1KXEA

Sindbis virus capsid (y180s, e183g double mutant), tetragonal crystal form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
157
structure length
157
Chain Sequence
LKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTSTSGHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
total genus 30
structure length 157
sequence length 157
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxeA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxeA01
1S83A 2OXSA 1E38B 3QN7A 3SV7A 1O3DA 1GJ5H 2BOHB 1FY1A 5DP8A 5T6GA 1LHEH 2ZNKH 1FONA 1UMAH 1K1IA 1FIZA 1GGDB 1YPKH 1L1GA 1AWHB 4FUEA 1SLWB 5CHAB 1C2JA 3SNEA 2PUXB 1AKSB 3RXSA 3R3GB 2HALA 3IWMA 1T4VH 1QL9A 1C5YB 3M5NA 2EI8A 3A87A 1NN6A 2XC4A 1YCPM 2OBQA 1TNKA 3UPEA 2Z9IA 1LKAA 4Y71A 4K8BA 1THPB 1PPGE 1BJVA 1O38A 4ZROA 2BD3A 1O3LA 1GCTB 2W7UA 2H9HA 1TGCA 1YPGH 4NA7A 1VJAU 1PPBH 1NM6A 3NKKA 5K0HA 4MNXA 1Z1JA 1GI3A 3HK3B 3MFJA 1TX7A 1O5GH 1K22H 1TYNA 3D23A 4K1EA 2ODQA 2THFB 4IN2A 3SORA 1HFDA 2ZTXA 1AD8H 4PROA 1ELFA 2Y80A 4Y79A 4TY7A 3GY8A 1MTWA 3SJ9A 1MTNC 1GBMA 3GICB 3V13A 5DK1A 1DLEA 1VR1H 3GCOA 3UREA 5EW2H 1AI8H 4JZEH 1O0DH 2WPIS 2VVVA 2VINA 2ZI2H 1D9IA 2Z3CA 2H6MA 1ANBA 2GKVE 5FX5A 1C5TA 4H4FA 5CE1A 1MBQA 1BOQA 4I8GA 6GCHG 2WUCA 1IQJA 1QURH 1GVLA 4DG4A 1TBRH 1CGIE 4MPWA 2Y81A 2C8YB 1UVSH 1SR5C 1Z1IA 4LZ1H 4K3JA 4Q7XA 1HAXB 5C20A 1FI8A 4I31A 5HXFA 3K6YA 4MVNA 4NSVA 4XOJA 1C5VA 1G3BA 1GHBF 1MTUA 2FESH 1UVTH 3VGCB 2NWNA 2BMGB 3MNSA 1GI9B 1C1TA 3DD2H 4B71A 1XX9A 1P57B 4ISIH 4ZKRU 4ASHA 2VNTA 1IQNA 1A61H 2TIOA 2YNAA 1UVUH 5FPSA 1Q2WA 5EQRA 1TMUH 1Y59T 2I6SA 1RD3B 4UDWH 2ZQ1A 1KXFA 1OWJA 4X1SU 3RMOH 4Y7BA 1ANEA 1VITF 1AVGH 2C4FH 2GDEH 3UR9A 2ODYB 2QN5T 3SV2H 1HIAB 1AQ7A 3ZZ3A 1NPMA 2ZTYA 4X0WU 1BTUA 2BLWA 1OWEA 3RXUA 1KXAA 4Y10E 2ZGHA 4X6NA 1C2FA 1O2YA 3JZ1B 1EZSC 1V2TT 3QGJA 3U9AH 4ISNA 2WPHS 1C1UH 4R8TB 4Y0ZE 1DANH 1P2KA 3PLBA 2WYGA 5C5OA 2FDAA 4J2YB 4XBCA 1SGFG 3UWJH 1V2JT 4RKJB 1ZMJA 4K2YA 3TJVA 3AW1A 1O5BB 2V0BA 1DXPA 3SU2A 3S9AA 1EPTA 3BIUH 1BBRE 2H2ZA 1CHOF 2SGEE 3PLPA 4D7GA 3UOPA 5FHTA 4UONA 1P2QA 1MQ5A 5LPFA 4BAHB 1Z71A 4WJG2 4NZQA 1O3MA 1T31A 4CBNA 1O2UA 4BAKB 1O3BA 3ZVCA 1EUFA 2BDCA 2FS8A 3EYDA 1TQ7B 1PQ5A 1V2PT 2W3KA 1KXEA 4X8SH 1Q3XA 3H7TA 1YCPK 3ZZ9A 1NROH 4HI3A 4KGAA 1SQAA 3PTNA 1QQUA 2WV4A 2PWXA 1C5QA 2ZDVH 4ZHLU 1XUFA 2GP9B 1LVBA 1ZHRA 2Q6FA 2A4OA 2R2MB 2FEQH 2C8WB 2C93B 2TRMA 4WWYA 1MKXH 2BVRH 1HCGA 1TA6A 1TNGA 2J38A 2OC8A 2A4QA 2A45B 3T26A 5G4BA 2CF8H 1UTNA 4DVAU 1IHTH 3SU6A 4B75A 1HPGA 4TPIZ 1ZR0A 1C5ZB 1TOCB 2NU0E 3BG8A 1AFQC 1O3PB 5DGJA 3ATMA 1CA8B 1SGEE 4BTUB 3RXVA 1PJPA 4I8KA 4X8TH 1XUJA 2BD8A 1Y3WA 4WF8A 3GY6A 2FYRA 1C1MA 4MNVA 1AFEH 2ZGBH 2ZCLP 3ENSB 1QB6A 3QO6A 1DPOA 4X2XA 1UVOA 1DS2E 2C8XB 3MI4A 2PSYA 5BRRE 1DLKB 4THNH 2VIPA 6CHAB 1Z8JB 3EA8A 4ZAEA 2FM2A 4B74A 3PTBA 1HV7A 1EB1H 1UHBA 1OYTH 2BXTH 3WY8A 1VGCC 3GDSA 4MNYA 1AZ8A 4DIIH 1ANCA 1Y3VA 1CA0C 1HJAC 1BRBE 2HVXA 4MQAA 3KNXA 3LGIA 1EAIA 1Y5UT 2BY9X 1QGFA 5EU8A 3BTDE 1A3EH 5DP6A 1BMNH 5F8ZA 3MO3A 4NIYA 3UWIA 1NRRH 2ZU1A 3NCLA 4OS7A 2P16A 3S9BA 3GCHB 1J14A 1AWFH 2SNWA 3MNBA 1ZGIA 1C4Y2 2PHBA 1TPSA 2F9PA 2BLOA 4ZHMU 3EDXB 1LQDB 3BSQA 5ETXA 2PTCE 2PGBB 2G4UA 4CRFA 1MCVA 2AIQA 2Y6TA 5F8TA 2BDBA 1DWEH 4Y7AA 2VGCC 1PPEE 3LU9B 4NIVA 4MDSA 1DWBH 1ZLRA 1NO9H 1SI5H 2BDIA 2ZZUH 2XRCA 3VXFH 4DURA 4ZKNU 1GI7B 1V3XA 1GBAA 2FXRA 4FUCA 2TGTA 1C2LA 3ZZ4A 1KDQB 1XVMA 2UUJB 3STIA 1BRAA 3U98H 3BTHE 1HYLA 4F4OC 1C2GA 3RMMH 2HPQH 1TBZH 1NRQH 3M5LA 1AZZA 2TGDA 3EGKH 1YPMH 1V2KT 3RDZA 2ALPA 2TBSA 1NFXA 1O2MA 3SUDA 3GCNA 1KY9A 3GDVA 2XTTB 3A7WA 4KTUA 2BD9A 2ZU5A 3S9CA 3BV9B 4YOGA 2J95A 2D2DA 5TJXA 4AB9A 5A8XA 2B9LA 1F0UA 4FUBA 5HGGA 3GCTF 3F9HA 3SO3A 1C5RA 1BCUH 2FPZA 3IITA 4Q7ZA 1WYKA 3A80A 1O3AA 1IQKA 1GJBB 1GMDG 4ZXYH 4SGAE 3BN9A 2B5TB 3SV8A 2DE8A 1ZPZA 1HAVB 2BLVA 1H4WA 3MH5A 1UK4A 1G36A 2AGIX 2ZHDA 2F91A 1QBOA 4D9RA 4UFEH 4YOIA 1O3HA 1MTNB 2FZZA 1ZMNA 2SGQE 2PFEA 2SGAA 2VB0A 5B6OA 1BHXF 1O30A 1FY8E 2GT7A 4YOJA 5EXNA 1EATA 1EZXC 3MWIU 4YT6H 1EB2A 1YPLH 2BX4A 1Q31A 4MNWA 3URCA 2TGPZ 2C3SA 1C1NA 1O35A 2FOAA 2F3CE 1PYTD 1TGSZ 3F9GA 4I32A 2YNBA 2Z6BD 4JYTA 3LGUA 1XXDA 1GBKA 2KAIB 2C8ZB 2ZU3A 3Q3YA 3UOUA 3F68H 1LO6A 1IQEA 2WINI 4FUFA 3SOSA 1G3EA 1QTFA 1HJ8A 4YESB 4WMEA 1UCYK 4GSOA 1GHAF 1QRXA 1TPOA 2O8WA 2A32A 1UTPA 3MH7A 3ATWA 4Y76A 2FTMA 3P8FA 4NIWA 5A0CA 2FI5E 2QXJA 1IQFA 1IQIA 4U30A 4Y8XA 3E91A 4U32A 4JK6A 4XFQA 2R2WU 1QQ4A 2FI4E 2VH0A 1D3DB 2B7DH 3A88A 3BTQE 3ZZCA 1ZJKA 3GY4A 3QZQA 1CBWC 2PTNA 1BDAA 1JRSA 4UFDH 1BTPA 2XYAA 2OC0A 1IHSH 1K1LA 1Y5BT 2NU3E 3MU1A 2Z9LA 4D7FA 1VITH 3UNSA 3T62A 1AN1E 3U1IB 2GX4A 1TAWA 1H8DH 2OQ5A 2ZFSA 5CMXH 1CU1A 3A89A 3EAJA 3M3TA 1HUTH 3I78A 5EXMA 4O9VA 3TH2H 1CT0E 4DGJA 1O36A 2V6NA 2P3FH 5GWZA 1GMHG 4UE7H 2GCHF 2PV9B 1IQGA 1GHXH 1P9UA 2BTCE 4FUDA 1YPJH 3BF6H 1BUIA 3RXQA 3TPIZ 4A92A 1KXBA 1K1MA 1MUEB 4INKA 1TONA 5DP9A 1EAWA 5TCAA 4JMYA 1K9OE 4FVDA 1L4ZA 1HAYB 3GY3A 5JBAS 5F03A 1O34A 1EJNA 5GCHG 1UTKA 3LJOA 3RXOA 2AMQA 4U01A 1GL0E 2B8OH 4GUXA 2QA9E 1JRTA 3BIVH 4TYDA 2ZCHP 3ZVDA 1VZQH 3MU8A 2H9TH 