3D62A

Development of broad-spectrum halomethyl ketone inhibitors against coronavirus main protease 3clpro
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
299
structure length
299
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Development of broad-spectrum halomethyl ketone inhibitors against coronavirus main protease 3CL(pro).
pubmed doi rcsb
source organism Sars coronavirus
total genus 65
structure length 299
sequence length 299
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3d62A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3d62A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3d62A02
3QTVH 4WWYA 3P8FA 1VITF 5EPYA 3UR9A 3SUGA 1GJ6A 1MKWH 1T8LA 1HGTH 1KLTA 1TFXA 2O8UA 2D1JA 2XTTB 4XDEA 3URDA 1QQ4A 3PYHA 5EOKA 4KP0A 2V0BA 2EC9H 2GZ7A 2Y80A 2Y81A 2EI6A 2GTBA 1GCDA 1F2SE 1NT1A 1GHVH 2PTCE 3TJVA 2HRVA 2BD9A 4FUBA 3SU6A 2ESTE 2AGIX 2FYQA 1ZMJA 1A46H 1GI0A 4K1SA 1G2MA 1TB6H 1MKWK 1AKSA 1GL1A 1AY6H 1A61H 1SHHB 1JRSA 2SFAA 3BIVH 3FZDA 4I8GA 4Y6DA 3BTWE 3I78A 4KTSA 3GCTF 2A31A 1O2TA 1FNIA 4OS1A 3TGJE 4JZ1A 4TPYA 4NCYA 3SHAH 3H5CB 3S69A 3OSYA 3D23A 3L3TA 1S6HA 3CP7A 1MTNC 1EAXA 4FU9A 2A32A 3ODFA 2UWPA 4Q2KA 1NESE 1UO6A 3KN2A 3I29A 1RTKA 1ARCA 1GBMA 3QLPH 1D6RA 2O8LA 1RTLA 5CMXH 3CS0A 4YT6H 2GT8A 2GV7A 4XBCA 4ZKSU 2BZAA 1KY9A 3NK8A 3A7XA 2IJOB 2Z3DA 1OOKB 4A5TS 4SGBE 2YNBA 2LPRA 3GY5A 4JYTA 1FPHH 1RFNA 1O2KA 1A0LA 1N6XA 1N6YA 2C8ZB 1UK3A 1Z8RA 1ZYOA 2F9OA 2BX3A 1V2WT 2ZDAH 4UEHH 1O3KA 3P92A 4NA8A 1G37A 1CE5A 1EP5A 1GBCA 4TY6A 3ZZDA 2O8TA 2G55A 3RMNH 3GCHB 1GCTC 3A7WA 2PGQB 1V2JT 4Y7AA 3KIDU 1X7AC 5DJ7A 1F0RA 5DGJA 1GDQA 3SU4A 2ZHFH 2Y5FA 1P10A 5GDSH 3A85A 1GMHG 3IWMA 3STJA 2RCEA 1O3OA 4YM9A 1UHBA 4I7YH 2C3SA 1YPGH 2JETB 2GCHF 1N8OC 3ODDA 1T7CA 1KYNA 3OTJE 3VPKA 3LOXA 2WYGA 1AVGH 9ESTA 1ELEE 2A4GA 4UD9H 1TIOA 1THSH 2HOBA 2UUKB 5JBAS 1MMJN 1EJNA 4NGAH 1OWEA 2CF9H 1HAIH 5FX5A 2FTMA 1BA8B 2SGQE 2OTVA 2UWOA 1FI8A 1TPOA 1V2OT 1OP2A 1AKSB 3QZRA 4ABAA 4AYVB 5BPEA 5T3HA 1A0HB 1YPEH 2WYJA 5ESTE 1FAKH 2UUYA 3RXJA 3SGBE 1CU1A 5C1YA 3UR6A 2BMGB 4E05H 1W2KH 2GCTC 2A1DB 1O31A 1CT0E 1AWHB 1P05A 3GYLB 3DHKH 4DCDA 3VGCB 1AUTC 3SO3A 3EE0B 9LPRA 1O2JA 1VZQH 1C9TA 2BVXH 2Y6TA 1TGSZ 1Y5UT 2FOMB 4BOHA 1O2LA 1AN1E 2FI4E 2FIRH 3MH4A 3GCTG 1O2UA 2ZU3A 4LZ4B 3SN8A 1SVPA 3URCA 1WBGB 1GJBB 2P59A 1O3EA 1ZRKA 4ABGA 1J8AA 5C5OA 1Z8GA 3TJUA 4MPXA 1NC6A 2NU0E 1P11E 3PMAB 1NY22 3RC4A 5FBEA 3SU5A 1D9IA 3RMLH 3BTME 1TALA 1YF4A 2WV4A 2XWBI 1GJ8B 3K65B 2ALVA 3TH4H 1TWXB 1GHAG 2CMYA 3LJOA 4U30A 2SGEE 1C4Y2 3RXIA 2ZU5A 2J95A 4X1QU 1O2SA 1GVLA 1Q3XA 1DWEH 3E6PH 4DT7B 2H5DA 4AFZA 2CN0H 4HI3A 4AFUA 2G52A 4GUXA 1ZGIA 3RXVA 8ESTE 1GMCG 4JZEH 2PHBA 1P06A 5IDKA 1QQUA 1GI4A 4ZROA 1WU1A 1JWTA 1ELAA 1MD7A 1ZR0A 2BLQA 2PKAA 2VWNA 3GISB 4ZUHA 2BD4A 5AFZH 5HYOA 1EAIA 2K1QA 1WV7H 2ZQ2A 2GT7A 2AIQA 2BDGA 1W0YH 3GCOA 4I8KA 3LGYA 3GCHC 2ZCKP 2HVXA 1EUFA 2IPHA 4NIXA 4X0WU 3O8RA 2W3KA 2C90B 3UOPA 2Z3CA 1TONA 5FCKA 1GBJA 2BLVA 4A92A 2V6NA 2BM2A 4YLUA 2C8WB 2XC4A 5A8YA 2FZZA 2J9NA 1GI3A 1C2GA 1GJ7B 1ANCA 4MQAA 5E0HA 2ZDNA 1EKBB 1QBOA 4OS2A 2JETC 2EEKA 1ANBA 4BAOB 1XUGA 2PW8H 1O2NA 4RN6A 3RMOH 3TITA 2P93A 5JBTA 1GBKA 1SG8B 4Y7BA 1E38B 2D8WA 1Y3VA 5HGGA 4A1VA 3GY6A 1P2KA 1GI6A 3ZZ3A 1W7GH 1YKTA 1DM4B 4XE4A 4Q80A 3OX7U 3PMJA 2ZPQA 3ZVBA 3IITA 1TMBH 2FOHA 1K1MA 2A2XH 2ZPRA 1O2GH 3LIWA 1S6FA 3VB3A 3RXDA 2WPIS 1HAVB 1AE5A 2V35A 1UTPA 1V2PT 2XBYA 3TJNA 3MH6A 3QGJA 1NFWA 1C1QA 1C5OH 2KAIB 1ZMLA 3RXFA 1FN8A 5EW1H 1DT2A 4ABDA 3PM3A 1SFQB 4THNH 1WTGH 2XRCA 1HAXB 1ZHRA 1RS0A 2J2UA 1O3CA 1CA0B 1GJDB 1VGCB 1C2FA 1C1OA 2W7UA 3VGCC 1ZJKA 2JH0D 3LKWA 1SC8U 1DY8A 4K3JA 4ZH8A 1KXDA 4FXGH 1ZSLA 3NZIA 1V2KT 1YPKH 1WQVH 3M37A 1V2MT 1OP0A 2OBQA 5GCHF 4ZKOU 2CXVA 1QBVH 1FY5A 3MNXA 4XBDA 1EXFA 8GCHF 2ZFSA 2ZDKA 3ZZ7A 2PKAB 4X6NA 2VWLA 1MUEB 4I32A 4ZKRU 4ABBA 1O33A 3FP8E 1H9IE 5FPSA 1CT2E 4B74A 1NRSH 1O32A 4ZHAA 3TPIZ 2F9PA 2QAAA 1GHBF 1XXFA 3BTKE 4JZDH 3MU4A 2QC2A 1IAUA 2R0KA 2PR3A 1VCPA 2ZTZA 1TLDA 4NZLA 4OS7A 8LPRA 1IQKA 3BTGE 2FXRA 5FCRA 2HNTC 4A1TA 5IYTA 1NFUA 1C5TA 3JZ2B 3D62A 2HNTF 2Z9GA 5HM2A 1MTSA 2OP9A 1C2KA 3UY9A 1TA2A 4Y10E 2ZF0H 5FHTA 4YTAA 1SHYA 1O3DA 1SGDE 2ZIQH 3C1KA 3UFAA 2ZFRH 2GVFA 1FZZA 1VJ9U 1GG6B 4CR5A 3RU4T 1GJ4H 1PPFE 1HAGE 1RTFB 4KKDA 4A1XA 4IN2A 1HB0B 3T62A 1AQ7A 1JOUB 4CBNA 3VB7A 4YOJA 1ETRH 3M7TA 4B1TA 5DP9A 4DW2U 4DURA 3RU4D 1LQDB 4D7GA 1TRYA 1FY8E 3B8JA 1XM1A 2WPLS 1G3CA 3V13A 1EOJA 3EAJA 3MU5A 1K1JA 1EB2A 1GBEA 5BRRE 2FEQH 3A87A 2FX6A 2HPQH 1NRRH 2BXTH 2I6SA 4JZFH 4K8BA 2VNTA 1FUJA 1GI9B 1LVOA 3MU8A 2AMQA 1TBQH 1BMNH 4MPVA 3TH3H 1KXBA 2F9UA 4X2XA 1B7XB 3UUZA 5EQRA 4Q7YA 3TGIE 1OWDA 1TNJA 3KQEA 1TAWA 3NWUA 1S83A 3MFJA 1P3EA 3PWCA 1G36A 2ZFQH 3ZVDA 1KSNA 1BB0B 4K2YA 6GCHF 1CHOG 3RXKA 1SL3A 4I8LA 3VB5A 1P3CA 3E3TA 3MU1A 1BRAA 5C20A 1P2QA 4MNYA 2ZA5A 1BJUA 2ZGXH 3MTYA 3U9AH 5F6MA 4LK4A 3E0NB 2UUFB 5GCHG 3LH3A 3ZV9A 2WV5A 1GMDF 4WMEA 1CA0C 1YGCH 1VGCC 2VJ1A 3BF6H 1CT4E 1ZSJA 1BZXE 2PLXA 4KTUA 1ETTH 2H9EH 3SUFA 4VGCC 1C5NH 3N7OA 1T32A 5JYIA 3T2NA 2STAE 1Z1IA 2VU8E 3BTEE 4CH8B 4K1TA 