1KXEA

Sindbis virus capsid (y180s, e183g double mutant), tetragonal crystal form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
157
structure length
157
Chain Sequence
LKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTSTSGHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
total genus 30
structure length 157
sequence length 157
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxeA01
2P95A 2RDLA 4TPIZ 4DIIH 3UQOA 5FXLA 4E05H 3A7YA 3ATMA 1C1UH 4CRAA 3PLBA 1A2CH 3QK1A 1DE7H 2ANWA 1FUJA 2ZHQH 4K1TA 2AMDA 5DGJA 2ZDAH 1TRYA 1HV7A 2EI8A 3BTQE 2HWLB 4AFQA 1NFUA 2Z9JA 5ESBA 2ULLA 1HFDA 2ZPQA 1O3NA 1CHOG 1O3LA 2Z6BD 3BTWE 2A5KA 4CR5A 2I6SA 2ZGCA 4OS6A 1Y3UA 3A84A 1DWCH 3G01A 3D62A 3WY8A 1QA7A 1V2WT 1EAUA 1GBLA 2GCTB 2ANKH 2A45B 1GI4A 4ZHMU 1GL1A 3MO3A 3NXPA 3RXUA 4AFUA 1S84A 2QN5T 1C1RA 1GI5A 2ZWLH 1ZGVA 3LGIA 3Q3XA 4WMDA 2W26A 1O2ZA 1MBMA 3Q00A 2B7DH 5C3NA 1BTHH 2ANYA 1GBTA 4BXWA 3RM0H 2IN2A 5L2YH 3OYPA 3S0NA 3EA8A 1Y5AT 1K9OE 1A7SA 2XC4A 2ZHDA 3C1KA 4K2YA 1PQ7A 2O9QA 1AUJA 1QIXB 1H1BA 1UCYH 1W0ZU 2Q6GA 1IHSH 2G5VA 2Z9LA 4BNRA 3BEUA 3QUMP 4KP0A 1CT2E 2ZIQH 1FIWA 1HJAC 3LIWA 3PO1B 3QLPH 5IYTA 3A8CA 3BIUH 1CO7E 1O2VA 8KME2 1XUKA 1UCYE 1DS2E 4Y10E 3W95A 1W7XH 4Y79A 4ISHH 1ZMLA 7KMEH 2ZDKA 2FO9A 4AYYB 1OOKB 1O33A 4MPWA 1W14U 1ESTA 3UR6A 2BZAA 1SC8U 2ZTYA 1S81A 3LC3A 5E8EH 5I46H 4INHA 2ODQA 3UR9A 3ZYEA 1C2MA 2P94A 2WPLS 2A31A 4WJG2 1Z8RA 1CSOE 1ELDE 3QWCH 2ZPSA 4JCNA 4ABHA 1KXFA 1IQJA 1FIZA 2HGTH 2HVXA 3L33A 4X2YA 5F8XA 3MFJA 1O3OA 1WOFA 2XBXA 1G37A 5TJXA 7GCHF 1PPZA 5DK1A 1QRZA 1PJPA 3KQBA 3V13A 4IW4E 3LGWA 3SGBE 3ESTA 1C9PA 1P2KA 3O8DA 3S9AA 1MTVA 2Q6DA 2XWBI 1NTPA 1QRWA 1RTKA 1GJCB 2BD8A 5CHAC 3ZZ6A 1GHZA 1BRUP 2EA3A 4ASHA 4XBBA 1K1JA 3BTGE 1O5AB 2ZFRH 1JOUB 2QA9E 4KTSA 1PPHE 1OWJA 2EI7A 3TJVA 4B76A 1GJ4H 2FOGA 3A7TA 3ZVAA 4CRDA 4LOYH 5DPAA 1GI8B 1TE0A 2GVFA 4XDEA 2JH0D 3SUGA 5BRRE 1ANBA 1C5OH 2BVXH 4YT6H 5FPTA 1C5XB 5AF9H 1P3EA 1V6DA 1C1PA 1FPHH 4FUJA 1NM6A 2XTTB 2YNBA 3RM2H 3V12A 3TLOA 2ZC9H 3LH1A 1D6RA 3FZZA 3BV9B 2VGCB 1BTUA 3I77A 1SGNE 4MPXA 4WH8A 4CBNA 1VCWA 1GMHG 6CHAC 1TRNA 1O5FH 1Z71A 2OINA 4YOGA 3A7VA 1D3TB 4GPGA 3UIRA 3KN2A 2BD5A 1C1NA 1GMCF 3C27B 2UWLA 1N6XA 3GY5A 3SNBA 4XSKU 1L0ZA 2ZTXA 1O2SA 1SGEE 1Z8GA 1MMJN 3GCHB 5EXLA 2AGIX 2V35A 4QT8C 2QCYA 5EG4A 4NIXA 1GL0E 2OBQA 3RXPA 2H9TH 3DFJA 3A83A 1K1PA 1DITH 2CN0H 4NIWA 2G81E 2FYRA 7GCHG 3ODDA 1A0LA 1T8OA 1D9IA 4X2VA 3A8DA 2BY5X 1GMHF 1WV7H 2QF3A 2H5CA 1GHYH 1K1NA 3BTEE 4AGKA 4J2YB 5E2PA 1ELTA 1QR3E 1MCVA 3JZ2B 1EOJA 1QGFA 1THRH 1GJBB 1U6QA 3TGKE 3S9CA 3RXLA 2FX4A 1C4Y2 4MNXA 4TPYA 3QTOH 1HAZB 1SGTA 1WAYB 1YP9A 1DM4B 1HXEH 4H42U 2H9HA 4O97A 4Q2KA 4X6NA 3KF2A 2P3FH 2UUYA 2JETC 1IQMA 1O37A 1T4UH 2PSYA 3N7OA 3SJOA 5F8TA 1GBBA 2AH4X 8LPRA 1C1OA 3QGJA 1H4WA 3U1IB 5JBCS 1C5TA 4NSVA 1HDTH 4TWWA 3SU2A 5HM9A 1K22H 3S7KB 2THFB 4BTIB 4ZXYH 1BIOA 1O2NA 5F8ZA 1UTJA 1JMOH 4I8GA 1HAVA 1TIOA 4U32A 3URCA 1P2OA 2FTLE 2ZA5A 1SL3A 2J34A 2IJOB 4I31A 5AFYH 1TPAE 6GCHG 1A3BH 1CT4E 5DP8A 1ZMJA 1SLXB 2VIQA 2GTBA 1TGSZ 1MH0A 4D9QA 1GVZA 2V3OH 2AGEX 1TQ7B 4X8UH 1C1TA 2HALA 3MU0A 2BY6X 1MKWH 1W11U 2WPMS 1RIWB 2AIPA 3LONA 5C2ZA 4FU7A 5C5OA 5A8YA 3U8RH 1G3EA 3NK8A 1T32A 3CS7A 4CR9A 3SUDA 1GBEA 5FHTA 2OBOA 1OWIA 2PGBB 2BY9X 1EPTC 2R0KA 1GVKB 3OTJE 5F03A 1YPMH 3MU1A 1QCPA 5JBAS 2JH5D 5A09A 2A7JA 1TMTH 1KSNA 4IBLH 4B71A 3ZZ7A 3GYLB 3RMNH 1O36A 3PWCA 4BTUB 1FMGA 2OP9A 1XKAC 1G32B 1A5HA 1N8OC 1ELCA 3LU9B 1JIMA 1SQAA 3KNXA 1BTZA 4A1TA 1KLTA 5JYIA 1K1IA 4OGYA 5FCRA 1TAWA 4X1RU 1MQ5A 3HATH 3LJOA 4ZHLU 1IQNA 1K21H 5F6MA 4AG2A 3ATKA 3VPKA 1O5EH 1J9CH 1LHEH 5JB9S 1EB2A 1BJUA 3MH4A 3SJ9A 1OWKA 1YGCH 1TGCA 3ZZAA 4UFFH 1S5SA 5EQQA 2J95A 3MNBA 5EW2H 1SG8B 2DE8A 4XBCA 2B0FA 1ANCA 1GJDB 2FOMB 2ZF0H 4JZIA 1Q31A 1BMAA 3RXMA 4YOIA 4H4FA 4RKJB 3B9FH 3ZVCA 2ZDLA 4AB9A 1ELVA 3ZVEA 3STIA 2BVSH 4YZUA 4RKOB 1EP6A 3MYWA 4Y8ZA 1GG6B 1UVPA 2NU4E 5C20A 2P3TB 2WPHS 3P8OA 2XYAA 1P9SA 2QV1A 2Y80A 1ZRBA 3RUOA 2CJIA 1YPEH 2R2MB 2VVVA 1DDJA 1MTNB 2ZGBH 5JDUB 1EXFA 1ZPZA 3FZDA 1Y3YA 1Q3XA 4JZEH 3RMLH 2PKSB 3SU5A 5A8XA 2Z9GA 2FODA 2BY7X 2FWWA 2XC0A 3HGNA 5DP3A 3S7HB 1A0JA 2CGAA 1A5IA 3QZRA 3A8AA 1CVWH 1MKWK 2Z9KA 4A5TS 1HGTH 2SNWA 1W8BH 1BITA 1TNKA 1UVOA 4ZMAH 1HAHH 1M9UA 2R3YA 3TJUA 2GCHF 3ZZ5A 3SV8A 3UUZA 3QO6A 1A4WH 1MBQA 2V6NA 1J14A 1TGBA 2FS9A 3K9XB 3RMOH 1ARBA 2QXGA 2AYWA 3PM3A 3EA7A 1PPCE 1SGRE 1KXDA 1HAIH 1ETTH 1O5CB 4UFEH 1VZQH 1O2IA 1QA0A 2F9NA 1GMDG 3SI4H 3LH3A 1AKSA 4Y11E 2FPZA 2XNIA 1RFNA 1O2JA 3P70B 4JK5A 2BQ7B 2ZFTA 3VB4A 3ZV9A 1VCQA 3RXKA 1YPKH 2OTVA 1DLEA 1V2TT 3F6UH 2JKHA 2WUBA 3UWIA 1GHBF 2ZCKP 3P6ZB 1BBRE 2H5DA 1T4VH 1ZSKA 3EDXB 1HRTH 4FVDA 2XW9A 5ABWA 3SU1A 3BSQA 2DUCA 1DT2A 1B0FA 4AFSA 5HGGA 4UFGH 2F3CE 5FBEA 2A7HA 1O5DH 2R0LA 3TU7H 1AHTH 2ZO3H 1GVLA 3MU5A 4VGCB 4X1NU 1EATA 1KXAA 4K69A 1BHXB 2XRCA 3LPRA 1PFXC 1ZPCA 5TCAA 3RLWH 3E90B 5EQRA 1NRRH 1RTLA 2AFQB 2GKVE 3TK9A 1SOTA 4Y8XA 1AFQB 1OWHA 1P2MA 2CV3A 4NFEA 1GHVH 3PMAB 1NC6A 1SGQE 3A89A 3PYHA 1HAYB 3Q3YA 1UTKA 1WUNH 2WPJS 1GHAF 1LO6A 3LGUA 3SO3A 