B 1DANH 4CH2B 1B0EA 1SR5C 1E79D 1IHSH 1O3JA 3RXIA 2TGAA 3P8NA 1WUNH 5TCCA 4AB9A 1LMWB 2XXLA 4ACBA 4NIYA 1O2RA 1PPHE 2EY4C 1W0JD 1O3IA 1S0QA 3GY5A 3BTTE 1LCYA 1RTFB 4AGJA 1GGDC 1D6RA 3PV2A 3ZVDA 2GDEH 2HLCA 2ZDMA 2G8TA 1ZYOA 1C4Y2 1C5VA 4DCDA 1LHEH 1QBOA 2BQWB 2FI4E 1FV9A 2VINA 4O3UA 1SGFG 1HXFH 3UPEA 3MH4A 4B71A 1Y59T 5JB8S 5TCAA 5BRRE 1O3KA 3VEQB 3RM2H 3TJVA 1BUIA 3AAVA 3O8RA 1C5QA 2G4TA 1KXFA 4WF8A 1WQSA 2B7DH 1PQ8A 1O3LA 4YM9A 3GDVA 1M9UA 1KLIH 4XBBA 3VXFH 4DG4A 5T6GA 2FODA 1XVOA 3KHVA 4ZUHA 4BOHA 2UWLA 3ATMA 3DSPA 4O9VA 3PMHB 1P0SH 2H9TH 3OY6U 2GGVB 1QRWA 1MAYA 4ESTE 1F0RA 1IHTH 3PRDA 2C8ZB 4O97A 1AI8H 4DGJA 3PLPA 3M5MA 1ORFA 3M37A 4I8HA 4BTIB 1BRAA 1GCTC 3RXQA 3RP2A 1O2VA 4TY6A 1DY8A 1RFNA 5L2ZH 4F4OC 1PPFE 2F9BH 4DOQA 3V0XA 2OK5A 1BMNH 2PP6A 3HPTB 3EE7A 1MCTA 4YOIA 3NRLA 5FCKA 1K28D 3SU6A 2ZU2A 1K1PA 2BB4A 1BDAA 3NKKA 1FI8A 3F9GA 2QCYA 1BZXE 3SQEE 1T8OA 4A1VA 4DIHH 1UTLM 1W0YH 2ZFFH 1UK2A 3MU0A 2VWMA 5F6MA 2FX6A 2WPMS 1IQNA 2R0KA 4ZH8A 1HUTH 4GVUA 2JKHA 4WMDA 3O8CA 1ZHMA 1GI4A 1EOLA 2BZ6H 1Z1IA 1ZLRA 1HIAB 4Y76A 4F48B 2HOBA 3M61U 3RXUA 1MMJN 1BMAA 2ZTYA 1ETTH 1XUFA 1QJ6B 1GCTB 2JH5D 1BJUA 1ZRBA 4AFZA 3KL6A 3HKIB 2BY8X 1C1RA 1Y5BT 1JOUB 4K1TA 2BOHB 4AG1A 1AZZA 1A2CH 1AHTH 1B0FA 2BDGA 3KCGH 1O2UA 3SV2H 2RDLA 1T8NA 3BEIB 1SGEE 5IK2D 5A0BA 4TT3D 1MKWK 2Z6BD 4FUDA 2HLDD 2A1DB 3GCNA 1QA0A 3OE7D 4ABBA 1GMHG 1PPBH 4YXWD 7KMEH 2FYRA 5F03A 3FZZA 1UK4A 1TQ7B 3PLKA 4X6NA 3SU4A 1VCWA 4WH8A 4YESB 3BN9A 3ATIA 3KQCA 1G3DA 1DX5M 2WUBA 1GI8B 1PYTD 2ZO3H 1AO5A 1S83A 2WPJS 4OS1A 4H6SB 1VITG 5GIBA 1ANCA 1XVMA 1Z8GA 2FESH 4INHA 1TNLA 1V6DA 1XKBC 3TNSA 1XX9A 1TGCA 3RU4E 4X2XA 1ZGVA 3HATH 3WW7A 1O3PB 1OWEA 4BAHB 3NK8A 3MH5A 1OX1A 3PTNA 3A89A 3D65E 1BTHH 3QLPH 1DM4B 2RDEA 1JRTA 4GPGA 4Z0KA 1BITA 4WY3A 1ELCA 1YBWA 1O3HA 5CE1A 3SHCH 2Z9LA 4DURA 2ZZUH 3LGUA 1IAUA 1RGQA 2VIQA 5C20A 5IDKA 4B6EA 3MYWA 4ABHA 2H5CA 2AS9A 1XUHA 2ODPA 3SBKA 2AIPA 4KGAA 3T27A 1QA7A 2BDAA 1GBKA 2GCHG 1MQ6A 2HNTF 3MO3A 1LO6A 2D2DA 1QQ4A 1SGNE 2ALVA 2VVVA 3MNSA 3F68H 1CU1A 3A7XA 1BTWA 1KLJH 2P3UB 3UIRA 5K7RA 2GMTC 1ZMLA 1TX7A 4CRDA 1TA2A 5F8ZA 3U98H 1C2KA 1ZTKA 2VH0A 1O3GA 1VJAU 3Q3XA 2ZPSA 4ABDA 2CV3A 3LGYA 2W6ID 3DSGA 3MMGA 3UY9A 1UK3A 1AFEH 1PQAA 1CA0C 1C5TA 1TNIA 5LH8A 5C0TA 1P2IA 5C94A 4A1XA 5JDUB 5JYIA 1O33A 4TWWA 3ATKA 4IBLH 3SQHE 