1TX6A 1NZQH 2O8MA 2ZGCA 2FX4A 2GMTB 4OGYA 3RXSA 1C1UH 4HZHA 3UNQA 2UWLA 1ZTKA 1UMAH 3MNBA 3PLKA 4FUCA 2A7CA 2ZECA 1M9UA 3MH5A 2ZFPH 3T26A 1TX8A 1DICA 5LGOA 1W3CA 1HBTH 4XOJA 1GI5A 4B76A 5L6NH 1MQ5A 3S7KB 1TOMH 1GGDB 2K7XA 1UJ1A 3PTNA 1V2ST 2OC8A 2Q6GA 1Z8IB 3ZZ5A 4AN7A 2ANKH 3K6YA 4D9QA 1MKXK 5JB8S 1SLUB 1TPSA 3L33A 3A7ZA 1W12U 4DGJA 3VXEH 3SHCH 5DK1A 3RM2H 3AAUA 1QL9A 2FOAA 1TNHA 2VVUA 1W11U 1SLVB 3ZVEA 1C2DA 1GG6C 4GLYA 3SGQE 2P8OB 1A7SA 4RKJB 1QHRB 3M7UA 1SLXB 1G3EA 1MCVA 2GD4B 3LPRA 2G4TA 2HALA 4JYVH 2SNWA 3MHWU 1A1RA 1MZAA 3BG8A 4K8YA 1AZ8A 5C1XA 4FU8A 4X1SU 4Q7ZA 4Z6AH 2EA3A 4FUFA 4IBLH 2ZGHA 4UFFH 1BT7A 3LJJA 1SSXA 1TYNA 3GY2A 3C27B 1A4WH 3GY3A 2W3IA 4WVPE 1YCPM 2F91A 3FP6E 3ATIA 2BQ7B 2DUCA 1UVSH 5E8EH 4IMQA 5T6FA 4YT7H 2XCNA 2A5KA 3U69H 3ELAH 3E1XB 3T29A 1W10U 4TWWA 3EQ0H 3RXUA 4BTTB 2SGPE 4ABHA 4FVBA 2F9BH 3AW1A 1GI2A 2XW9A 3A80A 4GHTA 6ESTA 1FMGA 4GCHG 1NM6A 1NFXA 2ANYA 4ZXYH 4CHAB 1O2XA 1BHXB 1QRXA 1TNKA 4AORA 2H9HA 2ZHWH 1XMNB 3QZQA 3UOUA 2PV9B 2GX4A 1XUJA 3SNAA 1Y3WA 2VINA 3DUXH 4GAWA 2VB0A 1PQ5A 5C5NA 3SV9A 1QL8A 5HMAA 1KXFA 1TRNA 1PQAA 4ESTE 5CE1A 1A2CH 1FQ3A 1MD8A 4LOYH 1INCA 2P16A 2FM2A 5FAHA 1DFPA 4YZUA 1UTNA 2BDIA 3A7TA 3S9CA 1O2ZA 1AB9B 4J1YA 3LGUA 1P2MA 1UTJA 4O03A 4R8TB 2Z3EA 1DWDH 1JMOH 1YPHE 2BD3A 1O3GA 3H7OA 4FUJA 1DXPA 1LO6A 3TNTA 5DP7A 1XUFA 2PKSB 4ZMAH 1SB1H 2ZU2A 3BTFE 1QRWA 4AGKA 2B0FA 2GMTC 3RXRA 3TGKE 1C5MD 3SJ8A 1C1PA 3ZYDA 2UUJB 2R9PA 2QA9E 2VIDA 2ZI2H 2J34A 1BUIA 1TPAE 1C2IA 4X6MA 2ZU4A 1VCQA 3VB6A 2BY6X 1SPJA 4CRBA 1SI5H 3SJOA 3E91A 1ELVA 3LC3A 4ABEA 5DP8A 2A5AA 1GGDC 4NSYA 4XFQA 3A8BA 3LGWA 1RJXB 5ETXA 3S7HB 3FVFB 3PTBA 1E35B 1E37B 5A8XA 1CSOE 4AX9H 1AI8H 4BTUB 3FFGA 1THRH 4AG2A 4F49A 3SGAE 7GCHF 1C1MA 1LKAA 1Q31A 3M7QA 1ELDE 1NROH 3ZV8A 1C2EA 3Q77A 1V2TT 1KXAA 1LHCH 1DLKB 3R0FA 1F0TA 2BLOA 3ESTA 3M3TA 1P2NA 2P8OC 1VITG 3SNEA 1SMFE 1P2JA 1WUNH 1IHSH 1GHWH 3GY7A 3PO1B 2BY8X 2C8YB 5E2OA 1MZDA 4H6TA 1GI8B 1HIAA 3ZVAA 3ZZ9A 1NN6A 3UIRA 1P9UA 2FOBA 1UVOA 3SJKA 2CV3A 4X1RU 1SGFG 1SOZA 1L4ZA 1QCPA 3LGTA 1GBLA 1BDAA 1ZPZA 1DXWA 2A45B 4O3UA 1E0FD 5C67A 4JZIA 1NRNH 1SGYE 3QTOH 1SFIA 3ZZ8A 2OXSA 3M5MA 4E7RG 1OWHA 1PPCE 1FY4A 1TGBA 1O34A 2Y82A 4AG1A 1TBZH 3G01A 4Z0KA 3UWJH 1O3IA 1P8VC 7ESTE 1S81A 2BD8A 5J4SA 4X1NU 4X2VA 2BDAA 4CHAC 1HNEE 5DP6A 5GJ4B 1LDTT 2D2DA 4JCNA 3SOSA 2VIPA 5DPAA 1K1PA 3U8RH 1FY3A 4O9VA 1OS8A 3W94A 3U1JB 3SI4H 1UHBB 4CRDA 2WUBA 1O5GH 1KDQA 2NU4E 4GPGA 3AW0A 1HPGA 4MNWA 1KTSB 3LDXH 4NA7A 1P9SA 1Z6EA 1WYKA 4IC6A 4U2WA 1A5GH 1AB9C 1AVXA 1BTXA 3A8CA 2AGGX 2ZFFH 1OPHB 2QY0B 1HAPH 1GPZA 3RXHA 1AFQB 2HWLB 3QWCH 1P2OA 4MPUA 3A86A 1QURH 3ATWA 2FWWA 1YP9A 5GIBA 1CQQA 1GHYH 2TRMA 1LPKB 2PKSC 1BQYA 1AIXH 3Q76A 4F4OC 4DIIH 4Q7XA 1AWFH 1EZXC 5FXLA 3IG6B 3PWBA 1MU8B 4UE7H 3RXBA 2ZPSA 3SUEA 1WOFA 2ZZUH 4NIVA 3E0PB 3KNXA 1A0JA 2GCHG 1MAYA 3TVJB 1HXFH 2FI5E 1BMAA 1H8DH 3RXLA 1SQOA 4BAMB 2ASUB 1MTWA 3HATH 3QDZB 2FESH 1BMMH 1CO7E 1KLIH 1D4PB 3SU2A 3VXFH 4ZKNU 1GBFA 3ZZBA 1UVUH 3K2UA 1WCZA 1Y3XA 1G3BA 1TNGA 3ATMA 1DWCH 5I46H 1DSTA 3TIUA 1NRQH 1O35A 1RD3B 3F9FA 1YBWA 4AYYB 5EQQA 2P3UB 4CH2B 4JYUH 1FN6A 4I8JA 4INLA 1BTYA 1FV9A 3BG4B 4YESB 3RU4E 5F03A 5AVDA 1TPPA 3KEEA 1P09A 1FXYA 4X8SH 3RXQA 5FPYA 3MMGA 1DUAA 1EQ9A 1OYTH 1ABJH 1T8NA 2GP9B 2XBVA 1GI7B 1YPLH 1NS3A 1PPHE 2VIWA 4O3TA 2XBXA 3PO1C 1GL0E 2J4IA 2XC0A 3MNCA 3TK5A 3MYWA 4D9RA 3UNRA 2ZCHP 3KF2A 1C4U2 2AFQB 1L1JA 3BSQA 3A7VA 1C2LA 2P3FH 1O2YA 2FOCA 4M7GA 4X6PA 2TGTA 2BXUH 4WJG2 1DOJA 2V3HH 1KDQB 1O3NA 1D3DB 1BTHH 3UQOA 1GVKB 2HPPH 4WMFA 1C5ZB 5A0BA 1A5HA 1XXDA 2R2WU 1OKXA 2F3CE 5SGAE 2G4UA 2ZKSA 2A4RA 1C5YB 2SGDE 4Y76A 1ORFA 1O3FA 2BLWA 3T28A 3RXGA 1O5CB 2P3TB 3HK6B 3A88A 3SORA 3W95A 1O2PA 3SQHE 3TJOA 1ELCA 2H9TH 4INKA 3ZVCA 1KTTB 5JBCS 2ZDMA 3TLOA 1O5AB 1TMUH 2C8XB 1O2QA 3SU1A 1C5PA 3PMBB 1HJAB 5CHAB 5JDUB 1P57B 2B8OH 1PYTC 3F9HA 1GJ5H 1AHTH 2Z9LA 3E90B 4X2WA 1BOQA 2BVSH 2BQWB 2RDLA 1QGFA 3Q00A 2ZCLP 5JB9S 2VIOA 2QXGA 1XX9A 1TABE 3E16B 4GSOA 4SGAE 1HV7A 5EXLA 1ELGA 3NXPA 2Z9KA 2EI8A 1EPTA 1AFQC 1GBIA 4AFQA 1OWJA 4OS5A 1YCPH 3VB4A 3P8OA 2M5TA 3GY4A 2LNCA 5B6OA 1H4WA 3ATLA 1HFDA 2ULLA 1SQAA 3BIUH 7LPRA 3ZZAA 1GJ9B 1O39A 3FANA 4NFFA 2XBWA 2DE9A 1BTWA 2PUQH 3SUDA 1UCYE 1ABIH 2GDDA 2VVCA 4CRCA 1YLDA 3U8OH 3QK1A 2BY9X 2XYAA 1YCPK 1O3LA 2AERH 1WTHD 2BD7A 1ESBA 1V2RT 2ZHDA 1HAOH 2VVVA 3TK6A 5EQSA 1ZOMA 1AD8H 4R0IA 5T6GA 2AYWA 4ZHMU 3UQVA 3SNCA 2A2QH 3QN7A 4MDSA 1J16A 2FLRH 4K5ZA 4UDWH 1BJVA 1K22H 2A4QA 4WXIA 1CBWB 1V2QT 4CR9A 2P95A 1O2MA 1F7ZA 2TIOA 1IQHA 1HUTH 1RGQA 1O5DH 1P04A 1NU7B 3F6UH 3BG4C 3U8TH 1EX3A 3NPSA 2B9LA 1JBUH 2B5TB 2BDBA 1OWKA 4ABJA 5FBIA 2R3UA 2A4OA 4NIWA 1C4V2 1TA6A 2FOFA 5DKMA 2PWXA 1BRCE 3KQBA 1O2WA 3TNSA 3DA9B 3P6ZB 3ZYEA 5EGMA 1UTKA 4X8UH 2TBSA 1O5FH 1O37A 3QX5H 1EASA 1QA0A 4RKOB 5C2ZA 4DIHH 5LPRA 4INHA 3BEFB 5EPNA 4BANB 4HFPB 8GCHG 3RUOA 2ZHQH 4NWLA 3MO6A 3F9GA 5A0AE 3PROA 4U32A 1RIWB 4CREA 4ASHA 4B71A 4ZAEA 4HGCA 4Y79A 1FY1A 2D26C 2GV6A 4HTCH 1EPTB 4O97A 1BTUA 1GHBG 1BMLA 3HGPA 1D3QB 3M35A 2BD5A 5F8XA 2FYRA 2O9QA 1MTUA 1O2IA 1VITH 1C2HA 1MKXH 1V6DA 