2A0QB 1EPTC 2UWLA 4BTIB 3L3TA 1GJCB 4XSKU 2P59A 5JPMH 1ETSH 5JB8S 2XXLA 1W14U 1SMFE 5AF9H 2W3IA 1RIWB 1TWXB 1XUIA 2ZA5A 3MNCA 2ANKH 4ISLA 3RU4E 1GHZA 2DE9A 1GBBA 1GDNA 1GI5A 2BVXH 1P2IA 4IBLH 1DFPA 1LQEA 2ZDKA 1AKSA 5K7RA 1BTXA 1C5NH 1SC8U 2GMTB 3T5FH 1AFQB 6LPRA 1AMHA 1V6DA 1S6FA 1NC6A 3S0NA 2W5EA 1O3JA 4GCHG 2ZC9H 1QBVH 1UTQA 1LCYA 1C2EA 2SGDE 1IQHA 1LVYA 1LVOA 3BEIB 4K1SA 1IQMA 1F2SE 1OKXA 1SLVB 1DWCH 4UEHH 1O2WA 1Z8IB 3V3MA 1Z6EA 2RG3A 2Y5FA 2ZWLH 1MKWH 1G37A 1THSH 1Y8TA 5FPYA 2UWPA 1A0LA 4NFFA 2STBE 2P8OC 1P2OA 1HAIH 5A09A 3SU0A 3A8BA 3MH4A 1VGCB 2FO9A 2PW8H 3UNQA 3HPTB 3ZVFA 1TGTA 1CA0B 1MAYA 1HJAB 1YBWA 1ZHMA 1C9PA 1RTKA 2OBOA 4LOYH 2FOHA 3UTUH 1O3EA 3MMGA 1GJAB 1P09A 2R3YA 3RXGA 1UK2A 4E06H 2V3HH 2Z94A 2HOBA 3Q00A 3T25A 1W13U 3U8TH 1G2MA 3M36A 1ETRH 1MU6B 1MCTA 2OD3B 3RXHA 1FJSA 1ESTA 1V2QT 1C2DA 1KLTA 2TGAA 2ZG0H 3V7TA 4CHAC 3M5OA 2BOKA 3A8DA 3FVFB 2G81E 3BEFB 2CMYA 1ZPCA 5ESBA 3L6PA 1H9IE 1P3EA 3LPRA 1SGRE 1WQSA 7LPRA 1Z8RA 1YKTA 3Q76A 2BXUH 3GDUA 1BA8B 4BAMB 3PWBA 1A7SA 1NU7B 2EI6A 5JYIA 3KF2A 2G55A 3UY9A 3SHCH 1GJ6A 3BTME 1SSXA 2VGCB 3DHKH 4YLQH 3SNCA 2RA3A 2FOCA 1A0JA 1T8LA 1INCA 1GWAA 2AERH 5LGOA 3UQOA 3K65B 1SGYE 2WPLS 3TJOA 5ABWA 3QZRA 1ETTH 2FI3E 3T2NA 1BTWA 4WH8A 3VB6A 1WOFA 3RMNH 3KCGH 5E0JA 7KMEH 1A2CH 1YP9A 2WPKS 1LHGH 1ESBA 2Q6DA 1S5SA 4IMZA 3LGVA 2BVSH 1TGBA 2ZCKP 3SU1A 2Z9JA 1O2KA 3VFEA 1C5WB 3TITA 2BYAX 1PQ8A 4A6LA 3ZYDA 1HIAA 1GI1A 3GOVB 4ABBA 3PYHA 2ZTZA 1OSSA 2J4IA 1EXFA 8GCHG 1JWTA 1GVZA 1EASA 2F9NA 1F5LA 1L2EA 1RTLA 3SU4A 1OWHA 1V2OT 5E2OA 3SNDA 1TX6A 5A8YA 2H5CA 1GVKB 1MZDA 2Y5GA 3TGIE 4I8LA 4Z0KA 2FWWA 2FOBA 2Z9KA 3DA9B 1D3PB 1YM0A 1D3TB 1SBWA 2A5AA 1YYY1 1XKBC 1TNHA 1TE0A 4QT8C 4K60A 3RMLH 1BBRH 3ZZ6A 4RSPA 1A46H 2P93A 2HWLB 2OC1A 2BQ7B 1DXWA 2H9EH 4F49A 1JBUH 4TPYA 4A1TA 3S7KB 1O5EH 4DIHH 1SOTA 1XMNB 2QF3A 4YTAA 5L2ZH 2ZHQH 4WMFA 3KN2A 1FN6A 1G30B 4GHTA 1AIXH 3SU3A 1DY8A 4FU8A 5T6DA 3SZNA 3RXLA 1C5LH 3SUGA 5C2ZA 3E0NB 3EQ0H 4D9QA 3A86A 1OP2A 2H1UA 4OGYA 4CH2B 4D76A 1UTMA 1QRWA 4VGCC 4DJZB 4MPUA 1UTLM 2GZ8A 3VPKA 3ZZ8A 3VEQB 2ZGJA 1OWDA 2SNVA 1DICA 1RXPA 1XUGA 2OP9A 1ORFA 2GCTC 3PLKA 2Y82A 1GJDB 1QJ6B 3ITIA 2O9QA 2OUAA 4XBBA 1AE5A 5DPAA 1WUNH 1ZRBA 2ZFRH 2ANWA 2WV5A 1OXGA 3MH6A 2ANMH 1BRUP 1WTGH 1O2GH 2NU1E 1IQLA 1WBGB 1GBTA 3A7YA 4YO9A 2QY0B 3HKIB 1NRSH 2ESTE 1SGQE 1JXPA 1UTJA 4ZHAA 1BMAA 1IAUA 1NS3A 4ZUHA 3IG6B 3M3VA 2DUCA 4NWLA 4OS6A 1HJ9A 1NU9A 3LDXH 1EAXA 2CHAB 4HGCA 5L30H 1CGJE 1AUJA 1UO6A 3KQEA 3KEEA 5GJ4B 1K28D 3D49H 1W11U 2ANYA 3QUMP 5J4QA 5JB9S 4O3UA 1MD7A 1TPPA 3A8CA 1TQ0B 3P8OA 1TA2A 4GHQA 1BMMH 3HKJB 5IYTA 1W2KH 3R0FA 1TIOA 2BDGA 2J94A 3LOXA 4NGAH 1C1RA 1C5MD 1NY22 5FCRA 1YPEH 1GHBG 4AYYB 3A81A 4YT7H 1Y3YA 1MH0A 2ZHEH 2FX6A 3CP7A 1UVPA 3BTGE 2ZDNA 3K6ZA 1EPTB 3ATIA 4HTCH 3O8RA 3SU5A 5L2YH 4AOQA 2VWNA 3ESTA 1AHTH 1DDJA 5C67A 1KIGH 1L4DA 5BPEA 5DP4A 1KTSB 3SW2B 1VITG 4O03A 1K2I1 3GYLB 1FIWA 4AFQA 3RM2H 2W7SA 1YLDA 1C9TA 1S6HA 3A7VA 1P11E 1J8AA 1TPAE 4TWYA 1C4V2 2AH4X 3RXAA 3FAOA 1TMBH 2O8LA 1KDQA 2JH5D 4X2YA 4Z6AH 2BQ6B 1V2LT 1CT2E 2JETC 1B0FA 1V2WT 2ODPA 2VWLA 1WU1A 2IPHA 3MYWA 1EJMA 3BTWE 3TNTA 4R0IA 1CHOG 2BZ6H 5JBCS 3TJNA 5FCKA 3AAVA 4YM9A 1O5CB 3RP2A 4AGKA 1TFXA 3LH3A 1OP8A 4X2VA 1GI8B 1O3OA 2QXGA 3LKWA 1H9HE 1V2RT 4ABEA 4B73A 2BY7X 1AO5A 1ELEE 1O2PA 1HAVA 2VJ1A 3NWUA 4XBDA 2QV1A 1J15A 4I8HA 1CGHA 4BNRA 3ATLA 3B8JA 2AMPA 3SGQE 3ZVGA 1RS0A 2ZQ2A 3PMBB 1AVXA 1ID5H 1TALA 5EPYA 4WVPE 3LJJA 4Y11E 1RRKA 1HDTH 1DSTA 3RLYH 1QFKH 1SGCA 1UHBB 5ESTE 3RXRA 4FVBA 5AVDA 1IOEA 4JCNA 1LPZB 1PYTC 1PFXC 1L1JA 3ZV9A 1EAUA 1TX8A 2ZFTA 3E0PB 2G5VA 3PB1E 5A0AE 4ABGA 1C2IA 1CSOE 3Q3XA 3HK6B 4AFSA 1AE8H 1ZRKA 2BDAA 2R3UA 1N8OC 1TB6H 2O8TA 1P02A 1YGCH 3FP7E 1JOUB 1O3FA 3RUOA 4ABHA 2UUKB 2ZPQA 1OS8A 3AASA 4UFFH 1GJ7B 3KGPA 4XE4A 1K21H 4KP0A 5E0HA 2QXIA 1FLEE 2VWMA 3E1XB 1S81A 4J1YA 1O3KA 4INLA 3RXDA 3M61U 3UFAA 3M3SA 1BBRK 3ZVEA 4KKDA 5LPEA 4ZXXH 3W94A 2HNTF 1KSNA 1MQ6A 4CR5A 4CRGA 1BTZA 3RC5A 1ZJDA 1C2HA 1ELVA 3CS7A 1FNIA 3E3TA 2UUFB 3BTKE 4OS5A 1VCWA 3FANA 3MO6A 4ZKSU 4JYUH 4NWKA 3EA9A 8LPRA 1Z8GA 4GVUA 3ZZBA 2STAE 4FXGH 1TGNA 4DCDA 3M7QA 3VGCC 1WQVH 1AB9C 3MU0A 1E37B 1SQTA 2O8UA 4KELA 1O2JA 3TNSA 2F83A 3CS0A 4Q80A 2BM2A 1W7GH 4OGXA 5PTPA 1K1NA 2BD5A 1V2UT 1FPCH 3KQDA 1C5OH 1TOMH 2XBYA 4IC6A 1AUTC 4E7RG 2A31A 5A0BA 2P3TB 2ZGCA 4O97A 3ZZ5A 1THRH 2PKAB 2IN2A 1GJ9B 1ZPBA 1EOLA 1O2ZA 3TJUA 1EOJA 4IN1A 2QAAA 3PO1C 2FMJA 2ZEBA 3U69H 4Q2KA 3PV4A 4JK5A 2P94A 2AEIH 1U6QA 5HMAA 3QDZB 4H6TA 2FOGA 3VB4A 4X6MA 2BD7A 3FZZA 4NA8A 5C1XA 1CT4E 4IGDA 4YZUA 2P3UB 1WAYB 3ZZ7A 1Z6JH 3O8DA 1O2VA 3P8GA 3RXMA 2JH0D 1HAHH 4AORA 2PLXA 5GXPA 1MKXK 4MLFB 1SVPA 3LC3A 4ZMAH 1FPHH 3QX5H 4Q7YA 4VGCB 1S0QA 1HGTH 5T6FA 3RC6A 1F0SA 2QXHA 1EP5A 8KME2 5HYOA 2R9PA 5DKMA 3UR6A 2ASUB 1QJ1B 2A7HA 3GCTG 4D8NA 5FPTA 2GCTB 1P04A 1T8MA 1WTHD 3D62A 5I25A 1W12U 2NU2E 3TK9A 3TLOA 3VB3A 2TPIZ 2ZIQH 3NPSA 1KLJH 1JIRA 3KIDU 1OWIA 2XCNA 1LKBA 4JYVH 3RLWH 3ELAH 5GPIB 3P70B 4OS4A 3TIUA 2GZ7A 1Y3XA 2LPRA 2RA0A 2VU8E 4LXBH 1QA7A 3A84A 1F7ZA 1GJ8B 4ABFA 