1TALA 3O8RA 4YT7H 4BAMB 4Z0KA 3FVFB 3T2NA 3BTTE 4XOJA 3DD2H 3EA9A 1AUTC 1B5GH 2VVUA 3O8BA 1QL8A 2VIDA 1OWEA 2FMJA 2H9EH 5A0AE 1W0YH 1SBWA 2ZG0H 1MTNC 1O3AA 2ASUB 3W94A 1E37B 1TWXB 1MQ6A 1QNJA 3M35A 1O38A 2A32A 1NO9H 3VB7A 1KYNA 3ZVBA 2P8OB 4WXVA 4DOQA 3PB1E 1GJ7B 4CH2B 1WSSH 1C4U2 3RXTA 2ZGJA 1ZYOA 5J4SA 1AD8H 4NG9H 2FOFA 3SZNA 4D76A 2TGTA 1IAUA 5GDSH 1F5RA 3MH7A 4XFQA 2OLGA 3QZQA 1Y3XA 1MU6B 3BIVH 3MNCA 5LH8A 1AY6H 3PWBA 1TGTA 2XCFA 4BXSA 1NS3A 4INLA 1MCTA 1TX8A 1GBMA 4AB8A 3M5OA 1NY22 2PTNA 1FQ3A 2HPQH 1TABE 2F91A 2C8WB 1C1WH 1AI8H 2A4OA 4CHAC 1AN1E 3GY3A 2BTCE 1LVBA 3RXEA 1WBGB 5EGMA 3TJOA 1L1NA 1NFYA 2ESTE 4B1TA 1O39A 1O3JA 3ZV8A 3V0XA 1V2RT 4U2WA 4A7IB 2GMTB 1CGJE 1SB1H 3Q3KA 1OPHB 4HFPB 1NRNH 3Q77A 4D8NA 2BDIA 3E0NB 4JK6A 4DW2U 1YPHE 1TX7A 1A61H 8ESTE 1SOZA 4K1EA 4OS1A 1IQGA 3I29A 5L2ZH 2OC0A 2G52A 1SGDE 1FPCH 3ZZDA 4ZHAA 1C5MD 3E91A 1JXPA 1D3PB 4UE7H 1AWFH 2D26C 1F2SE 1VITG 1DUEA 2FM2A 4NIYA 5LPFA 1LMWB 1UVSH 4ZXXH 3V7TA 1UMAH 4CRCA 2Z7FE 1YCPM 1EUFA 1K1MA 2WPIS 3OY5U 4GHQA 1TPPA 4INKA 1O5BB 1ELFA 2BYAX 1XUIA 2FI3E 5LPEA 2FYQA 1O2MA 1O3BA 3EYDA 4BAQB 3TNSA 1UK2A 1GI7B 4JYUH 1SGYE 1C2IA 4KTUA 1BMNH 1AZZA 1ANDA 1RTFB 1B7XB 3DUXH 1C5LH 1BZXE 1BTYA 3RMMH 4ZROA 1Y59T 2ZKSA 2EI6A 3GDVA 3M7QA 4CRBA 3SV2H 2VJ1A 5FX6A 1FY3A 3VXEH 2Y82A 3MU8A 4AYVB 2A5AA 1BJVA 1ANEA 5SGAE 3RXIA 4AFZA 1GI6A 4AX9H 2XBWA 4SGBE 4CHAB 3ODFA 1GG6C 1KDQA 4NZLA 1V2JT 1UVTH 3K6YA 1UTNA 1A5GH 1XMNB 2WPKS 4KTCA 3F9EA 1MTUA 1ZTKA 2OQUA 1LPZB 3TPIZ 1MZAA 3KQDA 5JB8S 5EPNA 1PPEE 1YF4A 1MTWA 1BRCE 4AGJA 2SGEE 3U9AH 4DG4A 2VGCC 1QBNA 1QB1A 1GJ8B 3A7WA 5ETXA 3DA9B 2J4IA 2O8WA 1OYTH 1O2XA 4I8LA 5CE1A 1GI2A 2FI5E 3SV9A 3E3TA 5GXPA 4OS5A 2G4UA 2J38A 1SGFA 3IWMA 4X2WA 1C1QA 3ZYDA 4IN2A 4ABEA 2AMQA 1S85A 1GBAA 3GCOA 3MOCA 1P05A 1AGJA 1O3EA 2A2QH 1XVOA 2OCVB 3TGJE 3VB3A 1V2VT 2ZEBA 1IHTH 1EJAA 2ZQ1A 3U8OH 1K1LA 1TA6A 3GICB 2BMGB 3TNTA 3I78A 1AQ7A 1EZSC 2STBE 3NZIA 2OD3B 4ABDA 1P04A 3TH2H 1HJ8A 1G2MA 1LHCH 4B73A 1SLWB 2BD7A 2G51A 4JMYA 5HMAA 2ZP0H 3L6PA 1HNEE 3TGIE 1O2LA 1FXYA 5E2OA 5ESTE 3RXCA 1IQFA 2BD3A 2D1JA 1EPTA 1LCYA 1CE5A 1AFQC 4I8JA 4DGJA 3D49H 2Z3DA 3LDXH 4KELA 3FANA 4UD9H 3RXRA 5T6FA 1KLJH 3HK3B 1TQ0B 1HCGA 1GDNA 2SGDE 3FP7E 2NWNA 4I8KA 3RXGA 2NU2E 1ZTLA 2C4FH 5CHAB 3TIUA 3RXVA 1J15A 2HOBA 1O2KA 2JETB 4X6MA 2VU8E 1P01A 4E7RG 1AB9B 1UVUH 1CBWC 3A7XA 2PLXA 1QJ1B 2PHBA 4XBDA 1VJAU 1W12U 4YTAA 1INCA 2G4TA 1O2RA 2XWAA 2H2ZA 3ZZ4A 2F9BH 4ZKNU 1LPKB 2Y7XA 3RXOA 1UCYK 1TFXA 1UTQA 3SI3H 2ZZUH 5C1XA 1P2QA 1ID5H 1ZMNA 4AG1A 3Q76A 4ZKOU 1C2JA 5DO4H 1PQ8A 1HLTH 3HKJB 3U69H 4IN1A 3TITA 3IG6B 2QIQA 1QQ4A 2ZDNA 2QC2A 8GCHG 2EEKA 1ZPBA 1X7AC 1LDTT 1WQVH 1WU1A 1C5ZB 1NESE 1HAXB 5DJ7A 2A1DB 1EZQA 1UJ1A 1IQHA 2QYIA 2TIOA 4Q7ZA 3P92A 3FFGA 1DVAH 2FLBH 4GCHG 4KGAA 2UWOA 1ZZZA 4NCYA 4Y76A 3SOSA 4MPUA 4X6PA 1P2NA 3SW2B 1FLEE 1HJAB 1SVPA 1O2WA 2OQ5A 1AVWA 1W13U 1DANH 1PYTD 5DP4A 4YO9A 3SJKA 1G30B 2ZFPH 1GI3A 3T5FH 1BRAA 1AFEH 5EODA 2BDCA 1VGCC 3VB5A 1P3CA 2QY0B 2QAAA 4DVAU 3NKKA 4ZH8A 1HXFH 2M5TA 1L1JA 1O3PB 3AW0A 5I25A 2Y5GA 3SORA 3URDA 1FN6A 4B2AA 4NSYA 2JH6D 3M3SA 1Z1IA 3BTKE 3GDUA 4K8YA 2VIOA 2CF8H 1SQTA 2GV6A 3HGPA 3K65B 4AN7A 2PKAA 2ZHEH 4NGAH 2WYGA 1Z8IB 2A7CA 2FOHA 1F0RA 2QF0A 1C2HA 1DFPA 1TGNA 2KAIB 3VXFH 3VB6A 3KQCA 1O34A 1CBWB 4JZ1A 1V2LT 3RXFA 3NUMA 1GHAG 1TPSA 3HPTB 4FUDA 3T29A 2A5IA 1Z7KA 1YPJH 1P02A 3KHVA 2GGVB 1GBCA 1IQIA 2C93B 2ZI2H 1K1OA 4BTTB 1SI5H 2P16A 1GHXH 2BHGA 4MNVA 1GI9B 3UFAA 2W7UA 2A0QB 1ACBE 4MPVA 4FUGA 5DP7A 2VH0A 2IOTA 1FY1A 1CA8B 2R9PA 5A2MH 2ZHWH 4A92A 2G5NA 2O8UA 1FONA 3ZZBA 2SGQE 1BMMH 5FCKA 3P95A 1ZGIA 4BANB 4BOHA 2ZU4A 1YKTA 3SUEA 1A3EH 2P59A 2Y6TA 3T25A 1C5NH 4J1YA 3ELAH 5DP5A 1BDAA 3T62A 1W7GH 4FU9A 2G8TA 1TBQH 1LKAA 2ZU3A 3UOUA 3HKIB 1FI8A 2HNTC 1OX1A 4WY3A 2VIVA 2ZQ2A 2CHAC 3UPEA 3GISB 3ZZ8A 1O32A 1MD8A 1QFKH 4BAKB 2FP7B 2DE9A 5HYOA 1GDUA 5E0GA 3E6PH 1AB9C 3A7ZA 3U98H 5H4IB 1GBHA 2ZNKH 1BBRK 1Z6EA 4NWLA 5FPSA 2OC1A 1P9UA 3NPSA 4FUFA 2D8WA 3ATIA 1HIAB 4ISOA 1PPFE 3MH6A 2C90B 3PV4A 3RC6A 1DPOA 4B2CA 1TPOA 1SPJA 2F9OA 1GJ9B 1IOEA 5K7RA 1DSTA 3FP6E 1O31A 2ZGHA 1Y8TA 4UDWH 3SJIA 3PO1C 4ZKRU 1O2TA 5DG6A 4AOQA 4ISLA 1O2PA 1KIGH 2VINA 3KIDU 5JBBS 3ZVGA 3A82A 1KY9A 5DP9A 1C2EA 4Q7YA 3E16B 1NRQH 1DWBH 1H8IH 2SGAA 3SUFA 4DT7B 3UREA 1BT7A 1F92A 1OYQA 2FTMA 4TWYA 4NFFA 1FZZA 2P3UB 2C8YB 3S9BA 3SNCA 1N6YA 1OKXA 4Y8YA 2Y5FA 1W3CA 2PKAB 3E0PB 1O5GH 1V2UT 4DJZB 5HM2A 3ZVDA 3BTME 1T8NA 2J9NA 1DY8A 1NFWA 2O8MA 1SGPE 1YCPH 3GY4A 2UUFB 4AZ2B 3A80A 5T6DA 4RN6A 2B5TB 3RU4E 5PTPA 1KDQB 2VB0A 3M7UA 3R0FA 2CXVA 5AVDA 2VIPA 2EC9H 2B8OH 1JRSA 2ILNA 2YOLA 3E1XB 5LPRA 3BN9A 2D2DA 3UY9A 4ABGA 1V2PT 1L2EA 2BLVA 2W3KA 4R0IA 1GBFA 3BG4B 4IMQA 2J2UA 3OU0A 1NN6A 3SGQE 2BD4A 2A4QA 2BQWB 3DFLA 3QX5H 2W5EA 5L30H 1C4V2 1DWEH 2FZZA 2VWMA 4E06H 3KCGH 1EQ9A 4GVUA 2VWOA 2BB4A 2BDHA 4WMEA 1GGDC 5DKMA 2PW8H 1MD7A 1DUAA 5L6NH 3LGYA 2BLQA 4H6TA 1ZHRA 3PMBB 2GT7A 2TGPZ 2RA3A 3MWIU 1C5RA 4FVBA 1Z8JB 2I6QA 3PMJA 4GHTA 5AHGH 3MH5A 1V2MT 4JZDH 3QGNB 1EP5A 3RXDA 1SSXA 2WV4A 4D7FA 1QBOA 