2QXHA 3UWIA 5A09A 1YM0A 1XKAC 3KQDA 4QT8C 1SGNE 1W7XH 1DPOA 2AS9A 1HJAC 5CHAC 4MPWA 1D6WA 4H6SB 2STBE 4X2YA 4JK6A 2F83A 1BITA 3NCLA 1JXPA 4ISIH 1IQGA 3MH7A 1IHTH 2PGBB 5EXMA 2H6MA 4ISLA 1K2I1 1QB1A 3T27A 3P17H 1C1RA 1NPMA 1ANEA 3H7TA 1LKBA 2Y7XA 1AZZA 1GI1A 2YOLA 1C5SA 3JZ1B 3TH2H 3SV7A 3SJIA 1K9OE 1T31A 1O38A 1P01A 1Z7KA 3ENSB 4UFEH 4BXWA 5GWZA 3RXAA 1FJSA 4YLQH 1MBMA 2ZC9H 3NKKA 4OS6A 4KELA 1Y59T 4ABFA 1GMHF 2FMJA 2OBOA 1DITH 2H2ZA 2XXLA 4WXVA 2C93B 8KME2 1IQNA 2XNIA 4AZ2B 1E36B 5FX6A 1EB1H 6CHAB 3S9BA 1Z8JB 2SNVA 2QCYA 1KXCA 1GBHA 1XUKA 5FPTA 1ESTA 1S0RA 3PB1E 2P94A 1XKBC 4LXBH 1DVAH 2ODYB 1G2LA 1TGTA 1V2NT 4IGDA 4ISHH 3EYDA 5LPFA 1LPZB 1VJAU 3LT3A 1L0ZA 5DO4H 1CGIE 4ZXXH 1K1NA 3O8BA 4YOGA 5L30H 5PTPA 4YO9A 1C1VH 1SBWA 1SGPE 4UFGH 1QB6A 4WH6A 4K60A 1CBWC 2AMDA 2BDCA 2CHAB 2GCTB 1K28D 6GCHG 2WPKS 1AGJA 1UCYH 3P70B 1CGHA 1T4UH 3T25A 1C9PA 1LCYA 1OWIA 2H1UA 4FU7A 4H42U 4OGXA 1ZRBA 2PSXA 4I8HA 1PQ7A 1TRMA 1ZZZA 1GMDG 2ZDVH 1QJ1B 3GDVA 1MTVA 3K6ZA 1N1LA 1BCUH 3PMHB 2NU2E 1F92A 2Z7FE 4LZ1H 1HAHH 1B5GH 4UFDH 4YOIA 4NIYA 1HLTH 1UCYK 1DWBH 2BVRH 4TY7A 3GOVB 4ISNA 3FP7E 1UTLM 1FPCH 1TX7A 3HKIB 4Y8ZA 2NU3E 3BEUA 1AVWA 2W7SA 4D8NA 1MQ6A 1RIWC 4BAQB 2NU1E 2QXJA 3I77A 2A5IA 1C1WH 1XUIA 3AAVA 3ZZ6A 1LVBA 1EPTC 2XCFA 2BOKA 3GICB 1ARBA 2BY5X 3EDXB 2OC1A 4H4FA 4MNXA 4NFEA 1GHAF 3RC5A 5L2YH 5J4QA 2FP7B 3UREA 3NUMA 1LPGB 2AGEX 4NA9H 4AOQA 1QBNA 2F9NA 1QIXB 1C5UA 1T8MA 2FI3E 1S84A 2Z94A 3SZNA 1GMCF 1PJPA 3LGIA 1W8BH 1YLCA 1SGTA 2HNTE 1IQFA 5C3NA 2Z9IA 5GPIB 1RXPA 2Y5HA 4B2BA 1TNLA 3A8AA 1SGEE 3E8LA 1O3AA 5A2MH 4RSPA 1H1BA 1LQEA 3M3SA 1W14U 1O2VA 1AFEH 2RG3A 2ALPA 2G8TA 3DFLA 4X8TH 3T5FH 2Z6BD 1CVWH 2DE8A 2QXIA 3RM0H 2TGAA 2OD3B 1B0EA 4X1PU 1WSSH 1FIZA 3A84A 1XVOA 4WF8A 5AF9H 1V3XA 1LTOA 1Y3YA 1HYLA 1G3DA 4BAKB 1RRKA 3KL6A 1C5WB 3A83A 3M5OA 2OCVB 5DP3A 4A7IB 1EAWA 6CHAC 1F5LA 1ELTA 1GHXH 2A7JA 4MVNA 1GHZA 3RLWH 2G00A 4OS4A 3RMMH 1IQMA 5GXPA 2YNAA 1SGQE 4B73A 3B23B 1O36A 1QR3E 5ESBA 1P2IA 3M5LA 3U98H 3GY8A 1AUJA 2VH6A 2OQ5A 2ZWLH 4DG4A 1BIOA 2ZG0H 1KXEA 1O3BA 1EZSC 5F8ZA 2ZQ1A 1Q2WA 2NWNA 3KQCA 1L1GA 1QFKH 2GZ8A 3MNSA 1HRTH 1A3BH 2CHAC 5LH8A 4ISOA 1NO9H 1OYQA 2ODQA 2W26A 3GCNA 1SR5C 3GYMA 3PLBA 1O2HA 5DG6A 1ZLRA 1BTPA 2AH4X 2ZGJA 5TJXA 1PPEE 1H9HE 1BHXF 3RP2A 3D65E 4DY7B 1S85A 3ZVFA 1B0FA 1Y8TA 1ZPCA 2OLGA 3QUMP 3RC6A 3RXPA 2BD2A 2IOTA 2OINA 3M3VA 4B75A 3SV6A 3M61U 1HJ8A 1BBRE 4K1EA 2QF3A 1IQJA 3MWIU 1HAVA 1ELFA 1EZQA 1Z1JA 1O5BB 1Y5BT 2ZNKH 4DVAU 3GDSA 1GBAA 1H8IH 2AIPA 2Q6DA 3A8DA 2KAIA 1AE8H 1UVTH 1K21H 5HXFA 4IS5A 3FAOA 3M36A 1PYTD 1H9LB 4BNRA 6LPRA 3EA8A 1SLWB 1HCGA 2BOHB 2G5NA 4IMZA 1MH0A 1QNJA 4J2YB 3MOCA 1GDNA 1UTQA 2QGRA 4A6LA 1K1OA 3P8GA 1O2OA 3O8DA 5EODA 1GBTA 4JMYA 3LGVA 3RXEA 3LH1A 3RLYH 1GWAA 1AU8A 1MU6B 2VIVA 3TK9A 3D49H 1UK2A 1PQ8A 3MI4A 4Y0ZE 4DOQA 4CRFA 4E06H 1HIAB 4CRGA 4FUEA 3RXCA 2RA3A 1EAUA 2Z9JA 3SNDA 1ZMNA 1LHEH 4B2AA 7GCHG 1LHFH 4XSKU 3V7TA 1F0SA 5JPMH 3V3MA 1NU9A 1QA7A 2FS8A 1K1LA 1G30B 3MO3A 1YPMH 2BYAX 3UPEA 1ACBE 1C5XB 1THPB 2G5VA 1Y3UA 1L1NA 5L2ZH 1W0ZU 1S82A 1NTPA 5G4BA 5A0CA 1HAYB 1SOTA 2V3OH 2XWAA 5HM9A 1C1NA 1MAXA 5AFYH 2FODA 2ZTXA 2FTLE 1J17T 3HKJB 2OC7A 3BEIB 1L4DA 1PFXC 2ZP0H 4NSVA 3AASA 3BTQE 4X6OA 2FDAA 2RA0A 3UNSA 4AB8A 3O8CA 3ATKA 3F1SB 2QN5T 1KLJH 2BB4A 3P95A 2OUAA 4GVUA 1YYY1 1O3HA 2H5CA 1FDPA 2VWMA 2ZTYA 1C2MA 2BHGA 1EZUC 3LC5A 1EP6A 1EOLA 1UTOA 1ID5H 2WPHS 1E34B 4K69A 1IQLA 4IN1A 1GDUA 1CHOF 1OP8A 5TCCA 3K9XB 5C1UA 1ANDA 4IW4E 2SGAA 2PFEA 2TGDA 4NG9H 2JH5D 3KHVA 1CA8B 4WMDA 2VH0A 1Z6JH 2HGTH 1KIGH 5EW2H 1DUEA 1EATA 1SGFA 1YPHC 2ODPA 5JBBS 1DSUA 3SV2H 4VGCB 1Z71A 2EI7A 3SU0A 3BTDE 4X8VH 1IQIA 1HXEH 5H4IB 2PUXB 3WY8A 3UTUH 1C1TA 1C5VA 5E0GA 2OC0A 2TGPZ 3Q3KA 1L2EA 1LVYA 2GKVE 4MG3A 4Y11E 1DX5M 3A82A 4TPIZ 1GBDA 5DP4A 1SGRE 1OSSA 2LIZA 3OY5U 3L6PA 4U01A 2FOGA 1FONA 1F5RA 2WINI 1TBRH 3OYPA 1PPGE 2GGVB 3S9AA 4ABIA 3TU7H 1U6QA 3ITIA 2Y7ZA 2J92A 3V12A 3EA9A 3KGPA 2CF8H 3EA7A 3FZZA 3RXMA 1YC0A 2PTNA 1J9CH 4BTIB 3QO6A 3LONA 1ZJDA 1CGJE 4CRAA 2OQUA 3BV9B 2PSYA 2G51A 1JIMA 4XBBA 1Y5AT 4PROA 1C2JA 1BBRH 2BQ6B 5DP5A 5A8ZA 1P0SH 2WUCA 1OXGA 2A0QB 1FLEE 1DLEA 5T6DA 1ZPBA 3B9FH 4CBOA 3Q3XA 1VCWA 1UVPA 1LVMA 2Q6FA 4JK5A 2FO9A 1K1IA 2VGCB 5E0JA 4AGJA 4WY3A 1J14A 5K0HA 4E7NA 1FAXA 1D3TB 3SJ9A 1ELBA 3SV8A 1P03A 1A3EH 2J38A 3M5NA 3HPTB 3VFEA 2JH6D 1EJAA 2A7HA 1T4VH 4NWKA 1BBRK 3V0XA 1GBBA 2ZHEH 2VIQA 1LHDH 1SQTA 1ETSH 4MNVA 1VR1H 2WPMS 2ZEBA 1QTFA 1T8OA 3CENA 2BZ6H 1ESAA 4Y8YA 1NRPH 3VEQB 1MCTA 2XC5A 2BTCE 2W5EA 2Y5GA 3AVZA 4DJZB 3QGNB 3STIA 3F9EA 2R0LA 1SGIB 2ILNA 4MTBA 4KTCA 1G9IE 3BN9A 1TGCA 3SQEE 1ZHMA 2B7DH 2I6QA 3BTTE 5F8TA 1BRUP 5ABWA 1JRTA 3DT0H 1QY6A 3SU3A 1JIRA 2BDHA 2ZFTA 1UK4A 3BTHE 1LHGH 3OU0A 2O8WA 1LMWB 2QYIA 3ZVGA 2CJIA 2BY7X 3SW2B 3A7YA 5EXNA 1G32B 1QL7A 1D3PB 1GVZA 1O3MA 1O5EH 3A81A 4B2CA 1QJ7B 1TNIA 1AO5A 1CHGA 1P12E 1QB9A 4KGAA 5EU8A 1MTNB 4Y0YE 1A5IA 2BDYA 3KCGH 1P02A 1O2RA 1AMHA 2AMPA 1DANH 1O30A 1ZHPA 1YPJH 4TYDA 4GCHF 1FIWA 2CGAA 4I33A 2FLBH 4TWYA 4MLFB 1XVMA 3U1IB 3EGKH 1C1SA 1EJMA 2QV1A 1O0DH 3SBKA 4FUIA 5TCAA 