4H6SB 2PKSC 4X1NU 1JMOH 4I33A 1EJAA 2Y7ZA 1SLXB 2OINA 3RC4A 3BTEE 1D3QB 1NFUA 1GBLA 1GG6C 1H8IH 1E34B 1Z7KA 1O2SA 1O39A 2ZPRA 1XUHA 3BG4C 1TLDA 3ODFA 1Y3UA 5DG6A 4K8YA 1PPZA 2BX3A 1P10A 3SV9A 3B23B 1AY6H 3CENA 1QCPA 1YCPH 1ARBA 1F0RA 1ZHPA 1FDPA 2G4TA 4JZDH 6CHAC 2BLQA 1GHAG 2YOLA 2ZDMA 3I77A 2XC0A 4AGJA 3SJIA 1HBTH 1YC0A 1EQ9A 5EGMA 2Y7XA 4RKOB 2VIWA 6GCHF 1D4PB 2Z3DA 4FUJA 1GDQA 2OTVA 1TABE 4CH8B 1BTYA 4ZH8A 1O2NA 2BY5X 3P6ZB 1O2LA 4AZ2B 1D6WA 4U2WA 1UTOA 1O2TA 4FUHA 1LVMA 1ARCA 3RXJA 4BAOB 4B2BA 2PUQH 1DWDH 4NFEA 3FP8E 4JZFH 5FX6A 2WYJA 1GBCA 3DFJA 3TGJE 5TCCA 1ELCA 1G3CA 3MOCA 3QTVH 3RU4D 1F5RA 2GCHG 2Z9GA 3HGPA 1A1RA 4IW4E 2ZU4A 3A85A 2GT8A 1SL3A 3O8BA 5H4IB 3K2UA 3OYPA 1MBMA 2D8WA 1GDUA 2D26C 1DT2A 3PMHB 6ESTA 2G5NA 2P95A 5EPNA 1O5DH 1OWKA 4MTBA 3GISB 5L6NH 1GL1A 1BQYA 4AN7A 4Y6DA 1GBEA 5EW1H 1BRCE 1K1OA 4ISHH 1FMGA 1S82A 1P3CA 3ATKA 4BTTB 3KQCA 3MTYA 1HB0B 1QL7A 3JZ2B 4X6PA 1DVAH 1OPHB 2QCYA 4XDEA 3F9EA 2A7CA 2HRVA 1O2XA 4LK4A 1SFQB 2OLGA 1T7CA 3OU0A 1PPFE 1WSSH 4JZ1A 1QJ7B 5C1UA 1WV7H 3P8NA 2IJOB 4UFGH 5C1YA 1A3BH 1SGFA 3QK1A 3GY7A 8ESTE 4IC5A 5SGAE 2Y5HA 2H5DA 3FFGA 2FOMB 3L33A 1N8OB 2J9NA 2Q6GA 4BANB 3E90B 2ZFFH 4BXSA 5EQSA 2EC9H 1GBIA 1O37A 3TH4H 3STJA 2D1JA 2XW9A 1NFYA 1O2IA 2AGGX 3LGTA 1CO7E 3E8LA 1O3GA 4YLUA 1C1SA 1B5GH 1T32A 1C5UA 1FUJA 1BZXE 1S84A 3SBKA 3PWCA 1H9LB 2VIOA 5E0GA 2VIQA 2RDLA 5HM9A 1G3DA 2AYWA 3F9FA 1P2JA 4B2AA 3ODDA 1P8VC 5DO4H 3A8AA 3TVJB 3C1KA 3O8CA 2ILNA 5LH8A 3RXPA 3ZZAA 3ZZDA 1KXDA 1FY3A 3FZDA 3U8RH 3E16B 1GBFA 4CRBA 1GHYH 2A4GA 1K1JA 5T3HA 3A7TA 2ZGXH 1O5FH 3SNAA 1AB9B 4X2WA 2EA3A 1ZSKA 1BT7A 1RGQA 1BIOA 4AG2A 3AW0A 2ZU2A 2V3OH 2ZFPH 1F5KU 1AU8A 2F9UA 3UIRA 3FP6E 1ZSJA 2XNIA 4X8VH 2LNCA 2F9OA 2M5TA 1A5IA 3RU4T 1P05A 1QB9A 2G52A 3MU5A 2Q1JA 3SJKA 7GCHF 1BITA 1FAKH 4A5TS 3PO1B 4NZLA 1XM1A 1C1VH 3LGYA 4CRDA 1SQOA 2XCFA 2BY6X 2HNTC 2NU4E 1GHWH 1MD8A 2VH6A 4NSYA 2GGVB 1CBWB 1V2MT 4FUIA 2FYQA 3TGKE 1J16A 5JBTA 2UWOA 1F0TA 1FY4A 1TNJA 1W7XH 2HNTE 3M5MA 4OS1A 1BMLA 1ZTLA 3QTOH 4AX9H 2ZDLA 1K1PA 2FOEA 1VCQA 2ZO3H 1GI6A 1SB1H 3NUMA 3SJ8A 1ELDE 3TH3H 1G2LA 2AMDA 1T8NA 1P06A 1VCPA 1UCYH 1HAZB 1NRPH 1QB1A 1ELTA 2RCEA 4B76A 3DFLA 1NTPA 1J9CH 5C3NA 1GI0A 4Y8ZA 1P03A 4X1QU 4ISOA 4TY6A 1DUEA 1EX3A 3GY5A 2BB4A 2O8MA 1C1OA 4B1TA 2A5KA 2ZDAH 2QGRA 5DP7A 1C1PA 1SGPE 1SHYA 1QR3E 2XC5A 2FLBH 1DM4B 1HAGE 4GAWA 3SHAH 4X8UH 3QLPH 3LC5A 1QHRB 5GDSH 1A4WH 2FLRH 1BJUA 1T8OA 1V2VT 1KTTB 1LTOA 1MZAA 1HNEE 1DITH 2GDDA 2OCVB 1EP6A 1O2OA 1QRZA 3A7ZA 1PQ7A 3C27B 4DOQA 1BTHH 2BD4A 5F6MA 1RIWC 5FBIA 1MKWK 3DUXH 1ELAA 1MAXA 3E6PH 1RTFB 4GLYA 4Y0YE 4E7NA 1GMCF 1L0ZA 2EI7A 3OSYA 1UCYE 5GIBA 4IS5A 5EODA 2QIQA 4GPGA 1DUAA 2CV3A 2J2UA 2PKSB 3PM3A 4B2CA 1GJ4H 2VVUA 1FAXA 1MU8B 2SGFE 2XBXA 2Z3EA 3LH1A 1E0FD 1MTVA 2GMTC 3OTJE 1W10U 3T27A 5A2MH 1GG6B 5AHGH 1N1LA 7ESTE 4I8JA 2EEKA 1TRNA 3BG4B 1LHDH 3V0XA 9ESTA 1GMDF 2AGEX 2SFAA 3UNRA 2G8TA 5J4SA 2Z7FE 4CR9A 2J92A 3T29A 3KL6A 2GD4B 3SGBE 2I6QA 2CN0H 1XKAC 3OY6U 1TMTH 3BEUA 5LPRA 1O33A 3H7OA 1ABJH 2G51A 1HLTH 4OS2A 2BDYA 3EA7A 3M37A 7GCHG 2VVCA 3SQHE 3TU7H 3B9FH 1TBQH 2XWAA 2ZHFH 3HATH 2HLCA 2FS9A 2ZPSA 4ZKOU 1GGDC 1KYNA 1OX1A 3F1SB 9LPRA 3LIWA 4SGBE 1JIMA 5CHAC 1O3NA 1QA0A 5FXLA 3SV6A 1O2QA 4K1TA 1GPZA 2P8OB 3GYMA 3UQVA 3P92A 3I29A 1O31A 1C1QA 3SJOA 1SGNE 2A4RA 3A82A 3H5CB 4IMQA 1SGDE 4DY7B 3UUZA 2UUYA 2AFQB 3G01A 3PMJA 1ZOMA 4HFPB 4WMDA 1PPHE 1HXEH 1HXFH 1C5SA 1O2HA 3TK5A 1GCTC 1SFIA 1X7AC 3W95A 2A5IA 5IDKA 1ZSLA 1O2RA 3M7UA 2HGTH 3OY5U 4CHAB 3QGNB 2R0KA 3ZVBA 3MU4A 3URDA 1NZQH 1GHVH 2WPMS 2GV6A 4INHA 1ZYOA 2ZKSA 1EZQA 5F8XA 1DX5M 1ZTJA 3TK6A 2B0FA 3BTTE 1LPGB 2BQWB 2ZFQH 4K69A 1FQ3A 4BXWA 3SN8A 1T4UH 1ELGA 4ABJA 1ANDA 4X6OA 4WXVA 2KAIA 1H1BA 4A1VA 4MPVA 2C90B 1P9SA 1V2NT 3MHWU 2VWOA 3NK8A 2BHGA 4AYVB 1O5AB 2F9VA 2R0LA 1GMCG 4E05H 1O3IA 1FN8A 1L1NA 5A8ZA 1F92A 2PKAA 1CVWH 3K9XB 4AG1A 3F6UH 3T28A 1GMHF 4X1RU 4WY3A 1W3CA 1C2MA 1YLCA 4ABDA 1SPJA 2JH6D 3RXEA 3DT0H 3AVZA 1MTSA 3PMAB 1LPKB 2F9BH 2GVFA 1LHCH 1FV9A 2PSXA 2CJIA 3Q77A 5GCHF 5E8EH 2QC2A 2G00A 4NCYA 1V2ST 2ZHWH 5EG4A 1ABIH 3S7HB 1NESE 3RXBA 1SGIB 1QBNA 5DP5A 3EE0B 1FXYA 1XUKA 4A7IB 3GY2A 5E2PA 1DSUA 1KXCA 1TNIA 4ABAA 2FIRH 4DT7B 4LZ4B 1XVOA 2WPJS 2FTLE 4TWWA 1P0SH 2FOFA 1SLUB 4A1XA 2ZP0H 5DJ7A 4CRAA 2FP7B 1GCDA 4NA9H 1DOJA 3M35A 2VIDA 4NG9H 3OX7U 2IOTA 1E35B 2W26A 1SOZA 5JDUB 1FZZA 1M9UA 1W0ZU 1QNJA 1EZUC 1WCZA 2OQUA 4AB8A 4GCHF 3RXIA 1W8BH 1C1WH 2A2XH 1XXFA 1LHFH 1C4U2 4RN6A 2CXVA 2BD2A 1UK3A 1LDTT 1MMJN 1KLIH 1Y5AT 2GTBA 2PR3A 2ZECA 2QYIA 5JBBS 1N6YA 1OYQA 1TRYA 4K5ZA 1ZMLA 3KHVA 1EKBB 1ZZZA 2BZAA 3LT3A 1UJ1A 5FBEA 1TRMA 2A7JA 1QIXB 4AFZA 1HAPH 1DE7H 2OC7A 1GBDA 3NXPA 2GZ9A 2QF0A 1BB0B 3LONA 3D65E 3ZVAA 5EOKA 1P2NA 3LGWA 1HRTH 3RM0H 2FODA 1LMWB 2XBVA 1QL8A 2XBWA 1BHXB 5EXLA 5I46H 1VJ9U 4KTCA 2SGPE 3PROA 2HPPH 2CF9H 5C5NA 1S85A 1ELBA 1GBHA 2CHAC 2ULLA 2XWBI 2PGQB 1C2KA 1D6RA 1GBJA 1NT1A 3SGAE 3SUFA 2GV7A 1CE5A 2WUBA 4KTSA 1AVWA 4ESTE 3Q3KA 3RXKA 2JKHA 4H42U 1GI4A 3ZYEA 3HGNA 1P2MA 1PPCE 1C5XB 3SQEE 4FU9A 1NFWA 3N7OA 5EQQA 4I7YH 1RFNA 1G9IE 2VIVA 1J17T 1RJXB 3SNBA 3MNXA 3A83A 1A5GH 3SI3H 4CBOA 1B7XB 4O3TA 1ZGVA 5AFYH 4DW2U 1SG8B 3KQBA 1N6XA 4BOHA 4UD9H 4WH6A 4Y8YA 3QWCH 2A1DB 1GI2A 4CRCA 5AFZH 2BDHA 1C5PA 1A5HA 1CQQA 3NZIA 5DP3A 1P01A 4FUGA 4MG3A 1ESAA 3V12A 1OP0A 1P12E 2ALVA 3U8OH 3ZV8A 1PQAA 2K1QA 3MO9A 2AIPA 3U1JB 1B0EA 4MPXA 3VB7A 1QY6A 3RXCA 4BAQB 2A2QH 1E36B 3AAUA 4AFUA 1HAOH 1TNLA 3BTFE 3RXFA 1W0YH 1S0RA 3M7TA 3A7XA 3P95A 3RXTA 2ZF0H 1O32A 3SUEA 4HZHA 4JZIA 1ACBE 2FX4A 8GCHF 4ABIA 1ZTKA 3S69A 2J34A 4NIXA 1AGJA 1YPHC 3SI4H 1G32B 2AS9A 3VB5A 5FAHA 2CGAA 3P17H 1NRNH 1SHHB 3GCHC 1YF4A 4M7GA 1YPHE 4WXIA 2BY8X 1FY5A 1CHGA 3VXEH 1O3CA 2V35A 5HM2A 1A0HB 4X1PU 1OOKB 4FU7A 4CREA 1SGTA 1DY9A 2JETB