8GCHF 1O2YA 3PMHB 5A0CA 1C1MA 4Y7BA 1FY4A 3AASA 1QTFA 4OGXA 1SR5C 2WINI 2UUJB 2GDDA 3TH3H 4BAOB 5IDKA 2ZFQH 1UTLM 2FI4E 3PLKA 4K60A 1V2NT 1GJ6A 1NFXA 1ESAA 3F1SB 1ELGA 1TBZH 1AVXA 1G2LA 1QL7A 4F4OC 2BZ6H 4F49A 2Q1JA 7LPRA 1NRSH 2ZU1A 1GCDA 1LKBA 3M37A 2GDEH 4LK4A 3SQEE 3JZ1B 1YPLH 4I8HA 1TRMA 2QXIA 4CREA 4D7GA 1GJAB 1QB9A 4FUIA 3GDSA 1O30A 1FN8A 3AVZA 4IGDA 2ZECA 1L4ZA 2HNTE 3LKWA 1YYY1 3KQEA 1V2QT 4K3JA 5G4BA 1THPB 1FNIA 2A4RA 3S69A 1BBRH 3KGPA 1OP8A 3U8TH 3LGVA 5GCHF 4FXGH 3RXAA 3SNDA 4YM9A 5FAHA 1MU8B 3RU4D 1EAWA 3RXBA 4UFDH 2IPHA 1FY8E 1AZ8A 1JIRA 3CS0A 1C2LA 2BD2A 3SN8A 1EAIA 1TOCB 2AMPA 3BG8A 4WXIA 2ZU2A 3LJJA 1Z1JA 1TLDA 1ZHMA 4YLUA 1WYKA 1TYNA 1LHFH 1F7ZA 3LC5A 1EZXC 3ENSB 1YCPK 1C2KA 4TY7A 3H7OA 2Y81A 4WVPE 2FDAA 3CP7A 2BXUH 1NPMA 4MTBA 4X1QU 3PLPA 4AORA 1BTXA 1O2OA 3AAVA 2AIQA 1PPGE 2PTCE 1QQUA 4THNH 2BXTH 1E0FD 1OWDA 2F83A 1AE5A 1AIXH 2WYJA 3QN7A 2OXSA 1ZLRA 2PUQH 1XUHA 1ABIH 4LXBH 1GBKA 2FXRA 1EKBB 2BDBA 1XXDA 1YLCA 4GLYA 3TJNA 1F5LA 2VIWA 3QTVH 4JYTA 1UTOA 2PR3A 2O8LA 2VWLA 2ZDVH 1F0TA 4ABFA 3UWJH 1C2GA 1GHBG 1KTSB 2WV5A 2BY8X 3TK6A 1H9IE 1EZUC 3M5MA 4LZ4B 2BM2A 5GPIB 1MAXA 1NU7B 3M5LA 1ETRH 3BTHE 1LVYA 2ZGXH 1QRXA 2BQ6B 3BTDE 3SJ8A 2ZPRA 1JRTA 4ZAEA 4A1XA 2BDYA 2ODPA 5EW1H 3TH4H 1J17T 4GCHF 1VR1H 3AW1A 1NRPH 1DLKB 4I33A 2GZ8A 2FX6A 2HNTF 6CHAB 3A81A 2QGRA 1SHHB 6GCHF 1DY9A 1EAXA 4U01A 1P2JA 1BTWA 1QBVH 1D3DB 1XXFA 1C5QA 4ABJA 1DWDH 2GZ9A 1CQQA 3UNSA 1LVMA 2QXJA 4JZFH 1K2I1 5GCHG 1JWTA 4GSOA 3AAUA 4NIVA 3VFEA 1TNJA 2A4GA 3BEIB 4B74A 4FUCA 3P17H 2AERH 2ODYB 2PSXA 1VGCB 1Y5UT 1UK3A 1QJ6B 1FJSA 3GCTF 3DHKH 1HJ9A 3EE0B 1XKBC 2QXHA 3D23A 4Y7AA 3RP2A 1TMBH 1C9TA 1T8LA 1HAOH 5B6OA 2PGQB 1RIWC 4A1VA 1MKXK 1KTTB 2HPPH 1P03A 1N8OB 3ATLA 4O3UA 4X8TH 1ETSH 4DURA 1DOJA 3SGAE 4NA7A 3SU6A 4WF8A 3RC5A 1HB0B 4O9VA 5EQSA 1KXBA 1S82A 2V3HH 4NA9H 2WUCA 3V3MA 4X8VH 1EPTB 1ZR0A 1WTHD 1GJ5H 1GDQA 1OS8A 1KXCA 9LPRA 3SU3A 5A8ZA 5J4QA 3QDZB 1BOQA 2ZDMA 4Y71A 2BD9A 3TK5A 1BHXF 1O3DA 4ZKSU 1SGIB 1ELAA 3SQHE 1UK4A 2GP9B 2XCNA 4X8SH 3ZVFA 4K8BA 1LPGB 1O3HA 4FUBA 1HIAA 3SNAA 1DSUA 1SMFE 1SFIA 1HUTH 1BTPA 5C5NA 3UTUH 1GI1A 1ZHPA 1RRKA 4NZQA 3GY2A 2BX3A 2G00A 3F68H 3M61U 2FS8A 1A46H 1HYLA 1C2DA 1FAXA 1C5UA 1ELEE 4HGCA 4X1PU 2TGAA 1TOMH 1UTPA 2CHAB 4E7NA 5TCCA 1ZSLA 1TB6H 3NCLA 3RXSA 1Y3WA 4CBOA 1ZJDA 2YNAA 2W3IA 1CU1A 3SHCH 4ISIH 1EX3A 4YESB 2W7SA 1BA8B 1O3IA 2Q6FA 1YC0A 3BTFE 2FIRH 1ORFA 2P8OC 1VITH 2FEQH 4FUHA 4WMFA 2K1QA 1BQYA 3RU4T 3H7TA 2SGPE 5AFZH 1G3BA 1OSSA 2GZ7A 2F9UA 1J16A 2AS9A 2XBVA 1ZTJA 2GCTC 2RG3A 3T26A 2FOBA 2TPIZ 1CHOF 5EXMA 1C5SA 1AO5A 1TA2A 1VJ9U 2BLOA 1JBUH 1UHBA 3RLYH 1V2ST 5DP6A 2H1UA 3M3TA 9ESTA 3T27A 1ZRKA 2SNVA 1O3FA 1YLDA 4OS7A 3TVJB 2VVCA 3KEEA 3DT0H 4JYVH 4ABAA 3OX7U 1L1GA 2NU1E 4CH8B 1P8VC 1CT0E 1GCTC 4U30A 1KLIH 2ALPA 1P0SH 2HLCA 3FAOA 1GCTB 1P57B 1GPZA 1MUEB 3GCHC 3HK6B 2OC8A 3RDZA 1FV9A 1VITF 2BX4A 3P8NA 1AE8H 3ATWA 1SGFG 3SNEA 4UONA 2NU0E 1T31A 2C3SA 3MNSA 1A1RA 3UNRA 1EJMA 1HAGE 1DXWA 3M3VA 1G3CA 2F9PA 1NU9A 1CGHA 3GYMA 1HBTH 1AVGH 2BOKA 4X0WU 4ESTE 2OUAA 2Z94A 4TY6A 1GI0A 1IQLA 3MO6A 3LT3A 4GUXA 5FPYA 1QURH 3MI4A 1GBIA 1FAKH 3VGCC 3GOVB 5EXNA 2OC7A 1SLVB 3EQ0H 3ZZ3A 3M5NA 3MHWU 2GCHG 2TGDA 1GBDA 3ZZCA 4YLQH 1S6FA 3GCNA 3B8JA 3P8FA 2R3UA 3R3GB 5T3HA 3PROA 5C67A 1S0RA 4OS4A 4SGAE 2FOEA 5E0JA 1YM0A 1P11E 3M7TA 1SFQB 6LPRA 2TRMA 1HPGA 1XUFA 2PWXA 3GY7A 2ZFSA 1C1SA 1ZSJA 3F9HA 1Y5BT 2ZFFH 1LHDH 2SFAA 1GWAA 2A2XH 1NROH 1UTMA 1K28D 1HAVB 3ITIA 4XE4A 1IQEA 1ZJKA 1Y3VA 3EAJA 4K5ZA 1MTSA 4HTCH 2TBSA 1D6WA 3GY6A 4X1SU 2Y5HA 5GWZA 3MNXA 4MLFB 1L4DA 4MG3A 1YPHC 2PKSC 1P2IA 1EOLA 2H6MA 1PQAA 1QY6A 2GD4B 1TNHA 4NWKA 1T8MA 1LTOA 1O3GA 2FLRH 5CMXH 4D9RA 1HAPH 4MNYA 1H8DH 1O3CA 1V2KT 3K6ZA 2BDGA 4ABBA 1P12E 1GHWH 1C5WB 4MVNA 2GMTC 1W2KH 3K2UA 3M36A 4DCDA 2Z9IA 4DY7B 4ABIA 1AKSB 3P8GA 1D4PB 3E8LA 1O0DH 1H9LB 5FX5A 4WH6A 1C5VA 1G9IE 3H5CB 5LGOA 1G3DA 4A6LA 4I32A 1C2FA 2STAE 4WWYA 5T6GA 2ZU5A 4TYDA 3VGCB 1MKXH 1Q2WA 1E34B 1CA0C 1E35B 2ZCLP 1MAYA 4PROA 3PTBA 1T7CA 2PV9B 1OP0A 1O2UA 3BF6H 1GMDF 1C5YB 5EU8A 1NZQH 2PUXB 4H6SB 3KL6A 1G36A 1E38B 2CF9H 4Q7XA 2V0BA 2FOAA 1P09A 4Y6DA 2ZHFH 1RGQA 5C1YA 1XUGA 3SHAH 3LOXA 4YOJA 3B23B 1C5PA 4ISNA 3RXQA 1D3QB 3STJA 2BVRH 1THSH 3F9GA 2NU3E 1XX9A 2B9LA 1TMUH 2GT8A 1EASA 2FOCA 1UO6A 1CA0B 1GGDB 2UUKB 1VCPA 4X6OA 1ABJH 1AU8A 4VGCC 1KXEA 4I7YH 1RXPA 3MMGA 2VH6A 3MTYA 2J92A 3O8CA 1GBJA 2SGFE 1BB0B 3SU0A 4MNWA 2Z3EA 2XC5A 3BG4C 2GV7A 1DX5M 3U1JB 1TBRH 3A86A 4B2BA 1EJNA 1TNLA 1UHBB 4B75A 5GJ4B 1H9HE 1O3KA 2LPRA 2P93A 5K0HA 1LHGH 4FUEA 3SBKA 1P10A 2GX4A 2HRVA 1QL9A 1TONA 4FU8A 1AWHB 3ZZ9A 1A0HB 3F9FA 1XUJA 4DIHH 3UNQA 1DXPA 1MZDA 3UQVA 1TNGA 1O2HA 3OY6U 3T28A 4BAHB 4MQAA 3GCTG 3SV6A 3MU4A 2PFEA 4LZ1H 2XXLA 2LNCA 5C1UA 2RA0A 4KKDA 4ZUHA 2FESH 1LQDB 3LGTA 1V2OT 2C8ZB 5JPMH 1WCZA 5JBTA 1BUIA 4OS2A 5E0HA 1O35A 1AMHA 4IS5A 3RC4A 1FDPA 1QJ7B 1CGIE 3UOPA 1XVMA 1FY5A 2ALVA 2C8XB 2UWPA 4O3TA 1O2GH 1W10U 4IC6A 1ZOMA 3RXJA 3A85A 5BPEA 1DICA 1BRBE 1SLUB 1PYTC 3RXHA 1OXGA 1RJXB 1CHGA 1QHRB 4RSPA 2XBYA 1N1LA 4CRFA 3MO9A 1S6HA 2Z3CA 1F5KU 1RD3B 1BMLA 4IMZA 3GY8A 4HZHA 7ESTE 2KAIA 4Q80A 2ANMH 4CRGA 1TX6A 1QB6A 2CMYA 2Y7ZA 2BDAA 1PPBH 3VEQB 2VWNA 1XM1A 1S0QA 1ELBA 4O03A 2VNTA 1LQEA 4NA8A 1ARCA 1PQ5A 4Y0YE 4Z6AH 3EGKH 1Z6JH 2R2WU 3PTNA 1F0SA 1C1VH 3A8BA 2ZTZA 1F0UA 2J94A 1OP2A 1WQSA 5EOKA 4GAWA 1LVOA 1RS0A 1S83A 2F9VA 3SV7A 1O3MA 5HXFA 3D65E 1SQOA 1J8AA 1SGCA 1GMCG 4Y0ZE 3NWUA 1ESBA 1SHYA 1YPGH 2BLWA 3A87A 4M7GA 4UEHH 1WTGH 1P06A 1B0EA 1EB1H 1YBWA 3BEFB 4HI3A 5A0BA 5FBIA 2BOHB 3A88A 6ESTA 3SU4A 2RCEA 3L3TA 4MDSA 3OSYA 1TNIA 1BCUH 1NT1A 5EPYA 1IQKA 4IC5A 2G55A 2ZCHP 1E36B 2AGGX 2O8TA 3FP8E 1O2QA 3IITA 4K1SA 5GIBA 2AEIH 1V3XA 4R8TB 3CENA 4X2XA