1F0UA 2AEIH 4FUDA 1DS2E 4AB9A 4Y71A 3P8NA 1WQSA 3RDZA 1BRBE 4NZQA 1W13U 4UONA 1S0QA 4WH8A 2G81E 1S5SA 3MU0A 4ZHLU 1UTMA 1SGCA 2GZ9A 1ZTLA 2ANWA 3R3GB 4D7FA 3OY6U 5K7RA 3HK3B 1ZTJA 2F9VA 1OX1A 1V2LT 5AHGH 1BTZA 1QRZA 1HDTH 1IQEA 2HLCA 3ZZ4A 3MO9A 4IC5A 1F5KU 1TE0A 3S0NA 3PV4A 2QF0A 2TPIZ 1O3JA 2FOEA 1GCTB 2WPJS 2ZO3H 4I31A 1TMTH 3LU9B 2VWOA 2FPZA 4BXSA 2SGFE 3A89A 3SNBA 2C4FH 1J15A 4FUGA 4GHQA 3SI3H 1GJCB 2R2MB 3ZZCA 3DD2H 2IN2A 1O3PB 4FUHA 1C5LH 1N8OB 2J94A 2THFB 1DY9A 3HGNA 2ZDLA 1TQ0B 2QIQA 1C5QA 1TQ7B 1WAYB 1XUHA 3CS7A 3Q3YA 2ZGBH 4BAHB 1C5RA 1HAZB 2Q1JA 2ANMH 3RXOA 1V2VT 4Y8XA 1TGNA 3GDUA 5EG4A 5I25A 2VGCC 1ZSKA 2FS9A 1NFYA 4D76A 1DDJA 1HJ9A 3EBNA 1IOEA 5LPEA 5E2PA 1PPBH 1TOCB 1ZGVA 4AFSA 2R3YA 2BX4A 1V2UT 3DFJA 4FVDA 3RXTA 7KMEH 2ZU1A 1MBQA 1QJ6B 3PLPA 3F68H 1DE7H 2GDEH 1PPZA 2JKHA 1GJAB
chains in the Genus database with same CATH superfamily
3QTVH 4WWYA 3P8FA 1VITF 5EPYA 3UR9A 3SUGA 1GJ6A 1MKWH 1T8LA 1HGTH 1KLTA 1TFXA 3F0OA 2O8UA 2D1JA 2XTTB 4XDEA 3URDA 1QQ4A 3PYHA 5EOKA 4KP0A 2V0BA 2EC9H 2GZ7A 2Y80A 2Y81A 2EI6A 2GTBA 1GCDA 1F2SE 1NT1A 1GHVH 2PTCE 3TJVA 2HRVA 2BD9A 4FUBA 3SU6A 2ESTE 2AGIX 2FYQA 1ZMJA 3KYFA 1A46H 1GI0A 4K1SA 1G2MA 1TB6H 1MKWK 1AKSA 1GL1A 1AY6H 1A61H 1SHHB 1JRSA 2SFAA 3BIVH 3FZDA 4I8GA 4Y6DA 3BTWE 3I78A 4KTSA 3GCTF 2A31A 1O2TA 1FNIA 4OS1A 3TGJE 4JZ1A 4TPYA 4NCYA 1KMHB 3SHAH 3H5CB 3S69A 3OSYA 3D23A 3L3TA 1S6HA 2F4LA 1MTNC 3CP7A 1EAXA 4FU9A 2A32A 2IPQX 3ODFA 2UWPA 4Q2KA 1NESE 1UO6A 3KN2A 3I29A 1RTKA 1ARCA 1GBMA 3QLPH 1D6RA 2O8LA 1RTLA 5CMXH 3CS0A 4YT6H 2GT8A 2GV7A 4XBCA 4ZKSU 2BZAA 1KY9A 3NK8A 3A7XA 2IJOB 2Z3DA 1OOKB 4A5TS 4SGBE 2YNBA 2LPRA 3GY5A 4JYTA 5EJ1A 1FPHH 1RFNA 1O2KA 1A0LA 1N6XA 1N6YA 2C8ZB 1UK3A 1Z8RA 1ZYOA 2F9OA 2BX3A 1V2WT 2ZDAH 4UEHH 1O3KA 3P92A 4NA8A 1G37A 1CE5A 1EP5A 1GBCA 4TY6A 3N99A 3ZZDA 2O8TA 2G55A 3RMNH 3GCHB 1GCTC 3A7WA 2PGQB 1V2JT 4Y7AA 3KIDU 1X7AC 5DJ7A 1F0RA 5DGJA 1GDQA 3SU4A 2ZHFH 2Y5FA 1P10A 2KM0A 5GDSH 3A85A 1GMHG 3IWMA 3STJA 2RCEA 1O3OA 4YM9A 1UHBA 4I7YH 2C3SA 1YPGH 2JETB 2GCHF 1N8OC 1YWUA 3ODDA 1T7CA 1KYNA 5IK2D 3OTJE 3VPKA 3LOXA 2WYGA 1AVGH 9ESTA 1ELEE 2A4GA 4UD9H 1TIOA 1THSH 2HOBA 2UUKB 5JBAS 1MMJN 1EJNA 4NGAH 1OWEA 2CF9H 1HAIH 3N7EA 5FX5A 2FTMA 1BA8B 2SGQE 2OTVA 2UWOA 2OK5A 1FI8A 1TPOA 1V2OT 1OP2A 3ZIAD 1AKSB 3QZRA 4ABAA 4AYVB 3WW7A 5BPEA 2JDID 5T3HA 1A0HB 1YPEH 2WYJA 5ESTE 1FAKH 2UUYA 3RXJA 3SGBE 1CU1A 5C1YA 3UR6A 2BMGB 4E05H 3DCLA 1W2KH 2GCTC 2A1DB 1O31A 1CT0E 1AWHB 1P05A 3GYLB 3DHKH 4DCDA 3VGCB 1AUTC 3SO3A 3EE0B 9LPRA 3SYJA 1O2JA 1VZQH 1C9TA 2BVXH 2Y6TA 1TGSZ 1Y5UT 3FOAA 2FOMB 4BOHA 1O2LA 1AN1E 2FI4E 2FIRH 3MH4A 3GCTG 1O2UA 2ZU3A 4LZ4B 3SN8A 1SVPA 3URCA 1WBGB 1GJBB 2P59A 1O3EA 1ZRKA 4ABGA 1J8AA 5C5OA 3AK5A 1Z8GA 3TJUA 4MPXA 1NC6A 2NU0E 1P11E 2WPDD 3PMAB 1NY22 3RC4A 5FBEA 3SU5A 1D9IA 3RMLH 3BTME 1TALA 1YF4A 4ACBA 2WV4A 2XWBI 1GJ8B 3K65B 2ALVA 3TH4H 1TWXB 1GHAG 2CMYA 3LJOA 4U30A 2SGEE 1C4Y2 3RXIA 2ZU5A 2J95A 4X1QU 1O2SA 1GVLA 1Q3XA 1DWEH 3E6PH 4DT7B 2H5DA 4AFZA 2WHXA 2CN0H 4HI3A 4AFUA 2G52A 4GUXA 1ZGIA 3RXVA 8ESTE 1GMCG 4JZEH 2PHBA 1P06A 5IDKA 1QQUA 1GI4A 4ZROA 1WU1A 1JWTA 1ELAA 3PRDA 1MD7A 1ZR0A 2BLQA 2PKAA 2VWNA 3GISB 4ZUHA 2BD4A 4XRNA 5HYOA 5AFZH 2W6JD 1EAIA 2K1QA 1WV7H 2ZQ2A 2GT7A 2AIQA 2BDGA 1W0YH 3GCOA 4I8KA 3LGYA 3GCHC 4AC9A 2ZCKP 2HVXA 1EUFA 2IPHA 4NIXA 4X0WU 3O8RA 2W3KA 2C90B 3UOPA 2Z3CA 1TONA 5FCKA 1GBJA 2BLVA 4A92A 3F2FA 2V6NA 2BM2A 4YLUA 2C8WB 2XC4A 5A8YA 2FZZA 2J9NA 1GI3A 1C2GA 1GJ7B 1ANCA 4MQAA 5E0HA 2ZDNA 1EKBB 1QBOA 4OS2A 2JETC 2EEKA 1ANBA 3CNRA 4BAOB 1XUGA 2PW8H 1O2NA 4RN6A 3RMOH 3TITA 1E1QD 2P93A 5JBTA 1GBKA 1SG8B 4Y7BA 1E38B 2D8WA 1Y3VA 5HGGA 4A1VA 3GY6A 1P2KA 1GI6A 3ZZ3A 1W7GH 1YKTA 1DM4B 4XE4A 4Q80A 3OX7U 3PMJA 2ZPQA 3ZVBA 3IITA 1TMBH 2FOHA 1K1MA 2A2XH 2ZPRA 1O2GH 2XNDD 1S6FA 3VB3A 3LIWA 3RXDA 2WPIS 1HAVB 1AE5A 2V35A 1UTPA 1V2PT 2XBYA 3TJNA 3MH6A 3QGJA 1NFWA 1C1QA 1C5OH 2KAIB 1ZMLA 3RXFA 1FN8A 5EW1H 1DT2A 4ABDA 2KCYA 3PM3A 1SFQB 4THNH 1WTGH 2XRCA 1HAXB 1ZHRA 1RS0A 2J2UA 1O3CA 1CA0B 1GJDB 1VGCB 1C2FA 1C1OA 2W7UA 3VGCC 1ZJKA 2JH0D 3LKWA 1SC8U 1DY8A 4K3JA 4ZH8A 1KXDA 4FXGH 1ZSLA 3NZIA 1V2KT 1YPKH 1WQVH 3M37A 1V2MT 1OP0A 2OBQA 5GCHF 4ZKOU 2CXVA 1QBVH 5EIYA 1FY5A 3MNXA 4XBDA 1EXFA 8GCHF 2ZFSA 2ZDKA 3ZZ7A 2PKAB 4X6NA 2VWLA 1MUEB 4I32A 4ZKRU 4ABBA 1O33A 3FP8E 1H9IE 5FPSA 1CT2E 4B74A 3DSGA 1NRSH 1O32A 4ZHAA 3TPIZ 2F9PA 1SKYE 2QAAA 2YMSB 1GHBF 1XXFA 3BTKE 4JZDH 3MU4A 2QC2A 1IAUA 2R0KA 2PR3A 1VCPA 2ZTZA 1TLDA 4NZLA 4OS7A 8LPRA 1IQKA 3BTGE 2FXRA 5FCRA 2HNTC 4A1TA 5IYTA 1NFUA 1C5TA 3JZ2B 3D62A 5T1VA 2HNTF 2Z9GA 5HM2A 1MTSA 2OP9A 1C2KA 3UY9A 1TA2A 4Y10E 2ZF0H 5FHTA 4YTAA 1SHYA 1O3DA 5C94A 1SGDE 3H09A 2ZIQH 3C1KA 3UFAA 4RT1A 2ZFRH 1FZZA 2GVFA 1VJ9U 1GG6B 4CR5A 3RU4T 1GJ4H 1WXRA 1PPFE 1HAGE 1RTFB 4KKDA 4A1XA 4IN2A 1HB0B 3T62A 1AQ7A 1JOUB 4CBNA 3VB7A 4YOJA 1ETRH 3M7TA 4B1TA 5DP9A 4DW2U 4DURA 3RU4D 1LQDB 4D7GA 1TRYA 1FY8E 3B8JA 1XM1A 2WPLS 1G3CA 3V13A 1EOJA 3EAJA 3MU5A 1K1JA 1EB2A 1GBEA 2RFKC 5BRRE 2FEQH 3A87A 2FX6A 2HPQH 2K0QA 1NRRH 2BXTH 2I6SA 4JZFH 4K8BA 2VNTA 1FUJA 1GI9B 3GS9A 1LVOA 