4NWLA

Crystal structure of hepatis c virus protease (ns3) complexed with bms-650032 aka n-(tert-butoxycarbonyl)-3-me thyl-l-valyl-(4r)-4-((7-chloro-4-methoxy-1-isoquinolinyl)o xy)-n-((1r,2s)-1-((cyclopropylsulfonyl)carbamoyl)-2-vinylc yclopropyl)-l-prolinamide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
194
structure length
194
Chain Sequence
KGSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVESLETTMRSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and Early Clinical Evaluation of BMS-605339, a Potent and Orally Efficacious Tripeptidic Acylsulfonamide NS3 Protease Inhibitor for the Treatment of Hepatitis C Virus Infection.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HCV NS3 1a Protease
total genus 50
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nwlA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4nwlA01
1GBMA 4FUGA 3P6ZB 2HWLB 3M3TA 1BTYA 3TH2H 1AUJA 1UTPA 2SFAA 2Q1JA 1KDQA 4UONA 4ASHA 1LKBA 2OBOA 4ABFA 4TYDA 1FN8A 3L3TA 4CH8B 3UREA 1D3QB 3SUEA 2VIQA 1GI3A 2VVVA 1GCTB 5EGMA 2O8WA 1GMHG 4NGAH 2OC8A 1A61H 1HAOH 4RKJB 2QA9E 1FPCH 1O3EA 1W13U 4XSKU 1AU8A 3GOVB 1DX5M 5GCHF 1JBUH 1MKWH 4AYYB 5J4QA 1LDTT 2KAIB 3M5MA 5JB8S 2H6MA 1TGCA 1ZTKA 1TNIA 4RKOB 1GBHA 1O2ZA 3Q3YA 1HAIH 2XYAA 3TK5A 1O3KA 5FXLA 6LPRA 1QGFA 1ZSLA 2GT8A 1H9HE 3M7TA 1LHDH 1OSSA 2AGGX 1V2PT 5T6DA 1ETRH 2Y81A 1JIMA 2A7JA 2PR3A 1TRMA 3OY5U 5LPRA 5A8XA 1EXFA 1SPJA 4LZ4B 5C1UA 1TB6H 3UWJH 1LQEA 2XXLA 1J9CH 2G4TA 1YC0A 1QJ1B 4Q7YA 3M3SA 1NFYA 4ZKNU 4AB9A 2W3IA 1SLUB 3F1SB 3MNCA 3ZVBA 1TRYA 3HK3B 4JK5A 1C5OH 1THPB 2BDAA 1ZGVA 1P03A 1J17T 2WV4A 2ZWLH 4X8VH 3QK1A 1IQGA 4A1TA 3MWIU 1YPKH 2QCYA 1AUTC 3PTNA 4K69A 1VITH 2G55A 3AASA 2FS8A 1WU1A 4B71A 3LGUA 3PMHB 3MU0A 2FI3E 1A7SA 3LGWA 3QWCH 1SB1H 1O3AA 1YPMH 3LJOA 2ZTZA 1V2VT 3SV7A 4MQAA 1E36B 3CENA 2OLGA 4JMYA 3B9FH 1O2RA 1SFQB 3H5CB 2W3KA 3M7QA 3VXFH 5ABWA 1DXPA 3SJ8A 4B2CA 1EJNA 6GCHG 1VITG 3HPTB 2B7DH 4A1XA 2V6NA 4ZXYH 3KN2A 1AFEH 1EAIA 3DHKH 4K8YA 1C2HA 2FWWA 5T6FA 2J9NA 1O3BA 2FX6A 4XBBA 4JCNA 3RUOA 1Y3UA 3UR9A 2GT7A 2M5TA 1QBOA 1S0RA 1GMHF 1YGCH 2WINI 3A8AA 3PMJA 3ZZ9A 6CHAC 3PROA 5AVDA 1EZUC 4ESTE 1RS0A 4FU7A 3GY6A 1YPHE 4AZ2B 3TJUA 3MHWU 1O2XA 4HTCH 2QN5T 1SLXB 1YM0A 2FMJA 1T8NA 3MTYA 3BTEE 4M7GA 1GWAA 2GCHF 1FJSA 4O9VA 4NIXA 3BTWE 3ITIA 1BMMH 2EEKA 1HAZB 3RXFA 3ZYDA 2PHBA 3K2UA 4Y7BA 1DT2A 5C3NA 2PKAA 3G01A 1KXCA 1NRPH 4AG2A 1BRUP 3WY8A 1TGSZ 2OC1A 1K1OA 1BRAA 4H6TA 5E0HA 4NWLA 1K1NA 1HBTH 1UTMA 2P59A 2SGPE 1GHVH 4OS4A 4CREA 1ZSKA 1BITA 4CRAA 4JZDH 2VGCC 1O2YA 1ELFA 4F4OC 3UR6A 1P2JA 5EW2H 3Q3XA 3S69A 1BZXE 1WV7H 1GI9B 1GJ8B 2CJIA 1SGEE 1D3DB 1TBZH 1TMBH 3TK6A 4Q80A 1C2MA 3QX5H 2Y7ZA 5CHAB 2G8TA 4IC5A 5C20A 3OTJE 4WH8A 4GVUA 4TWYA 2ZU3A 3S0NA 3MO6A 4LOYH 1J14A 2G51A 1ORFA 4ABEA 3W94A 1WSSH 1DLEA 2FDAA 2HNTF 4U32A 1K21H 1AZ8A 2BDCA 1C1PA 1A5GH 1RTKA 2AIPA 4CBNA 4MLFB 3E16B 1XUIA 2QGRA 5DGJA 2QXHA 2P94A 4D7GA 2R3UA 1QBNA 2QIQA 3ZVEA 2AGEX 1S6FA 1C2GA 2TGPZ 4ISNA 1C2FA 2AMQA 3P95A 1T4VH 1BBRK 3I78A 1IAUA 1UK3A 2F83A 3U8RH 3K6YA 5JBBS 1C5VA 1IQFA 5JYIA 3SV6A 2J95A 2Z94A 2ZO3H 4MDSA 3TK9A 4F49A 2FEQH 2GTBA 2V3HH 2ZIQH 1LVBA 2TIOA 1O38A 2R0KA 2H5CA 3B23B 1JWTA 1YPJH 4NFFA 3EDXB 2O9QA 4ZKOU 4I31A 1B0EA 1TFXA 1LTOA 3RMNH 1A3EH 1TNHA 4E7RG 1P3EA 1HXEH 4D9QA 3ZZ7A 2G00A 