chains in the Genus database with same CATH superfamily
1S83A 2OXSA 1E38B 3QN7A 3SV7A 1O3DA 1GJ5H 2BOHB 1FY1A 5DP8A 5T6GA 1LHEH 2ZNKH 1FONA 1UMAH 1K1IA 1FIZA 1GGDB 3FO8D 1YPKH 1L1GA 1AWHB 4FUEA 1SLWB 5CHAB 1C2JA 3SNEA 2PUXB 1AKSB 3RXSA 3R3GB 2HALA 3IWMA 1T4VH 1QL9A 1C5YB 3M5NA 2EI8A 3A87A 4F55A 1NN6A 2XC4A 1YCPM 2OBQA 1TNKA 3UPEA 1VKYA 2Z9IA 1LKAA 4Y71A 4K8BA 1THPB 1PPGE 1BJVA 1O38A 4ZROA 2BD3A 1O3LA 1GCTB 2W7UA 2H9HA 1TGCA 1YPGH 4NA7A 1VJAU 1PPBH 1NM6A 3NKKA 5K0HA 4MNXA 1Z1JA 1GI3A 3HK3B 3MFJA 1TX7A 1O5GH 1K22H 1TYNA 3D23A 4K1EA 2ODQA 2THFB 4IN2A 3SORA 1HFDA 2K8IA 2ZTXA 1AD8H 4PROA 1ELFA 2Y80A 4Y79A 4TY7A 3GY8A 1MTWA 3SJ9A 1MTNC 1GBMA 3GICB 3V13A 5DK1A 1DLEA 1VR1H 3GCOA 3UREA 5EW2H 1AI8H 4JZEH 1O0DH 2WPIS 2VVVA 2VINA 2ZI2H 4XRNA 1D9IA 2Z3CA 2H6MA 1ANBA 2GKVE 5FX5A 1C5TA 4H4FA 5CE1A 1MBQA 1BOQA 4I8GA 6GCHG 2WUCA 1IQJA 1QURH 1GVLA 2J97A 4DG4A 1TBRH 1CGIE 4MPWA 2Y81A 2C8YB 1UVSH 1SR5C 1Z1IA 4LZ1H 4K3JA 4Q7XA 1HAXB 5C20A 1FI8A 4I31A 5HXFA 3K6YA 4MVNA 4NSVA 1E79D 4XOJA 1C5VA 1G3BA 1GHBF 1MTUA 2FESH 1UVTH 3VGCB 2RFKC 2NWNA 2BMGB 3MNSA 1GI9B 1C1TA 3DD2H 4B71A 1XX9A 1P57B 4ISIH 4ZKRU 4ASHA 2VNTA 1IQNA 1A61H 2TIOA 2YNAA 1UVUH 5FPSA 1Q2WA 5EQRA 1TMUH 1Y59T 2I6SA 1RD3B 4UDWH 2ZQ1A 1KXFA 1OWJA 4X1SU 3RMOH 1E1RD 1ANEA 1VITF 1AVGH 4Y7BA 2C4FH 2GDEH 3UR9A 2ODYB 2QN5T 3SV2H 1HIAB 1AQ7A 3ZZ3A 1NPMA 2ZTYA 4X0WU 1BTUA 2BLWA 1OWEA 3RXUA 1KXAA 4Y10E 2ZGHA 4X6NA 1C2FA 1O2YA 3JZ1B 1EZSC 3DSPA 1V2TT 3QGJA 3U9AH 4ISNA 2WPHS 1C1UH 4R8TB 4Y0ZE 1DANH 1P2KA 3PLBA 2WYGA 5C5OA 2FDAA 4J2YB 4XBCA 1SGFG 3UWJH 1V2JT 4RKJB 1ZMJA 4K2YA 3TJVA 3AW1A 1O5BB 2V0BA 1DXPA 3SU2A 3S9AA 1EPTA 3BIUH 1BBRE 2H2ZA 1CHOF 2SGEE 3PLPA 4D7GA 3UOPA 5FHTA 4UONA 1P2QA 1MQ5A 5LPFA 4BAHB 1MABB 1Z71A 4WJG2 3H09A 4NZQA 1O3MA 1T31A 4CBNA 1O2UA 4BAKB 1O3BA 3ZVCA 1EUFA 2BDCA 2FS8A 2WSSD 1TQ7B 1PQ5A 3EYDA 1V2PT 2W3KA 1KXEA 4X8SH 1Q3XA 3H7TA 1YCPK 3ZZ9A 1NROH 4HI3A 4KGAA 1EFRD 1SQAA 3PTNA 1QQUA 1H8ED 2WV4A 2PWXA 1C5QA 2ZDVH 4ZHLU 1XUFA 2GP9B 1LVBA 1ZHRA 2Q6FA 2A4OA 2R2MB 2FEQH 2C8WB 2C93B 2TRMA 4WWYA 1MKXH 2BVRH 1HCGA 1TA6A 1TNGA 2J38A 2F43B 2OC8A 2A4QA 2A45B 3T26A 5G4BA 2CF8H 1UTNA 4DVAU 1IHTH 3SU6A 4B75A 1HPGA 4TPIZ 1ZR0A 1C5ZB 1TOCB 2NU0E 2YMSC 3BG8A 1AFQC 1O3PB 5DGJA 3ATMA 1CA8B 1SGEE 4BTUB 3RXVA 1PJPA 4I8KA 4X8TH 1XUJA 2BD8A 1Y3WA 4WF8A 3GY6A 2FYRA 1C1MA 4MNVA 1AFEH 2ZGBH 2ZCLP 3ENSB 1QB6A 3QO6A 1DPOA 4X2XA 4I86A 1UVOA 1DS2E 2C8XB 3MI4A 2F4LA 5KEDA 2PSYA 5BRRE 1DLKB 4THNH 2VIPA 6CHAB 1Z8JB 3EA8A 4ZAEA 2FM2A 4B74A 5EJ1A 3PTBA 1HV7A 1EB1H 1UHBA 1OYTH 2BXTH 3WY8A 1VGCC 3GDSA 4MNYA 1AZ8A 3FOAA 1ANCA 4DIIH 1Y3VA 1CA0C 1HJAC 1BRBE 2HVXA 4MQAA 3KNXA 3LGIA 1EAIA 1Y5UT 2BY9X 1QGFA 5EU8A 3BTDE 1A3EH 5DP6A 1BMNH 5F8ZA 2KZ4A 3MO3A 4NIYA 3UWIA 3KYGA 1NRRH 2ZU1A 3NCLA 4OS7A 2P16A 3S9BA 3GCHB 1J14A 1AWFH 2SNWA 3MNBA 1ZGIA 1C4Y2 2PHBA 1TPSA 2F9PA 2BLOA 4ZHMU 3EDXB 1LQDB 3BSQA 5ETXA 2PTCE 2PGBB 2G4UA 4CRFA 1MCVA 2AIQA 2Y6TA 5F8TA 2BDBA 1DWEH 4Y7AA 2VGCC 1PPEE 3LU9B 4ACAA 4NIVA 4MDSA 1DWBH 1ZLRA 1NO9H 1SI5H 2BDIA 2ZZUH 3SYJA 2XRCA 2LP6A 3VXFH 4DURA 4ZKNU 1GI7B 1V3XA 1GBAA 2FXRA 4FUCA 2TGTA 1C2LA 3ZZ4A 1KDQB 1XVMA 2UUJB 3STIA 1BRAA 3U98H 3BTHE 1HYLA 4F4OC 1C2GA 3RMMH 2HPQH 1TBZH 1NRQH 3M5LA 1AZZA 2TGDA 3EGKH 1YPMH 1V2KT 3RDZA 2ALPA 2TBSA 3EE7A 1NFXA 1O2MA 3SUDA 2XNDD 3GCNA 1KY9A 3GDVA 2XTTB 3A7WA 4KTUA 2BD9A 2ZU5A 3S9CA 3BV9B 4YOGA 2J95A 2D2DA 5TJXA 4AB9A 5A8XA 2B9LA 1F0UA 4FUBA 5HGGA 3GCTF 3F9HA 3SO3A 1C5RA 1BCUH 2FPZA 3IITA 2KCPA 1WYKA 4Q7ZA 3A80A 5C94A 2VBCA 1O3AA 1IQKA 3OE7D 1GJBB 1GMDG 4ZXYH 4SGAE 2KX4A 2B5TB 3BN9A 3SV8A 2DE8A 1ZPZA 3UAIC 1HAVB 2BLVA 1H4WA 3MH5A 1UK4A 1G36A 2AGIX 2ZHDA 2F91A 1QBOA 4D9RA 4UFEH 4YOIA 5C0TA 1O3HA 1MTNB 2FZZA 1ZMNA 2SGQE 3F0PA 2PFEA 2SGAA 2VB0A 5B6OA 1BHXF 1O30A 1FY8E 2GT7A 4YOJA 5EXNA 1EATA 1EZXC 3MWIU 4YT6H 1EB2A 1YPLH 2BX4A 1Q31A 4MNWA 3URCA 2TGPZ 3KQ5A 2C3SA 1C1NA 1O35A 2FOAA 2F3CE 1PYTD 1TGSZ 3F9GA 4I32A 2YNBA 2Z6BD 4JYTA 3LGUA 1XXDA 1GBKA 2KAIB 2C8ZB 2ZU3A 3Q3YA 3UOUA 3F68H 1LO6A 1IQEA 2WINI 4FUFA 3SOSA 1G3EA 1QTFA 1HJ8A 4YESB 4WMEA 1UCYK 4GSOA 1GHAF 1QRXA 1TPOA 2O8WA 2A32A 1UTPA 3MH7A 3ATWA 4Y76A 2FTMA 3P8FA 4NIWA 3F2FA 5A0CA 2FI5E 2QXJA 1IQFA 1IQIA 4U30A 4Y8XA 3E91A 4U32A 4JK6A 4XFQA 2R2WU 4AC9A 1QQ4A 2FI4E 2VH0A 1D3DB 2B7DH 3A88A 3BTQE 3ZZCA 4Z1MD 1NBME 1ZJKA 3GY4A 3QZQA 1CBWC 2PTNA 1BDAA 1JRSA 4UFDH 