chains in the Genus database with same CATH superfamily
2P95A 2RDLA 4TPIZ 4DIIH 3F3BA 3UQOA 5FXLA 4E05H 3A7YA 3ATMA 1C1UH 4CRAA 3WW7A 3PLBA 1A2CH 3QK1A 1DE7H 2L74A 2ANWA 1FUJA 2ZHQH 4K1TA 2AMDA 5DGJA 2ZDAH 1TRYA 1HV7A 2EI8A 3BTQE 2HWLB 4AFQA 1NFUA 2Z9JA 5ESBA 2ULLA 1HFDA 2ZPQA 1O3NA 1CHOG 1O3LA 2Z6BD 3BTWE 2A5KA 4CR5A 2I6SA 2ZGCA 4OS6A 1Y3UA 3A84A 1DWCH 3G01A 3D62A 3WY8A 1QA7A 1V2WT 1EAUA 1GBLA 2GCTB 2ANKH 2A45B 1GI4A 4ZHMU 3FN8A 1GL1A 3MO3A 3NXPA 3RXUA 4AFUA 1S84A 2QN5T 1C1RA 1GI5A 2ZWLH 1ZGVA 3LGIA 3Q3XA 4WMDA 2W26A 1O2ZA 1MBMA 3Q00A 2B7DH 5C3NA 1BTHH 4F55A 2ANYA 1GBTA 4BXWA 3RM0H 2IN2A 5L2YH 3OYPA 3S0NA 3EA8A 1Y5AT 1K9OE 1A7SA 2XC4A 2ZHDA 3C1KA 4K2YA 1PQ7A 2O9QA 1AUJA 1QIXB 1H1BA 1UCYH 1W0ZU 2Q6GA 1IHSH 2G5VA 2Z9LA 4BNRA 3BEUA 3QUMP 4KP0A 2PP6A 1CT2E 2ZIQH 1FIWA 1HJAC 3LIWA 3PO1B 3QLPH 5IYTA 3A8CA 3BIUH 1CO7E 1O2VA 8KME2 1XUKA 1UCYE 1DS2E 4Y10E 3W95A 1W7XH 3OEHD 4Y79A 4ISHH 1ZMLA 7KMEH 2ZDKA 2FO9A 4AYYB 1OOKB 1O33A 4MPWA 1W14U 1ESTA 3UR6A 2BZAA 1SC8U 2ZTYA 1S81A 3LC3A 5E8EH 5I46H 4INHA 2ODQA 3UR9A 3ZYEA 1C2MA 2P94A 2WPLS 2A31A 4WJG2 1Z8RA 1CSOE 1ELDE 3QWCH 2ZPSA 4JCNA 4ABHA 1KXFA 1IQJA 1FIZA 4F48B 2HGTH 2HVXA 3L33A 4X2YA 5F8XA 2EY4C 3MFJA 1O3OA 1WOFA 2XBXA 1G37A 5TJXA 7GCHF 1PPZA 5DK1A 1QRZA 4B6FA 1PJPA 3KQBA 3V13A 4IW4E 3LGWA 5F53A 3SGBE 1WDIA 3ESTA 1C9PA 1P2KA 2RFKC 3O8DA 1MABB 3S9AA 1MTVA 2Q6DA 2XWBI 1NTPA 1QRWA 1RTKA 1GJCB 2BD8A 5CHAC 3ZZ6A 1GHZA 1BRUP 2EA3A 4ASHA 4XBBA 1K1JA 1EFRD 3BTGE 1O5AB 2ZFRH 1JOUB 4HG6A 2QA9E 4KTSA 1PPHE 1OWJA 2EI7A 3TJVA 4B76A 1GJ4H 2FOGA 3A7TA 3ZVAA 4CRDA 4LOYH 5DPAA 1GI8B 1TE0A 2GVFA 4XDEA 2JH0D 3SUGA 5BRRE 5IK2D 1ANBA 1C5OH 2BVXH 4YT6H 5FPTA 1C5XB 5AF9H 1P3EA 1V6DA 1C1PA 1FPHH 4FUJA 1NM6A 2XTTB 2YNBA 3RM2H 3V12A 3TLOA 2ZC9H 3LH1A 1D6RA 3FZZA 3BV9B 2F4LA 2VGCB 1BTUA 3I77A 1SGNE 2V3MA 4MPXA 4WH8A 4CBNA 1VCWA 1GMHG 6CHAC 1TRNA 1O5FH 1Z71A 2OINA 4YOGA 3A7VA 1D3TB 4GPGA 3UIRA 3KN2A 2BD5A 1C1NA 1GMCF 3C27B 2UWLA 1N6XA 3GY5A 2QF4A 2HVYB 3SNBA 3F0PA 5DN6D 4XSKU 1L0ZA 2ZTXA 1O2SA 3KQ5A 1SGEE 1Z8GA 1MMJN 3GCHB 2W6JD 5EXLA 2AGIX 2V35A 4QT8C 2QCYA 5EG4A 4NIXA 1GL0E 2OBQA 3RXPA 2H9TH 1KMHB 3DFJA 3W1EA 3A83A 1K1PA 3F2HA 1DITH 2CN0H 4NIWA 3F2FA 2G81E 2FYRA 2KR7A 7GCHG 3ODDA 1A0LA 1T8OA 1D9IA 4X2VA 3A8DA 2BY5X 1GMHF 1WV7H 2QF3A 2H5CA 1GHYH 1K1NA 3BTEE 4AGKA 4J2YB 5E2PA 1ELTA 1QR3E 1MCVA 3JZ2B 1EOJA 1QGFA 1THRH 1GJBB 1U6QA 3TGKE 3S9CA 3RXLA 3WWBA 2FX4A 1C4Y2 4MNXA 4Q63A 4TPYA 3QTOH 1HAZB 1SGTA 1WAYB 1YP9A 1DM4B 1HXEH 4H42U 2H9HA 4O97A 4Q2KA 4X6NA 3KF2A 2P3FH 2UUYA 2JETC 4XD7D 1IQMA 1O37A 1T4UH 2PSYA 3N7OA 3SJOA 1NBME 1WXRA 5F8TA 1GBBA 2AH4X 8LPRA 1C1OA 3QGJA 1H4WA 3U1IB 5JBCS 1C5TA 4NSVA 1HDTH 4TWWA 3SU2A 5HM9A 1K22H 3S7KB 2THFB 4BTIB 4ZXYH 2IJD1 1BIOA 1O2NA 5F8ZA 1UTJA 1JMOH 4I8GA 1HAVA 1TIOA 2J98B 4U32A 3URCA 1P2OA 2FTLE 2ZA5A 2CK3D 1SL3A 2J34A 2IJOB 2XOKD 4I31A 5AFYH 1TPAE 6GCHG 1A3BH 1FX0B 1CT4E 2L6OA 5DP8A 1ZMJA 1SLXB 2VIQA 2GTBA 1TGSZ 1MH0A 4D9QA 1GVZA 2V3OH 2AGEX 1TQ7B 4X8UH 1C1TA 2HALA 3MU0A 2BY6X 1MKWH 1W11U 2WPMS 1RIWB 2AIPA 3LONA 5C2ZA 4FU7A 5C5OA 5A8YA 3U8RH 1G3EA 4ZCNA 3NK8A 1T32A 3CS7A 4CR9A 3SUDA 1GBEA 5FHTA 2OBOA 1OWIA 4RI0A 2PGBB 2BY9X 1EPTC 3FOAA 2R0KA 1GVKB 3OTJE 5F03A 1YPMH 3MU1A 1QCPA 5JBAS 2JH5D 5A09A 2A7JA 1TMTH 1KSNA 4IBLH 2HLDD 4B71A 3ZZ7A 3GYLB 3RMNH 1O36A 3PWCA 4BTUB 1FMGA 2OP9A 1XKAC 3CNRA 1G32B 1A5HA 1N8OC 1ELCA 3LU9B 1JIMA 2WHXA 1SQAA 5EJZA 3KNXA 1BTZA 4A1TA 1KLTA 5JYIA 1K1IA 4OGYA 5FCRA 1TAWA 4X1RU 1MQ5A 3HATH 3LJOA 4ZHLU 1IQNA 1K21H 5F6MA 4AG2A 3ATKA 3VPKA 1O5EH 1J9CH 1LHEH 5JB9S 1EB2A 1BJUA 3MH4A 3SJ9A 1OWKA 1YGCH 1TGCA 3ZZAA 4UFFH 1S5SA 5EQQA 2J95A 3MNBA 5EW2H 1K0HA 1SG8B 2DE8A 4XBCA 2B0FA 1ANCA 1GJDB 5KEDA 2FOMB 2ZF0H 4JZIA 1Q31A 1BMAA 3RXMA 4YOIA 4H4FA 4RKJB 3B9FH 3ZVCA 3WWFA 2ZDLA 4AB9A 3N99A 1ELVA 3ZVEA 3STIA 2BVSH 4YZUA 4RKOB 1EP6A 3MYWA 4Y8ZA 1QZ8A 1GG6B 1UVPA 2NU4E 5C20A 2P3TB 2WPHS 3P8OA 2XYAA 1P9SA 2QV1A 2Y80A 1ZRBA 3RUOA 2JJ1D 2CJIA 1YPEH 2R2MB 2VVVA 1DDJA 1MTNB 2ZGBH 5JDUB 1EXFA 1ZPZA 3FZDA 1Y3YA 1Q3XA 4JZEH 1BMFD 3RMLH 2PKSB 3SU5A 5A8XA 2Z9GA 2FODA 2BY7X 2FWWA 2XC0A 3HGNA 5DP3A 3S7HB 1A0JA 2CGAA 1A5IA 2KCAA 3QZRA 3A8AA 1CVWH 1MKWK 2Z9KA 4A5TS 1HGTH 5T1VA 2JDID 2SNWA 1W8BH 1BITA 1TNKA 1UVOA 4ZMAH 1HAHH 1M9UA 2R3YA 3TJUA 2GCHF 3ZZ5A 3SV8A 3UUZA 3QO6A 1A4WH 1MBQA 2V6NA 1J14A 1TGBA 2FS9A 3K9XB 3RMOH 1ARBA 2QXGA 2AYWA 3PM3A 3EA7A 1PPCE 