5EXLA 2ZGJA 2GP9B 2C8WB 2TBSA 1UMAH 4H6SB 2PW8H 2GX4A 3QZQA 1C1QA 3A7XA 1HDTH 2ZCLP 1T32A 3PMBB 3VB4A 1C2JA 1MKWK 2H5DA 3BEUA 3P8NA 3U69H 1ZMJA 2A5IA 1P2OA 2BM2A 1HAVB 1NC6A 1ZHPA 3GCNA 4AFQA 1NFUA 1C5NH 1G37A 4ZROA 2VWOA 2ZU5A 3O8RA 4Y71A 4NSYA 3TPIZ 4TY6A 8LPRA 3LGIA 1C4V2 1O3OA 3M61U 2F9OA 1JOUB 1XM1A 1HFDA 1V2KT 2BY6X 2PGQB 1ANDA 2HPQH 3JZ1B 2W26A 3Q77A 1BRBE 4CH2B 1QFKH 3P92A 2UWLA 2XCFA 2PV9B 1PYTD 2GZ8A 4X2YA 2BX4A 1LHFH 1ACBE 1NESE 4FUCA 1UK2A 1RIWC 2QC2A 3EYDA 1C5SA 1BCUH 2LNCA 2NWNA 2B8OH 1LMWB 1O5CB 3M5NA 5CHAC 4IN2A 5F03A 4GHQA 1HAXB 2EA3A 1OWJA 3TITA 1RRKA 1C1TA 4OS2A 1LPGB 3RXLA 3NPSA 3ZVGA 1MTWA 1O2IA 1MU8B 5I25A 2LPRA 2PTNA 1GJ9B 3GCHC 1L4ZA 5FHTA 4OGYA 4ABJA 1OP8A 3GYLB 2ODPA 2IOTA 5AHGH 1SGRE 5A0AE 2QXJA 4FUBA 3RMLH 2KAIA 2BDHA 3OY6U 1K2I1 8GCHF 1Z1IA 4FUHA 4X6PA 4B76A 3T2NA 1YLDA 1AO5A 1GVKB 2ZFPH 3KL6A 4KTUA 5HMAA 3P8FA 4FXGH 3DD2H 1VCWA 2C8XB 3LU9B 2F3CE 4AFSA 1W8BH 3ATLA 1PYTC 1RTFB 3PM3A 4GCHG 2J2UA 7KMEH 3QZRA 3SW2B 1QRWA 1C5TA 3BG8A 1MZAA 1EQ9A 3Q3KA 1CU1A 5HM2A 1ELTA 4Q2KA 1PQ7A 4OS5A 2PKSB 1FNIA 4X8TH 1HIAB 2ZECA 1TBRH 1GI0A 1PPGE 4AOQA 1LPZB 2J92A 1SG8B 2VH0A 4B75A 3S7KB 2BY5X 2ZHEH 1G2MA 2ZPRA 2EI7A 1GBTA 4ABBA 3RLYH 2CGAA 3HGNA 1NU9A 1Q31A 2VINA 1THRH 2FTMA 1ZPBA 1J8AA 4IC6A 1YCPK 2ZCKP 4INLA 1UHBB 2WV5A 2IPHA 1CVWH 1FZZA 3GY4A 4AX9H 5A8YA 2ZQ2A 4TY7A 3ENSB 5FAHA 1W11U 1Z8IB 1L4DA 4NCYA 3RXUA 1O5FH 4DY7B 3HK6B 2F9UA 4RSPA 5HYOA 2ESTE 5LGOA 5A8ZA 1SC8U 1ANEA 1A0LA 1V2NT 5TCAA 3D62A 1F2SE 4KTCA 2BDYA 1AWFH 4LK4A 1BUIA 1TOCB 4BTTB 3BIUH 1HGTH 3P8GA 4X8UH 4BAKB 1XKBC 1C1UH 3SI3H 5EOKA 2HNTC 1C5WB 3HKJB 3NWUA 1OP0A 3FP8E 5DPAA 3C1KA 2G4UA 1SBWA 1RTLA 4DIHH 2OD3B 5F8ZA 2Z9IA 4WVPE 3NCLA 1DWBH 1BTXA 1GMCF 3F68H 3HGPA 2SNWA 4UDWH 2BY8X 2XC5A 1Z8JB 3SU2A 3FP7E 4MG3A 1S82A 2EI6A 3IG6B 4ZHLU 1BB0B 2VGCB 2FODA 3BSQA 1JMOH 4O3TA 2F9VA 3ZVCA 3QTOH 4MNVA 3A7YA 2FS9A 4I8JA 3P17H 4FUFA 3P70B 3MO9A 3VB7A 2PTCE 2HLCA 2UWOA 5EU8A 3EA9A 2YNAA 1O2NA 1C5PA 1S84A 2XBYA 3KCGH 3NUMA 1DLKB 1TE0A 3RMMH 1FY5A 1EUFA 1OS8A 1WCZA 4E06H 3L6PA 2ZI2H 4JYTA 3SZNA 3A82A 1GBFA 2Z9GA 4NA7A 4MNYA 1S0QA 2ZHWH 1OWEA 1HJAC 4OS7A 2AH4X 2CF8H 1PPHE 5FBEA 1UTOA 1UVOA 3RXBA 3U1JB 3IWMA 1N8OB 3ESTA 3BTQE 4DT7B 1GHBF 2BD8A 4WXIA 1P57B 1W2KH 2J34A 1GBEA 5JB9S 3K65B 3RDZA 2CF9H 3BEIB 2XWBI 1W7XH 1O3CA 3UPEA 3RM0H 3VFEA 3GDVA 3GDUA 1QJ7B 1ZMLA 3U9AH 5A09A 1CO7E 4BNRA 1GGDC 1THSH 5JBAS 2GZ7A 5DP8A 1FY4A 1NU7B 1TAWA 5L30H 1LQDB 3ATIA 2FI5E 3QUMP 3ZYEA 1OWDA 5EQRA 1P2NA 3RXSA 1VJAU 1Y8TA 1H9IE 3RM2H 1MQ6A 1Z71A 1S85A 1W10U 3DUXH 1FY3A 2BX3A 1DSTA 2Y6TA 3NZIA 3RXKA 1C1OA 3MO3A 1ETSH 3TGIE 5A0BA 1VGCB 2CV3A 4H42U 1BIOA 2RDLA 2XCNA 1ANBA 3KIDU 3EAJA 5TJXA 4DG4A 4MTBA 1QQUA 5JDUB 5HXFA 1Z7KA 3RC5A 3MH5A 4ABHA 2F91A 3E6PH 1GJ7B 2VJ1A 2ZA5A 3CP7A 1G2LA 2FIRH 2XBWA 3ZZ5A 1QRZA 2STAE 3SNAA 2BOKA 4IMZA 3BTFE 1ZZZA 1AWHB 2P93A 4Y6DA 3K6ZA 3W95A 1O34A 1U6QA 1Q3XA 3ATWA 3LH3A 3ZZ3A 5T3HA 4DVAU 4Y0YE 4MNXA 3VB5A 1QTFA 2A4RA 5L2YH 1GI5A 1TGTA 1F0UA 3VXEH 1DUAA 4SGBE 4R8TB 1NFXA 1F5KU 1XKAC 4XBDA 2OQUA 1KLIH 4XE4A 3RXJA 3ZZ6A 4AG1A 2P3FH 5HGGA 3GYMA 1GHWH 1CA0C 3HATH 1WQSA 1UVUH 2O8LA 3LDXH 1QCPA 1BRCE 2BLVA 2QXIA 3UOPA 1D3TB 2Y7XA 1N8OC 1GGDB 4FUDA 1KTSB 1GI2A 1YPGH 2THFB 2VWMA 2YNBA 1NO9H 4ISIH 2J94A 1HJAB 4CHAB 1T8OA 5K0HA 5EPNA 3RXRA 1H9LB 3D65E 1C1SA 