1BTPA 2XYAA 2OC0A 1IHSH 1K1LA 1Y5BT 2NU3E 3MU1A 2Z9LA 4D7FA 4RT1A 1VITH 3UNSA 3T62A 1AN1E 3U1IB 2GX4A 1TAWA 1H8DH 2OQ5A 2ZFSA 5CMXH 1CU1A 3A89A 3EAJA 3M3TA 1HUTH 3I78A 5EXMA 4O9VA 3TH2H 1CT0E 4DGJA 1O36A 2V6NA 2P3FH 5GWZA 1GMHG 4UE7H 2GCHF 2PV9B 4Q4LA 1IQGA 1GHXH 1P9UA 2BTCE 4FUDA 1YPJH 3BF6H 1BUIA 3RXQA 3TPIZ 4A92A 1KXBA 1K1MA 1MUEB 4INKA 1TONA 5DP9A 2WZQA 1EAWA 5TCAA 4JMYA 1K9OE 4FVDA 1L4ZA 1HAYB 3GY3A 5JBAS 5F03A 1O34A 1EJNA 5GCHG 5KECA 1UTKA 3LJOA 3RXOA 2AMQA 4U01A 3DSOA 1GL0E 3ZIAD 2B8OH 4GUXA 2QA9E 1JRTA 3BIVH 4TYDA 2ZCHP 3ZVDA 1VZQH 3MU8A 2H9TH 2A0QB 1EPTC 2UWLA 4BTIB 3L3TA 1GJCB 4XSKU 2P59A 5JPMH 1ETSH 3KYFA 5JB8S 2XXLA 1W14U 1SMFE 5AF9H 2W3IA 2W6JD 1RIWB 1TWXB 1XUIA 2ZA5A 3MNCA 2ANKH 4ISLA 3CNRA 3RU4E 1GHZA 2DE9A 1GBBA 1GDNA 1GI5A 2BVXH 1P2IA 4IBLH 1DFPA 1LQEA 2ZDKA 1AKSA 5K7RA 1BTXA 1C5NH 1SC8U 2GMTB 3T5FH 1AFQB 6LPRA 1COWD 1AMHA 1V6DA 1S6FA 1NC6A 3S0NA 2W5EA 1O3JA 4GCHG 2ZC9H 5HKKD 1QBVH 1UTQA 1LCYA 1C2EA 2SGDE 1IQHA 1FX0B 1LVYA 1LVOA 3BEIB 4K1SA 1IQMA 1F2SE 1OKXA 1SLVB 1DWCH 4UEHH 1O2WA 1Z8IB 3V3MA 1Z6EA 2RG3A 2Y5FA 2ZWLH 1YWUA 1MKWH 1G37A 1THSH 1Y8TA 5FPYA 2UWPA 1A0LA 4NFFA 2STBE 2P8OC 1P2OA 1HAIH 5F53A 3SU0A 5A09A 3A8BA 3MH4A 1VGCB 2FO9A 2PW8H 3UNQA 3HPTB 3ZVFA 1TGTA 1CA0B 1MAYA 1HJAB 1YBWA 1ZHMA 1C9PA 1RTKA 2OBOA 5KGOA 4LOYH 2FOHA 3UTUH 1O3EA 3MMGA 1GJAB 1P09A 2R3YA 3RXGA 4OM9A 1UK2A 4E06H 2V3HH 2Z94A 2HOBA 3Q00A 3T25A 1W13U 3DCLA 3U8TH 1G2MA 3M36A 1ETRH 1MU6B 1KMHB 1MCTA 2OD3B 3RXHA 1FJSA 1ESTA 1V2QT 1C2DA 1KLTA 2TGAA 2ZG0H 3V7TA 4CHAC 3M5OA 2BOKA 3A8DA 3FVFB 2KCOA 2JJ1D 2G81E 3BEFB 2CMYA 1ZPCA 5ESBA 3L6PA 1H9IE 1P3EA 3LPRA 1SGRE 1WQSA 7LPRA 1Z8RA 1YKTA 3Q76A 2BXUH 3GDUA 1BA8B 4BAMB 3PWBA 1A7SA 1NU7B 2EI6A 2KR7A 3KF2A 5JYIA 2G55A 3UY9A 3SHCH 1GJ6A 3BTME 1SSXA 2VGCB 3DHKH 4YLQH 3SNCA 2RA3A 2FOCA 1A0JA 1T8LA 1INCA 1GWAA 5EJLA 2AERH 5LGOA 3UQOA 3K65B 1SGYE 2WPLS 3TJOA 5ABWA 3QZRA 1ETTH 2FI3E 3T2NA 1BTWA 4WH8A 3VB6A 1WOFA 3RMNH 3KCGH 5E0JA 2RDEA 7KMEH 3W1EA 1A2CH 1YP9A 2WPKS 1LHGH 1ESBA 2Q6DA 1S5SA 4IMZA 3LGVA 2BVSH 1TGBA 2ZCKP 3SU1A 2Z9JA 1O2KA 3VFEA 1C5WB 3TITA 2BYAX 1PQ8A 4A6LA 3ZYDA 1HIAA 1GI1A 3GOVB 4ABBA 3PYHA 5C17A 2ZTZA 1OSSA 2J4IA 1EXFA 8GCHG 1JWTA 1GVZA 1EASA 2F9NA 1F5LA 1L2EA 1RTLA 3SU4A 5EIYA 1OWHA 1V2OT 5E2OA 3SNDA 1TX6A 5A8YA 2H5CA 1GVKB 1MZDA 2Y5GA 3NRLA 3TGIE 4I8LA 4Z0KA 2FWWA 2FOBA 2Z9KA 3DA9B 1D3PB 1YM0A 1D3TB 1SBWA 2A5AA 1YYY1 1XKBC 1TNHA 1TE0A 4QT8C 4K60A 3RMLH 1BBRH 3ZZ6A 4RSPA 1A46H 2HWLB 2P93A 2OC1A 2BQ7B 1DXWA 2H9EH 4F49A 5HIZA 1JBUH 4TPYA 4A1TA 3S7KB 1O5EH 4DIHH 1SOTA 1XMNB 2QF3A 4YTAA 5L2ZH 2ZHQH 4WMFA 3KN2A 1FN6A 1G30B 4GHTA 1AIXH 3SU3A 1DY8A 4FU8A 5T6DA 3SZNA 3RXLA 1C5LH 3SUGA 5C2ZA 3E0NB 3EQ0H 4D9QA 1S6LA 3A86A 1OP2A 4FOUC 2H1UA 5C0UA 4OGYA 2L74A 4CH2B 4D76A 2GJGA 1UTMA 1QRWA 4VGCC 4DJZB 4MPUA 1UTLM 2GZ8A 3VPKA 3ZZ8A 3VEQB 2ZGJA 4XD7D 1OWDA 2SNVA 1DICA 1RXPA 1XUGA 1ORFA 2OP9A 2GCTC 3PLKA 2Y82A 1GJDB 1QJ6B 3ITIA 2O9QA 2OUAA 3PV2A 4XBBA 4B6EA 1AE5A 5DPAA 1WUNH 1ZRBA 2ZFRH 2ANWA 2WV5A 1OXGA 3MH6A 2ANMH 1BRUP 1WTGH 1O2GH 2NU1E 1IQLA 1WBGB 1GBTA 3A7YA 2WHXA 4YO9A 2QY0B 3HKIB 1NRSH 2ESTE 1SGQE 1JXPA 1UTJA 4ZHAA 1BMAA 1IAUA 1NS3A 4ZUHA 3IG6B 3M3VA 2DUCA 4NWLA 4OS6A 1HJ9A 1NU9A 3LDXH 1EAXA 2CHAB 4HGCA 5L30H 1CGJE 1AUJA 1UO6A 3KQEA 3KEEA 5GJ4B 1K28D 3D49H 1W11U 2ANYA 3QUMP 5J4QA 5JB9S 4O3UA 1MD7A 1TPPA 3A8CA 2AHME 2XOKD 1TQ0B 3P8OA 1TA2A 4GHQA 1BMMH 3HKJB 5IYTA 1W2KH 3R0FA 1TIOA 2BDGA 2J94A 3LOXA 4NGAH 1C1RA 1C5MD 1NY22 5FCRA 1YPEH 1GHBG 4AYYB 3A81A 4YT7H 1Y3YA 1MH0A 2ZHEH 2FX6A 3CP7A 1UVPA 3BTGE 2ZDNA 3K6ZA 1EPTB 3ATIA 4HTCH 3O8RA 3SU5A 5L2YH 4AOQA 2VWNA 3ESTA 1AHTH 1DDJA 5C67A 1KIGH 5B6LA 1L4DA 1YLNA 5BPEA 5DP4A 1KTSB 3SW2B 1VITG 4O03A 1K2I1 3GYLB 1FIWA 4AFQA 1OHHD 3RM2H 2W7SA 1YLDA 1C9TA 1S6HA 3A7VA 1P11E 1J8AA 1TPAE 4TWYA 1C4V2 2AH4X 3RXAA 3FAOA 1TMBH 2O8LA 1KDQA 2JH5D 3F0OA 4X2YA 4Z6AH 2BQ6B 1V2LT 1CT2E 2JETC 1WXRA 1B0FA 1V2WT 2ODPA 2W6ID 2VWLA 1WU1A 1UW7A 2IJD1 2IPHA 3MYWA 1EJMA 3BTWE 3TNTA 4R0IA 1CHOG 2BZ6H 5JBCS 3TJNA 5FCKA 3AAVA 4YM9A 1O5CB 3RP2A 4AGKA 1TFXA 3LH3A 1OP8A 4X2VA 1GI8B 1O3OA 2QXGA 3LKWA 1H9HE 1V2RT 4ABEA 4B73A 2BY7X 1AO5A 1ELEE 4Q63A 1O2PA 1HAVA 2VJ1A 3NWUA 4XBDA 2QV1A 1J15A 4I8HA 1CGHA 4BNRA 3ATLA 3B8JA 2AMPA 3SGQE 3ZVGA 1RS0A 2ZQ2A 3PMBB 1AVXA 1ID5H 1TALA 5EPYA 4WVPE 3LJJA 4Y11E 1RRKA 1HDTH 1DSTA 3RLYH 1QFKH 1SGCA 1UHBB 5ESTE 3RXRA 4FVBA 5AVDA 1IOEA 4JCNA 1LPZB 1PYTC 1PFXC 1L1JA 3ZV9A 5EJZA 1EAUA 1TX8A 2ZFTA 3E0PB 2G5VA 3PB1E 5A0AE 4ABGA 1C2IA 3OFND 1CSOE 3Q3XA 3HK6B 4AFSA 2IPQX 1AE8H 1ZRKA 2BDAA 2R3UA 1N8OC 1TB6H 2O8TA 1P02A 1YGCH 3FP7E 1JOUB 1O3FA 3RUOA 4ABHA 2UUKB 2ZPQA 1OS8A 3AASA 4UFFH 1GJ7B 3KGPA 4XE4A 1K21H 4KP0A 5E0HA 4ASUD 2QXIA 1FLEE 2VWMA 3E1XB 1S81A 4J1YA 1O3KA 4INLA 3RXDA 3M61U 3UFAA 3M3SA 1BBRK 3ZVEA 4KKDA 5LPEA 4ZXXH 3W94A 2WV9A 2HNTF 1KSNA 1MQ6A 4CR5A 4CRGA 1BTZA 3RC5A 1ZJDA 1C2HA 1ELVA 3CS7A 1FNIA 3E3TA 2UUFB 3BTKE 4OS5A 1VCWA 3FANA 3MO6A 4ZCNA 4ZKSU 4JYUH 4NWKA 3EA9A 8LPRA 1Z8GA 4GVUA 3ZZBA 2STAE 4FXGH 1TGNA 4DCDA 3M7QA 3VGCC 1WQVH 1AB9C 3MU0A 1E37B 4P02A 