1SGRE 1KXDA 1HAIH 1ETTH 1O5CB 4UFEH 1VZQH 1O2IA 1QA0A 2F9NA 1GMDG 3SI4H 3LH3A 1AKSA 4Y11E 2FPZA 4I86A 2XNIA 1RFNA 2YMSC 1O2JA 2XNDD 3P70B 4JK5A 2BQ7B 2ZFTA 3VB4A 3ZV9A 1VCQA 3RXKA 1YPKH 2OTVA 1DLEA 1V2TT 3F6UH 2JKHA 2WUBA 3UWIA 1GHBF 2ZCKP 3P6ZB 1BBRE 2H5DA 1T4VH 1ZSKA 3EDXB 1HRTH 4FVDA 2XW9A 5ABWA 3SU1A 3BSQA 1YLNA 1DT2A 2DUCA 1B0FA 4AFSA 5HGGA 4UFGH 2F3CE 5FBEA 2A7HA 1O5DH 2R0LA 3TU7H 1AHTH 2ZO3H 1GVLA 2GJGA 3MU5A 4VGCB 1EATA 1KXAA 4X1NU 4K69A 1BHXB 2XRCA 3LPRA 1PFXC 1ZPCA 5TCAA 3RLWH 3E90B 5EQRA 1NRRH 1RTLA 2AFQB 2GKVE 3TK9A 1SOTA 4Y8XA 1AFQB 1OWHA 1P2MA 3PRBA 2CV3A 4NFEA 1GHVH 3PMAB 1NC6A 1SGQE 3A89A 3PYHA 1HAYB 3Q3YA 1UTKA 1WUNH 2WPJS 1GHAF 1LO6A 3LGUA 3SO3A 1TALA 3O8RA 4YT7H 4BAMB 4Z0KA 3FVFB 3T2NA 3BTTE 4XOJA 3DD2H 3EA9A 1AUTC 1B5GH 2YMSD 2VVUA 3O8BA 1QL8A 2VIDA 1OWEA 2FMJA 2H9EH 5A0AE 1W0YH 1SBWA 2ZG0H 1MTNC 1O3AA 2ASUB 5C0TA 3W94A 1E37B 1TWXB 1MQ6A 1QNJA 3M35A 1O38A 2A32A 1NO9H 5KECA 3VB7A 1KYNA 3ZVBA 2P8OB 4WXVA 4DOQA 3PB1E 1GJ7B 2WZQA 4CH2B 1WSSH 1C4U2 3RXTA 2ZGJA 1ZYOA 5J4SA 1AD8H 4NG9H 2FOFA 3SZNA 4D76A 2TGTA 1IAUA 5GDSH 1F5RA 3MH7A 4XFQA 2OLGA 3QZQA 1Y3XA 1MU6B 3BIVH 3MNCA 5LH8A 1AY6H 3PWBA 1TGTA 2XCFA 4BXSA 1NS3A 4INLA 5HKKD 1MCTA 1TX8A 1GBMA 4AB8A 3M5OA 1NY22 2PTNA 1FQ3A 2HPQH 1TABE 2F91A 2C8WB 2KX4A 1C1WH 1AI8H 2A4OA 4CHAC 1AN1E 3GY3A 2BTCE 1LVBA 3RXEA 1WBGB 3GS9A 5EGMA 3TJOA 1L1NA 1NFYA 2ESTE 4B1TA 1O39A 1O3JA 3ZV8A 3V0XA 1V2RT 4U2WA 4A7IB 2GMTB 1CGJE 1SB1H 4TSFD 3Q3KA 1OPHB 4HFPB 1NRNH 3Q77A 4D8NA 2BDIA 3E0NB 4JK6A 4DW2U 1YPHE 1TX7A 1A61H 8ESTE 1SOZA 4K1EA 4OS1A 1IQGA 3I29A 5L2ZH 2OC0A 2G52A 1SGDE 1FPCH 3ZZDA 4ZHAA 1C5MD 3E91A 1JXPA 1D3PB 4UE7H 3SZEA 1AWFH 2D26C 4ACBA 1F2SE 1VITG 1DUEA 2FM2A 4NIYA 5LPFA 1LMWB 1UVSH 4ZXXH 3V7TA 1UMAH 4CRCA 2Z7FE 1YCPM 1EUFA 1K1MA 2WPIS 3OY5U 4GHQA 1TPPA 4INKA 1O5BB 1ELFA 2BYAX 1XUIA 2FI3E 5LPEA 2FYQA 1O2MA 1O3BA 3EYDA 4BAQB 3TNSA 1UK2A 1GI7B 4JYUH 1S6LA 1SGYE 1C2IA 1W0KD 4KTUA 1BMNH 1AZZA 1ANDA 1RTFB 1B7XB 3DUXH 5C17A 1C5LH 1BZXE 1BTYA 3RMMH 4ZROA 1Y59T 2ZKSA 2EI6A 3GDVA 3M7QA 4CRBA 3SYJA 3SV2H 2VJ1A 5FX6A 1FY3A 3VXEH 2Y82A 3MU8A 4AYVB 2A5AA 1BJVA 1ANEA 5SGAE 3RXIA 4AFZA 1GI6A 4AX9H 2XBWA 4SGBE 4CHAB 3ODFA 1GG6C 1KDQA 4NZLA 1V2JT 1UVTH 3K6YA 4ACAA 1UTNA 1A5GH 1XMNB 2WPKS 4KTCA 3F9EA 1MTUA 1ZTKA 2OQUA 1LPZB 3TPIZ 1MZAA 3KQDA 5JB8S 5EPNA 1PPEE 1YF4A 1MTWA 2QE7D 1BRCE 4AGJA 2SGEE 3U9AH 4DG4A 2VGCC 1QBNA 1QB1A 1GJ8B 3A7WA 5ETXA 3DA9B 2J4IA 2O8WA 1OYTH 1O2XA 4I8LA 5EJLA 5CE1A 1GI2A 2FI5E 3SV9A 3E3TA 5GXPA 4OS5A 2G4UA 2J38A 1SGFA 3IWMA 4X2WA 1C1QA 3ZYDA 4IN2A 4ABEA 2AMQA 1S85A 1GBAA 3GCOA 3MOCA 1P05A 1AGJA 1O3EA 2A2QH 1XVOA 2OCVB 3TGJE 3VB3A 1V2VT 2ZEBA 1IHTH 1EJAA 2ZQ1A 3U8OH 1K1LA 1TA6A 3GICB 2BMGB 3TNTA 3I78A 1AQ7A 1EZSC 2STBE 3NZIA 2OD3B 2IPQX 4ABDA 1P04A 3TH2H 1HJ8A 1G2MA 1LHCH 4B73A 1SLWB 2BD7A 2G51A 4JMYA 5HMAA 2ZP0H 3L6PA 1HNEE 3TGIE 1O2LA 1FXYA 5E2OA 5ESTE 3RXCA 1IQFA 2BD3A 2D1JA 1EPTA 1E1QD 1CE5A 1LCYA 1AFQC 4I8JA 4DGJA 3D49H 2Z3DA 3LDXH 4KELA 3FANA 4UD9H 3RXRA 5T6FA 1KLJH 3HK3B 1TQ0B 3H09A 1HCGA 1GDNA 3KYFA 2SGDE 3FP7E 2NWNA 4I8KA 4XRNA 3RXGA 2NU2E 1NBMD 1ZTLA 2C4FH 5CHAB 3TIUA 3RXVA 1J15A 2HOBA 1O2KA 2JETB 4X6MA 2VU8E 1P01A 4E7RG 1AB9B 3OTPA 1UVUH 1CBWC 3A7XA 2PLXA 1QJ1B 2PHBA 4XBDA 1VJAU 1W12U 4YTAA 1INCA 2G4TA 1O2RA 4FOUC 2XWAA 2H2ZA 3ZZ4A 2F9BH 4Z1MD 4ZKNU 1LPKB 2Y7XA 3RXOA 1UCYK 1TFXA 1UTQA 3SI3H 2ZZUH 5C1XA 1P2QA 1ID5H 1ZMNA 4AG1A 3Q76A 4ZKOU 1C2JA 5DO4H 1PQ8A 1HLTH 3HKJB 3U69H 4IN1A 3TITA 3IG6B 2QIQA 1QQ4A 2ZDNA 2QC2A 8GCHG 2KCPA 2EEKA 1ZPBA 1X7AC 1LDTT 1WQVH 1WU1A 1C5ZB 1NESE 1HAXB 5DJ7A 2A1DB 3OE7D 1EZQA 1UJ1A 1IQHA 2QYIA 2TIOA 4Q7ZA 3P92A 3FFGA 1DVAH 2FLBH 4GCHG 4KGAA 2UWOA 1ZZZA 4NCYA 4Y76A 3SOSA 4MPUA 4OM9A 4X6PA 1P2NA 3SW2B 1FLEE 1HJAB 1SVPA 1O2WA 2OQ5A 1AVWA 1W13U 1DANH 1PYTD 3F2GA 5DP4A 4YO9A 3SJKA 1G30B 2ZFPH 1GI3A 3T5FH 1BRAA 1AFEH 5EODA 2BDCA 1VGCC 3VB5A 1P3CA 2QY0B 2QAAA 4DVAU 3NKKA 4ZH8A 1HXFH 2M5TA 1L1JA 1O3PB 3AW0A 5I25A 2Y5GA 3SORA 3URDA 1FN6A 4B2AA 4NSYA 2JH6D 3M3SA 4RT0A 1Z1IA 3BTKE 3GDUA 4K8YA 2VIOA 2CF8H 1SQTA 2GV6A 3HGPA 3K65B 4AN7A 2PKAA 2ZHEH 4NGAH 2WYGA 2J5UA 1Z8IB 2A7CA 2FOHA 1F0RA 2QF0A 1C2HA 1DFPA 1TGNA 2KAIB 3VXFH 3VB6A 3KQCA 1O34A 1E79D 1CBWB 4JZ1A 1V2LT 3RXFA 3NUMA 1GHAG 2M2AA 1TPSA 3HPTB 4FUDA 3T29A 2A5IA 1Z7KA 1YPJH 3N7EA 1P02A 3KHVA 2GGVB 1GBCA 1IQIA 2C93B 2ZI2H 4P00A 1K1OA 4BTTB 1SI5H 2P16A 1GHXH 3VG8A 2BHGA 4MNVA 1GI9B 3UFAA 2W7UA 2A0QB 1ACBE 4MPVA 4FUGA 5DP7A 2VH0A 2IOTA 1FY1A 1CA8B 2R9PA 5A2MH 2ZHWH 4A92A 2G5NA 2O8UA 1FONA 3ZZBA 2SGQE 1BMMH 5B6LA 5FCKA 3P95A 1ZGIA 4BANB 4BOHA 2ZU4A 1YKTA 3SUEA 1A3EH 2P59A 2Y6TA 3T25A 1C5NH 4J1YA 3ELAH 5DP5A 1BDAA 3T62A 1W7GH 4FU9A 2G8TA 1TBQH 1LKAA 2ZU3A 3UOUA 3HKIB 1FI8A 2HNTC 1OX1A 4WY3A 2VIVA 2ZQ2A 2CHAC 3UPEA 3GISB 3ZZ8A 1O32A 1MD8A 1QFKH 4BAKB 2FP7B 2DE9A 5HYOA 3DSOA 1GDUA 5E0GA 3E6PH 1AB9C 3A7ZA 3U98H 5H4IB 1GBHA 2ZNKH 1BBRK 1Z6EA 4NWLA 5FPSA 2OC1A 1P9UA 3NPSA 4FUFA 2D8WA 3ATIA 1HIAB 1SQRA 4ISOA 1PPFE 3MH6A 2C90B 3PV4A 3RC6A 1DPOA 4B2CA 1TPOA 1SPJA 2F9OA 1GJ9B 3F0OA 1IOEA 5K7RA 