3MU8A 2AMQA 1TBQH 1BMNH 4MPVA 3TH3H 1KXBA 2F9UA 3OAAD 4X2XA 1B7XB 3UUZA 5EQRA 4Q7YA 3TGIE 1OWDA 3W1EA 1TNJA 3KQEA 1TAWA 3NWUA 1S83A 3MFJA 1P3EA 3PWCA 1G36A 2ZFQH 3ZVDA 1KSNA 1BB0B 4K2YA 6GCHF 1CHOG 3EE7A 2L6OA 3RXKA 1SL3A 4I8LA 3VB5A 1P3CA 3E3TA 3MU1A 1BRAA 5C20A 1P2QA 4MNYA 2ZA5A 1BJUA 2ZGXH 3MTYA 3U9AH 5F6MA 1EFRD 4LK4A 3E0NB 2UUFB 5GCHG 3LH3A 3ZV9A 2WV5A 1GMDF 4WMEA 3PV5A 1CA0C 1YGCH 1VGCC 4HG6A 2VJ1A 3BF6H 1CT4E 1ZSJA 1BZXE 2PLXA 4KTUA 1ETTH 2H9EH 3SUFA 4VGCC 1C5NH 3N7OA 1T32A 5JYIA 3T2NA 2STAE 1Z1IA 2VU8E 4Z1MD 3BTEE 4CH8B 4K1TA 1TX6A 1NZQH 2O8MA 2ZGCA 2FX4A 2GMTB 4OGYA 3RXSA 1C1UH 4YXWD 4HZHA 3UNQA 2HLDD 1ZTKA 1UMAH 2UWLA 2YMSC 3MNBA 2A7CA 3PLKA 4FUCA 2ZECA 1M9UA 3MH5A 2ZFPH 3T26A 1TX8A 1DICA 5LGOA 1W3CA 1HBTH 4XOJA 1GI5A 4B76A 5L6NH 1W0JD 1MQ5A 3S7KB 1TOMH 1GGDB 2K7XA 1UJ1A 3PTNA 1V2ST 2OC8A 2Q6GA 1Z8IB 3ZZ5A 4AN7A 2ANKH 3K6YA 4D9QA 1MKXK 5JB8S 1SLUB 1TPSA 3L33A 3A7ZA 1W12U 4DGJA 3VXEH 3SHCH 5DK1A 3RM2H 3AAUA 1QL9A 2FOAA 1TNHA 2VVUA 1W11U 1SLVB 3ZVEA 1C2DA 1GG6C 4GLYA 3SGQE 2P8OB 1A7SA 3VG8A 4RKJB 1QHRB 3PV2A 3M7UA 1SLXB 1G3EA 1MCVA 2GD4B 3LPRA 2G4TA 2HALA 4JYVH 2SNWA 3MHWU 1A1RA 1MZAA 3BG8A 4K8YA 1AZ8A 5C1XA 4FU8A 4X1SU 4Q7ZA 4Z6AH 2EA3A 4ACAA 4FUFA 4IBLH 2ZGHA 4UFFH 1BT7A 3LJJA 1SSXA 1TYNA 2J5UA 4Q63A 3GY2A 3C27B 1A4WH 3GY3A 2W3IA 4WVPE 1YCPM 2F91A 3FP6E 2EY4C 3ATIA 2BQ7B 2DUCA 1UVSH 5E8EH 4IMQA 5T6FA 4YT7H 2XCNA 2A5KA 3U69H 3ELAH 3E1XB 3T29A 1W10U 4TWWA 3EQ0H 3RXUA 4BTTB 2SGPE 4ABHA 4FVBA 2F9BH 3AW1A 1GI2A 2XW9A 3A80A 4GHTA 6ESTA 1FMGA 4GCHG 1NM6A 1NFXA 2ANYA 4ZXYH 4CHAB 1O2XA 1BHXB 1QRXA 1TNKA 4AORA 2H9HA 2ZHWH 1XMNB 3QZQA 3UOUA 2PV9B 2GX4A 1XUJA 3SNAA 1Y3WA 2VINA 3DUXH 4GAWA 2VB0A 1PQ5A 5C5NA 3SV9A 1QL8A 5HMAA 1KXFA 1TRNA 3U28C 1PQAA 4ESTE 5CE1A 1A2CH 1FQ3A 1MD8A 4LOYH 1INCA 2P16A 2FM2A 5FAHA 1DFPA 4YZUA 1UTNA 2BDIA 3A7TA 3S9CA 1O2ZA 1AB9B 4J1YA 3LGUA 1P2MA 1UTJA 4O03A 5EJLA 4R8TB 2Z3EA 1DWDH 1JMOH 1YPHE 3OEED 2BD3A 1O3GA 3H7OA 4FUJA 1DXPA 1LO6A 3TNTA 5DP7A 1XUFA 2PKSB 4ZMAH 1SB1H 2ZU2A 3BTFE 1QRWA 1E1RD 4AGKA 2B0FA 2GMTC 3RXRA 3F2GA 3TGKE 1C5MD 3SJ8A 1C1PA 3ZYDA 2UUJB 2R9PA 2QA9E 2VIDA 2ZI2H 2J34A 1BUIA 1TPAE 1C2IA 4X6MA 2ZU4A 1VCQA 3VB6A 2BY6X 1SPJA 4CRBA 2J98A 1SI5H 3SJOA 3E91A 1ELVA 3LC3A 4ABEA 5DP8A 2A5AA 1GGDC 1H8HD 5HIYA 4NSYA 4XFQA 3A8BA 3LGWA 1RJXB 1UW7A 5ETXA 3S7HB 3FVFB 3PTBA 1E35B 1E37B 5A8XA 2IJD1 1CSOE 4AX9H 1AI8H 4BTUB 3FFGA 1THRH 4AG2A 4F49A 3SGAE 7GCHF 1C1MA 1LKAA 1Q31A 3M7QA 1ELDE 1NROH 3ZV8A 1C2EA 3Q77A 1V2TT 1KXAA 1LHCH 1DLKB 3R0FA 1F0TA 2BLOA 3ESTA 3M3TA 1P2NA 2P8OC 1VITG 2PP6A 3SNEA 1SMFE 1P2JA 1WUNH 1IHSH 1GHWH 3GY7A 3PO1B 2BY8X 2C8YB 5E2OA 1MZDA 4H6TA 1GI8B 1HIAA 3ZVAA 3ZZ9A 1NN6A 3UIRA 1P9UA 2FOBA 1UVOA 3SJKA 2CV3A 4X1RU 1SGFG 1SOZA 1L4ZA 1QCPA 3LGTA 1GBLA 1BDAA 1ZPZA 1DXWA 2A45B 4O3UA 1E0FD 5C67A 4JZIA 1NRNH 1SGYE 3QTOH 1SFIA 2HVYB 3ZZ8A 4F55A 2OXSA 3M5MA 5C0UA 1E79D 4E7RG 1OWHA 1PPCE 1FY4A 3WWFA 1TGBA 1O34A 2Y82A 4AG1A 1TBZH 3G01A 4Z0KA 3UWJH 2LP6A 1O3IA 1P8VC 7ESTE 1S81A 2BD8A 3DSPA 5J4SA 4X1NU 4X2VA 2BDAA 4CHAC 2QF4A 1HNEE 5DP6A 5GJ4B 1LDTT 2D2DA 4JCNA 3SOSA 2VIPA 5DPAA 1K1PA 3U8RH 1FY3A 4O9VA 2J98B 1FX0B 1OS8A 3W94A 3U1JB 3SI4H 1UHBB 2QF5A 4CRDA 2WUBA 1O5GH 1KDQA 2NU4E 4GPGA 3AW0A 1HPGA 2CK3D 1KTSB 3LDXH 4MNWA 4NA7A 1P9SA 1Z6EA 1WYKA 4IC6A 3DSOA 4U2WA 1A5GH 1AB9C 1AVXA 1BTXA 3A8CA 2AGGX 2ZFFH 1OPHB 2QY0B 1HAPH 1GPZA 3RXHA 1AFQB 2HWLB 3QWCH 1P2OA 4MPUA 3A86A 1QURH 2KR7A 3ATWA 5FL7D 2FWWA 1YP9A 5GIBA 1CQQA 1GHYH 2TRMA 1LPKB 2PKSC 1BQYA 1AIXH 3Q76A 4F4OC 4DIIH 4Q7XA 1AWFH 1EZXC 5FXLA 3IG6B 3PWBA 1MU8B 4UE7H 3RXBA 2ZPSA 3SUEA 2KZ4A 1WOFA 2QE7D 2ZZUH 4NIVA 3E0PB 3KNXA 1A0JA 2GCHG 1MAYA 3TVJB 1HXFH 2FI5E 3F0PA 1BMAA 1H8DH 3RXLA 1SQOA 4BAMB 2ASUB 1MTWA 3HATH 3QDZB 2FESH 1BMMH 1CO7E 1KLIH 1D4PB 3SU2A 3VXFH 4ZKNU 1GBFA 3ZZBA 1UVUH 3K2UA 1WCZA 1Y3XA 1G3BA 1TNGA 3ATMA 1DWCH 4TT3D 5I46H 1DSTA 3TIUA 3MQKC 1NRQH 1O35A 2W6ID 1RD3B 3F9FA 1YBWA 4AYYB 5EQQA 4F48B 2P3UB 4CH2B 4JYUH 1FN6A 4I8JA 4INLA 1BTYA 1FV9A 3BG4B 4YESB 3RU4E 5F03A 5AVDA 3UAIC 1TPPA 3KEEA 1P09A 1FXYA 4X8SH 3RXQA 5FPYA 3MMGA 1DUAA 1EQ9A 1OYTH 1ABJH 1T8NA 2GP9B 2XBVA 1GI7B 1YPLH 1NS3A 1PPHE 2VIWA 4O3TA 2XBXA 3PO1C 1GL0E 2J4IA 2XC0A 3MNCA 3TK5A 3MYWA 4D9RA 3UNRA 2ZCHP 3KF2A 1C4U2 2AFQB 1L1JA 3BSQA 3A7VA 1C2LA 2P3FH 1O2YA 2FOCA 4M7GA 4X6PA 2TGTA 2BXUH 4WJG2 2F43B 1DOJA 2V3HH 1KDQB 1O3NA 1D3DB 1BTHH 4XD7D 3UQOA 1GVKB 2HPPH 4WMFA 1C5ZB 3FO8D 5HIZA 4B6FA 5A0BA 1A5HA 1XXDA 2R2WU 1OKXA 2F3CE 5SGAE 2G4UA 2ZKSA 2A4RA 1C5YB 2SGDE 4Y76A 1ORFA 1O3FA 2BLWA 3T28A 3RXGA 1O5CB 2P3TB 3HK6B 3A88A 3SORA 3W95A 1O2PA 3SQHE 3TJOA 1ELCA 2H9TH 4INKA 3OE7D 3ZVCA 1KTTB 5JBCS 2ZDMA 3TLOA 1O5AB 1TMUH 2C8XB 1O2QA 3SU1A 1C5PA 3PMBB 1HJAB 2J97A 5CHAB 5JDUB 5KECA 1P57B 2B8OH 1PYTC 3F9HA 1GJ5H 1AHTH 2Z9LA 2KX4A 1SQRA 3E90B 4X2WA 1BOQA 5DN6D 2BVSH 2BQWB 2RDLA 1QGFA 3N7DA 3Q00A 2ZCLP 5JB9S 2VIOA 2QXGA 1XX9A 2YMSD 2AHME 1TABE 3E16B 4GSOA 4SGAE 1HV7A 5EXLA 1ELGA 3NXPA 2Z9KA 5GNDA 2EI8A 1EPTA 1AFQC 1GBIA 4AFQA 1OWJA 4OS5A 1YCPH 3VB4A 3F2HA 3P8OA 3NRLA 5CHBA 2M5TA 4FOUC 3GY4A 2LNCA 5B6OA 1K0HA 