4ABAA 1EAUA 1N6YA 3M35A 1W14U 4MPUA 1EPTA 1L2EA 1PQ8A 2BZ6H 2VIPA 2FI4E 2BMGB 2O8UA 4AFUA 1AY6H 4I32A 4A6LA 4X2VA 1Z6EA 4Y0ZE 4ZKSU 5DP9A 2VWNA 1V2LT 2ZNKH 4K2YA 1SGPE 1ZSJA 1YPLH 3V0XA 1O39A 3LC3A 5F6MA 1LVMA 1Y3VA 1UJ1A 3ODDA 1O3PB 2UUJB 1SGTA 4ZXXH 4DGJA 4UE7H 2FOFA 5C5OA 1KSNA 1P05A 3S7HB 2BXTH 1XUJA 4Y79A 3AAVA 1AZZA 5JPMH 1O2JA 1PPBH 2XC4A 2Z3DA 1BHXB 2XBXA 1DE7H 1S5SA 4ZKRU 2HALA 4D8NA 1TABE 3QO6A 2WPMS 1VCQA 4YESB 4BTIB 1MTVA 1SFIA 2FTLE 4U01A 1Z1JA 3V7TA 3RXOA 5FX6A 3RXIA 1NRSH 1ZLRA 1KYNA 3KF2A 1ZR0A 1RXPA 1ZOMA 2V0BA 2FZZA 1BHXF 5LPFA 1EATA 3ZZBA 1AKSB 3KNXA 3E90B 4K1TA 3LIWA 1SSXA 4KGAA 4VGCC 2A5KA 1ABIH 4Q7ZA 1IHTH 4FUIA 3OTPA 1BT7A 3QGNB 5DO4H 2PUXB 3O8BA 1FIWA 2RCEA 1J15A 5C1XA 1V2ST 1GJDB 3TJNA 2BLOA 2ANYA 1DPOA 1XXDA 2H9HA 4AB8A 1A4WH 2ZDNA 1GJ5H 1WOFA 5F8TA 2AERH 3SNEA 1GMCG 3A83A 1ESTA 5EODA 3RP2A 4ISLA 1TBQH 2ZQ1A 3GY5A 5SGAE 3JZ2B 1IQLA 4XBCA 2G5NA 3PB1E 3ZZ8A 4GCHF 5E0GA 2FP7B 4MPXA 1HB0B 2PKAB 2I6QA 3S9BA 1DVAH 1BMLA 2ZFTA 1P10A 2ZHFH 4NZLA 2VIDA 2OXSA 1TA6A 1C5LH 2ZHDA 3KQDA 2B5TB 4OM9A 1IQMA 1V2OT 2PFEA 2PKSC 2BB4A 3SGQE 1OX1A 1MH0A 3BTGE 3UTUH 1DOJA 3A7TA 3BG4C 3PO1B 1MTUA 3AW1A 1LVYA 2CHAC 4AORA 2ANMH 5DP7A 3MU5A 1A1RA 3EA8A 3FANA 1A46H 7GCHF 1RFNA 2BVRH 1S6HA 1O2QA 3QDZB 3BTHE 1MTSA 2O8TA 5GWZA 4J1YA 1P01A 1H1BA 1D4PB 3LPRA 1AVWA 5A2MH 1K9OE 4IN1A 2Z6BD 1EZQA 3A80A 2WPHS 2FOHA 1O2WA 1MCTA 2XWAA 3A85A 2XTTB 1FLEE 1UCYE 1ELCA 3PTBA 1GHAG 4ABDA 2OQ5A 2GCTC 4JZ1A 1NT1A 2GDEH 1KTTB 3GY8A 4CR9A 1Y5BT 2GGVB 5I46H 2SGFE 2F4LA 1P9UA 2BQ7B 2AFQB 1O3LA 2FX4A 2ODQA 5IDKA 1CHOG 4SGAE 2D26C 1IQJA 1OWIA 1SGYE 3SNBA 3ELAH 1CT4E 1VITF 4NIWA 4O97A 1ZHRA 4GAWA 1QA0A 1DFPA 5FX5A 4HGCA 4YTAA 2GMTB 1GJBB 4HFPB 1PPFE 3MFJA 1MU6B 2ZDVH 2A1DB 2ZFRH 2R9PA 1TMUH 1PFXC 1EZXC 1SQAA 1KXFA 3PV2A 1DY9A 1IOEA 4I8GA 1AD8H 2RA0A 4IW4E 1V2UT 1GDQA 3UQOA 1GJ4H 3MOCA 2Z3CA 1UVTH 1AFQB 1EPTB 2FOAA 2Z9KA 1GVLA 1O33A 2BDGA 3RXDA 4UFEH 2FOEA 2QY0B 3PLPA 2H9TH 1JRTA 1RIWB 1LO6A 1JRSA 3MH4A 1EJAA 2A31A 3P8OA 3F9EA 3BIVH 1GBDA 4Y8XA 1FY1A 3UNSA 2UUYA 1AI8H 1F7ZA 1O30A 5FBIA 2FLRH 4K8BA 1VCPA 1O32A 4I33A 1TX8A 4WH6A 1HV7A 5EG4A 1QA7A 1TNJA 2HRVA 3UNRA 3UIRA 3EA7A 4FVDA 4M9FA 4BXWA 1O3FA 1BMNH 2PSXA 4IBLH 2AEIH 1XMNB 2BYAX 1ELDE 4YOIA 3M36A 5GPIB 1FONA 3A84A 2PWXA 3I77A 3RXAA 2GDDA 2R3YA 2Y5HA 4ZAEA 2GCTB 2XBVA 3OX7U 4FUEA 1BTZA 3GICB 4AN7A 1FQ3A 1XUFA 2A4GA 1LCYA 1T7CA 1TQ7B 1HAHH 2Q6GA 2RA3A 1M9UA 2FOBA 4Z6AH 1QRXA 2AYWA 2AMPA 3V12A 2OC0A 1CA8B 2BD5A 3BV9B 3EQ0H 1TONA 1GVZA 2H1UA 4ZMAH 2ILNA 1DWCH 1QURH 4CRFA 3T26A 2WUCA 1FDPA 5E0JA 1FV9A 2IJD1 2Y80A 3SN8A 4WWYA 3F9GA 5EQSA 1GG6B 1CGIE 3T29A 9ESTA 3AVZA 4Y8ZA 6CHAB 1D3PB 3MH6A 1SHYA 2BY7X 1HJ9A 1G3CA 1K1PA 1O3GA 1TPPA 3SU6A 1O2LA 2FM2A 2HNTE 4UD9H 1EB1H 1FUJA 4D7FA 2ZDKA 2W7UA 1DSUA 1W0YH 3SUFA 2CMYA 1O2SA 1BTPA 1GBBA 2Y82A 3A8BA 2VNTA 1NM6A 1OWKA 1QR3E 2V35A 3DFLA 1O2TA 1Z8GA 1P0SH 1G3BA 4IMQA 2FYRA 3LOXA 1UCYH 1ANCA 1BDAA 5DP5A 1OPHB 3T27A 1FN6A 3GY2A 1GBAA 3A89A 1E35B 2ZU4A 1C5XB 1L1GA 1DXWA 1YKTA 2BVSH 4JYVH 1H8DH 1L1NA 1Y5AT 1TPSA 1TLDA 1AB9B 3RXGA 1O2GH 1EOLA 2H2ZA 1C2EA 5C1YA 1BJUA 1ESBA 2P95A 4A7IB 4FUJA 2BVXH 3OSYA 1SGFG 3BTDE 1L1JA 2AGIX 3PV5A 5B6OA 4JYUH 1UHBA 3MU4A 1QL8A 3LH1A 2A32A 1EX3A 2EI8A 3SGBE 1A5HA 2ZGBH 4GSOA 4I8HA 4UEHH 4INKA 1FIZA 3MU1A 3U98H 1F0RA 2A5AA 