2A32A 1TAWA 3LT3A 3SOSA 3JZ1B 3GCTG 1K9OE 1ZOMA 1GJCB 2G51A 4NFEA 2PKSC 2BY6X 1LDTT 1GBAA 5B6LA 1NESE 3U69H 2GMTB 2LIZA 1GMDF 2VWNA 4IC5A 3SI3H 5JB9S 2H5DA 2J98A 4Q80A 3CENA 2NU3E 1S85A 1K0HA 6CHAC 1O2TA 2D26C 2ZHWH 2GT7A 1IQHA 1SHHB 4LOYH 3RXPA 1P11E 2A2QH 3QN7A 3ZZ4A 1F0UA 1J16A 3GS9A 3TIUA 3U8RH 3C27B 2WHXA 2M2AA 1WAYB 1IQLA 1JBUH 2PSYA 1IQIA 2AEIH 1O39A 1AMHA 1N1LA 3U9AH 1W11U 3KQDA 4UONA 2PKAB 4AB8A 1RJXB 5DPAA 4CRBA 1C4V2 3QWCH 1Z6JH 2DUCA 1UHBB 1C1MA 4MDSA 5CDFE 4BTUB 3OU0A 5SGAE 1BTZA 1L4DA 1UJ1A 1FY5A 2J38A 1BA8B 1QZ8A 2PKSB 1MH0A 3A8CA 2Z3DA 1O5FH 1O2HA 5DSFA 4GSOA 1AN1E 4JYUH 3QX5H 3OX7U 1AQ7A 4MNYA 2F9PA 4O3TA 1P3CA 4DT4A 1IQFA 1DITH 3EA7A 4MNXA 1LVBA 1GBEA 1C9PA 2C8WB 3STIA 3B23B 4Z1MD 1MU8B 1LHFH 1SQRA 1UTMA 3AVZA 1SGDE 2TBSA 3E90B 4AFUA 2ZPRA 4D8NA 1WXRA 1W14U 2L6OA 1D3TB 2VJ1A 1MKXK 3A7WA 4Y79A 4AC9A 3RMOH 1V2JT 2FOBA 3BTWE 4XBCA 3PMBB 1PYTC 1VJ9U 1YGCH 2BD2A 2FOMB 4Q7YA 3UNRA 1AUJA 1C1OA 3DD2H 2B9LA 4Y0YE 2R2WU 3V7TA 1QNJA 3LH3A 2ZGCA 4WVPE 1HNEE 1UCYH 1UVSH 4YOGA 1O38A 1FLEE 3TITA 4YZUA 3SUDA 1L0ZA 4FU8A 4FVBA 1QBVH 1BBRH 4NIXA 2AHME 3PMJA 1O2QA 1WOFA 3UQVA 1FPHH 5ESTE 1KIGH 1F7ZA 5EGMA 4M9FA 3MOCA 1GI5A 1GJ7B 1MBMA 3LGIA 1GHXH 3VB3A 1AFQC 1PPZA 3FZDA 2ZGJA 4YLQH 1VKYA 3ZZ3A 3QZQA 4OS5A 3FP6E 3FP7E 4I33A 4X0WU 4BAMB 2SGDE 3MTYA 4TPYA 1AIXH 2OCVB 4NFFA 4B2CA 4Z6AH 1G3EA 3T2NA 1S84A 5FX5A 3MH7A 1OKXA 4IC6A 1K1LA 4I8LA 4TY7A 1BMLA 2Z9KA 1UVTH 1SVPA 1YYY1 5AFZH 1HLTH 1F2SE 1P2MA 5FHTA 5KEDA 3E1XB 3MH6A 1C9TA 4IS5A 3TLOA 5A0CA 1LHDH 2F3CE 3T5FH 3Q3YA 2KM0A 2I6QA 1ZSLA 3M7QA 3SNBA 3ZYDA 5DP7A 1TPSA 1C2IA 3OFND 4CHAC 1Y5UT 4AN7A 2HPQH 2VIDA 6LPRA 1GBJA 2LNCA 2VNTA 2IPHA 1O2SA 2XNDD 2RA3A 1O34A 2O8TA 2YNAA 2YNBA 3F2HA 2BTCE 2A4GA 3A7ZA 2BVSH 2YMSD 2XWBI 1EKBB 1EPTC 2JJ2D 4NSVA 2ZPQA 4ZHAA 3SN8A 4HFPB 2J92A 2OQUA 2ZFTA 2BD5A 4Y8ZA 1QRXA 4YT6H 5DP8A 3VFEA 2PLXA 2H6MA 3A7YA 4HZHA 3RC5A 2VBCA 2OINA 4WMFA 1ABIH 2AMQA 1HAVB 5TJXA 2HRVA 5EXLA 1FX0B 2OC1A 1ZRKA 3LIWA 2EEKA 4Y10E 1NC6A 4MPWA 5C2ZA 5C1UA 2O8LA 3KQBA 4ABAA 3A84A 2AGGX 1YPJH 1DWCH 1TMUH 1F5KU 4CHAB 2QXIA 5PTPA 2PR3A 1P2OA 7GCHG 1FUJA 1LQDB 9ESTA 3GY2A 2GZ8A 4ABGA 3L3TA 1HJ9A 1TQ0B 3RDZA 5L2YH 4AG2A 1L4ZA 3O8DA 3PTBA 2OXSA 3TGJE 1LKAA 3K9XB 4X8VH 2JH6D 2BVXH 3OYPA 4U30A 3GCOA 3L33A 2FIRH 1OP8A 5GDSH 1UTNA 1BRUP 2QA9E 3CS0A 