1SQTA 2O8UA 4KELA 1O2JA 3TNSA 2F83A 3CS0A 4Q80A 2BM2A 1W7GH 4OGXA 5GNDA 5PTPA 1K1NA 2BD5A 1V2UT 1FPCH 3KQDA 2WPDD 1C5OH 1TOMH 2XBYA 4IC6A 1AUTC 4E7RG 2A31A 5A0BA 2P3TB 2ZGCA 4O97A 3ZZ5A 1THRH 2PKAB 2IN2A 1GJ9B 1ZPBA 1EOLA 1O2ZA 3TJUA 1EOJA 2QF5A 3AK5A 4IN1A 2QAAA 3PO1C 2FMJA 2ZEBA 3U69H 4Q2KA 3PV4A 4JK5A 2P94A 2AEIH 1U6QA 5HMAA 3QDZB 4H6TA 2FOGA 3VB4A 4X6MA 1K0HA 2BD7A 3FZZA 4NA8A 5C1XA 1CT4E 4IGDA 4YZUA 3VG8A 2P3UB 1WAYB 3ZZ7A 1Z6JH 3O8DA 1O2VA 3P8GA 3N99A 3RXMA 2JH0D 1HAHH 4AORA 2PLXA 5GXPA 1MKXK 4MLFB 1SVPA 3LC3A 4ZMAH 1FPHH 3QX5H 4Q7YA 4VGCB 1S0QA 1HGTH 5T6FA 3RC6A 1F0SA 2QXHA 1EP5A 8KME2 3PV5A 5HYOA 2R9PA 5DKMA 3UR6A 2ASUB 1QJ1B 2A7HA 3GCTG 4D8NA 5FPTA 2GCTB 1P04A 1T8MA 1WTHD 3D62A 5I25A 1W12U 2NU2E 3TK9A 3TLOA 2J98B 3SZEA 3VB3A 2KM0A 2TPIZ 2ZIQH 3NPSA 1KLJH 1JIRA 3KIDU 1OWIA 2XCNA 1LKBA 4JYVH 3OEHD 3RLWH 2L6OA 3ELAH 5GPIB 3P70B 4OS4A 3TIUA 2GZ7A 1Y3XA 2LPRA 2RA0A 2VU8E 4LXBH 1QA7A 3A84A 1F7ZA 1GJ8B 4ABFA 4H6SB 2PKSC 4X1NU 1JMOH 4I33A 1EJAA 2Y7ZA 1SLXB 2OINA 3RC4A 3BTEE 1D3QB 1NFUA 5DN6D 1GBLA 1SKYE 1GG6C 1H8IH 1E34B 1Z7KA 1O2SA 1O39A 2ZPRA 1XUHA 3BG4C 1TLDA 3ODFA 1Y3UA 5DG6A 4K8YA 1PPZA 2BX3A 1P10A 3SV9A 3B23B 1AY6H 2YMSB 3CENA 1QCPA 1YCPH 1ARBA 4RI0A 1F0RA 1ZHPA 1FDPA 2CK3D 2G4TA 4JZDH 6CHAC 2BLQA 1GHAG 1W0JD 2YOLA 2ZDMA 3I77A 2XC0A 4AGJA 4DT4A 3SJIA 1HBTH 1YC0A 1EQ9A 5EGMA 2Y7XA 4RKOB 2VIWA 6GCHF 1D4PB 2Z3DA 4FUJA 1GDQA 2OTVA 1TABE 4CH8B 1BTYA 3OTPA 4ZH8A 1O2NA 2BY5X 3P6ZB 1O2LA 4AZ2B 2M2AA 1D6WA 4U2WA 1UTOA 1O2TA 4FUHA 1LVMA 1ARCA 3RXJA 4BAOB 4B2BA 2PUQH 1DWDH 4NFEA 3FP8E 4JZFH 5FX6A 2WYJA 1GBCA 3DFJA 3TGJE 5TCCA 2KCAA 1ELCA 1G3CA 3MOCA 3QTVH 3RU4D 1F5RA 2GCHG 2Z9GA 3HGPA 1A1RA 4IW4E 2ZU4A 2HLDD 3A85A 2GT8A 1SL3A 3O8BA 5H4IB 3K2UA 3OYPA 1MBMA 2D8WA 1GDUA 2D26C 1DT2A 3PMHB 6ESTA 2G5NA 2P95A 5EPNA 1O5DH 1OWKA 4MTBA 3GISB 5L6NH 1GL1A 1BQYA 4AN7A 4Y6DA 1GBEA 3F3BA 1BRCE 1K1OA 4ISHH 5EW1H 1FMGA 1S82A 1P3CA 3N7DA 3ATKA 4BTTB 3KQCA 3MTYA 1HB0B 1QL7A 3JZ2B 4X6PA 1DVAH 3OAAD 1OPHB 2QCYA 4XDEA 3F9EA 2A7CA 2HRVA 1O2XA 4LK4A 1SFQB 1T7CA 2OLGA 3OEED 3OU0A 1PPFE 1WSSH 4YXWD 4JZ1A 1QJ7B 5C1UA 1WV7H 3P8NA 2IJOB 4UFGH 5C1YA 1A3BH 1SGFA 3QK1A 3GY7A 8ESTE 4IC5A 5SGAE 2Y5HA 2H5DA 3FFGA 2FOMB 3L33A 1N8OB 2J9NA 2Q6GA 4BANB 3E90B 2ZFFH 4BXSA 5EQSA 2EC9H 1GBIA 1O37A 3TH4H 3STJA 2D1JA 2XW9A 3WWFA 1NFYA 1O2IA 2AGGX 3LGTA 1CO7E 3E8LA 5CHBA 2J5UA 1O3GA 4YLUA 1C1SA 3N7EA 1B5GH 1T32A 2JIZD 1C5UA 1FUJA 1BZXE 1S84A 3SBKA 3PWCA 1H9LB 2VIOA 5E0GA 2VIQA 2RDLA 5HM9A 1G3DA 3PRDA 2AYWA 3F9FA 1P2JA 4B2AA 3ODDA 1P8VC 5DO4H 1H8HD 3A8AA 3TVJB 5CDFE 3C1KA 3O8CA 2ILNA 5LH8A 3RXPA 3ZZAA 3ZZDA 1KXDA 1FY3A 3FZDA 3U8RH 3E16B 1GBFA 4CRBA 1GHYH 2A4GA 1K1JA 5T3HA 3A7TA 2ZGXH 1O5FH 3SNAA 1AB9B 4X2WA 2EA3A 1ZSKA 1BT7A 1RGQA 1BIOA 4AG2A 3AW0A 2ZU2A 2V3OH 2ZFPH 1F5KU 1AU8A 2F9UA 3UIRA 3DSGA 3FP6E 1ZSJA 2XNIA 4X8VH 2LELA 3U28C 2LNCA 2F9OA 2M5TA 1A5IA 2PP6A 3RU4T 1P05A 1QB9A 2G52A 3MU5A 2Q1JA 3SJKA 7GCHF 1BITA 1FAKH 4TT3D 4A5TS 3PO1B 2K0QA 4NZLA 1XM1A 1C1VH 3LGYA 4CRDA 1SQOA 2XCFA 2BY6X 2HNTC 2NU4E 1GHWH 1MD8A 2VH6A 4NSYA 2GGVB 1CBWB 1V2MT 4FUIA 2FYQA 3TGKE 1J16A 5IK2D 2UWOA 5JBTA 1F0TA 1FY4A 1TNJA 1W7XH 2HNTE 3M5MA 4OS1A 1BMLA 1ZTLA 3QTOH 4AX9H 2ZDLA 1K1PA 2FOEA 1VCQA 2ZO3H 1GI6A 1SB1H 3NUMA 3SJ8A 1ELDE 5T1VA 3TH3H 1G2LA 2AMDA 1T8NA 1P06A 1VCPA 1UCYH 1HAZB 1NRPH 1QB1A 1ELTA 2RCEA 2EY4C 4B76A 3DFLA 1NTPA 1J9CH 5C3NA 1GI0A 4Y8ZA 1P03A 4X1QU 4ISOA 4TY6A 1DUEA 1EX3A 3GY5A 2BB4A 2O8MA 1C1OA 4F48B 5HIYA 4B1TA 2A5KA 2ZDAH 2QGRA 5DP7A 1C1PA 1SGPE 1SHYA 1QR3E 2XC5A 2FLBH 1DM4B 1HAGE 4GAWA 3SHAH 4X8UH 3QLPH 3LC5A 1E1QD 1QHRB 5GDSH 1A4WH 2FLRH 1BJUA 1T8OA 1V2VT 1KTTB 1LTOA 1MZAA 1HNEE 1DITH 2GDDA 2OCVB 1EP6A 1O2OA 1QRZA 3A7ZA 1PQ7A 3C27B 4DOQA 1BTHH 2BD4A 5F6MA 1RIWC 5FBIA 1MKWK 3DUXH 1ELAA 1MAXA 3E6PH 1RTFB 4GLYA 4Y0YE 4M9FA 1GMCF 1L0ZA 2EI7A 3OSYA 1UCYE 4E7NA 5GIBA 4IS5A 5EODA 2QIQA 4GPGA 1SQRA 1DUAA 2CV3A 2J2UA 2PKSB 3PM3A 4B2CA 1GJ4H 2VVUA 1FAXA 1MU8B 2SGFE 2XBXA 2Z3EA 3LH1A 1E0FD 1MTVA 2GMTC 3OTJE 1W10U 3T27A 5A2MH 1GG6B 5AHGH 3F2GA 1N1LA 7ESTE 4I8JA 2EEKA 1TRNA 3BG4B 1LHDH 3UB0A 3V0XA 3WWBA 9ESTA 1GMDF 2AGEX 2SFAA 3UNRA 2G8TA 5J4SA 2Z7FE 4CR9A 2J92A 3T29A 3KL6A 2GD4B 3SGBE 2I6QA 2CN0H 1XKAC 3OY6U 1TMTH 3BEUA 5LPRA 1O33A 3H7OA 1ABJH 2G51A 1HLTH 4OS2A 2BDYA 3EA7A 3M37A 7GCHG 2VVCA 3SQHE 3TU7H 3B9FH 1TBQH 2XWAA 2ZHFH 3HATH 2HLCA 2FS9A 2ZPSA 4ZKOU 1GGDC 1KYNA 1OX1A 3F1SB 9LPRA 3LIWA 4SGBE 1JIMA 5CHAC 1O3NA 1QA0A 5FXLA 3SV6A 1O2QA 3F2HA 4K1TA 1GPZA 2P8OB 3GYMA 3UQVA 4ACBA 3P92A 5FL7D 3I29A 1O31A 2YMSD 2QF4A 1C1QA 3GS9A 3SJOA 1SGNE 2A4RA 3A82A 3H5CB 4IMQA 1YY3A 1SGDE 4DY7B 3UUZA 2UUYA 2AFQB 3G01A 3PMJA 1ZOMA 4HFPB 4WMDA 1PPHE 1HXEH 1HXFH 1C5SA 1O2HA 3TK5A 1GCTC 1SFIA 1X7AC 3W95A 2A5IA 5IDKA 1ZSLA 1O2RA 3M7UA 2HGTH 3OY5U 4CHAB 3QGNB 2R0KA 3ZVBA 3MU4A 3URDA 3PRBA 1NZQH 1GHVH 2WPMS 2GV6A 4INHA 1ZYOA 2ZKSA 1EZQA 3WW7A 5F8XA 1DX5M 1ZTJA 3TK6A 2B0FA 3BTTE 1LPGB 2BQWB 2ZFQH 4K69A 1FQ3A 4BXWA 3SN8A 2OK5A 1T4UH 1ELGA 4ABJA 1ANDA 4X6OA 3FN8A 4WXVA 2KAIA 1BMFD 1H1BA 4A1VA 4MPVA 2C90B 1P9SA 