8GCHG 1GDNA 1C2IA 4NG9H 1MUEB 2G81E 5BPEA 1SLWB 3TGKE 4GUXA 4BTUB 3TVJB 4OS1A 1NY22 2NU4E 1P3CA 2D2DA 2JH5D 3U1IB 3UUZA 3ATKA 3SU1A 1YLCA 2ZDAH 1P2IA 3MNSA 1OP2A 3O8CA 4OS6A 1LHEH 2IJOB 3U8TH 9LPRA 1QIXB 2P8OB 5GCHG 2ZCHP 5G4BA 1O31A 1GMDG 1GHAF 1O3JA 1OYTH 3E1XB 4OGXA 1GHYH 5EW1H 1G3EA 3MH7A 1ELEE 2J4IA 5EXMA 5ETXA 2ZFFH 4YOJA 2NU1E 2NU0E 3AW0A 3ZZ4A 1O37A 1MMJN 2ZP0H 5BRRE 1ZPCA 1K1JA 1XXFA 1CHOF 4X6NA 1XVMA 3SJ9A 1UVPA 1P09A 1UTKA 1SGFA 2P16A 3ZV8A 4BXSA 3R0FA 1O5AB 4K1SA 2AS9A 1GBLA 3LC5A 1ZTLA 3SU4A 2Z9LA 1E38B 3DT0H 1MTNB 1IQKA 2VVCA 1O5EH 2TGDA 2BZAA 2HVXA 5FCRA 1ZPZA 3OU0A 2QYIA 2BY9X 1O2KA 4D9RA 2ZDMA 7GCHG 1MTNC 2J38A 1PQ5A 2BLQA 3BTME 3SO3A 2CXVA 1CA0B 2GVFA 1EZSC 3UWIA 1X7AC 3A7VA 1QL9A 2WZQA 2PGBB 1CSOE 3B8JA 1BJVA 4XDEA 2TRMA 1TNGA 4INHA 1LPKB 1V2RT 4ABIA 4YOGA 3A87A 1XUKA 1CQQA 1ZRBA 2FLBH 4B73A 1RD3B 1N6XA 1SOZA 3L33A 2ZDLA 1B0FA 2GD4B 1WBGB 1IQIA 4CRGA 1HAYB 2SGAA 3U8OH 1HUTH 4NSVA 1JXPA 1HJ8A 3RC6A 2ZU1A 3GY3A 2ZZUH 2FOCA 2SGDE 1EB2A 1V2MT 4BAMB 2P8OC 5EQQA 2ZC9H 4TPIZ 4X1RU 1DUEA 3DFJA 4YLQH 1GI8B 1ID5H 1EASA 1ZYOA 1F0SA 1MD7A 3RC4A 4X6OA 2A2XH 1EP6A 1GJCB 1NRRH 1TNKA 1XUHA 1DWDH 2WPIS 1AE8H 2A4OA 4BAQB 1CT2E 3LONA 3T5FH 1PPZA 4WJG2 3SJOA 1QB9A 3KQEA 2C93B 4BANB 4WMEA 4RI0A 4HZHA 1C5QA 1P02A 2I6SA 2GCHG 4KTSA 1V3XA 1DITH 4AYVB 3S9AA 2BD9A 1NZQH 4XFQA 4K5ZA 2STBE 2ZTYA 1O3DA 2BQ6B 1C4Y2 5IYTA 1EKBB 3QLPH 4WXVA 2R2MB 1IQEA 1DDJA 1VGCC 1AHTH 2BHGA 3KQBA 1MAXA 1BMAA 3VGCB 2ZF0H 3M37A 4O3UA 4WY3A 1AKSA 3A8CA 2ZFQH 3ZVDA 2W7SA 1JIRA 1OWHA 1DICA 3EGKH 1O2OA 4CHAC 4IS5A 2JH0D 2WPLS 3TNTA 5CMXH 4IGDA 1O2PA 3TH3H 4DOQA 5EPYA 2BDBA 2BLWA 1ESAA 2PSYA 6GCHF 3A7WA 5E2OA 4GHTA 1QBVH 3O8DA 4THNH 1BBRE 1O5BB 2JETB 3GCTF 1IQHA 1RJXB 2K1QA 4WMDA 1BA8B 2C8YB 4O03A 4DURA 1K1MA 1ZMNA 1YBWA 1QQ4A 1A3BH 2Y5GA 1TALA 1SHHB 8KME2 2WPKS 3VGCC 5TCCA 4UFGH 4WF8A 1GG6C 4R0IA 4MVNA 5DG6A 3RXMA 1KDQB 2UUFB 1DWEH 1NTPA 4PROA 2SGQE 1CE5A 2EC9H 3A81A 2JKHA 2GZ9A 3E3TA 4K1EA 4NA9H 1WYKA 4NFEA 1UTQA 2OP9A 5LH8A 1EJMA 1C5UA 4YLUA 1DANH 1Y59T 2UUKB 1E37B 1GL1A 2QF0A 1VJ9U 4JK6A 2WYGA 3SV9A 1RGQA 3GCTG 3H09A 2Z9JA 1KXDA 4I8KA 1MCVA 4YT6H 5DP3A 3SV8A 5CE1A 3SU5A 1TMTH 3SZEA 1WTGH 2AIQA 1GI1A 3E0PB 1E34B 2BD2A 5J4SA 3SI4H 3SU3A 5JBCS 2OK5A 2O8MA 4YM9A 4X2XA 3VB3A 1SL3A 1C1RA 1GHBG 2IN2A 4MNWA 3PWBA 2ZGXH 3PYHA 1OOKB 1WUNH 1P2QA 1C9TA 1YP9A 3IITA 4DCDA 1BTUA 4X8SH 4JZFH 1AIXH 1SVPA 2BD4A 5PTPA 2ZFSA 1O2UA 1NS3A 1QL7A 1LHCH 2R0LA 5GDSH 1GHXH 1O0DH 3ODFA 4B2AA 1J16A 3FP6E 2FYQA 1ABJH 1C1NA 2VBCA 1SGNE 1E0FD 1HAVA 1W0ZU 2A7HA 1C4U2 2F9BH 1SGCA 2DUCA 5E8EH 1DM4B 1QY6A 1WQVH 1KXAA 1CT0E 4Z0KA 4AFZA 2OINA 1O5DH 1HAGE 4NZQA 4X6MA 1GCTC 5F8XA 2D1JA 4MPVA 1EAWA 2QXGA 3EE0B 1NN6A 4DJZB 1EP5A 3HKIB 4YZUA 1C5ZB 2GMTC 5E2PA 2C4FH 1V2TT 1MKXK 3CS0A 4J2YB 1W12U 3FFGA 3KQCA 4B1TA 1GL0E 3V13A 5ESBA 4K3JA 4B6FA 1FAXA 4YO9A 1C2LA 2QF3A 1Y3XA 1ELVA 2FESH 4ZHAA 1F0TA 4ISHH 1HYLA 2ULLA 3LKWA 2ANWA 3STIA 2VIWA 2C90B 3T28A 3BF6H 5HM9A 2OUAA 3OYPA 1O2MA 3SYJA 4E7NA 5DKMA 1ZGIA 3V3MA 2ALPA 3AK5A 1W3CA 2D8WA 3BEFB 1NRNH 3E91A 4LXBH 5GJ4B 2CN0H 3QTVH 3TNSA 3RMOH 1ARCA 3E8LA 1P12E 3SQEE 2HPPH 1C9PA 5B6LA 4B6EA 2XNIA 1AVXA 2OC7A 1T31A 2ZPSA 2BTCE 4WMFA 3M5LA 1D9IA 1A5IA 3LGTA 1BBRH 2ANKH 1K22H 1P06A 3TLOA 2DE9A 3RXHA 4JZIA 1FAKH 4TPYA 3T62A 2ZU2A 3A88A 4MPWA 1W7GH 