4X1NU 3EA8A 2R9PA 3ENSB 1G2MA 2QF5A 1CHOF 1SSXA 4ZXXH 3CNRA 3P95A 1GHZA 4KTSA 3QUMP 1V2WT 4NG9H 1JIMA 2WPIS 1GDNA 5LPEA 3KQEA 1TONA 2V3MA 3UB0A 5EPYA 3TVJB 2CJIA 5EODA 3W94A 1GJ8B 3HKJB 1SGRE 1RRKA 2BXUH 3BF6H 3FN8A 1C5UA 3I29A 4WXIA 1YY3A 1EX3A 1QR3E 1EP5A 2PFEA 2EI6A 1E38B 2OBOA 4RT0A 4I8JA 3SV7A 2EA3A 3A83A 4E7RG 2ZFRH 3ITIA 2A7CA 1CGHA 1Q2WA 1P2NA 1O3OA 2P8OC 1SQOA 2PV9B 4ABIA 1CBWB 1Z8IB 1DUEA 1ABJH 1OSSA 4ISOA 1Z8RA 1FONA 2G5VA 3RMNH 2QYIA 2XOKD 1EUFA 2KCYA 1TBRH 1OYTH 4ZCNA 1DLKB 1KXCA 2FOAA 2C3SA 2BD7A 4E06H 5HM9A 1A3BH 1GVLA 1K1OA 3M36A 2IJD1 1P02A 1FAKH 1SOTA 2KR7A 3UWJH 5FPSA 3M5OA 3SZNA 4H6TA 1G37A 1YCPM 1CGJE 1NU9A 4GLYA 1PJPA 3LONA 2HVYB 4KTCA 1OP0A 1SGPE 1OWJA 1HV7A 4X8SH 1KMHB 4ZAEA 1QJ1B 1A4WH 1P01A 3LGWA 1O3EA 1EAIA 2A4RA 1GMCG 1YC0A 1DY9A 1SC8U 2FXRA 2BY7X 5EW2H 2ZDLA 1ZHPA 3P70B 1K21H 1HJ8A 2ZA5A 2P8OB 1INCA 1WBGB 1O2ZA 1QQUA 1TX6A 1MTVA 2ULLA 1AUTC 3F9FA 2ZP0H 3SV8A 2SFAA 1S0RA 3RU4D 5FBIA 3SNEA 1P04A 1E1RD 1O3BA 1H8HD 2W26A 1O3DA 2WV5A 4LXBH 2QF0A 3SNAA 2G81E 4QT8C 3O8BA 1H9HE 2OUAA 2VIWA 1AE5A 2AMDA 5CHBA 1CO7E 4MPVA 1TOMH 1TMTH 1ELEE 4A7IB 1GDQA 1A0HB 5DGJA 2GCTC 5EJLA 1GL1A 2XBXA 2YMSC 2B0FA 3BG4C 5EOKA 4BAKB 3ZZCA 3N7OA 2H9EH 4UFGH 2PSXA 2K0QA 1SOZA 1MTNC 2SGFE 3LJOA 5H4IB 3N7EA 1K1NA 1UTPA 4VGCC 4INKA 1C2FA 5E2OA 4GAWA 5A8YA 1DUAA 1CQQA 1ELTA 1TX8A 5GCHG 1GBDA 3M3SA 2PHBA 5C1YA 4X1PU 4ZMAH 3PWCA 3TGIE 4I8GA 1YCPH 5JBAS 3SGBE 5GWZA 1W12U 2WPKS 1D4PB 3LOXA 5JBBS 2ZC9H 2RG3A 2UWOA 3UREA 1S81A 3BTHE 4Y8XA 2CGAA 4MPXA 1LVYA 1WSSH 2OC7A 4DT7B 2A31A 1Q31A 4MVNA 4NWKA 5T1VA 2K1QA 2STAE 2TGTA 3SJ8A 4CR9A 5HIZA 9LPRA 1THRH 3A8AA 1NZQH 4LZ4B 4M7GA 1Z71A 4A92A 1QFKH 1GGDB 2F43B 8ESTE 4FUGA 2ZKSA 1GHAG 4MTBA 5AHGH 3P8GA 1TA6A 2YMSB 4JYVH 3BTFE 3BG4B 1GBLA 3MU4A 2WYJA 4ZHMU 4NIVA 1ZPBA 2F83A 1MTNB 3RXLA 2TPIZ 4VGCB 1VITF 1XMNB 1Y3WA 1D3DB 3STJA 1FY1A 4KKDA 1O37A 1NRNH 2V3HH 2O8WA 5AVDA 2HNTE 1W7GH 3QK1A 1O31A 1MQ5A 2XC4A 1H1BA 4K1EA 5FX6A 1BHXB 5E0GA 2FYQA 3H09A 1RIWC 1ZZZA 2ASUB 3SI4H 3VB6A 1SFIA 3TGKE 5IYTA 3GICB 1TALA 1TNHA 1TNKA 2R2MB 1C5SA 1F5LA 4NSYA 2CMYA 1KLTA 4SGAE 2FOFA 2H1UA 1AVXA 4FOUC 4ISLA 1FMGA 1AKSB 4FVDA 1HPGA 5FCRA 3PO1C 2TGPZ 2Y7XA 4FUHA 1H8ED 1F92A 4ZHLU 2BX4A 4B74A 1JXPA 2HWLB 1GI9B 2G55A 2BD8A 1D6WA 1QB6A 3RC6A 1T8LA 1O5CB 1GI1A 2W7UA 3P8FA 1PPGE 1C1TA 