1DSTA 3FP6E 1O31A 4B6EA 2ZGHA 1Y8TA 4UDWH 3SJIA 3PO1C 4ZKRU 1O2TA 5DG6A 4AOQA 4ISLA 1O2PA 1KIGH 2AHME 2VINA 3KIDU 5JBBS 3ZVGA 3A82A 1KY9A 5DP9A 1C2EA 4Q7YA 3E16B 1NRQH 1DWBH 1H8IH 2SGAA 3SUFA 4DT7B 3UREA 1BT7A 1F92A 1OYQA 2FTMA 1E1RD 4TWYA 4NFFA 1FZZA 2P3UB 2KFWA 2C8YB 3S9BA 3SNCA 1N6YA 1OKXA 4Y8YA 2Y5FA 1W3CA 2PKAB 3E0PB 1O5GH 1V2UT 5KGOA 4DJZB 5HM2A 3ZVDA 3BTME 1T8NA 2J9NA 1DY8A 1NFWA 2O8MA 1SGPE 1YCPH 3GY4A 2UUFB 4AZ2B 3A80A 5T6DA 4RN6A 2B5TB 3RU4E 5PTPA 1KDQB 2VB0A 3M7UA 3R0FA 2CXVA 5AVDA 4YXWD 2VIPA 2EC9H 2B8OH 2W6ID 1JRSA 2RDEA 2ILNA 2YOLA 3E1XB 5LPRA 3BN9A 2D2DA 3KYGA 3UY9A 4ABGA 1V2PT 1L2EA 2BLVA 2W3KA 4R0IA 1GBFA 3BG4B 4IMQA 2J2UA 3OU0A 1NN6A 3SGQE 2BD4A 2A4QA 2BQWB 3DFLA 3QX5H 2W5EA 5L30H 4DT4A 1C4V2 2J98A 1DWEH 2FZZA 1YWUA 2VWMA 4E06H 3KCGH 1EQ9A 4GVUA 2VWOA 3MQKC 2BB4A 2BDHA 4WMEA 1GGDC 5DKMA 5CDFE 2PW8H 1MD7A 1DUAA 5L6NH 3LGYA 2BLQA 4H6TA 1ZHRA 3PMBB 2GT7A 2TGPZ 2RA3A 4ASUD 3MWIU 1C5RA 4FVBA 5DSFA 1Z8JB 2I6QA 3PMJA 4GHTA 5AHGH 3MH5A 1V2MT 4JZDH 3QGNB 1EP5A 3RXDA 1SSXA 2WV4A 4D7FA 1QBOA 8GCHF 1O2YA 3PMHB 5A0CA 1C1MA 4Y7BA 1FY4A 3AASA 1QTFA 4OGXA 1SR5C 2WINI 2UUJB 2GDDA 3TH3H 4BAOB 5IDKA 2ZFQH 1UTLM 5C0UA 2FI4E 3PLKA 4K60A 1V2NT 1GJ6A 1NFXA 1ESAA 3F1SB 1ELGA 1TBZH 1AVXA 1G2LA 1QL7A 4F4OC 2BZ6H 4F49A 2Q1JA 2VBCA 7LPRA 1NRSH 2ZU1A 1GCDA 1LKBA 3M37A 2GDEH 4LK4A 3SQEE 3JZ1B 1YPLH 4I8HA 1TRMA 2QXIA 4CREA 4D7GA 1GJAB 1QB9A 4FUIA 3GDSA 1O30A 1FN8A 3AVZA 4IGDA 2ZECA 1L4ZA 2HNTE 3LKWA 1YYY1 3OAAD 3KQEA 1V2QT 4K3JA 5G4BA 1THPB 5EIYA 1FNIA 2A4RA 3S69A 1BBRH 3KGPA 1OP8A 3U8TH 3LGVA 5GCHF 4FXGH 3RXAA 3SNDA 4YM9A 5FAHA 1MU8B 3RU4D 1EAWA 3RXBA 4UFDH 2IPHA 1FY8E 1AZ8A 1JIRA 3CS0A 1C2LA 2BD2A 3SN8A 1EAIA 1TOCB 2AMPA 3BG8A 3PV5A 4WXIA 3N7DA 2J97A 2ZU2A 3LJJA 1Z1JA 1TLDA 1ZHMA 4YLUA 1WYKA 1TYNA 1LHFH 1F7ZA 3LC5A 1EZXC 3ENSB 1YCPK 1C2KA 4TY7A 3H7OA 2Y81A 4WVPE 2FDAA 3CP7A 2BXUH 1NPMA 4MTBA 4X1QU 3PLPA 4AORA 1BTXA 1O2OA 3AAVA 2AIQA 1PPGE 2PTCE 1QQUA 4THNH 2BXTH 1E0FD 1OWDA 2F83A 1AE5A 1AIXH 2WYJA 3QN7A 2OXSA 1ZLRA 2PUQH 1XUHA 1ABIH 4LXBH 1GBKA 2FXRA 1EKBB 2BDBA 1XXDA 1YLCA 4GLYA 3TJNA 1F5LA 2VIWA 3QTVH 4JYTA 1UTOA 2PR3A 2O8LA 2VWLA 2ZDVH 1F0TA 4ABFA 3UWJH 1C2GA 1GHBG 2LELA 1KTSB 2WV5A 2BY8X 3TK6A 1H9IE 1EZUC 3M5MA 4LZ4B 3U28C 2BM2A 5GPIB 1MAXA 1NU7B 2EQNA 3M5LA 1ETRH 3BTHE 1LVYA 2ZGXH 1QRXA 2BQ6B 3BTDE 3SJ8A 5GNDA 2ZPRA 1JRTA 4ZAEA 4A1XA 2BDYA 2KM0A 2ODPA 5EW1H 3TH4H 1J17T 3DCLA 4GCHF 1VR1H 3AW1A 1NRPH 1DLKB 4I33A 2GZ8A 2FX6A 2HNTF 6CHAB 3A81A 2QGRA 1SHHB 6GCHF 1DY9A 1EAXA 3ZIAD 4U01A 1P2JA 2KCOA 1BTWA 1QBVH 1D3DB 1XXFA 1C5QA 4ABJA 1DWDH 2GZ9A 1CQQA 3UNSA 1LVMA 2QXJA 4JZFH 1K2I1 5GCHG 1JWTA 4GSOA 3AAUA 4NIVA 3VFEA 1TNJA 2A4GA 3BEIB 4B74A 2JIZD 4FUCA 3P17H 2AERH 2ODYB 2PSXA 1VGCB 1OHHD 1Y5UT 3DSGA 1UK3A 1QJ6B 1FJSA 3GCTF 3OEED 3DHKH 1HJ9A 3EE0B 1XKBC 2QXHA 3D23A 4Y7AA 3RP2A 1TMBH 1C9TA 1T8LA 3UB0A 5HIZA 1HAOH 5B6OA 2PGQB 1RIWC 4A1VA 1MKXK 4RT1A 3OFND 1KTTB 2HPPH 1P03A 1N8OB 3ATLA 4O3UA 4X8TH 1ETSH 4DURA 1DOJA 3SGAE 4NA7A 3SU6A 4WF8A 3RC5A 1HB0B 4O9VA 5EQSA 1KXBA 1S82A 2V3HH 5FL7D 4NA9H 2WUCA 3V3MA 4X8VH 1EPTB 1ZR0A 1WTHD 1GJ5H 1GDQA 1OS8A 1KXCA 9LPRA 3SU3A 5A8ZA 5J4QA 3QDZB 1BOQA 2ZDMA 4Y71A 2BD9A 3TK5A 1BHXF 1O3DA 4ZKSU 1SGIB 1ELAA 3SQHE 1UK4A 2GP9B 2XCNA 4X8SH 3ZVFA 4K8BA 1LPGB 1O3HA 4FUBA 1HIAA 3SNAA 1DSUA 1SMFE 1SFIA 1HUTH 1BTPA 5C5NA 3UTUH 1GI1A 1ZHPA 1RRKA 1UW7A 4NZQA 3GY2A 2BX3A 2G00A 3F68H 3M61U 2FS8A 1A46H 1HYLA 1C2DA 1FAXA 1C5UA 1ELEE 4HGCA 4X1PU 2TGAA 1TOMH 1UTPA 2CHAB 4E7NA 5TCCA 1ZSLA 2OK5A 1TB6H 3NCLA 3RXSA 1Y3WA 4CBOA 1ZJDA 2YNAA 2W3IA 1CU1A 3SHCH 4ISIH 1EX3A 4YESB 3UAIC 2W7SA 1BA8B 1O3IA 2Q6FA 1YC0A 3BTFE 2FIRH 1ORFA 2P8OC 1VITH 2FEQH 4FUHA 4WMFA 2K1QA 1BQYA 3RU4T 3H7TA 2SGPE 5AFZH 1G3BA 1OSSA 2GZ7A 2WSSD 3PV2A 2F9UA 1J16A 2WPDD 2AS9A 2XBVA 1ZTJA 2GCTC 2RG3A 3T26A 2FOBA 2TPIZ 1CHOF 5EXMA 1C5SA 1AO5A 1TA2A 1VJ9U 2BLOA 1JBUH 1UHBA 3RLYH 1V2ST 3DSPA 5DP6A 2H1UA 3M3TA 9ESTA 3T27A 1ZRKA 2SNVA 1O3FA 1YLDA 4OS7A 3TVJB 2VVCA 3KEEA 3DT0H 4JYVH 4ABAA 3OX7U 1L1GA 2NU1E 4CH8B 1P8VC 1CT0E 1GCTC 3FO8D 3FKSD 1KLIH 4U30A 2ALPA 1P0SH 2HLCA 3FAOA 1GCTB 5HIYA 1P57B 1GPZA 1MUEB 3GCHC 3HK6B 2OC8A 3RDZA 1FV9A 5CHBA 1VITF 2BX4A 1W0JD 3P8NA 1AE8H 3ATWA 1SGFG 3SNEA 4UONA 2NU0E 1T31A 3EE7A 2C3SA 3MNSA 1A1RA 3UNRA 1EJMA 1HAGE 1DXWA 3M3VA 1G3CA 2F9PA 1NU9A 1CGHA 3GYMA 1HBTH 1AVGH 2BOKA 4X0WU 4ESTE 1SKYE 2OUAA 2Z94A 4TY6A 1GI0A 1IQLA 3MO6A 3LT3A 4GUXA 5FPYA 1QURH 2YMSB 3MI4A 1GBIA 1FAKH 3VGCC 3GOVB 4Q4LA 5EXNA 2OC7A 1SLVB 3EQ0H 3ZZ3A 3M5NA 3MHWU 2GCHG 2TGDA 1GBDA 3ZZCA 4YLQH 1S6FA 3GCNA 3B8JA 3P8FA 2R3UA 3R3GB 5T3HA 3PROA 5C67A 1S0RA 4OS4A 4SGAE 2WV9A 3AK5A 2FOEA 5E0JA 1YM0A 1P11E 2LP6A 3M7TA 1SFQB 6LPRA 2TRMA 1HPGA 1XUFA 2PWXA 3GY7A 2ZFSA 1C1SA 1ZSJA 3F9HA 1Y5BT 2ZFFH 1LHDH 2SFAA 1GWAA 2A2XH 1NROH 1UTMA 4AC9A 1K28D 1HAVB 3ITIA 4TT3D 4XE4A 1IQEA 1ZJKA 1Y3VA 3EAJA 4K5ZA 1MTSA 4HTCH 2TBSA 1D6WA 3GY6A 4X1SU 2Y5HA 5GWZA 3MNXA 4FETA 1L4DA 4MG3A 4MLFB 1YPHC 2PKSC 1P2IA 1EOLA 2H6MA 1PQAA 1QY6A 2GD4B 1TNHA 4NWKA 1T8MA 1LTOA 1O3GA 2FLRH 5CMXH 4D9RA 1HAPH 