1A0HB 1KXBA 4Y8YA 4X2WA 1CBWB 3SBKA 3SHAH 2YOLA 1YPHC 2A0QB 2BD3A 1HIAA 3STJA 3KGPA 1VR1H 1D6WA 1C5MD 1G30B 3GY7A 3BTKE 1SGDE 4FU9A 2WYJA 1B7XB 4XOJA 3SHCH 7LPRA 4I8LA 1D6RA 2Y5FA 1WTHD 2HOBA 4X1NU 6ESTA 5FCKA 2BD7A 5FPTA 1HLTH 1ARBA 3PLKA 1T8LA 4RN6A 3CS7A 4U2WA 1MQ5A 3GCHB 4ZUHA 1P11E 2F9PA 1XUGA 3PMAB 4NA8A 1OKXA 1AFQC 1EPTC 4DW2U 1ELAA 1ELBA 2ASUB 4Q7XA 5C2ZA 2VU8E 1F92A 3D49H 4GLYA 1K28D 1TWXB 1V2QT 1O2VA 3FAOA 2ALVA 1C2DA 1NPMA 1TYNA 1AGJA 3LJJA 1P2KA 2JH6D 5GXPA 4VGCB 2RG3A 4H4FA 4JZEH 1O3MA 1O36A 1Y3WA 3Q76A 4ZHMU 2BXUH 1PPCE 2TPIZ 2QV1A 1F5LA 3NK8A 2SNVA 3N7OA 3AAUA 3UQVA 4HI3A 1PPEE 3ZZDA 1P04A 3I29A 1EOJA 2VH6A 3KEEA 1UVSH 5K7RA 2DE8A 1ZJDA 3MNXA 1QB6A 1F5RA 2G5VA 1S83A 1LKAA 1GCDA 3S9CA 1A0JA 3VB6A 5GNDA 1QNJA 2P3TB 4FU8A 4K60A 2ZEBA 1SOTA 1GBJA 3ZV9A 1C1MA 3PLBA 1XX9A 1TPAE 3SU0A 1BTHH 3RU4E 1GJ6A 2ZGCA 1L0ZA 3TJVA 1CGJE 2Z3EA 1O35A 2CHAB 2GKVE 1K1LA 4X1QU 1GPZA 1ZTJA 1IHSH 1UTJA 1UTLM 2BQWB 1SLVB 3SNCA 4AGKA 3MU8A 3SNDA 4I7YH 2FOGA 1Y3YA 1Y5UT 1OYQA 1TA2A 4FVBA 2OCVB 1TIOA 2A4QA 1P2MA 3RLWH 3TIUA 3BTTE 3PWCA 1N1LA 1SMFE 5C5NA 2VIVA 1FXYA 5T1VA 4KELA 1T4UH 3RU4D 1V2WT 4U30A 3TH4H 5DK1A 3VEQB 1PQAA 1G9IE 1GHZA 2WPJS 1O3IA 3A8DA 1HAPH 1SQOA 2FO9A 3ZVFA 2C8ZB 2VB0A 1C1WH 1K1IA 1ZRKA 2XW9A 2WUBA 1EAXA 3TU7H 3QN7A 1B5GH 2AMDA 1ZHMA 3PV4A 1MZDA 4AGJA 4TWWA 1GI4A 2PLXA 4UFDH 3ZZAA 4UFFH 1XVOA 2Z7FE 1YPEH 2FOMB 5AF9H 3RU4T 1NROH 1HNEE 2TGTA 7ESTE 2VWLA 1S81A 1SR5C 1UK4A 8ESTE 5L2ZH 3M7UA 5H4IB 1MD8A 1G36A 1KLJH 3VPKA 4YT7H 2G52A 1GI7B 2ZHQH 4A1VA 2NU2E 1KIGH 1TX7A 3DA9B 1G3DA 2F9NA 2PUQH 3LT3A 4DIIH 2Q6FA 3GISB 2ZGHA 1NRQH 1TGBA 1GDUA 1TX6A 1ELGA 1C1VH 3FVFB 2ZKSA 2QAAA 3UY9A 3RXPA 3SUDA 1KY9A 1UCYK 2A2QH 3RXCA 1AVGH 5DP6A 1SQTA 1BOQA 5T6GA 1C5RA 4GPGA 4LZ1H 1O3NA 1QHRB 3BG4B 3PO1C 1SGIB 3K9XB 1HPGA 1DS2E 3FZZA 4CBOA 2A45B 1GI6A 4ISOA 2H9EH 3UFAA 3UOUA 1FI8A 1KLTA 4E05H 2B0FA 2XC0A 2WHXA 1TQ0B 2JETC 3T25A 4CRDA 4KKDA 3A86A 3RXTA 2GV7A 1BQYA 3M5OA 3ATMA 5ESTE 1TPOA 3RXVA 1AQ7A 3KHVA 5JBTA 2P3UB 2FPZA 1Q2WA 2B9LA 1TRNA 4KP0A 1G32B 1VZQH 4A92A 4Y7AA 1DY8A 3RXEA 2UWPA 4A5TS 3H7OA 2ZG0H 1LVOA 2GV6A 2V3OH 1FMGA 4BAHB 1FY8E 2VVUA 2A7CA 4NIYA 1O2HA 1GBIA 4CRCA 4B2BA 3MMGA 1Z6JH 1YF4A 1GBCA 2C3SA 2OTVA 3A7ZA 3SGAE 3MYWA 1UO6A 1OXGA 1V6DA 3SUGA 1LHGH 1FPHH 1A2CH 2FXRA 1O3HA 3H7TA 1KXEA 2HGTH 1CGHA 3E0NB 3C27B 5DJ7A 2TGAA 5LPEA 1MAYA 1AE5A 1WAYB 3FZDA 3GDSA 4X1PU 2W5EA 3SJKA 3QGJA 4ZH8A 2Q6DA 4BOHA 1C5YB 5FPYA 1GJAB 3ZZCA 1P9SA 3D23A 4Y11E 3URCA 4CR5A 3BN9A 5FPSA 1INCA 4CRBA 1PJPA 1C2KA 4BAOB 1HXFH 1ZJKA 5EXNA 3MNBA 1H4WA 1QB1A 3F6UH 5AFZH 3Q00A 1TOMH 1CBWC 2OBQA 1CHGA 4Y76A 4D76A 2WV9A 2BOHB 1T8MA 3R3GB 1V2JT 1AMHA 1WXRA 2SGEE 1GBKA 1ETTH 1GMDF 1HCGA 1TNLA 4X0WU 3LGVA 2ZTXA 1H8IH 3NKKA 1P8VC 4NIVA 5C67A 4QT8C 1SGQE 1MBMA 1Z8RA 4NWKA 3UNQA 3F9FA 3F9HA 3NXPA 1MBQA 2ZPQA 2VIOA 1BTWA 3GCOA 5A0CA 2ODYB 1QJ6B 1YCPH 4ABGA 1HRTH 5DP4A 5AFYH 2XRCA 2NU3E 1O5GH 4Y10E 1AB9C 3SV2H 3RXQA 3MI4A 3TGJE 3TJOA 3ZVAA 1YYY1 5GIBA 1MKXH 3SJIA 1NFWA 1YCPM 3M3VA 1AN1E 1TGNA 1UTNA 2BDIA 3SORA 4B74A 3URDA 3LGYA 4X1SU 3SOSA 1IQNA 3SQHE 2R2WU 1SI5H 5L6NH
chains in the Genus database with same CATH superfamily