1TOCB 1P10A 5C67A 5K0HA 1A1RA 4R0IA 4NWLA 2QGRA 3RXVA 4HG6A 2AERH 1HAOH 2F4LA 4RI0A 3UOUA 1SKYE 1C1WH 1OHHD 1WTHD 3QGNB 1TB6H 1RIWB 1JMOH 2Z94A 1ELGA 1AWFH 1HXEH 3FKSD 1F0TA 2CK3D 1C2GA 1SMFE 3U8OH 2P93A 5EXMA 2ANYA 1L2EA 4OS7A 1U6QA 1YM0A 3SJ9A 4MNVA 2AH4X 5DK1A 3TK9A 2JETC 3RXDA 1A5HA 1T31A 1TWXB 2QN5T 3AW0A 3PO1B 1HCGA 3TJNA 1VGCC 4IMZA 4BTTB 3DFJA 1DSTA 2BOKA 1IQKA 1EAXA 2ANMH 3S9CA 2BY9X 2F9UA 3KNXA 2CXVA 4A1TA 3B9FH 4K8YA 3KIDU 3UOPA 4FXGH 3RXRA 2IPQX 3S69A 4B2BA 3MQKC 1KYNA 2PW8H 3RMLH 1NTPA 3W1EA 4DIIH 2BDIA 1SLUB 4LZ1H 1TBQH 3OSYA 3RU4T 5EW1H 4WJG2 4CREA 3U1IB 4IN2A 1G9IE 1KTSB 4X1SU 2F9NA 2IN2A 1J9CH 2M5TA 1ETRH 2Q1JA 1ANEA 2FS8A 1FY8E 2WYGA 2Q6DA 3F9HA 4F49A 2FWWA 3ESTA 2FOCA 1ESTA 1KDQB 2LPRA 1ANBA 1C5OH 1TPPA 2JETB 1H8IH 1C1UH 4NZLA 3RXCA 4AFQA 4UFDH 3BEFB 1VGCB 1P09A 4K8BA 5FXLA 3LC5A 1QGFA 3L6PA 3SORA 3SGAE 2XBVA 4JK5A 1UVOA 1NROH 1E0FD 1QL8A 3A8DA 2BX3A 1TBZH 2BD4A 2GV6A 2Z7FE 3ZV9A 3TH4H 3ZZAA 2VIVA 2NU4E 5G4BA 5AFYH 3RXAA 1MTUA 3A8BA 4D76A 1SFQB 2ODYB 3N7DA 5T6FA 1W13U 2OBQA 4NGAH 4CBOA 1DSUA 1B7XB 1CA8B 1C4U2 5GJ4B 5T6DA 2YOLA 1EJAA 3GYLB 1GHBF 3M5LA 1G3BA 1NS3A 2J34A 2XCFA 5HM2A 2A4QA 1S6FA 4MQAA 2F9VA 4UD9H 2ALPA 1YLDA 2FI5E 8GCHF 1ZTJA 3CP7A 1CA0B 4B76A 4BXWA 5F8XA 4DJZB 2HALA 3K6ZA 5EPNA 1P3EA 3P6ZB 5EIYA 1GBIA 2KAIA 3V12A 1MZAA 1EB2A 3ZZ6A 2FI3E 1G30B 5DN6D 3AAUA 1AWHB 1BIOA 3GYMA 4JZ1A 1CE5A 1O5GH 2G5NA 3DHKH 5JBCS 8KME2 4FUBA 1WCZA 1THSH 3FAOA 1H4WA 3SYJA 3ZVEA 3GY6A 1MTWA 2FM2A 1NN6A 1BTYA 1BMMH 3QGJA 4AYVB 2G52A 1H9LB 1V2RT 1C5WB 4FU7A 1O2YA 3M3VA 4Y11E 3LPRA 6CHAB 3A85A 2CF8H 3E8LA 6GCHF 4Q2KA 5A8XA 1SB1H 1IQEA 4J1YA 1DOJA 3UNSA 4RT1A 1EOJA 3E0PB 2DE8A 1O0DH 2QE7D 1O3AA 3BTEE 2SNWA 2BXTH 1VZQH 3FVFB 3URCA 1K2I1 3T28A 1WQVH 4ISIH 1YF4A 1LVMA 4AGKA 4I7YH 1NY22 2FZZA 2ZF0H 1O2JA 4CRCA 2VIPA 3M3TA 1KXBA 1YPKH 1YPEH 1KXEA 1CT2E 3S7HB 1FQ3A 4D7GA 1Y3UA 1BCUH 1MD7A 3RXHA 2BQ7B 1O30A 2OLGA 2D8WA 2O8MA 3FFGA 4YO9A 5GPIB 3QTOH 1J17T 1GMDG 4HI3A 3K65B 4ISHH 1GBHA 1EATA 3M7UA 3GISB 3QTVH 1TRNA 5C5NA 2OC0A 1RTLA 3RXOA 1TPOA 2A4OA 5KECA 3FO8D 2EC9H 3PV5A 2CN0H 1GI0A 5DP9A 2J2UA 1O5AB 1OXGA 3TU7H 2ANKH 2AYWA 2Z9IA 3ZVAA 4Y8YA 3TH2H 1RS0A 2WV4A 3TJUA 1A0JA 4B1TA 5FBEA 5DJ7A 2FOHA 4NIWA 4AFSA 1SGYE 1N6XA 2GVFA 1N8OC 1O2IA 3SU0A 1W8BH 1GBFA 2FPZA 1RXPA 3M5NA 1GWAA 5BPEA 3SO3A 2ZTZA 