1H4WA 2EQNA 3ATLA 1HFDA 2KCOA 2ULLA 1SQAA 3BIUH 7LPRA 3ZZAA 2XOKD 1GJ9B 1O39A 3FANA 4NFFA 2XBWA 2DE9A 1BTWA 2PUQH 3SUDA 1UCYE 1ABIH 2GDDA 2VVCA 4CRCA 1YLDA 3U8OH 3QK1A 2BY9X 2XYAA 1YCPK 1O3LA 2AERH 1WTHD 2BD7A 1ESBA 1V2RT 2ZHDA 1HAOH 2VVVA 3TK6A 5EQSA 1ZOMA 1AD8H 4R0IA 5T6GA 2AYWA 4ZHMU 3UQVA 3SNCA 2A2QH 3QN7A 4MDSA 1J16A 2FLRH 4K5ZA 4UDWH 1BJVA 1K22H 2A4QA 4WXIA 1CBWB 1V2QT 4CR9A 2P95A 1O2MA 1F7ZA 2TIOA 1IQHA 3OFND 1HUTH 1RGQA 1O5DH 1P04A 1NU7B 3F6UH 3BG4C 3U8TH 1EX3A 3NPSA 2B9LA 1JBUH 2B5TB 2BDBA 1OWKA 4ABJA 5FBIA 2R3UA 2A4OA 4NIWA 1C4V2 1TA6A 2JJ1D 2FOFA 5DKMA 2PWXA 1BRCE 3FN8A 3KQBA 1O2WA 3TNSA 3DA9B 3P6ZB 3ZYEA 5EGMA 1UTKA 4X8UH 2TBSA 1O5FH 1O37A 3QX5H 1EASA 1QA0A 4RKOB 5C2ZA 4DIHH 5LPRA 4INHA 3BEFB 5EPNA 4BANB 4HFPB 8GCHG 3RUOA 2ZHQH 4NWLA 3MO6A 3F9GA 5A0AE 3PROA 4U32A 1RIWB 4CREA 4ASHA 4B71A 4ZAEA 4HGCA 4Y79A 1FY1A 2D26C 2GV6A 4HTCH 1EPTB 4O97A 1BTUA 1GHBG 1BMLA 3HGPA 1D3QB 3M35A 2BD5A 5F8XA 2FYRA 2O9QA 1MTUA 1O2IA 1VITH 1C2HA 1MKXH 1V6DA 2QXHA 3UWIA 5A09A 1YM0A 1XKAC 3KQDA 4QT8C 1SGNE 4B6EA 1NBME 1W7XH 1DPOA 2AS9A 1HJAC 5CHAC 4MPWA 1D6WA 4H6SB 2STBE 4X2YA 4JK6A 2F83A 1BITA 3NCLA 1JXPA 2GJGA 4ISIH 1W0KD 1IQGA 3MH7A 1IHTH 2PGBB 5EXMA 2H6MA 4ISLA 1K2I1 1QB1A 3T27A 3P17H 1C1RA 1NPMA 1ANEA 3H7TA 1LKBA 2Y7XA 1AZZA 2LELA 1GI1A 2YOLA 1C5SA 3JZ1B 3TH2H 3SV7A 3SJIA 1K9OE 1T31A 1O38A 1P01A 1Z7KA 4P00A 3ENSB 4UFEH 4BXWA 5GWZA 2M2AA 3RXAA 1FJSA 4YLQH 1MBMA 2ZC9H 3NKKA 3PRBA 4OS6A 4KELA 1Y59T 4ABFA 1GMHF 2FMJA 2OBOA 1DITH 2H2ZA 2XXLA 4WXVA 2C93B 8KME2 1IQNA 2XNIA 4AZ2B 1E36B 5FX6A 1EB1H 6CHAB 3S9BA 1Z8JB 2SNVA 2QCYA 1KXCA 1GBHA 1XUKA 4M9FA 1ESTA 5FPTA 1S0RA 3PB1E 2P94A 4TSFD 1XKBC 4LXBH 1DVAH 2ODYB 1G2LA 1TGTA 1V2NT 4IGDA 4ISHH 3EYDA 5LPFA 1LPZB 1VJAU 3LT3A 1L0ZA 5DO4H 1CGIE 4ZXXH 1K1NA 3O8BA 4YOGA 5L30H 5PTPA 4YO9A 1C1VH 1SBWA 1SGPE 4UFGH 1QB6A 4WH6A 4K60A 1CBWC 2AMDA 2BDCA 2CHAB 1K28D 2GCTB 6GCHG 2WPKS 1AGJA 1UCYH 3P70B 1CGHA 1T4UH 3T25A 1C9PA 1LCYA 1OWIA 2H1UA 1YLNA 4FU7A 4H42U 4OGXA 1ZRBA 2PSXA 4I8HA 1PQ7A 1TRMA 1ZZZA 1GMDG 2ZDVH 1QJ1B 3GDVA 1MTVA 3K6ZA 1N1LA 1BCUH 3PMHB 2NU2E 1F92A 2Z7FE 4LZ1H 1HAHH 1B5GH 4UFDH 4YOIA 4NIYA 1NBMD 1HLTH 1UCYK 1DWBH 2BVRH 4TY7A 3GOVB 4ISNA 3FP7E 1UTLM 1FPCH 1TX7A 3HKIB 4Y8ZA 2NU3E 3BEUA 1AVWA 2W7SA 4D8NA 1MQ6A 1RIWC 4BAQB 2NU1E 2QXJA 3I77A 2A5IA 1C1WH 1XUIA 3AAVA 3ZZ6A 1LVBA 1EPTC 2XCFA 2BOKA 3GICB 1ARBA 2BY5X 3EDXB 2OC1A 4H4FA 4MNXA 4NFEA 1GHAF 3RC5A 5L2YH 5J4QA 2FP7B 3UREA 3NUMA 1LPGB 2KCPA 2AGEX 4NA9H 4AOQA 1QBNA 2F9NA 1QIXB 1C5UA 1T8MA 2FI3E 1S84A 2Z94A 5DSFA 3SZNA 1GMCF 1PJPA 3LGIA 1W8BH 1YLCA 1SGTA 2HNTE 1IQFA 5C3NA 2Z9IA 5GPIB 1RXPA 2Y5HA 4B2BA 1TNLA 3A8AA 1SGEE 3E8LA 1O3AA 5A2MH 4RSPA 1H1BA 4ZCNA 1MABB 1LQEA 5C17A 3M3SA 1W14U 1O2VA 3KYGA 1AFEH 2RG3A 2ALPA 2G8TA 3DFLA 4X8TH 3T5FH 2Z6BD 1CVWH 2DE8A 2QXIA 3RM0H 2TGAA 2OD3B 1B0EA 4X1PU 1WSSH 1FIZA 3A84A 1XVOA 4WF8A 5AF9H 1V3XA 1LTOA 1Y3YA 1HYLA 1G3DA 4BAKB 1RRKA 3KL6A 1C5WB 3A83A 3M5OA 2OCVB 5DP3A 4A7IB 1EAWA 6CHAC 1F5LA 1ELTA 1GHXH 2A7JA 4MVNA 5HKKD 1GHZA 3RLWH 2G00A 2KCAA 4OS4A 3RMMH 1IQMA 1S6LA 5GXPA 2YNAA 1SGQE 4B73A 3B23B 1O36A 1QR3E 5ESBA 1P2IA 3M5LA 3U98H 3GY8A 1AUJA 2VH6A 2OQ5A 2ZWLH 4DG4A 1BIOA 2ZG0H 1KXEA 1O3BA 1EZSC 2WSSD 5F8ZA 2ZQ1A 1Q2WA 2NWNA 3KQCA 1L1GA 1QFKH 2GZ8A 3MNSA 1HRTH 1A3BH 2CHAC 5LH8A 4ISOA 1NO9H 1OYQA 2ODQA 2W26A 3GCNA 1SR5C 3GYMA 3PLBA 4DT4A 1O2HA 4FETA 5DG6A 1ZLRA 1BTPA 2AH4X 2ZGJA 5TJXA 1PPEE 1H9HE 1BHXF 3RP2A 5B6LA 3D65E 4DY7B 1S85A 3ZVFA 1B0FA 1Y8TA 1ZPCA 2OLGA 3QUMP 3RC6A 3RXPA 2BD2A 2IOTA 2OINA 3M3VA 4B75A 3SV6A 3M61U 1HJ8A 1BBRE 4K1EA 2QF3A 1IQJA 3MWIU 3SZEA 1HAVA 1ELFA 1EZQA 1Z1JA 1O5BB 1Y5BT 2ZNKH 4DVAU 3GDSA 1GBAA 1H8IH 2AIPA 2Q6DA 3A8DA 2KAIA 1AE8H 1UVTH 1K21H 5HXFA 4IS5A 3FAOA 3M36A 1PYTD 1H9LB 4BNRA 6LPRA 3EA8A 4RI0A 1SLWB 1HCGA 2BOHB 2G5NA 4IMZA 1MH0A 1QNJA 4J2YB 3MOCA 1GDNA 1UTQA 2QGRA 4A6LA 1K1OA 3P8GA 5C0TA 2JJ2D 1O2OA 2K8IA 3O8DA 5EODA 1GBTA 4JMYA 3LGVA 3RXEA 3LH1A 3RLYH 1GWAA 1AU8A 1MU6B 2VIVA 4RT0A 3D49H 3TK9A 1UK2A 1PQ8A 3MI4A 4Y0ZE 4DOQA 4CRFA 4P02A 1HIAB 2WZQA 4CRGA 3OEHD 4FUEA 4E06H 3RXCA 2RA3A 1EAUA 2Z9JA 3SNDA 1ZMNA 1LHEH 4B2AA 7GCHG 1LHFH 4XSKU 3V7TA 1F0SA 5JPMH 3V3MA 1NU9A 1QA7A 2FS8A 1K1LA 1G30B 3MO3A 1YPMH 2BYAX 3UPEA 1ACBE 1C5XB 1THPB 2G5VA 1Y3UA 1L1NA 5L2ZH 1W0ZU 1S82A 1NTPA 5G4BA 5A0CA 1HAYB 1SOTA 2V3OH 2XWAA 5HM9A 2JIZD 1C1NA 1MAXA 5AFYH 2FODA 2ZTXA 2FTLE 1J17T 3HKJB 2OC7A 3BEIB 1L4DA 1PFXC 2ZP0H 4NSVA 3AASA 5F53A 3BTQE 4X6OA 2FDAA 2RA0A 3UNSA 4AB8A 3O8CA 3ATKA 3F1SB 2QN5T 1KLJH 2BB4A 3P95A 5CDFE 2OUAA 2RDEA 4GVUA 1YYY1 1O3HA 2H5CA 1FDPA 2VWMA 2ZTYA 1C2MA 2BHGA 4OM9A 1EZUC 3LC5A 1EP6A 1EOLA 1UTOA 1ID5H 2WPHS 1E34B 4K69A 1IQLA 4IN1A 1GDUA 1CHOF 1OP8A 5TCCA 3K9XB 5C1UA 1ANDA 4IW4E 2SGAA 2PFEA 2TGDA 4NG9H 1WDIA 2JH5D 3KHVA 1CA8B 4WMDA 2VH0A 1Z6JH 2HGTH 1KIGH 5EW2H 1DUEA 1EATA 1SGFA 1YPHC 2ODPA 5JBBS 1DSUA 3SV2H 4VGCB 1Z71A 2EI7A 3SU0A 3BTDE 4X8VH 1IQIA 1HXEH 5H4IB 2PUXB 3WY8A 3UTUH 1C1TA 1C5VA 5E0GA 2OC0A 2TGPZ 3Q3KA 1L2EA 1LVYA 2GKVE 4MG3A 4Y11E 1DX5M 3A82A 4TPIZ 1GBDA 5DP4A 1SGRE 1OSSA 2LIZA 2L74A 