1GBMA 4FUGA 3P6ZB 2HWLB 3M3TA 1BTYA 3TH2H 1AUJA 1UTPA 2SFAA 2Q1JA 1KDQA 4UONA 4Z1MD 4ASHA 1LKBA 3F3BA 2OBOA 2XOKD 4TYDA 4ABFA 1FN8A 3L3TA 4CH8B 3UREA 1D3QB 3SUEA 2VIQA 1GI3A 2YMSC 2VVVA 1GCTB 5EGMA 2O8WA 1GMHG 4NGAH 3NRLA 2OC8A 1A61H 1HAOH 4RKJB 2WSSD 2QA9E 1FPCH 1O3EA 1W13U 4XSKU 1AU8A 3GOVB 1DX5M 5GCHF 1JBUH 1MKWH 4AYYB 5J4QA 1LDTT 2KAIB 3M5MA 5JB8S 2H6MA 1TGCA 1ZTKA 1TNIA 4RKOB 1GBHA 1O2ZA 3Q3YA 1HAIH 2XYAA 3TK5A 1O3KA 5FXLA 6LPRA 1QGFA 1ZSLA 2GT8A 1H9HE 3M7TA 1LHDH 1OSSA 2AGGX 1V2PT 5T6DA 1ETRH 3U28C 2Y81A 1JIMA 3FKSD 2A7JA 2PR3A 1TRMA 3OY5U 5LPRA 5A8XA 1EXFA 1SPJA 4LZ4B 5C1UA 1TB6H 3UWJH 1LQEA 2XXLA 1J9CH 2G4TA 1YC0A 1QJ1B 4Q7YA 3M3SA 1NFYA 4ZKNU 4AB9A 2W3IA 1SLUB 3F1SB 3MNCA 3KQ5A 1TRYA 3HK3B 3ZVBA 4JK5A 1C5OH 1THPB 2BDAA 1ZGVA 1P03A 1J17T 2WV4A 2ZWLH 4X8VH 3QK1A 1IQGA 4A1TA 3MWIU 1YPKH 2QCYA 1AUTC 3PTNA 4K69A 1VITH 2G55A 3AASA 2FS8A 1WU1A 4B71A 3LGUA 3PMHB 2V3MA 3MU0A 2FI3E 1A7SA 3LGWA 3QWCH 1SB1H 1O3AA 1YPMH 3LJOA 2ZTZA 1V2VT 3SV7A 4MQAA 1E36B 3CENA 2OLGA 4JMYA 3B9FH 1NBMD 2LP6A 1O2RA 1SFQB 3H5CB 2W3KA 3M7QA 3VXFH 5ABWA 1DXPA 3SJ8A 4B2CA 1EJNA 6GCHG 1VITG 3HPTB 2B7DH 4FOUC 4A1XA 2V6NA 4ZXYH 3KN2A 1AFEH 1EAIA 3DHKH 4K8YA 1C2HA 2FWWA 5T6FA 2J9NA 1O3BA 2FX6A 4XBBA 4JCNA 3RUOA 2J98A 1Y3UA 3UR9A 2GT7A 2M5TA 1QBOA 2KCAA 1S0RA 3CNRA 1GMHF 1YGCH 2WINI 3A8AA 3PMJA 3ZZ9A 6CHAC 3PROA 5AVDA 1EZUC 4ESTE 1RS0A 4FU7A 3GY6A 1YPHE 4AZ2B 3TJUA 3MHWU 1O2XA 4HTCH 2QN5T 1SLXB 1YM0A 2FMJA 1T8NA 3MTYA 3BTEE 4M7GA 1GWAA 2GCHF 1FJSA 4O9VA 4NIXA 3BTWE 3ITIA 1BMMH 2EEKA 1HAZB 3RXFA 3ZYDA 2PHBA 3K2UA 3N7EA 4Y7BA 1DT2A 5C3NA 2PKAA 2LELA 3G01A 1KXCA 1NRPH 4AG2A 1BRUP 3WY8A 1TGSZ 2OC1A 1K1OA 1BRAA 4H6TA 5E0HA 4NWLA 2WPDD 1K1NA 1HBTH 1UTMA 2P59A 2SGPE 1GHVH 4OS4A 5CHBA 4CREA 1ZSKA 1BITA 4CRAA 4JZDH 2VGCC 1O2YA 1ELFA 4F4OC 3UR6A 1P2JA 5EW2H 3Q3XA 3S69A 1BZXE 1WV7H 1GI9B 1GJ8B 2CJIA 1SGEE 1D3DB 1TBZH 1TMBH 3TK6A 4Q80A 1C2MA 3QX5H 2Y7ZA 5CHAB 2G8TA 4IC5A 5C20A 3OTJE 4WH8A 4GVUA 4TWYA 2ZU3A 3S0NA 3MO6A 4LOYH 1J14A 2G51A 1ORFA 4ABEA 3W94A 3UB0A 1WSSH 1DLEA 2FDAA 2HNTF 4U32A 1K21H 1AZ8A 2BDCA 2F43B 1C1PA 1A5GH 1RTKA 2AIPA 4CBNA 4MLFB 3E16B 2JIZD 1XUIA 2QGRA 5DGJA 1COWD 2QXHA 2P94A 4D7GA 2R3UA 1QBNA 2QIQA 3ZVEA 2AGEX 1S6FA 1C2GA 2TGPZ 4ISNA 1C2FA 2AMQA 3P95A 2QF5A 1T4VH 1BBRK 3I78A 1IAUA 1YY3A 1UK3A 2F83A 3U8RH 3K6YA 5JBBS 1C5VA 1SQRA 1IQFA 5JYIA 3SV6A 2J95A 2Z94A 2ZO3H 4MDSA 3TK9A 4F49A 4AC9A 2FEQH 2GTBA 2V3HH 2ZIQH 1LVBA 2TIOA 1O38A 2R0KA 2H5CA 3B23B 1JWTA 1YPJH 4NFFA 3EDXB 2O9QA 4ZKOU 4I31A 1B0EA 1TFXA 1LTOA 3RMNH 1A3EH 1TNHA 4E7RG 1P3EA 1HXEH 4D9QA 3ZZ7A 2G00A 5EXLA 2ZGJA 2GP9B 2C8WB 2TBSA 1UMAH 4H6SB 2PW8H 2GX4A 3QZQA 1C1QA 3A7XA 1HDTH 2ZCLP 1T32A 3PMBB 3VB4A 1C2JA 1MKWK 2H5DA 3BEUA 3P8NA 3U69H 1ZMJA 2A5IA 1P2OA 2BM2A 1HAVB 1NC6A 1ZHPA 3GCNA 4AFQA 1NFUA 1C5NH 1G37A 4ZROA 2VWOA 2ZU5A 3O8RA 4Y71A 4NSYA 3TPIZ 4TY6A 8LPRA 3LGIA 1C4V2 1O3OA 3M61U 2F9OA 1JOUB 1XM1A 1HFDA 1V2KT 2BY6X 2PGQB 1ANDA 2HPQH 2YMSD 3JZ1B 2W26A 3Q77A 1BRBE 4CH2B 1QFKH 3P92A 2UWLA 2XCFA 2PV9B 1PYTD 2GZ8A 4X2YA 2BX4A 1LHFH 1ACBE 1FX0B 1NESE 4FUCA 1UK2A 1RIWC 2QC2A 3EYDA 1C5SA 1BCUH 2LNCA 2NWNA 2B8OH 3ZIAD 1LMWB 1O5CB 3M5NA 5CHAC 4IN2A 5F03A 4GHQA 1HAXB 2EA3A 2IPQX 1OWJA 3TITA 1RRKA 1C1TA 4OS2A 1LPGB 3RXLA 3NPSA 3ZVGA 1MTWA 1O2IA 1MU8B 5I25A 2LPRA 2PTNA 1YWUA 1GJ9B 3GCHC 1L4ZA 5FHTA 4OGYA 4ABJA 1OP8A 3GYLB 2ODPA 3N7DA 2IOTA 5AHGH 1SGRE 5A0AE 2QXJA 4FUBA 3RMLH 2KAIA 2BDHA 3OY6U 1K2I1 3WW7A 8GCHF 1Z1IA 4FUHA 