2VVUA 3ZV8A 3Q76A 4XDEA 4OS6A 2GD4B 1S6HA 3RXFA 1EXFA 1BMFD 1O3FA 3UR9A 2CHAC 2XC0A 3F9EA 4OS2A 2XNIA 4OGXA 1QY6A 1EZSC 3EYDA 3SGQE 1K1JA 1B5GH 1V2QT 5GXPA 4ABEA 1GBMA 1Y8TA 3A81A 3EAJA 1P12E 1FAXA 1HDTH 1ANDA 2RCEA 1AFQB 3OY5U 4TWYA 4INLA 2J9NA 1N6YA 4HTCH 3F0PA 1EAUA 1P05A 1S6LA 2W5EA 2ZQ2A 2JH0D 3TPIZ 3ELAH 1OP2A 1NFWA 4X2WA 3K2UA 1UVPA 3BEUA 2BD3A 2BDYA 3FOAA 2AIQA 3VXEH 3KN2A 4I86A 4XFQA 2VU8E 3DCLA 2K8IA 4OM9A 1CHGA 1XXDA 4U32A 2CHAB 3U28C 1G3CA 5E0HA 3EDXB 5EG4A 1O2PA 1TMBH 4YT7H 3UAIC 3GCHC 3NCLA 5HXFA 2ODQA 3GDUA 2GZ9A 3MU8A 2BQ6B 4GCHF 2LELA 1UTQA 1V2MT 1ZMJA 1ID5H 2I6SA 5EXNA 1ELVA 3RXJA 1QBNA 1ZMNA 5B6OA 4UDWH 3ATWA 1HIAA 1TGTA 1C1VH 1GI3A 1EPTB 3AASA 4MNWA 4DVAU 2IOTA 3LDXH 1HAYB 2G00A 2R0LA 1VCPA 4A5TS 3MU1A 3RLYH 1C1SA 2QAAA 1TE0A 2BMGB 3PLBA 1O2OA 1LKBA 1TPAE 1FIWA 1Z8JB 1CT4E 3PB1E 1SI5H 1VCQA 1BQYA 3U1JB 3BG8A 1GG6C 1SGTA 3GDSA 5HIYA 1IQJA 1FJSA 1LPZB 2ANWA 2WPHS 5KGOA 1UVUH 2SGEE 2PTNA 1W10U 3UTUH 1G36A 1QJ7B 2RFKC 4KP0A 2W3KA 4UEHH 1P57B 1XXFA 1SBWA 1YWUA 1XM1A 3WWFA 1LVOA 4ABJA 4Y7BA 4CR5A 1DT2A 2XW9A 1L1GA 2GTBA 3BIVH 1QB9A 3T62A 1GJ6A 3RM0H 3SV9A 2H2ZA 2VH6A 3S9BA 1GJBB 2DE9A 5CHAC 2A45B 2J4IA 1WU1A 2THFB 3PYHA 4JK6A 4CH8B 1NRRH 4Y6DA 2UUKB 3H5CB 3A87A 5A8ZA 3ZZDA 1A5IA 1YPHE 3MWIU 2D1JA 1NBME 1GG6B 1O2NA 2TIOA 2PGQB 4BNRA 4F55A 3SU1A 2C8YB 4FUFA 4BANB 1FN8A 3LJJA 2WSSD 3RXKA 1DWBH 1UW7A 3F3BA 3TJOA 1O35A 1W0ZU 1P9UA 3M35A 3KYGA 2VGCC 5DP3A 2JJ1D 3KYFA
chains in the Genus database with same CATH topology
4WXVA 1H9IE 3HK3B 1XUGA 1Z6EA 3IG6B 4X8TH 2BM2A 1V2VT 1OWIA 1XUJA 3T29A 5LPRA 2FLBH 3HGPA 1NRQH 2Z3CA 3MO6A 1P2JA 1CHOG 4OGYA 2C8XB 1HAIH 5DG6A 1UO6A 3TH3H 1F5RA 3RUOA 1LPGB 2J94A 1ARBA 2ILNA 3GY7A 1NFUA 1HAZB 2PGBB 2QXGA 4BXSA 5A2MH 1J14A 4RSPA 3A88A 1Q3XA 3WY8A 1A46H 3A82A 3A7VA 5DO4H 4MPUA 3MU5A 3RXGA 5LPFA 1Y3VA 1TGNA 1ELFA 1IQGA 2UUFB 1K1IA 5CMXH 2VGCB 1J8AA 1QIXB 4IN1A 1C1PA 1EB1H 2RA0A 1CT0E 4X8UH 4NA9H 4R8TB 5A0AE 2ZDNA 1T8MA 1D3QB 6ESTA 1NRSH 1W3CA 3MNXA 4FUCA 7LPRA 3SHAH 3VB5A 5L30H 4I32A 1P8VC 1V2OT 3NXPA 3T25A 1O2KA 4YTAA 4NA7A 3HK6B 4JMYA 2PKAA 1GCDA 1O5BB 1MZDA 2ZU5A 1E35B 2OC8A 1SQAA 4JZEH 1D9IA 2CF9H 1FY4A 5E0JA 4WMEA 3VGCC 2ZCLP 1GMHF 1UHBA 2XBYA 1W7XH 3GOVB 2GCTB 5HYOA 2NWNA 2ZFPH 1PQ5A 5I25A 3A80A 2GX4A 1O2WA 2QV1A 1Y5AT 3QZRA 1AY6H 1C2JA 3H7OA 