3OY5U 3L6PA 4U01A 2FOGA 1FONA 1F5RA 2WINI 1TBRH 3OYPA 1PPGE 2GGVB 3S9AA 4ABIA 3TU7H 1U6QA 2V7QD 3ITIA 2Y7ZA 2J92A 3V12A 3EA9A 3KGPA 2CF8H 3EA7A 3FZZA 3RXMA 1YC0A 2PTNA 1J9CH 4BTIB 3QO6A 3LONA 1ZJDA 1CGJE 4CRAA 2OQUA 3BV9B 4Q4LA 2PSYA 2G51A 1JIMA 4XBBA 4I86A 1Y5AT 4PROA 1C2JA 1BBRH 2BQ6B 5DP5A 1YY3A 5A8ZA 1QZ8A 1P0SH 2WUCA 1OXGA 2A0QB 1FLEE 1DLEA 5T6DA 1ZPBA 3B9FH 4CBOA 3Q3XA 1VCWA 1UVPA 1LVMA 2Q6FA 4JK5A 2FO9A 1K1IA 2VGCB 3OTPA 5E0JA 4AGJA 4WY3A 1J14A 5K0HA 4E7NA 1FAXA 1D3TB 3SJ9A 1ELBA 3SV8A 1P03A 1A3EH 2J38A 3M5NA 3HPTB 3VFEA 2JH6D 1EJAA 2A7HA 1T4VH 4NWKA 3UB0A 1BBRK 3V0XA 1GBBA 2ZHEH 2VIQA 1LHDH 1SQTA 1ETSH 4MNVA 1VR1H 2WPMS 2ZEBA 1QTFA 1T8OA 3CENA 2BZ6H 1ESAA 4Y8YA 1NRPH 3VEQB 1MCTA 2XC5A 2BTCE 3FKSD 2W5EA 2Y5GA 3AVZA 4DJZB 3QGNB 3STIA 3F9EA 1BMFD 1SGIB 2ILNA 2R0LA 4MTBA 4KTCA 1G9IE 3BN9A 1TGCA 3SQEE 1ZHMA 2B7DH 2I6QA 3BTTE 5F8TA 1BRUP 5ABWA 1JRTA 3DT0H 1QY6A 3SU3A 1JIRA 2BDHA 2ZFTA 1UK4A 3BTHE 1LHGH 3OU0A 1H8ED 2O8WA 1LMWB 2QYIA 3ZVGA 2CJIA 2BY7X 3SW2B 3A7YA 5EXNA 1G32B 1QL7A 1D3PB 1GVZA 1O3MA 1O5EH 3A81A 4B2CA 1QJ7B 1TNIA 1AO5A 1CHGA 1P12E 1QB9A 4KGAA 5EU8A 1MTNB 4Y0YE 1A5IA 2BDYA 3KCGH 1P02A 1O2RA 1AMHA 2AMPA 1DANH 1O30A 1ZHPA 1YPJH 4TYDA 4GCHF 1FIWA 2CGAA 4I33A 2FLBH 4TWYA 4MLFB 1XVMA 3U1IB 3EGKH 1C1SA 1EJMA 2QV1A 1O0DH 3SBKA 4FUIA 5TCAA 1F0UA 2AEIH 4FUDA 1DS2E 4AB9A 4Y71A 3P8NA 1WQSA 3RDZA 1BRBE 4NZQA 1W13U 4UONA 1S0QA 4WH8A 2G81E 1S5SA 3MU0A 4ZHLU 1UTMA 3WWBA 1SGCA 5KEDA 2GZ9A 1ZTLA 2ANWA 3R3GB 4D7FA 4ASUD 2VBCA 3OY6U 2KFWA 5K7RA 3HK3B 1ZTJA 2F9VA 1OX1A 1V2LT 5AHGH 1BTZA 1QRZA 1HDTH 1IQEA 2HLCA 3ZZ4A 3MO9A 4IC5A 1F5KU 1TE0A 3S0NA 3PV4A 2QF0A 2TPIZ 1O3JA 2FOEA 1GCTB 2WPJS 2ZO3H 4I31A 1TMTH 3LU9B 2VWOA 2FPZA 4BXSA 2SGFE 3A89A 3SNBA 2C4FH 1J15A 4FUGA 4GHQA 3SI3H 1GJCB 2R2MB 3ZZCA 3DD2H 2IN2A 1O3PB 4FUHA 1C5LH 1N8OB 2J94A 2THFB 1DY9A 3HGNA 2ZDLA 1TQ0B 2QIQA 1COWD 1C5QA 1TQ7B 1WAYB 1XUHA 3CS7A 1OHHD 2ZGBH 3Q3YA 4BAHB 1C5RA 1HAZB 2Q1JA 2ANMH 3RXOA 5EJZA 1V2VT 4Y8XA 1TGNA 3GDUA 5KGOA 5EG4A 5I25A 2WV9A 2VGCC 3F3BA 1ZSKA 2FS9A 1NFYA 4D76A 3KQ5A 1DDJA 1HJ9A 1VKYA 3EBNA 1IOEA 5LPEA 5E2PA 1PPBH 1TOCB 1ZGVA 4AFSA 2R3YA 2BX4A 1V2UT 3DFJA 4FVDA 3RXTA 7KMEH 2ZU1A 2V3MA 1MBQA 1QJ6B 3PLPA 3F68H 1DE7H 2GDEH 1PPZA 2JKHA 1GJAB
chains in the Genus database with same CATH topology
3QTVH 4WWYA 3P8FA 1VITF 5EPYA 3UR9A 3SUGA 1GJ6A 1MKWH 1T8LA 1HGTH 1KLTA 1TFXA 2O8UA 2D1JA 2XTTB 4XDEA 3URDA 1QQ4A 3PYHA 5EOKA 4KP0A 2V0BA 2EC9H 2GZ7A 2Y80A 2Y81A 2EI6A 2GTBA 1GCDA 1F2SE 1NT1A 1GHVH 2PTCE 3TJVA 2HRVA 2BD9A 4FUBA 3SU6A 2ESTE 2AGIX 2FYQA 1ZMJA 1A46H 1GI0A 4K1SA 1G2MA 1TB6H 1MKWK 1AKSA 1GL1A 1AY6H 1A61H 1SHHB 1JRSA 2SFAA 3BIVH 3FZDA 4I8GA 4Y6DA 3BTWE 3I78A 4KTSA 3GCTF 2A31A 1O2TA 1FNIA 4OS1A 3TGJE 4JZ1A 4TPYA 4NCYA 3SHAH 3H5CB 3S69A 3OSYA 3D23A 3L3TA 1S6HA 3CP7A 1MTNC 1EAXA 4FU9A 2A32A 3ODFA 2UWPA 4Q2KA 1NESE 1UO6A 3KN2A 3I29A 1RTKA 1ARCA 1GBMA 3QLPH 1D6RA 2O8LA 1RTLA 5CMXH 3CS0A 4YT6H 2GT8A 2GV7A 4XBCA 4ZKSU 2BZAA 1KY9A 3NK8A 3A7XA 2IJOB 2Z3DA 1OOKB 4A5TS 4SGBE 2YNBA 2LPRA 3GY5A 4JYTA 1FPHH 1RFNA 1O2KA 1A0LA 1N6XA 1N6YA 2C8ZB 1UK3A 1Z8RA 1ZYOA 2F9OA 2BX3A 1V2WT 2ZDAH 4UEHH 1O3KA 3P92A 4NA8A 1G37A 1CE5A 1EP5A 1GBCA 4TY6A 3ZZDA 2O8TA 2G55A 3RMNH 3GCHB 1GCTC 3A7WA 2PGQB 1V2JT 4Y7AA 3KIDU 1X7AC 5DJ7A 1F0RA 5DGJA 1GDQA 3SU4A 2ZHFH 2Y5FA 1P10A 5GDSH 3A85A 1GMHG 3IWMA 3STJA 2RCEA 1O3OA 4YM9A 1UHBA 4I7YH 2C3SA 1YPGH 2JETB 2GCHF 1N8OC 3ODDA 1T7CA 1KYNA 3OTJE 3VPKA 3LOXA 2WYGA 1AVGH 9ESTA 1ELEE 2A4GA 4UD9H 1TIOA 1THSH 2HOBA 2UUKB 5JBAS 1MMJN 1EJNA 4NGAH 1OWEA 2CF9H 1HAIH 5FX5A 2FTMA 1BA8B 2SGQE 2OTVA 2UWOA 1FI8A 1TPOA 1V2OT 1OP2A 1AKSB 3QZRA 4ABAA 4AYVB 5BPEA 5T3HA 1A0HB 1YPEH 2WYJA 5ESTE 1FAKH 2UUYA 3RXJA 3SGBE 1CU1A 5C1YA 3UR6A 2BMGB 4E05H 1W2KH 2GCTC 2A1DB 1O31A 1CT0E 1AWHB 1P05A 3GYLB 3DHKH 4DCDA 3VGCB 1AUTC 3SO3A 3EE0B 9LPRA 1O2JA 1VZQH 1C9TA 2BVXH 2Y6TA 1TGSZ 1Y5UT 2FOMB 4BOHA 1O2LA 1AN1E 2FI4E 2FIRH 3MH4A 3GCTG 1O2UA 2ZU3A 4LZ4B 3SN8A 1SVPA 3URCA 1WBGB 1GJBB 2P59A 1O3EA 1ZRKA 4ABGA 1J8AA 5C5OA 1Z8GA 3TJUA 4MPXA 1NC6A 2NU0E 1P11E 3PMAB 1NY22 3RC4A 5FBEA 3SU5A 1D9IA 3RMLH 3BTME 1TALA 1YF4A 2WV4A 2XWBI 1GJ8B 3K65B 2ALVA 3TH4H 1TWXB 1GHAG 2CMYA 3LJOA 4U30A 2SGEE 1C4Y2 3RXIA 2ZU5A 2J95A 4X1QU 1O2SA 1GVLA 1Q3XA 1DWEH 3E6PH 4DT7B 2H5DA 4AFZA 2CN0H 4HI3A 4AFUA 2G52A 4GUXA 1ZGIA 3RXVA 8ESTE 1GMCG 4JZEH 2PHBA 1P06A 5IDKA 1QQUA 1GI4A 4ZROA 1WU1A 1JWTA 1ELAA 1MD7A 1ZR0A 2BLQA 2PKAA 2VWNA 3GISB 4ZUHA 2BD4A 5AFZH 5HYOA 1EAIA 2K1QA 1WV7H 2ZQ2A 2GT7A 2AIQA 2BDGA 1W0YH 3GCOA 4I8KA 3LGYA 3GCHC 2ZCKP 2HVXA 1EUFA 2IPHA 4NIXA 4X0WU 3O8RA 2W3KA 2C90B 3UOPA 2Z3CA 1TONA 5FCKA 1GBJA 2BLVA 4A92A 2V6NA 2BM2A 4YLUA 2C8WB 2XC4A 5A8YA 2FZZA 2J9NA 1GI3A 1C2GA 1GJ7B 1ANCA 4MQAA 5E0HA 2ZDNA 1EKBB 1QBOA 4OS2A 2JETC 2EEKA 1ANBA 4BAOB 1XUGA 2PW8H 1O2NA 4RN6A 3RMOH 3TITA 2P93A 5JBTA 1GBKA 1SG8B 4Y7BA 1E38B 2D8WA 1Y3VA 5HGGA 4A1VA 3GY6A 1P2KA 1GI6A 3ZZ3A 1W7GH 1YKTA 1DM4B 4XE4A 4Q80A 3OX7U 3PMJA 2ZPQA 3ZVBA 3IITA 1TMBH 2FOHA 1K1MA 2A2XH 2ZPRA 1O2GH 3LIWA 1S6FA 3VB3A 3RXDA 2WPIS 1HAVB 1AE5A 2V35A 1UTPA 