4MNYA 1H8DH 1O3CA 1V2KT 3K6ZA 2BDGA 4ABBA 1P12E 1GHWH 1C5WB 4MVNA 2GMTC 1W2KH 3K2UA 2QF5A 3M36A 4DCDA 2Z9IA 4DY7B 4ABIA 1AKSB 3P8GA 1D4PB 3E8LA 1O0DH 1H9LB 2KZ4A 5FX5A 4WH6A 1C5VA 1G9IE 3H5CB 5LGOA 1G3DA 4A6LA 4I32A 1C2FA 2F43B 2STAE 4WWYA 5T6GA 2ZU5A 4TYDA 3VGCB 3PRDA 1MKXH 1Q2WA 1E34B 1CA0C 1E35B 2ZCLP 1MAYA 4PROA 3PTBA 1T7CA 2PV9B 1OP0A 1VKYA 1O2UA 3BF6H 1GMDF 1C5YB 2K8IA 5EU8A 1NZQH 1H8HD 2PUXB 4H6SB 3KL6A 1G36A 1E38B 2CF9H 4Q7XA 2V0BA 2FOAA 1P09A 4Y6DA 2ZHFH 1RGQA 5C1YA 1XUGA 3SHAH 3LOXA 4YOJA 3B23B 1C5PA 4ISNA 3RXQA 1D3QB 2K0QA 3STJA 2BVRH 1THSH 3F9GA 2NU3E 1XX9A 2B9LA 1TMUH 2GT8A 1EASA 2FOCA 1UO6A 1CA0B 1GGDB 2UUKB 1VCPA 4X6OA 1ABJH 1AU8A 4VGCC 1KXEA 3NRLA 5EJ1A 4I7YH 1RXPA 3MMGA 2VH6A 3MTYA 2J92A 3O8CA 1GBJA 5C94A 2SGFE 1BB0B 3SU0A 4MNWA 2Z3EA 2XC5A 3BG4C 2GV7A 1DX5M 3U1JB 1TBRH 3A86A 4B2BA 1EJNA 1TNLA 1UHBB 4B75A 5GJ4B 1H9HE 1O3KA 2LPRA 2P93A 5K0HA 1LHGH 4FUEA 3SBKA 1P10A 2GX4A 2HRVA 1QL9A 1TONA 4FU8A 1AWHB 3ZZ9A 1A0HB 3F9FA 1XUJA 4DIHH 3UNQA 1DXPA 1MZDA 3UQVA 1TNGA 1O2HA 3OY6U 3T28A 1YY3A 4MQAA 4BAHB 3GCTG 3SV6A 3MU4A 2PFEA 4LZ1H 2XXLA 2LNCA 5C1UA 2RA0A 4KKDA 4ZUHA 2FESH 1LQDB 3LGTA 1V2OT 2C8ZB 5JPMH 1WCZA 5JBTA 1BUIA 4OS2A 4P02A 5E0HA 1O35A 1AMHA 4IS5A 3RC4A 1FDPA 1QJ7B 2V7QD 1CGIE 3UOPA 1XVMA 1COWD 1FY5A 2ALVA 2C8XB 2UWPA 4O3TA 1O2GH 1W10U 2JJ2D 4IC6A 1ZOMA 3RXJA 3A85A 5BPEA 1DICA 1BRBE 1SLUB 1PYTC 3RXHA 1OXGA 1RJXB 1CHGA 1QHRB 4RSPA 2XBYA 1N1LA 4CRFA 3MO9A 1S6HA 2Z3CA 1F5KU 1RD3B 1BMLA 4IMZA 3GY8A 4HZHA 7ESTE 1H8ED 2KAIA 2ANMH 4Q80A 4CRGA 1TX6A 1QB6A 2CMYA 2Y7ZA 2BDAA 1PPBH 4M9FA 3VEQB 2VWNA 1XM1A 1S0QA 1ELBA 4O03A 2VNTA 1LQEA 4NA8A 1ARCA 1PQ5A 4Y0YE 4Z6AH 3EGKH 1Z6JH 2R2WU 3PTNA 1F0SA 1C1VH 3A8BA 2ZTZA 1F0UA 2J94A 1OP2A 1WQSA 5EOKA 4GAWA 1LVOA 1RS0A 1S83A 2F9VA 3SV7A 1O3MA 5HXFA 3D65E 1SQOA 1J8AA 1SGCA 1GMCG 4Y0ZE 3NWUA 1ESBA 1SHYA 1YPGH 2BLWA 3A87A 4M7GA 4UEHH 1WTGH 1P06A 1B0EA 1EB1H 1YBWA 3BEFB 4HI3A 5A0BA 5FBIA 2BOHB 3A88A 6ESTA 3SU4A 2RCEA 3L3TA 4MDSA 3OSYA 1TNIA 1BCUH 1NT1A 2KCYA 1IQKA 5EPYA 4IC5A 2G55A 2ZCHP 1E36B 2AGGX 2O8TA 3FP8E 1O2QA 3IITA 4K1SA 5GIBA 2AEIH 1V3XA 4R8TB 3CENA 4X2XA
chains in the Genus database with same CATH topology
2P95A 2RDLA 4TPIZ 4DIIH 3UQOA 5FXLA 4E05H 3A7YA 3ATMA 1C1UH 4CRAA 3PLBA 1A2CH 3QK1A 1DE7H 2ANWA 1FUJA 2ZHQH 4K1TA 2AMDA 5DGJA 2ZDAH 1TRYA 1HV7A 2EI8A 3BTQE 2HWLB 4AFQA 1NFUA 2Z9JA 5ESBA 2ULLA 1HFDA 2ZPQA 1O3NA 1CHOG 1O3LA 2Z6BD 3BTWE 2A5KA 4CR5A 2I6SA 2ZGCA 4OS6A 1Y3UA 3A84A 1DWCH 3G01A 3D62A 3WY8A 1QA7A 1V2WT 1EAUA 1GBLA 2GCTB 2ANKH 2A45B 1GI4A 4ZHMU 1GL1A 3MO3A 3NXPA 3RXUA 4AFUA 1S84A 2QN5T 1C1RA 1GI5A 2ZWLH 1ZGVA 3LGIA 3Q3XA 4WMDA 2W26A 1O2ZA 1MBMA 3Q00A 2B7DH 5C3NA 1BTHH 2ANYA 1GBTA 4BXWA 3RM0H 2IN2A 5L2YH 3OYPA 3S0NA 3EA8A 1Y5AT 1K9OE 1A7SA 2XC4A 2ZHDA 3C1KA 4K2YA 1PQ7A 2O9QA 1AUJA 1QIXB 1H1BA 1UCYH 1W0ZU 2Q6GA 1IHSH 2G5VA 2Z9LA 4BNRA 3BEUA 3QUMP 4KP0A 1CT2E 2ZIQH 1FIWA 1HJAC 3LIWA 3PO1B 3QLPH 5IYTA 3A8CA 3BIUH 1CO7E 1O2VA 8KME2 1XUKA 1UCYE 1DS2E 4Y10E 3W95A 1W7XH 4Y79A 4ISHH 1ZMLA 7KMEH 2ZDKA 2FO9A 4AYYB 1OOKB 1O33A 4MPWA 1W14U 1ESTA 3UR6A 2BZAA 1SC8U 2ZTYA 1S81A 3LC3A 5E8EH 5I46H 4INHA 2ODQA 3UR9A 3ZYEA 1C2MA 2P94A 2WPLS 2A31A 4WJG2 1Z8RA 1CSOE 1ELDE 3QWCH 2ZPSA 4JCNA 4ABHA 1KXFA 1IQJA 1FIZA 2HGTH 2HVXA 3L33A 4X2YA 5F8XA 3MFJA 1O3OA 1WOFA 2XBXA 1G37A 5TJXA 7GCHF 1PPZA 5DK1A 1QRZA 1PJPA 3KQBA 3V13A 4IW4E 3LGWA 3SGBE 3ESTA 1C9PA 1P2KA 3O8DA 3S9AA 1MTVA 2Q6DA 2XWBI 1NTPA 1QRWA 1RTKA 1GJCB 2BD8A 5CHAC 3ZZ6A 1GHZA 1BRUP 2EA3A 4ASHA 4XBBA 1K1JA 3BTGE 1O5AB 2ZFRH 1JOUB 2QA9E 4KTSA 1PPHE 1OWJA 2EI7A 3TJVA 4B76A 1GJ4H 2FOGA 3A7TA 3ZVAA 4CRDA 4LOYH 5DPAA 1GI8B 1TE0A 2GVFA 4XDEA 2JH0D 3SUGA 5BRRE 1ANBA 1C5OH 2BVXH 4YT6H 5FPTA 1C5XB 5AF9H 1P3EA 1V6DA 1C1PA 1FPHH 4FUJA 1NM6A 2XTTB 2YNBA 3RM2H 3V12A 3TLOA 2ZC9H 3LH1A 1D6RA 3FZZA 3BV9B 2VGCB 1BTUA 3I77A 1SGNE 4MPXA 4WH8A 4CBNA 1VCWA 1GMHG 6CHAC 1TRNA 1O5FH 1Z71A 2OINA 4YOGA 3A7VA 1D3TB 4GPGA 3UIRA 3KN2A 2BD5A 1C1NA 1GMCF 3C27B 2UWLA 1N6XA 3GY5A 3SNBA 4XSKU 1L0ZA 2ZTXA 1O2SA 1SGEE 1Z8GA 1MMJN 3GCHB 5EXLA 2AGIX 2V35A 4QT8C 2QCYA 5EG4A 4NIXA 1GL0E 2OBQA 3RXPA 2H9TH 3DFJA 3A83A 1K1PA 1DITH 2CN0H 4NIWA 2G81E 2FYRA 7GCHG 3ODDA 1A0LA 1T8OA 1D9IA 4X2VA 3A8DA 2BY5X 1GMHF 1WV7H 2QF3A 2H5CA 1GHYH 1K1NA 3BTEE 4AGKA 4J2YB 5E2PA 1ELTA 1QR3E 1MCVA 3JZ2B 1EOJA 1QGFA 1THRH 1GJBB 1U6QA 3TGKE 3S9CA 3RXLA 2FX4A 1C4Y2 4MNXA 4TPYA 3QTOH 1HAZB 1SGTA 1WAYB 1YP9A 1DM4B 1HXEH 4H42U 2H9HA 4O97A 4Q2KA 4X6NA 3KF2A 2P3FH 2UUYA 2JETC 1IQMA 1O37A 1T4UH 2PSYA 3N7OA 3SJOA 5F8TA 1GBBA 2AH4X 8LPRA 1C1OA 3QGJA 1H4WA 3U1IB 5JBCS 1C5TA 4NSVA 1HDTH 4TWWA 3SU2A 5HM9A 1K22H 3S7KB 2THFB 4BTIB 4ZXYH 1BIOA 1O2NA 5F8ZA 1UTJA 1JMOH 4I8GA 1HAVA 1TIOA 4U32A 3URCA 1P2OA 2FTLE 2ZA5A 1SL3A 2J34A 2IJOB 4I31A 5AFYH 1TPAE 6GCHG 1A3BH 1CT4E 5DP8A 1ZMJA 1SLXB 2VIQA 2GTBA 1TGSZ 1MH0A 4D9QA 1GVZA 2V3OH 2AGEX 1TQ7B 4X8UH 1C1TA 2HALA 3MU0A 2BY6X 1MKWH 1W11U 2WPMS 1RIWB 2AIPA 3LONA 5C2ZA 4FU7A 5C5OA 5A8YA 3U8RH 1G3EA 3NK8A 1T32A 3CS7A 4CR9A 3SUDA 1GBEA 5FHTA 2OBOA 1OWIA 2PGBB 2BY9X 