4X6PA 4B76A 3T2NA 1YLDA 1AO5A 1GVKB 2ZFPH 3KL6A 4KTUA 5HMAA 3P8FA 4FXGH 3DD2H 1VCWA 2C8XB 3LU9B 2F3CE 4AFSA 1W8BH 3ATLA 1PYTC 1RTFB 3PM3A 2L6OA 4GCHG 2J2UA 7KMEH 3QZRA 3SW2B 1QRWA 1C5TA 3BG8A 1MZAA 1EQ9A 3Q3KA 1CU1A 5HM2A 1ELTA 4Q2KA 1KMHB 1PQ7A 4OS5A 2PKSB 1FNIA 4X8TH 1HIAB 2ZECA 1TBRH 1GI0A 1PPGE 4AOQA 1LPZB 2J92A 1SG8B 2VH0A 4B75A 3S7KB 2BY5X 2ZHEH 1G2MA 2ZPRA 2EI7A 1GBTA 4ABBA 3RLYH 2CGAA 3HGNA 1NU9A 1Q31A 2VINA 1THRH 2FTMA 1ZPBA 1J8AA 3DSGA 4IC6A 1YCPK 2ZCKP 4INLA 1UHBB 2WV5A 2IPHA 1CVWH 1FZZA 3GY4A 4AX9H 5A8YA 2ZQ2A 4TY7A 3ENSB 5FAHA 1W11U 1Z8IB 1L4DA 4NCYA 3RXUA 1O5FH 4DY7B 2KCPA 3HK6B 2F9UA 4RSPA 5HYOA 2ESTE 5LGOA 5A8ZA 4P02A 1SC8U 1ANEA 1A0LA 1V2NT 5TCAA 3D62A 1F2SE 4KTCA 2BDYA 1AWFH 4LK4A 1BUIA 1TOCB 4BTTB 3BIUH 1HGTH 3P8GA 4X8UH 4BAKB 1XKBC 1C1UH 3SI3H 5EOKA 2HNTC 2J98B 1C5WB 3HKJB 3NWUA 1OP0A 3FP8E 5DPAA 3C1KA 2G4UA 1SBWA 1RTLA 4DIHH 2OD3B 5F8ZA 2Z9IA 4WVPE 3NCLA 1DWBH 1BTXA 1GMCF 3F68H 3HGPA 1E79D 2SNWA 4UDWH 2BY8X 2XC5A 1Z8JB 3SU2A 3FP7E 4MG3A 1S82A 2EI6A 3IG6B 4ZHLU 1BB0B 2VGCB 2FODA 3BSQA 1JMOH 4O3TA 2F9VA 3ZVCA 3QTOH 4MNVA 3A7YA 2FS9A 2J97A 4I8JA 3P17H 4FUFA 3P70B 3MO9A 3VB7A 2PTCE 2HLCA 2UWOA 5EU8A 3EA9A 2YNAA 1O2NA 1C5PA 1S84A 2XBYA 3KCGH 3NUMA 4ZCNA 1DLKB 1TE0A 4TT3D 3RMMH 1FY5A 1EUFA 1OS8A 1WCZA 4E06H 3L6PA 2ZI2H 4JYTA 3OEED 3SZNA 3A82A 1GBFA 2Z9GA 4NA7A 4MNYA 1S0QA 2ZHWH 4XRNA 1OWEA 1HJAC 4OS7A 2AH4X 2CF8H 1PPHE 5FBEA 1UTOA 1UVOA 3RXBA 3U1JB 3IWMA 1N8OB 3ESTA 3BTQE 4DT7B 1GHBF 2BD8A 4WXIA 1P57B 1W2KH 2J34A 1GBEA 5JB9S 3K65B 3RDZA 2CF9H 3BEIB 2XWBI 1W7XH 1O3CA 3UPEA 3RM0H 5EJ1A 3VFEA 3GDVA 3GDUA 1QJ7B 1ZMLA 3U9AH 5A09A 1CO7E 1K0HA 4BNRA 1GGDC 1THSH 5JBAS 2GZ7A 5DP8A 1FY4A 1NU7B 1TAWA 5L30H 1LQDB 3ATIA 2FI5E 3QUMP 2W6JD 3ZYEA 1OWDA 5EQRA 1P2NA 3RXSA 1VJAU 3DCLA 1Y8TA 1H9IE 3RM2H 1MQ6A 1Z71A 1S85A 1W10U 3DUXH 1FY3A 2BX3A 1DSTA 2Y6TA 3NZIA 3RXKA 1C1OA 3MO3A 1ETSH 3TGIE 5A0BA 1VGCB 2CV3A 4H42U 1BIOA 2RDLA 2XCNA 1ANBA 3KIDU 3EAJA 5TJXA 4DG4A 4MTBA 2QF4A 1QQUA 5JDUB 5HXFA 1Z7KA 3RC5A 3MH5A 4ABHA 2F91A 3E6PH 1GJ7B 3DSPA 2VJ1A 2ZA5A 3CP7A 1G2LA 2FIRH 2XBWA 3ZZ5A 1QRZA 2STAE 4Q4LA 3SNAA 2BOKA 4IMZA 3BTFE 2V7QD 1ZZZA 1AWHB 2P93A 4Y6DA 3K6ZA 3W95A 1O34A 1U6QA 1Q3XA 3ATWA 3LH3A 3ZZ3A 5T3HA 4DVAU 4Y0YE 4MNXA 2PP6A 1QTFA 2A4RA 3VB5A 2J5UA 5L2YH 5C94A 5EJZA 5KECA 3F2GA 1GI5A 1TGTA 1YLNA 1F0UA 3VXEH 1DUAA 4SGBE 4R8TB 1NFXA 1F5KU 3UAIC 1XKAC 4XBDA 2OQUA 1KLIH 4XE4A 3RXJA 3ZZ6A 4AG1A 2P3FH 5HGGA 3GYMA 1GHWH 2M2AA 1CA0C 3HATH 1WQSA 1UVUH 2O8LA 3LDXH 1QCPA 1BRCE 2BLVA 2QXIA 3UOPA 1D3TB 2Y7XA 3PRBA 1N8OC 1GGDB 4FUDA 1KTSB 1GI2A 1YPGH 2THFB 2VWMA 2YNBA 1NO9H 4ISIH 2J94A 1HJAB 4CHAB 1T8OA 5K0HA 5EPNA 3RXRA 1H9LB 3D65E 1C1SA 4ABAA 1EAUA 1N6YA 3M35A 1W14U 4MPUA 1EPTA 1L2EA 1PQ8A 2BZ6H 2VIPA 2KCOA 2FI4E 2BMGB 2HLDD 2O8UA 4AFUA 1AY6H 4I32A 4A6LA 4X2VA 1Z6EA 4Y0ZE 4ZKSU 5DP9A 2VWNA 1V2LT 2ZNKH 4K2YA 1SGPE 1ZSJA 1YPLH 3V0XA 1O39A 3LC3A 5F6MA 1LVMA 1Y3VA 1UJ1A 3ODDA 1O3PB 2UUJB 1SGTA 4ZXXH 4DGJA 4UE7H 2FOFA 5C5OA 1KSNA 1P05A 3S7HB 2BXTH 1XUJA 4Y79A 3AAVA 1AZZA 5JPMH 1O2JA 1PPBH 2XC4A 2Z3DA 1BHXB 2XBXA 5IK2D 1DE7H 1S5SA 4ZKRU 2HALA 4D8NA 1TABE 3QO6A 2WPMS 1VCQA 4YESB 4BTIB 1MTVA 1SFIA 2FTLE 4U01A 1Z1JA 3V7TA 3RXOA 5FX6A 3RXIA 1NRSH 1ZLRA 5EIYA 1KYNA 3KF2A 1ZR0A 1RXPA 3VG8A 1ZOMA 2V0BA 2FZZA 1BHXF 5LPFA 1EATA 3ZZBA 1AKSB 3KNXA 