1V2NT 3MHWU 2VWOA 3NK8A 2BHGA 4AYVB 1O5AB 2F9VA 2R0LA 1GMCG 4E05H 1O3IA 1FN8A 1L1NA 5A8ZA 1F92A 2PKAA 1CVWH 3K9XB 4AG1A 3F6UH 3T28A 1GMHF 4X1RU 4WY3A 1W3CA 1C2MA 1YLCA 4ABDA 1SPJA 2JH6D 2JJ2D 3RXEA 3DT0H 3AVZA 1MTSA 3PMAB 1LPKB 2F9BH 2GVFA 4FETA 1LHCH 1FV9A 2PSXA 2CJIA 3Q77A 5GCHF 5E8EH 2QC2A 2G00A 4NCYA 1V2ST 2ZHWH 5EG4A 1ABIH 4RT0A 3S7HB 1NESE 3RXBA 1WDIA 1SGIB 1QBNA 5DP5A 3EE0B 2V7QD 1FXYA 1XUKA 4A7IB 3GY2A 5E2PA 1DSUA 1KXCA 1TNIA 4TSFD 4ABAA 2FIRH 4DT7B 4LZ4B 1XVOA 2WPJS 2FTLE 4TWWA 1P0SH 2FOFA 1SLUB 4A1XA 2ZP0H 5DJ7A 4CRAA 2FP7B 1GCDA 4NA9H 1DOJA 3M35A 2VIDA 4NG9H 3OX7U 2IOTA 1E35B 2W26A 1SOZA 3FKSD 5JDUB 1FZZA 1M9UA 1W0ZU 2J98A 1QNJA 1EZUC 1WCZA 2OQUA 4AB8A 4GCHF 3RXIA 1W8BH 1C1WH 2A2XH 1XXFA 1LHFH 1C4U2 4RN6A 2CXVA 2BD2A 2KFWA 1UK3A 1LDTT 1MMJN 1KLIH 1Y5AT 2GTBA 2PR3A 2ZECA 2QYIA 5JBBS 1N6YA 1OYQA 1TRYA 4K5ZA 1ZMLA 3KHVA 1EKBB 1ZZZA 2BZAA 3LT3A 1UJ1A 5FBEA 1TRMA 2A7JA 1QIXB 4AFZA 1HAPH 1DE7H 2OC7A 1GBDA 3NXPA 2GZ9A 2QF0A 1BB0B 3LONA 3D65E 3ZVAA 5EOKA 1P2NA 3LGWA 1HRTH 3RM0H 2FODA 1LMWB 2XBVA 2HVYB 1QL8A 2XBWA 1BHXB 5EXLA 5I46H 1VJ9U 4KTCA 2SGPE 3PROA 2HPPH 2CF9H 5C5NA 1S85A 1ELBA 1GBHA 2CHAC 2ULLA 2XWBI 1QZ8A 2PGQB 1C2KA 1D6RA 1GBJA 1NT1A 3SGAE 3SUFA 2GV7A 1CE5A 2WUBA 4KTSA 1AVWA 4ESTE 3Q3KA 3RXKA 2JKHA 4H42U 1GI4A 3ZYEA 3HGNA 1P2MA 1PPCE 1C5XB 5DSFA 3SQEE 4FU9A 1NFWA 3N7OA 2EQNA 5EQQA 1RFNA 4I7YH 1G9IE 1NBMD 2VIVA 1J17T 1RJXB 3SNBA 3MNXA 3A83A 1A5GH 3SI3H 4CBOA 1B7XB 4O3TA 1ZGVA 5AFYH 4DW2U 1SG8B 3KQBA 1N6XA 4BOHA 4UD9H 4WH6A 3MQKC 4Y8YA 3QWCH 2A1DB 1GI2A 2KCYA 4CRCA 5AFZH 2BDHA 1C5PA 1A5HA 1CQQA 3NZIA 5DP3A 1P01A 4FUGA 4MG3A 1ESAA 3V12A 1OP0A 1P12E 2ALVA 3U8OH 3ZV8A 1PQAA 2K1QA 3MO9A 2AIPA 3U1JB 1B0EA 4MPXA 3VB7A 1W0KD 1QY6A 3RXCA 4BAQB 2A2QH 1E36B 3AAUA 4HG6A 4AFUA 1HAOH 1TNLA 3BTFE 3RXFA 1W0YH 1S0RA 3M7TA 3A7XA 3P95A 3RXTA 2ZF0H 1O32A 3SUEA 2JDID 4HZHA 4JZIA 1ACBE 2FX4A 8GCHF 4ABIA 1ZTKA 3S69A 2QE7D 2J34A 4NIXA 1AGJA 1YPHC 3SI4H 1G32B 2AS9A 3VB5A 5FAHA 2CGAA 3P17H 1NRNH 4B6FA 1SHHB 3GCHC 1YF4A 4M7GA 1YPHE 4P00A 4WXIA 2BY8X 1FY5A 1CHGA 3VXEH 1O3CA 2V35A 2V3MA 5HM2A 1A0HB 4X1PU 1OOKB 4FU7A 4CREA 1SGTA 1DY9A 2JETB
chains in the Genus database with same CATH topology
1S83A 2OXSA 1E38B 3QN7A 3SV7A 1O3DA 1GJ5H 2BOHB 1FY1A 5DP8A 5T6GA 1LHEH 2ZNKH 1FONA 1UMAH 1K1IA 1FIZA 1GGDB 1YPKH 1L1GA 1AWHB 4FUEA 1SLWB 5CHAB 1C2JA 3SNEA 2PUXB 1AKSB 3RXSA 3R3GB 2HALA 3IWMA 1T4VH 1QL9A 1C5YB 3M5NA 2EI8A 3A87A 1NN6A 2XC4A 1YCPM 2OBQA 1TNKA 3UPEA 2Z9IA 1LKAA 4Y71A 4K8BA 1THPB 1PPGE 1BJVA 1O38A 4ZROA 2BD3A 1O3LA 1GCTB 2W7UA 2H9HA 1TGCA 1YPGH 4NA7A 1VJAU 1PPBH 1NM6A 3NKKA 5K0HA 4MNXA 1Z1JA 1GI3A 3HK3B 3MFJA 1TX7A 1O5GH 1K22H 1TYNA 3D23A 4K1EA 2ODQA 2THFB 4IN2A 3SORA 1HFDA 2ZTXA 1AD8H 4PROA 1ELFA 2Y80A 4Y79A 4TY7A 3GY8A 1MTWA 3SJ9A 1MTNC 1GBMA 3GICB 3V13A 5DK1A 1DLEA 1VR1H 3GCOA 3UREA 5EW2H 1AI8H 4JZEH 1O0DH 2WPIS 2VVVA 2VINA 2ZI2H 1D9IA 2Z3CA 2H6MA 1ANBA 2GKVE 5FX5A 1C5TA 4H4FA 5CE1A 1MBQA 1BOQA 4I8GA 6GCHG 2WUCA 1IQJA 1QURH 1GVLA 4DG4A 1TBRH 1CGIE 4MPWA 2Y81A 2C8YB 1UVSH 1SR5C 1Z1IA 4LZ1H 4K3JA 4Q7XA 1HAXB 5C20A 1FI8A 4I31A 5HXFA 3K6YA 4MVNA 4NSVA 4XOJA 1C5VA 1G3BA 1GHBF 1MTUA 2FESH 1UVTH 3VGCB 2NWNA 2BMGB 3MNSA 1GI9B 1C1TA 3DD2H 4B71A 1XX9A 1P57B 4ISIH 4ZKRU 4ASHA 2VNTA 1IQNA 1A61H 2TIOA 2YNAA 1UVUH 5FPSA 1Q2WA 5EQRA 1TMUH 1Y59T 2I6SA 1RD3B 4UDWH 2ZQ1A 1KXFA 1OWJA 4X1SU 3RMOH 4Y7BA 1ANEA 1VITF 1AVGH 2C4FH 2GDEH 3UR9A 2ODYB 2QN5T 3SV2H 1HIAB 1AQ7A 3ZZ3A 1NPMA 2ZTYA 4X0WU 1BTUA 2BLWA 1OWEA 3RXUA 1KXAA 4Y10E 2ZGHA 4X6NA 1C2FA 1O2YA 3JZ1B 1EZSC 1V2TT 3QGJA 3U9AH 4ISNA 2WPHS 1C1UH 4R8TB 4Y0ZE 1DANH 1P2KA 3PLBA 2WYGA 5C5OA 2FDAA 4J2YB 4XBCA 1SGFG 3UWJH 1V2JT 4RKJB 1ZMJA 4K2YA 3TJVA 3AW1A 1O5BB 2V0BA 1DXPA 3SU2A 3S9AA 1EPTA 3BIUH 1BBRE 2H2ZA 1CHOF 2SGEE 3PLPA 4D7GA 3UOPA 5FHTA 4UONA 1P2QA 1MQ5A 5LPFA 4BAHB 1Z71A 4WJG2 4NZQA 1O3MA 1T31A 4CBNA 1O2UA 4BAKB 1O3BA 3ZVCA 1EUFA 2BDCA 2FS8A 3EYDA 1TQ7B 1PQ5A 1V2PT 2W3KA 1KXEA 4X8SH 1Q3XA 3H7TA 1YCPK 3ZZ9A 1NROH 4HI3A 4KGAA 1SQAA 3PTNA 1QQUA 2WV4A 2PWXA 1C5QA 2ZDVH 4ZHLU 1XUFA 2GP9B 1LVBA 1ZHRA 2Q6FA 2A4OA 2R2MB 2FEQH 2C8WB 2C93B 2TRMA 4WWYA 1MKXH 2BVRH 1HCGA 1TA6A 1TNGA 2J38A 2OC8A 2A4QA 2A45B 3T26A 5G4BA 2CF8H 1UTNA 4DVAU 1IHTH 3SU6A 4B75A 1HPGA 4TPIZ 1ZR0A 1C5ZB 1TOCB 2NU0E 3BG8A 1AFQC 1O3PB 5DGJA 3ATMA 1CA8B 1SGEE 4BTUB 3RXVA 1PJPA 4I8KA 4X8TH 1XUJA 2BD8A 1Y3WA 4WF8A 3GY6A 2FYRA 1C1MA 4MNVA 1AFEH 2ZGBH 2ZCLP 3ENSB 1QB6A 3QO6A 1DPOA 4X2XA 1UVOA 1DS2E 2C8XB 3MI4A 2PSYA 5BRRE 1DLKB 4THNH 2VIPA 6CHAB 1Z8JB 3EA8A 4ZAEA 2FM2A 4B74A 3PTBA 1HV7A 1EB1H 1UHBA 1OYTH 2BXTH 3WY8A 1VGCC 3GDSA 4MNYA 1AZ8A 4DIIH 1ANCA 1Y3VA 1CA0C 1HJAC 1BRBE 2HVXA 4MQAA 3KNXA 3LGIA 1EAIA 1Y5UT 2BY9X 1QGFA 5EU8A 3BTDE 1A3EH 5DP6A 1BMNH 5F8ZA 3MO3A 4NIYA 3UWIA 1NRRH 2ZU1A 3NCLA 4OS7A 2P16A 3S9BA 3GCHB 1J14A 1AWFH 2SNWA 3MNBA 1ZGIA 1C4Y2 2PHBA 1TPSA 2F9PA 2BLOA 4ZHMU 3EDXB 1LQDB 3BSQA 5ETXA 2PTCE 2PGBB 2G4UA 4CRFA 1MCVA 2AIQA 2Y6TA 5F8TA 2BDBA 1DWEH 4Y7AA 2VGCC 1PPEE 3LU9B 4NIVA 4MDSA 1DWBH 1ZLRA 1NO9H 1SI5H 2BDIA 2ZZUH 2XRCA 3VXFH 4DURA 