1FXYA 1HJAC 5C5OA 5I46H 1KY9A 3UR6A 3NWUA 4KTUA 3FP8E 1Z1JA 1FY3A 3ZZ5A 3D62A 1K22H 2FMJA 3I78A 1WTGH 3SJKA 3EA9A 1GVKB 1YP9A 3D49H 2HNTC 2AGIX 3EBNA 4I8KA 5DP4A 5J4SA 1ZJDA 3S0NA 1NRPH 5ETXA 1TABE 1LPKB 3P92A 1E37B 1QTFA 1FN6A 1S5SA 2FOEA 3MNBA 4TPIZ 2BLVA 4B73A 4XE4A 2BLOA 2BLWA 1EZQA 1C2MA 4BAOB 1UTKA 2GCHF 2GDDA 1SG8B 4Q7ZA 3VGCB 3RMMH 3F1SB 3DUXH 1O5EH 1DLEA 1O3CA 2OQ5A 1O2XA 1CSOE 4WWYA 1ZR0A 1OYQA 2GZ7A 1QL9A 4NCYA 1QHRB 3A7TA 4ABFA 1HJAB 2QXJA 2VB0A 1PPCE 3ODDA 2Z3EA 2AGEX 2A0QB 1S82A 3E6PH 1HGTH 1J15A 2A7HA 4CRAA 3R3GB 3EGKH 1TYNA 3UUZA 1DWDH 1NPMA 1UCYK 2BVRH 5DKMA 1JRSA 3MO9A 1GJ4H 2ZGXH 4RN6A 3E3TA 4O03A 1QL7A 1BBRK 1IOEA 1JWTA 3BTME 1YPGH 2Q6FA 2A5IA 1SGIB 1GBCA 3RC4A 1O36A 2C90B 4K3JA 3BTDE 1TNGA 2QY0B 4FU9A 1C5MD 1H8DH 4YOJA 2Y7ZA 1UTOA 1BHXF 2K7XA 2XC5A 4E05H 3GCTF 5FPTA 3V13A 3V3MA 3C1KA 3ODFA 1MU6B 1GL0E 2P16A 1JIRA 2ZHQH 2ZFQH 1TGSZ 3UQOA 1OWHA 5JBTA 4X6OA 4ZKNU 1TRYA 3IITA 3SU2A 4GUXA 1TIOA 1GBTA 4U2WA 1DS2E 4LK4A 3SNCA 2TRMA 4IMQA 3ZVCA 1YPMH 2F91A 4GHQA 1BOQA 2ZG0H 2FX4A 3D23A 1NT1A 1HAGE 2Y6TA 1EZXC 3SU3A 3ZVGA 2BHGA 1G2LA 1Z7KA 3ZVFA 1C2DA 1GJAB 1KTTB 2PTCE 4RKJB 1V2ST 1EJMA 2AMPA 1PPEE 2NU2E 2UUJB 2ZHEH 3DFLA 3I77A 2V35A 2PUQH 1T7CA 1A3EH 2ZCKP 1PQ7A 1HAXB 3Q00A 4KELA 4UFEH 3SW2B 1FIZA 1HAPH 3RXTA 1P06A 3MNCA 1HAVA 1C1QA 1MTSA 4H4FA 4H42U 3VB4A 2A5AA 5FPYA 1YKTA 1E36B 5F8TA 2OD3B 1C2EA 3URDA 3SV6A 4NA8A 1OS8A 1MUEB 1BRCE 1FZZA 3SUFA 7ESTE 1ELDE 1KXDA 3S9AA 4K1SA 4CRGA 4Y0ZE 3LGTA 1ETSH 1LQEA 1SGFA 4RKOB 1XKAC 4Y7AA 1MAXA 1THPB 2OP9A 1AU8A 2Y82A 1TLDA 1EPTA 3RLWH 4X1RU 2EI7A 1AE8H 1TGBA 1HFDA 1BTPA 3E0NB 4XSKU 3UWIA 4ZROA 2BLQA 3JZ2B 2A2XH 3LH1A 1QB1A 5E2PA 1C5RA 1Y3XA 1EP6A 1XUKA 2GV7A 2WPLS 4Y71A 3DT0H 5C3NA 1ZPCA 2PUXB 4JCNA 2G4UA 1L1NA 1RD3B 4ISNA 4K69A 2V6NA 1BB0B 3SUEA 1YLCA 1HAHH 3BSQA 3ZZ8A 4CBNA 1TFXA 3TK5A 4X6PA 2V0BA 1LHGH 4AORA 1EASA 1V2LT 1V3XA 3K6YA 1GBBA 2SGPE 1ESAA 5AF9H 2ESTE 4NZQA 3FANA 3E16B 1VR1H 4E7NA 2ZEBA 3HGNA 1YPLH 2R3UA 1T32A 2R3YA 1EJNA 1ZTLA 2P3FH 3RXEA 4K5ZA 4D9QA 2GKVE 5EQRA 4UE7H 3KF2A 1DXWA 1SLXB 1NO9H 5EQQA 1LTOA 4B75A 4BAQB 1GJ5H 2UWPA 4XOJA 2NU0E 1MD8A 1SGQE 1Y3YA 2VWLA 2XWAA 2ZFSA 2Y80A 2VIOA 4AYYB 1ZJKA 3GY4A 1GJDB 4ZXYH 1O3MA 1HYLA 2VWOA 2P3TB 1ZPZA 2ZDVH 4PROA 4ZKOU 2ZNKH 3PWBA 3MI4A 1GI7B 3BTKE 3LC3A 4I31A 1O32A 1V2NT 3UFAA 