1V2PT 2XBYA 3TJNA 3MH6A 3QGJA 1NFWA 1C1QA 1C5OH 2KAIB 1ZMLA 3RXFA 1FN8A 5EW1H 1DT2A 4ABDA 3PM3A 1SFQB 4THNH 1WTGH 2XRCA 1HAXB 1ZHRA 1RS0A 2J2UA 1O3CA 1CA0B 1GJDB 1VGCB 1C2FA 1C1OA 2W7UA 3VGCC 1ZJKA 2JH0D 3LKWA 1SC8U 1DY8A 4K3JA 4ZH8A 1KXDA 4FXGH 1ZSLA 3NZIA 1V2KT 1YPKH 1WQVH 3M37A 1V2MT 1OP0A 2OBQA 5GCHF 4ZKOU 2CXVA 1QBVH 1FY5A 3MNXA 4XBDA 1EXFA 8GCHF 2ZFSA 2ZDKA 3ZZ7A 2PKAB 4X6NA 2VWLA 1MUEB 4I32A 4ZKRU 4ABBA 1O33A 3FP8E 1H9IE 5FPSA 1CT2E 4B74A 1NRSH 1O32A 4ZHAA 3TPIZ 2F9PA 2QAAA 1GHBF 1XXFA 3BTKE 4JZDH 3MU4A 2QC2A 1IAUA 2R0KA 2PR3A 1VCPA 2ZTZA 1TLDA 4NZLA 4OS7A 8LPRA 1IQKA 3BTGE 2FXRA 5FCRA 2HNTC 4A1TA 5IYTA 1NFUA 1C5TA 3JZ2B 3D62A 2HNTF 2Z9GA 5HM2A 1MTSA 2OP9A 1C2KA 3UY9A 1TA2A 4Y10E 2ZF0H 5FHTA 4YTAA 1SHYA 1O3DA 1SGDE 2ZIQH 3C1KA 3UFAA 2ZFRH 2GVFA 1FZZA 1VJ9U 1GG6B 4CR5A 3RU4T 1GJ4H 1PPFE 1HAGE 1RTFB 4KKDA 4A1XA 4IN2A 1HB0B 3T62A 1AQ7A 1JOUB 4CBNA 3VB7A 4YOJA 1ETRH 3M7TA 4B1TA 5DP9A 4DW2U 4DURA 3RU4D 1LQDB 4D7GA 1TRYA 1FY8E 3B8JA 1XM1A 2WPLS 1G3CA 3V13A 1EOJA 3EAJA 3MU5A 1K1JA 1EB2A 1GBEA 5BRRE 2FEQH 3A87A 2FX6A 2HPQH 1NRRH 2BXTH 2I6SA 4JZFH 4K8BA 2VNTA 1FUJA 1GI9B 1LVOA 3MU8A 2AMQA 1TBQH 1BMNH 4MPVA 3TH3H 1KXBA 2F9UA 4X2XA 1B7XB 3UUZA 5EQRA 4Q7YA 3TGIE 1OWDA 1TNJA 3KQEA 1TAWA 3NWUA 1S83A 3MFJA 1P3EA 3PWCA 1G36A 2ZFQH 3ZVDA 1KSNA 1BB0B 4K2YA 6GCHF 1CHOG 3RXKA 1SL3A 4I8LA 3VB5A 1P3CA 3E3TA 3MU1A 1BRAA 5C20A 1P2QA 4MNYA 2ZA5A 1BJUA 2ZGXH 3MTYA 3U9AH 5F6MA 4LK4A 3E0NB 2UUFB 5GCHG 3LH3A 3ZV9A 2WV5A 1GMDF 4WMEA 1CA0C 1YGCH 1VGCC 2VJ1A 3BF6H 1CT4E 1ZSJA 1BZXE 2PLXA 4KTUA 1ETTH 2H9EH 3SUFA 4VGCC 1C5NH 3N7OA 1T32A 5JYIA 3T2NA 2STAE 1Z1IA 2VU8E 3BTEE 4CH8B 4K1TA 1TX6A 1NZQH 2O8MA 2ZGCA 2FX4A 2GMTB 4OGYA 3RXSA 1C1UH 4HZHA 3UNQA 2UWLA 1ZTKA 1UMAH 3MNBA 3PLKA 4FUCA 2A7CA 2ZECA 1M9UA 3MH5A 2ZFPH 3T26A 1TX8A 1DICA 5LGOA 1W3CA 1HBTH 4XOJA 1GI5A 4B76A 5L6NH 1MQ5A 3S7KB 1TOMH 1GGDB 2K7XA 1UJ1A 3PTNA 1V2ST 2OC8A 2Q6GA 1Z8IB 3ZZ5A 4AN7A 2ANKH 3K6YA 4D9QA 1MKXK 5JB8S 1SLUB 1TPSA 3L33A 3A7ZA 1W12U 4DGJA 3VXEH 3SHCH 5DK1A 3RM2H 3AAUA 1QL9A 2FOAA 1TNHA 2VVUA 1W11U 1SLVB 3ZVEA 1C2DA 1GG6C 4GLYA 3SGQE 2P8OB 1A7SA 4RKJB 1QHRB 3M7UA 1SLXB 1G3EA 1MCVA 2GD4B 3LPRA 2G4TA 2HALA 4JYVH 2SNWA 3MHWU 1A1RA 1MZAA 3BG8A 4K8YA 1AZ8A 5C1XA 4FU8A 4X1SU 4Q7ZA 4Z6AH 2EA3A 4FUFA 4IBLH 2ZGHA 4UFFH 1BT7A 3LJJA 1SSXA 1TYNA 3GY2A 3C27B 1A4WH 3GY3A 2W3IA 4WVPE 1YCPM 2F91A 3FP6E 3ATIA 2BQ7B 2DUCA 1UVSH 5E8EH 4IMQA 5T6FA 4YT7H 2XCNA 2A5KA 3U69H 3ELAH 3E1XB 3T29A 1W10U 4TWWA 3EQ0H 3RXUA 4BTTB 2SGPE 4ABHA 4FVBA 2F9BH 3AW1A 1GI2A 2XW9A 3A80A 4GHTA 6ESTA 1FMGA 4GCHG 1NM6A 1NFXA 2ANYA 4ZXYH 4CHAB 1O2XA 1BHXB 1QRXA 1TNKA 4AORA 2H9HA 2ZHWH 1XMNB 3QZQA 3UOUA 2PV9B 2GX4A 1XUJA 3SNAA 1Y3WA 2VINA 3DUXH 4GAWA 2VB0A 1PQ5A 5C5NA 3SV9A 1QL8A 5HMAA 1KXFA 1TRNA 1PQAA 4ESTE 5CE1A 1A2CH 1FQ3A 1MD8A 4LOYH 1INCA 2P16A 2FM2A 5FAHA 1DFPA 4YZUA 1UTNA 2BDIA 3A7TA 3S9CA 1O2ZA 1AB9B 4J1YA 3LGUA 1P2MA 1UTJA 4O03A 4R8TB 2Z3EA 1DWDH 1JMOH 1YPHE 2BD3A 1O3GA 3H7OA 4FUJA 1DXPA 1LO6A 3TNTA 5DP7A 1XUFA 2PKSB 4ZMAH 1SB1H 2ZU2A 3BTFE 1QRWA 4AGKA 2B0FA 2GMTC 3RXRA 3TGKE 1C5MD 3SJ8A 1C1PA 3ZYDA 2UUJB 2R9PA 2QA9E 2VIDA 2ZI2H 2J34A 1BUIA 1TPAE 1C2IA 4X6MA 2ZU4A 1VCQA 3VB6A 2BY6X 1SPJA 4CRBA 1SI5H 3SJOA 3E91A 1ELVA 3LC3A 4ABEA 5DP8A 2A5AA 1GGDC 4NSYA 4XFQA 3A8BA 3LGWA 1RJXB 5ETXA 3S7HB 3FVFB 3PTBA 1E35B 1E37B 5A8XA 1CSOE 4AX9H 1AI8H 4BTUB 3FFGA 1THRH 4AG2A 4F49A 3SGAE 7GCHF 1C1MA 1LKAA 1Q31A 3M7QA 1ELDE 1NROH 3ZV8A 1C2EA 3Q77A 1V2TT 1KXAA 1LHCH 1DLKB 3R0FA 1F0TA 2BLOA 3ESTA 3M3TA 1P2NA 2P8OC 1VITG 3SNEA 1SMFE 1P2JA 1WUNH 1IHSH 1GHWH 3GY7A 3PO1B 2BY8X 2C8YB 5E2OA 1MZDA 4H6TA 1GI8B 1HIAA 3ZVAA 3ZZ9A 1NN6A 3UIRA 1P9UA 2FOBA 1UVOA 3SJKA 2CV3A 4X1RU 1SGFG 1SOZA 1L4ZA 1QCPA 3LGTA 1GBLA 1BDAA 1ZPZA 1DXWA 2A45B 4O3UA 1E0FD 5C67A 4JZIA 1NRNH 1SGYE 3QTOH 1SFIA 3ZZ8A 2OXSA 3M5MA 4E7RG 1OWHA 1PPCE 1FY4A 1TGBA 1O34A 2Y82A 4AG1A 1TBZH 3G01A 4Z0KA 3UWJH 1O3IA 1P8VC 7ESTE 1S81A 2BD8A 5J4SA 4X1NU 4X2VA 2BDAA 4CHAC 1HNEE 5DP6A 5GJ4B 1LDTT 2D2DA 4JCNA 3SOSA 2VIPA 5DPAA 1K1PA 3U8RH 1FY3A 4O9VA 1OS8A 3W94A 3U1JB 3SI4H 1UHBB 4CRDA 2WUBA 1O5GH 1KDQA 2NU4E 4GPGA 3AW0A 1HPGA 4MNWA 1KTSB 3LDXH 4NA7A 1P9SA 1Z6EA 1WYKA 4IC6A 4U2WA 1A5GH 1AB9C 1AVXA 1BTXA 3A8CA 2AGGX 2ZFFH 1OPHB 2QY0B 1HAPH 1GPZA 3RXHA 1AFQB 2HWLB 3QWCH 1P2OA 4MPUA 3A86A 1QURH 3ATWA 2FWWA 1YP9A 5GIBA 1CQQA 1GHYH 2TRMA 1LPKB 2PKSC 1BQYA 1AIXH 3Q76A 4F4OC 4DIIH 4Q7XA 1AWFH 1EZXC 5FXLA 3IG6B 3PWBA 1MU8B 4UE7H 3RXBA 2ZPSA 3SUEA 1WOFA 2ZZUH 4NIVA 3E0PB 3KNXA 1A0JA 2GCHG 1MAYA 3TVJB 1HXFH 2FI5E 1BMAA 1H8DH 3RXLA 1SQOA 4BAMB 2ASUB 1MTWA 3HATH 3QDZB 2FESH 1BMMH 1CO7E 1KLIH 1D4PB 3SU2A 3VXFH 4ZKNU 1GBFA 3ZZBA 1UVUH 3K2UA 1WCZA 1Y3XA 1G3BA 1TNGA 3ATMA 1DWCH 5I46H 1DSTA 3TIUA 1NRQH 1O35A 1RD3B 3F9FA 1YBWA 4AYYB 5EQQA 2P3UB 4CH2B 4JYUH 1FN6A 4I8JA 4INLA 1BTYA 1FV9A 3BG4B 4YESB 3RU4E 5F03A 5AVDA 1TPPA 3KEEA 1P09A 1FXYA 4X8SH 3RXQA 5FPYA 3MMGA 1DUAA 1EQ9A 1OYTH 1ABJH 1T8NA 2GP9B 2XBVA 1GI7B 1YPLH 1NS3A 1PPHE 2VIWA 4O3TA 2XBXA 3PO1C 1GL0E 2J4IA 2XC0A 3MNCA 3TK5A 3MYWA 4D9RA 3UNRA 2ZCHP 3KF2A 1C4U2 2AFQB 1L1JA