4ZKNU 1GI7B 1V3XA 1GBAA 2FXRA 4FUCA 2TGTA 1C2LA 3ZZ4A 1KDQB 1XVMA 2UUJB 3STIA 1BRAA 3U98H 3BTHE 1HYLA 4F4OC 1C2GA 3RMMH 2HPQH 1TBZH 1NRQH 3M5LA 1AZZA 2TGDA 3EGKH 1YPMH 1V2KT 3RDZA 2ALPA 2TBSA 1NFXA 1O2MA 3SUDA 3GCNA 1KY9A 3GDVA 2XTTB 3A7WA 4KTUA 2BD9A 2ZU5A 3S9CA 3BV9B 4YOGA 2J95A 2D2DA 5TJXA 4AB9A 5A8XA 2B9LA 1F0UA 4FUBA 5HGGA 3GCTF 3F9HA 3SO3A 1C5RA 1BCUH 2FPZA 3IITA 4Q7ZA 1WYKA 3A80A 1O3AA 1IQKA 1GJBB 1GMDG 4ZXYH 4SGAE 3BN9A 2B5TB 3SV8A 2DE8A 1ZPZA 1HAVB 2BLVA 1H4WA 3MH5A 1UK4A 1G36A 2AGIX 2ZHDA 2F91A 1QBOA 4D9RA 4UFEH 4YOIA 1O3HA 1MTNB 2FZZA 1ZMNA 2SGQE 2PFEA 2SGAA 2VB0A 5B6OA 1BHXF 1O30A 1FY8E 2GT7A 4YOJA 5EXNA 1EATA 1EZXC 3MWIU 4YT6H 1EB2A 1YPLH 2BX4A 1Q31A 4MNWA 3URCA 2TGPZ 2C3SA 1C1NA 1O35A 2FOAA 2F3CE 1PYTD 1TGSZ 3F9GA 4I32A 2YNBA 2Z6BD 4JYTA 3LGUA 1XXDA 1GBKA 2KAIB 2C8ZB 2ZU3A 3Q3YA 3UOUA 3F68H 1LO6A 1IQEA 2WINI 4FUFA 3SOSA 1G3EA 1QTFA 1HJ8A 4YESB 4WMEA 1UCYK 4GSOA 1GHAF 1QRXA 1TPOA 2O8WA 2A32A 1UTPA 3MH7A 3ATWA 4Y76A 2FTMA 3P8FA 4NIWA 5A0CA 2FI5E 2QXJA 1IQFA 1IQIA 4U30A 4Y8XA 3E91A 4U32A 4JK6A 4XFQA 2R2WU 1QQ4A 2FI4E 2VH0A 1D3DB 2B7DH 3A88A 3BTQE 3ZZCA 1ZJKA 3GY4A 3QZQA 1CBWC 2PTNA 1BDAA 1JRSA 4UFDH 1BTPA 2XYAA 2OC0A 1IHSH 1K1LA 1Y5BT 2NU3E 3MU1A 2Z9LA 4D7FA 1VITH 3UNSA 3T62A 1AN1E 3U1IB 2GX4A 1TAWA 1H8DH 2OQ5A 2ZFSA 5CMXH 1CU1A 3A89A 3EAJA 3M3TA 1HUTH 3I78A 5EXMA 4O9VA 3TH2H 1CT0E 4DGJA 1O36A 2V6NA 2P3FH 5GWZA 1GMHG 4UE7H 2GCHF 2PV9B 1IQGA 1GHXH 1P9UA 2BTCE 4FUDA 1YPJH 3BF6H 1BUIA 3RXQA 3TPIZ 4A92A 1KXBA 1K1MA 1MUEB 4INKA 1TONA 5DP9A 1EAWA 5TCAA 4JMYA 1K9OE 4FVDA 1L4ZA 1HAYB 3GY3A 5JBAS 5F03A 1O34A 1EJNA 5GCHG 1UTKA 3LJOA 3RXOA 2AMQA 4U01A 1GL0E 2B8OH 4GUXA 2QA9E 1JRTA 3BIVH 4TYDA 2ZCHP 3ZVDA 1VZQH 3MU8A 2H9TH 2A0QB 1EPTC 2UWLA 4BTIB 3L3TA 1GJCB 4XSKU 2P59A 5JPMH 1ETSH 5JB8S 2XXLA 1W14U 1SMFE 5AF9H 2W3IA 1RIWB 1TWXB 1XUIA 2ZA5A 3MNCA 2ANKH 4ISLA 3RU4E 1GHZA 2DE9A 1GBBA 1GDNA 1GI5A 2BVXH 1P2IA 4IBLH 1DFPA 1LQEA 2ZDKA 1AKSA 5K7RA 1BTXA 1C5NH 1SC8U 2GMTB 3T5FH 1AFQB 6LPRA 1AMHA 1V6DA 1S6FA 1NC6A 3S0NA 2W5EA 1O3JA 4GCHG 2ZC9H 1QBVH 1UTQA 1LCYA 1C2EA 2SGDE 1IQHA 1LVYA 1LVOA 3BEIB 4K1SA 1IQMA 1F2SE 1OKXA 1SLVB 1DWCH 4UEHH 1O2WA 1Z8IB 3V3MA 1Z6EA 2RG3A 2Y5FA 2ZWLH 1MKWH 1G37A 1THSH 1Y8TA 5FPYA 2UWPA 1A0LA 4NFFA 2STBE 2P8OC 1P2OA 1HAIH 5A09A 3SU0A 3A8BA 3MH4A 1VGCB 2FO9A 2PW8H 3UNQA 3HPTB 3ZVFA 1TGTA 1CA0B 1MAYA 1HJAB 1YBWA 1ZHMA 1C9PA 1RTKA 2OBOA 4LOYH 2FOHA 3UTUH 1O3EA 3MMGA 1GJAB 1P09A 2R3YA 3RXGA 1UK2A 4E06H 2V3HH 2Z94A 2HOBA 3Q00A 3T25A 1W13U 3U8TH 1G2MA 3M36A 1ETRH 1MU6B 1MCTA 2OD3B 3RXHA 1FJSA 1ESTA 1V2QT 1C2DA 1KLTA 2TGAA 2ZG0H 3V7TA 4CHAC 3M5OA 2BOKA 3A8DA 3FVFB 2G81E 3BEFB 2CMYA 1ZPCA 5ESBA 3L6PA 1H9IE 1P3EA 3LPRA 1SGRE 1WQSA 7LPRA 1Z8RA 1YKTA 3Q76A 2BXUH 3GDUA 1BA8B 4BAMB 3PWBA 1A7SA 1NU7B 2EI6A 5JYIA 3KF2A 2G55A 3UY9A 3SHCH 1GJ6A 3BTME 1SSXA 2VGCB 3DHKH 4YLQH 3SNCA 2RA3A 2FOCA 1A0JA 1T8LA 1INCA 1GWAA 2AERH 5LGOA 3UQOA 3K65B 1SGYE 2WPLS 3TJOA 5ABWA 3QZRA 1ETTH 2FI3E 3T2NA 1BTWA 4WH8A 3VB6A 1WOFA 3RMNH 3KCGH 5E0JA 7KMEH 1A2CH 1YP9A 2WPKS 1LHGH 1ESBA 2Q6DA 1S5SA 4IMZA 3LGVA 2BVSH 1TGBA 2ZCKP 3SU1A 2Z9JA 1O2KA 3VFEA 1C5WB 3TITA 2BYAX 1PQ8A 4A6LA 3ZYDA 1HIAA 1GI1A 3GOVB 4ABBA 3PYHA 2ZTZA 1OSSA 2J4IA 1EXFA 8GCHG 1JWTA 1GVZA 1EASA 2F9NA 1F5LA 1L2EA 1RTLA 3SU4A 1OWHA 1V2OT 5E2OA 3SNDA 1TX6A 5A8YA 2H5CA 1GVKB 1MZDA 2Y5GA 3TGIE 4I8LA 4Z0KA 2FWWA 2FOBA 2Z9KA 3DA9B 1D3PB 1YM0A 1D3TB 1SBWA 2A5AA 1YYY1 1XKBC 1TNHA 1TE0A 4QT8C 4K60A 3RMLH 1BBRH 3ZZ6A 4RSPA 1A46H 2P93A 2HWLB 2OC1A 2BQ7B 1DXWA 2H9EH 4F49A 1JBUH 4TPYA 4A1TA 3S7KB 1O5EH 4DIHH 1SOTA 1XMNB 2QF3A 4YTAA 5L2ZH 2ZHQH 4WMFA 3KN2A 1FN6A 1G30B 4GHTA 1AIXH 3SU3A 1DY8A 4FU8A 5T6DA 3SZNA 3RXLA 1C5LH 3SUGA 5C2ZA 3E0NB 3EQ0H 4D9QA 3A86A 1OP2A 2H1UA 4OGYA 4CH2B 4D76A 1UTMA 1QRWA 4VGCC 4DJZB 4MPUA 1UTLM 2GZ8A 3VPKA 3ZZ8A 3VEQB 2ZGJA 1OWDA 2SNVA 1DICA 1RXPA 1XUGA 2OP9A 1ORFA 2GCTC 3PLKA 2Y82A 1GJDB 1QJ6B 3ITIA 2O9QA 2OUAA 4XBBA 1AE5A 5DPAA 1WUNH 1ZRBA 2ZFRH 2ANWA 2WV5A 1OXGA 3MH6A 2ANMH 1BRUP 1WTGH 1O2GH 2NU1E 1IQLA 1WBGB 1GBTA 3A7YA 4YO9A 2QY0B 3HKIB 1NRSH 2ESTE 1SGQE 1JXPA 1UTJA 4ZHAA 1BMAA 1IAUA 1NS3A 4ZUHA 3IG6B 3M3VA 2DUCA 4NWLA 4OS6A 1HJ9A 1NU9A 3LDXH 1EAXA 2CHAB 4HGCA 5L30H 1CGJE 1AUJA 1UO6A 3KQEA 3KEEA 5GJ4B 1K28D 3D49H 1W11U 2ANYA 3QUMP 5J4QA 5JB9S 4O3UA 1MD7A 1TPPA 3A8CA 1TQ0B 3P8OA 1TA2A 4GHQA 1BMMH 3HKJB 5IYTA 1W2KH 3R0FA 1TIOA 2BDGA 2J94A 3LOXA 4NGAH 1C1RA 1C5MD 1NY22 5FCRA 1YPEH 1GHBG 4AYYB 3A81A 4YT7H 1Y3YA 1MH0A 2ZHEH 2FX6A 3CP7A 1UVPA 3BTGE 2ZDNA 3K6ZA 1EPTB 3ATIA 4HTCH 3O8RA 3SU5A 5L2YH 4AOQA 2VWNA 3ESTA 1AHTH 1DDJA 5C67A 1KIGH 1L4DA 5BPEA 5DP4A 1KTSB 3SW2B 1VITG 4O03A 1K2I1 3GYLB 1FIWA 4AFQA 3RM2H 2W7SA 1YLDA 1C9TA 1S6HA 3A7VA 1P11E 1J8AA 1TPAE 4TWYA 1C4V2 2AH4X 3RXAA 3FAOA 1TMBH 2O8LA 1KDQA 2JH5D 4X2YA 4Z6AH 2BQ6B 1V2LT 1CT2E 2JETC 1B0FA 1V2WT 2ODPA 2VWLA 1WU1A 2IPHA 3MYWA 1EJMA 3BTWE 3TNTA 4R0IA 1CHOG 2BZ6H 5JBCS 3TJNA 5FCKA 3AAVA 4YM9A 1O5CB 3RP2A 4AGKA 1TFXA 3LH3A 1OP8A 4X2VA 1GI8B 1O3OA 2QXGA 3LKWA 1H9HE 1V2RT 4ABEA 4B73A 2BY7X 1AO5A 1ELEE 1O2PA 1HAVA 2VJ1A