3RXMA 4THNH 1C1NA 1KXAA 4OS4A 1HRTH 1QRZA 1O2LA 3NZIA 2ZU1A 2FS9A 1GDUA 1DVAH 3SU5A 4ASHA 1GHBG 5LGOA 5E8EH 1C5LH 4D9RA 1DWEH 1MKWH 1KSNA 2XRCA 3IWMA 3F6UH 1A0LA 1OWKA 3QDZB 1A5GH 2FEQH 4WH6A 2PWXA 8GCHG 2Q6GA 1GHWH 3LGVA 2QC2A 4IGDA 2ZDKA 3P8OA 3LU9B 1UMAH 7GCHF 2Z9JA 2C93B 4ZKSU 4J2YB 3ATLA 4IW4E 5C1XA 1BT7A 1FNIA 5DP5A 2V3OH 3ZVBA 2A5KA 5HGGA 4B2AA 2Y5HA 2FTLE 1C5NH 2BD9A 1DPOA 3OTJE 3PROA 1AGJA 1DXPA 1EQ9A 1V2KT 3CS7A 2HPPH 3LKWA 2ZECA 1L1JA 1EZUC 3SJIA 1C2LA 6GCHG 3NPSA 1T4VH 4JYTA 1YCPK 2BZAA 2QF3A 4HGCA 2SNVA 4FUIA 4JZFH 4X6MA 2O8UA 2BDCA 1EAWA 5L6NH 2NU1E 1IQMA 1ACBE 1P03A 1ARCA 3G01A 1SL3A 4CRFA 1G32B 4MLFB 1HBTH 2UUYA 1BJVA 1OOKB 5ESBA 3RXBA 3VPKA 1CGIE 4U01A 2BY5X 2FO9A 3SUGA 3U8TH 4XBDA 1N8OB 1AD8H 5EU8A 2ZGHA 1C5ZB 2STBE 3UNQA 2OTVA 3ZYEA 2ZU3A 2BYAX 3W95A 3R0FA 1OWDA 5HMAA 1C2HA 2QIQA 2EI8A 2FP7B 3PM3A 1NFXA 2O9QA 1DDJA 4D7FA 2GT8A 5DP6A 3BIUH 5T3HA 1ZSKA 3Q77A 1UCYE 1BTUA 2ZHDA 3PV4A 1AZ8A 1O5DH 4JZIA 3T26A 1VITH 1FPCH 5A09A 2FDAA 1BBRE 2IJOB 1GVZA 3VB7A 4AOQA 1C5XB 1ZHRA 1AKSA 2AFQB 1O3NA 1GHYH 4YLUA 4FUJA 1GMCF 2BDHA 3Q3KA 3KGPA 1ZGIA 2GP9B 4DY7B 1SLWB 1XUIA 3BV9B 1O2GH 1LHCH 2XYAA 2WINI 4X2VA 2QXHA 1CBWC 1NFYA 2Z9GA 1A61H 4AX9H 3DA9B 4MG3A 1AVGH 1GJ9B 2W7SA 1ELAA 1OPHB 1O2MA 2P59A 3ZZ9A 3EQ0H 1ESBA 3QO6A 3GCHB 1HB0B 1GPZA 4ZKRU 3MHWU 2J95A 1QCPA 3RXSA 3GY8A 1E34B 2SGAA 1TNJA 2ZU4A 2Y5GA 5EQSA 4AZ2B 2VVCA 1WV7H 2Y81A 3BTGE 1TRMA 3PMAB 3MFJA 1C5YB 2TGDA 1F0SA 4TYDA 2ZIQH 1SHYA 1C5PA 1A7SA 2C4FH 2P95A 3P17H 1W2KH 2KAIB 1BTXA 2SGQE 1SLVB 4DW2U 5FAHA 2ZTXA 2H9HA 4FUEA 1GI2A 3NUMA 4X1QU 2ZHFH 3S7KB 1GI6A 2ZDAH 1BRBE 2B8OH 1PFXC 5GCHF 5J4QA 3TNTA 2P94A 2XTTB 2FTMA 1AB9C 2BDBA 3EE0B 3H7TA 1NU7B 1DFPA 1V2UT 1MCVA 1P2KA 2ZI2H 1T4UH 4SGBE 1V2TT 1YPHC 1NM6A 2XCNA 3AW1A 1UTJA 2F9OA 2ZCHP 1SPJA 3SNDA 1QURH 1MKXH 5ABWA 1ELBA 1P9SA 1GHVH 1SQTA 4GCHG 1FDPA 2Y5FA 3KEEA 2HGTH 2FLRH 1WYKA 5JPMH 3E91A 2W3IA 1V2PT 3ZZ7A 3B8JA 1AVWA 4K2YA 4UFFH 1X7AC 1GHAF 4A6LA 2XBWA 4GHTA 1KDQA 1P2QA 1RTKA 2WUCA 4K60A 2B5TB 2ZWLH 2ZQ1A 3TK6A 3GY3A 1SGCA 3ZZBA 4JZDH 3BTQE 5CHAB 1D3PB 3A86A 1DE7H 4Q7XA 3M7TA 2A7JA 2HVXA 1DICA 1K1MA 1ZSJA 2ZGBH 8LPRA 1MBQA 2FOGA 3SJOA 4X2YA 1CVWH 1AB9B 1DANH 4CH2B 1B0EA 1SR5C 1IHSH 1O3JA 3RXIA 2TGAA 3P8NA 1WUNH 5TCCA 4AB9A 1LMWB 2XXLA 4NIYA 1O2RA 1PPHE 1O3IA 1S0QA 3GY5A 3BTTE 1LCYA 