1EPTC 2R0KA 1GVKB 3OTJE 5F03A 1YPMH 3MU1A 1QCPA 5JBAS 2JH5D 5A09A 2A7JA 1TMTH 1KSNA 4IBLH 4B71A 3ZZ7A 3GYLB 3RMNH 1O36A 3PWCA 4BTUB 1FMGA 2OP9A 1XKAC 1G32B 1A5HA 1N8OC 1ELCA 3LU9B 1JIMA 1SQAA 3KNXA 1BTZA 4A1TA 1KLTA 5JYIA 1K1IA 4OGYA 5FCRA 1TAWA 4X1RU 1MQ5A 3HATH 3LJOA 4ZHLU 1IQNA 1K21H 5F6MA 4AG2A 3ATKA 3VPKA 1O5EH 1J9CH 1LHEH 5JB9S 1EB2A 1BJUA 3MH4A 3SJ9A 1OWKA 1YGCH 1TGCA 3ZZAA 4UFFH 1S5SA 5EQQA 2J95A 3MNBA 5EW2H 1SG8B 2DE8A 4XBCA 2B0FA 1ANCA 1GJDB 2FOMB 2ZF0H 4JZIA 1Q31A 1BMAA 3RXMA 4YOIA 4H4FA 4RKJB 3B9FH 3ZVCA 2ZDLA 4AB9A 1ELVA 3ZVEA 3STIA 2BVSH 4YZUA 4RKOB 1EP6A 3MYWA 4Y8ZA 1GG6B 1UVPA 2NU4E 5C20A 2P3TB 2WPHS 3P8OA 2XYAA 1P9SA 2QV1A 2Y80A 1ZRBA 3RUOA 2CJIA 1YPEH 2R2MB 2VVVA 1DDJA 1MTNB 2ZGBH 5JDUB 1EXFA 1ZPZA 3FZDA 1Y3YA 1Q3XA 4JZEH 3RMLH 2PKSB 3SU5A 5A8XA 2Z9GA 2FODA 2BY7X 2FWWA 2XC0A 3HGNA 5DP3A 3S7HB 1A0JA 2CGAA 1A5IA 3QZRA 3A8AA 1CVWH 1MKWK 2Z9KA 4A5TS 1HGTH 2SNWA 1W8BH 1BITA 1TNKA 1UVOA 4ZMAH 1HAHH 1M9UA 2R3YA 3TJUA 2GCHF 3ZZ5A 3SV8A 3UUZA 3QO6A 1A4WH 1MBQA 2V6NA 1J14A 1TGBA 2FS9A 3K9XB 3RMOH 1ARBA 2QXGA 2AYWA 3PM3A 3EA7A 1PPCE 1SGRE 1KXDA 1HAIH 1ETTH 1O5CB 4UFEH 1VZQH 1O2IA 1QA0A 2F9NA 1GMDG 3SI4H 3LH3A 1AKSA 4Y11E 2FPZA 2XNIA 1RFNA 1O2JA 3P70B 4JK5A 2BQ7B 2ZFTA 3VB4A 3ZV9A 1VCQA 3RXKA 1YPKH 2OTVA 1DLEA 1V2TT 3F6UH 2JKHA 2WUBA 3UWIA 1GHBF 2ZCKP 3P6ZB 1BBRE 2H5DA 1T4VH 1ZSKA 3EDXB 1HRTH 4FVDA 2XW9A 5ABWA 3SU1A 3BSQA 2DUCA 1DT2A 1B0FA 4AFSA 5HGGA 4UFGH 2F3CE 5FBEA 2A7HA 1O5DH 2R0LA 3TU7H 1AHTH 2ZO3H 1GVLA 3MU5A 4VGCB 4X1NU 1EATA 1KXAA 4K69A 1BHXB 2XRCA 3LPRA 1PFXC 1ZPCA 5TCAA 3RLWH 3E90B 5EQRA 1NRRH 1RTLA 2AFQB 2GKVE 3TK9A 1SOTA 4Y8XA 1AFQB 1OWHA 1P2MA 2CV3A 4NFEA 1GHVH 3PMAB 1NC6A 1SGQE 3A89A 3PYHA 1HAYB 3Q3YA 1UTKA 1WUNH 2WPJS 1GHAF 1LO6A 3LGUA 3SO3A 1TALA 3O8RA 4YT7H 4BAMB 4Z0KA 3FVFB 3T2NA 3BTTE 4XOJA 3DD2H 3EA9A 1AUTC 1B5GH 2VVUA 3O8BA 1QL8A 2VIDA 1OWEA 2FMJA 2H9EH 5A0AE 1W0YH 1SBWA 2ZG0H 1MTNC 1O3AA 2ASUB 3W94A 1E37B 1TWXB 1MQ6A 1QNJA 3M35A 1O38A 2A32A 1NO9H 3VB7A 1KYNA 3ZVBA 2P8OB 4WXVA 4DOQA 3PB1E 1GJ7B 4CH2B 1WSSH 1C4U2 3RXTA 2ZGJA 1ZYOA 5J4SA 1AD8H 4NG9H 2FOFA 3SZNA 4D76A 2TGTA 1IAUA 5GDSH 1F5RA 3MH7A 4XFQA 2OLGA 3QZQA 1Y3XA 1MU6B 3BIVH 3MNCA 5LH8A 1AY6H 3PWBA 1TGTA 2XCFA 4BXSA 1NS3A 4INLA 1MCTA 1TX8A 1GBMA 4AB8A 3M5OA 1NY22 2PTNA 1FQ3A 2HPQH 1TABE 2F91A 2C8WB 1C1WH 1AI8H 2A4OA 4CHAC 1AN1E 3GY3A 2BTCE 1LVBA 3RXEA 1WBGB 5EGMA 3TJOA 1L1NA 1NFYA 2ESTE 4B1TA 1O39A 1O3JA 3ZV8A 3V0XA 1V2RT 4U2WA 4A7IB 2GMTB 1CGJE 1SB1H 3Q3KA 1OPHB 4HFPB 1NRNH 3Q77A 4D8NA 2BDIA 3E0NB 4JK6A 4DW2U 1YPHE 1TX7A 1A61H 8ESTE 1SOZA 4K1EA 4OS1A 1IQGA 3I29A 5L2ZH 2OC0A 2G52A 1SGDE 1FPCH 3ZZDA 4ZHAA 1C5MD 3E91A 1JXPA 1D3PB 4UE7H 1AWFH 2D26C 1F2SE 1VITG 1DUEA 2FM2A 4NIYA 5LPFA 1LMWB 1UVSH 4ZXXH 3V7TA 1UMAH 4CRCA 2Z7FE 1YCPM 1EUFA 1K1MA 2WPIS 3OY5U 4GHQA 1TPPA 4INKA 1O5BB 1ELFA 2BYAX 1XUIA 2FI3E 5LPEA 2FYQA 1O2MA 1O3BA 3EYDA 4BAQB 3TNSA 1UK2A 1GI7B 4JYUH 1SGYE 1C2IA 4KTUA 1BMNH 1AZZA 1ANDA 1RTFB 1B7XB 3DUXH 1C5LH 1BZXE 1BTYA 3RMMH 4ZROA 1Y59T 2ZKSA 2EI6A 3GDVA 3M7QA 4CRBA 3SV2H 2VJ1A 5FX6A 1FY3A 3VXEH 2Y82A 3MU8A 4AYVB 2A5AA 1BJVA 1ANEA 5SGAE 3RXIA 4AFZA 1GI6A 4AX9H 2XBWA 4SGBE 4CHAB 3ODFA 1GG6C 1KDQA 4NZLA 1V2JT 1UVTH 3K6YA 1UTNA 1A5GH 1XMNB 2WPKS 4KTCA 3F9EA 1MTUA 1ZTKA 2OQUA 1LPZB 3TPIZ 1MZAA 3KQDA 5JB8S 5EPNA 1PPEE 1YF4A 1MTWA 1BRCE 4AGJA 2SGEE 3U9AH 4DG4A 2VGCC 1QBNA 1QB1A 1GJ8B 3A7WA 5ETXA 3DA9B 2J4IA 2O8WA 1OYTH 1O2XA 4I8LA 5CE1A 1GI2A 2FI5E 3SV9A 3E3TA 5GXPA 4OS5A 2G4UA 2J38A 1SGFA 3IWMA 4X2WA 1C1QA 3ZYDA 4IN2A 4ABEA 2AMQA 1S85A 1GBAA 3GCOA 3MOCA 1P05A 1AGJA 1O3EA 2A2QH 1XVOA 2OCVB 3TGJE 3VB3A 1V2VT 2ZEBA 1IHTH 1EJAA 2ZQ1A 3U8OH 1K1LA 1TA6A 3GICB 2BMGB 3TNTA 3I78A 1AQ7A 1EZSC 2STBE 3NZIA 2OD3B 4ABDA 1P04A 3TH2H 1HJ8A 1G2MA 1LHCH 4B73A 1SLWB 2BD7A 2G51A 4JMYA 5HMAA 2ZP0H 3L6PA 1HNEE 3TGIE 1O2LA 1FXYA 5E2OA 5ESTE 3RXCA 1IQFA 2BD3A 2D1JA 1EPTA 1LCYA 1CE5A 1AFQC 4I8JA 4DGJA 3D49H 2Z3DA 3LDXH 4KELA 3FANA 4UD9H 3RXRA 5T6FA 1KLJH 3HK3B 1TQ0B 1HCGA 1GDNA 2SGDE 3FP7E 2NWNA 4I8KA 3RXGA 2NU2E 1ZTLA 2C4FH 5CHAB 3TIUA 3RXVA 1J15A 2HOBA 1O2KA 2JETB 4X6MA 2VU8E 1P01A 4E7RG 1AB9B 1UVUH 1CBWC 3A7XA 2PLXA 1QJ1B 2PHBA 4XBDA 1VJAU 1W12U 4YTAA 1INCA 2G4TA 1O2RA 2XWAA 2H2ZA 3ZZ4A 2F9BH 4ZKNU 1LPKB 2Y7XA 3RXOA 1UCYK 1TFXA 1UTQA 3SI3H 2ZZUH 5C1XA 1P2QA 1ID5H 1ZMNA 4AG1A 3Q76A 4ZKOU 1C2JA 5DO4H 1PQ8A 1HLTH 3HKJB 3U69H 4IN1A 3TITA 3IG6B 2QIQA 1QQ4A 2ZDNA 2QC2A 8GCHG 2EEKA 1ZPBA 1X7AC 1LDTT 1WQVH 1WU1A 1C5ZB 1NESE 1HAXB 5DJ7A 2A1DB 1EZQA 1UJ1A 1IQHA 2QYIA 2TIOA 4Q7ZA 3P92A 3FFGA 1DVAH 2FLBH 4GCHG 4KGAA 2UWOA 1ZZZA 4NCYA 4Y76A 3SOSA 4MPUA 4X6PA 1P2NA 3SW2B 1FLEE 1HJAB 1SVPA 1O2WA 2OQ5A 1AVWA 1W13U 1DANH 1PYTD 5DP4A 4YO9A 3SJKA 1G30B 2ZFPH 1GI3A 3T5FH 1BRAA 1AFEH 5EODA 2BDCA 1VGCC 3VB5A 1P3CA 2QY0B 2QAAA 4DVAU 3NKKA 4ZH8A 1HXFH 2M5TA 1L1JA 1O3PB 3AW0A 5I25A 2Y5GA 3SORA 3URDA 1FN6A 4B2AA 4NSYA 2JH6D 3M3SA 1Z1IA 3BTKE 3GDUA 4K8YA 2VIOA 2CF8H 1SQTA 2GV6A 3HGPA 3K65B 4AN7A 2PKAA 2ZHEH 4NGAH 2WYGA 1Z8IB 2A7CA 2FOHA 1F0RA 2QF0A 1C2HA 1DFPA 1TGNA 2KAIB 3VXFH 3VB6A