1RTFB 4AGJA 1GGDC 1D6RA 3ZVDA 2GDEH 2HLCA 2ZDMA 2G8TA 1ZYOA 1C4Y2 1C5VA 4DCDA 1LHEH 1QBOA 2BQWB 2FI4E 1FV9A 2VINA 4O3UA 1SGFG 1HXFH 3UPEA 3MH4A 4B71A 1Y59T 5JB8S 5TCAA 5BRRE 1O3KA 3VEQB 3RM2H 3TJVA 1BUIA 3AAVA 3O8RA 1C5QA 2G4TA 1KXFA 4WF8A 1WQSA 2B7DH 1PQ8A 1O3LA 4YM9A 3GDVA 1M9UA 1KLIH 4XBBA 3VXFH 4DG4A 5T6GA 2FODA 1XVOA 3KHVA 4ZUHA 4BOHA 2UWLA 3ATMA 4O9VA 3PMHB 1P0SH 2H9TH 3OY6U 2GGVB 1QRWA 1MAYA 4ESTE 1F0RA 1IHTH 2C8ZB 4O97A 1AI8H 4DGJA 3PLPA 3M5MA 1ORFA 3M37A 4I8HA 4BTIB 1BRAA 1GCTC 3RXQA 3RP2A 1O2VA 4TY6A 1DY8A 1RFNA 5L2ZH 4F4OC 1PPFE 2F9BH 4DOQA 3V0XA 1BMNH 3HPTB 1MCTA 4YOIA 5FCKA 1K28D 3SU6A 2ZU2A 1K1PA 2BB4A 1BDAA 3NKKA 1FI8A 3F9GA 2QCYA 1BZXE 3SQEE 1T8OA 4A1VA 4DIHH 1UTLM 1W0YH 2ZFFH 1UK2A 3MU0A 2VWMA 5F6MA 2FX6A 2WPMS 1IQNA 2R0KA 4ZH8A 1HUTH 4GVUA 2JKHA 4WMDA 3O8CA 1ZHMA 1GI4A 1EOLA 2BZ6H 1Z1IA 1ZLRA 1HIAB 4Y76A 2HOBA 3M61U 3RXUA 1MMJN 1BMAA 2ZTYA 1ETTH 1XUFA 1QJ6B 1GCTB 2JH5D 1BJUA 1ZRBA 4AFZA 3KL6A 3HKIB 2BY8X 1C1RA 1Y5BT 1JOUB 4K1TA 2BOHB 4AG1A 1AZZA 1A2CH 1AHTH 1B0FA 2BDGA 3KCGH 1O2UA 3SV2H 2RDLA 1T8NA 3BEIB 1SGEE 5A0BA 1MKWK 2Z6BD 4FUDA 3GCNA 2A1DB 1QA0A 4ABBA 1GMHG 1PPBH 7KMEH 2FYRA 5F03A 3FZZA 1UK4A 1TQ7B 3PLKA 4X6NA 3SU4A 1VCWA 4WH8A 4YESB 3BN9A 3ATIA 3KQCA 1G3DA 1DX5M 2WUBA 1GI8B 1PYTD 2ZO3H 1AO5A 1S83A 2WPJS 4OS1A 4H6SB 1VITG 5GIBA 1ANCA 1XVMA 1Z8GA 2FESH 4INHA 1TNLA 1V6DA 1XKBC 3TNSA 1XX9A 1TGCA 3RU4E 4X2XA 1ZGVA 3HATH 1O3PB 1OWEA 4BAHB 3NK8A 3MH5A 1OX1A 3PTNA 3A89A 3D65E 1BTHH 3QLPH 1DM4B 1JRTA 4GPGA 4Z0KA 1BITA 4WY3A 1ELCA 1YBWA 1O3HA 5CE1A 3SHCH 2Z9LA 4DURA 2ZZUH 3LGUA 1IAUA 1RGQA 2VIQA 5C20A 5IDKA 3MYWA 4ABHA 2H5CA 2AS9A 1XUHA 2ODPA 3SBKA 2AIPA 4KGAA 3T27A 1QA7A 2BDAA 1GBKA 2GCHG 1MQ6A 2HNTF 3MO3A 1LO6A 2D2DA 1QQ4A 1SGNE 2ALVA 2VVVA 3MNSA 3F68H 1CU1A 3A7XA 1BTWA 1KLJH 2P3UB 3UIRA 5K7RA 2GMTC 1ZMLA 1TX7A 4CRDA 1TA2A 5F8ZA 3U98H 1C2KA 1ZTKA 2VH0A 1O3GA 1VJAU 3Q3XA 2ZPSA 4ABDA 2CV3A 3LGYA 3MMGA 3UY9A 1UK3A 1AFEH 1PQAA 1CA0C 1C5TA 1TNIA 5LH8A 1P2IA 4A1XA 5JDUB 5JYIA 1O33A 4TWWA 3ATKA 4IBLH 3SQHE 2A32A 1TAWA 3LT3A 3SOSA 3JZ1B 3GCTG 1K9OE 1ZOMA 1GJCB 2G51A 4NFEA 2PKSC 2BY6X 1LDTT 1GBAA 1NESE 3U69H 2GMTB 2LIZA 1GMDF 2VWNA 4IC5A 3SI3H 5JB9S 2H5DA 4Q80A 3CENA 2NU3E 1S85A 6CHAC 1O2TA 2D26C 2ZHWH 2GT7A 1IQHA 1SHHB 4LOYH 3RXPA 1P11E 2A2QH 3QN7A 3ZZ4A 1F0UA 1J16A 3TIUA 3U8RH