3E90B 4K1TA 3LIWA 1SSXA 4KGAA 4VGCC 2A5KA 1ABIH 4Q7ZA 1IHTH 3OTPA 4FUIA 1BT7A 3QGNB 5DO4H 2PUXB 3O8BA 1FIWA 2RCEA 1J15A 5C1XA 1V2ST 1GJDB 3TJNA 2BLOA 2ANYA 1DPOA 1XXDA 5EJLA 2H9HA 4AB8A 1A4WH 2ZDNA 1GJ5H 1WOFA 5F8TA 2AERH 3SNEA 1GMCG 3A83A 1ESTA 5EODA 3RP2A 4ISLA 1TBQH 2ZQ1A 3GY5A 5SGAE 3JZ2B 1IQLA 4XBCA 2G5NA 3PB1E 3ZZ8A 4GCHF 5E0GA 2FP7B 4MPXA 1HB0B 2PKAB 2I6QA 3S9BA 1DVAH 1BMLA 2ZFTA 1P10A 2QE7D 2ZHFH 4NZLA 2KM0A 2VIDA 2OXSA 1TA6A 1C5LH 2ZHDA 3KQDA 2B5TB 4OM9A 1IQMA 1V2OT 2PFEA 2PKSC 2BB4A 3SGQE 1OX1A 1MH0A 3BTGE 3UTUH 1DOJA 3A7TA 3BG4C 3PO1B 1MTUA 3AW1A 1LVYA 2CHAC 4AORA 2ANMH 5DP7A 3MU5A 1A1RA 2K8IA 3EA8A 3FANA 1A46H 7GCHF 1RFNA 2BVRH 1S6HA 1O2QA 3QDZB 3BTHE 1MTSA 2O8TA 5GWZA 1VKYA 4J1YA 1P01A 1H1BA 1D4PB 3LPRA 1AVWA 5A2MH 1K9OE 4IN1A 2Z6BD 1EZQA 3A80A 2WPHS 2FOHA 1O2WA 1MCTA 2XWAA 3A85A 2XTTB 1FLEE 1UCYE 1ELCA 5KGOA 3PTBA 1GHAG 5C17A 4ABDA 2OQ5A 2GCTC 4JZ1A 1NT1A 2GDEH 1KTTB 3GY8A 4CR9A 1Y5BT 2GGVB 5I46H 2SGFE 2F4LA 1P9UA 2BQ7B 2AFQB 1O3LA 2FX4A 2ODQA 5IDKA 3GS9A 1CHOG 4SGAE 2D26C 1IQJA 1OWIA 1SGYE 3SNBA 3ELAH 1CT4E 1VITF 4NIWA 4O97A 1ZHRA 4GAWA 1QA0A 1DFPA 5FX5A 4HGCA 4YTAA 2GMTB 1GJBB 4HFPB 1PPFE 3MFJA 1MU6B 2ZDVH 2A1DB 2ZFRH 2R9PA 1TMUH 1PFXC 1EZXC 1SQAA 1KXFA 3PV2A 1DY9A 1IOEA 4I8GA 1AD8H 2RA0A 4IW4E 1V2UT 1GDQA 3UQOA 1GJ4H 3MOCA 2Z3CA 1UVTH 2EY4C 1AFQB 1EPTB 2FOAA 2Z9KA 1GVLA 1O33A 2BDGA 3N99A 1E1RD 3RXDA 4UFEH 2FOEA 2QY0B 3PLPA 2H9TH 1JRTA 1RIWB 1LO6A 1JRSA 3MH4A 1EJAA 2A31A 3P8OA 3F9EA 2RFKC 3BIVH 1GBDA 4Y8XA 1FY1A 3UNSA 2UUYA 1AI8H 1F7ZA 1O30A 5FBIA 2FLRH 4K8BA 1VCPA 1O32A 4I33A 1TX8A 4WH6A 1HV7A 5EG4A 1QA7A 1TNJA 2HRVA 3UNRA 3UIRA 3EA7A 4FVDA 4M9FA 4BXWA 1O3FA 1BMNH 2PSXA 4IBLH 2AEIH 1XMNB 2BYAX 1ELDE 5C0TA 4YOIA 3M36A 5GPIB 1FONA 3A84A 2PWXA 3I77A 3RXAA 2GDDA 2R3YA 2Y5HA 1OHHD 4ZAEA 2GCTB 2XBVA 3OX7U 4FUEA 1BTZA 3GICB 4AN7A 5FL7D 1FQ3A 1XUFA 2A4GA 1LCYA 1T7CA 1TQ7B 2HVYB 1HAHH 2Q6GA 2RA3A 1M9UA 2KX4A 2FOBA 4Z6AH 1QRXA 2AYWA 2AMPA 3V12A 2OC0A 1CA8B 2BD5A 3BV9B 3EQ0H 1TONA 1GVZA 2H1UA 4ZMAH 2ILNA 1DWCH 1QURH 4CRFA 3T26A 2WUCA 1FDPA 2IJD1 1FV9A 5E0JA 2Y80A 3SN8A 4WWYA 3F9GA 5EQSA 1GG6B 1CGIE 3T29A 9ESTA 3AVZA 2EQNA 3F2HA 4Y8ZA 1D3PB 6CHAB 3MH6A 1SHYA 2BY7X 1HJ9A 1G3CA 1K1PA 1O3GA 3F0OA 1TPPA 3SU6A 1O2LA 2FM2A 2W6ID 2HNTE 4UD9H 1EB1H 1FUJA 4D7FA 2ZDKA 2W7UA 1DSUA 1W0YH 3SUFA 2CMYA 1O2SA 1BTPA 1GBBA 2Y82A 3A8BA 5HIYA 2VNTA 1NM6A 1OWKA 1QR3E 2V35A 3KYFA 3DFLA 1O2TA 1Z8GA 1P0SH 1G3BA 4IMQA 2FYRA 3LOXA 1UCYH 1ANCA 3OE7D 1BDAA 5DP5A 1OPHB 3T27A 1FN6A 3GY2A 1GBAA 3A89A 1E35B 2ZU4A 1C5XB 1L1GA 1DXWA 1YKTA 2BVSH 4JYVH 1H8DH 1L1NA 1Y5AT 1TPSA 1TLDA 1AB9B 3RXGA 1O2GH 1EOLA 2H2ZA 1C2EA 5C1YA 1BJUA 1ESBA 2P95A 4A7IB 4FUJA 2BVXH 3OSYA 1SGFG 3BTDE 1L1JA 2AGIX 3PV5A 5B6OA 4JYUH 1UHBA 3MU4A 1QL8A 3LH1A 2A32A 1EX3A 2EI8A 3SGBE 1A5HA 2ZGBH 4GSOA 4I8HA 4UEHH 4INKA 1FIZA 3MU1A 3U98H 1F0RA 2A5AA 8GCHG 1GDNA 1C2IA 3EE7A 4NG9H 1MUEB 2G81E 5BPEA 1SLWB 3TGKE 4GUXA 4BTUB 3TVJB 4OS1A 1NY22 2NU4E 1P3CA 2D2DA 2JH5D 3U1IB 3UUZA 3ATKA 3SU1A 1YLCA 2ZDAH 2KCYA 1P2IA 3MNSA 1OP2A 3O8CA 4OS6A 1LHEH 2IJOB 3U8TH 9LPRA 1QIXB 2P8OB 5GCHG 2ZCHP 5G4BA 1O31A 1GMDG 1GHAF 1O3JA 1OYTH 4F55A 3E1XB 4OGXA 1GHYH 5EW1H 1G3EA 3MH7A 1ELEE 2J4IA 5EXMA 5ETXA 2ZFFH 4YOJA 2GJGA 2NU1E 2NU0E 3AW0A 3ZZ4A 1O37A 1MMJN 2ZP0H 5BRRE 1ZPCA 1K1JA 1XXFA 1CHOF 4X6NA 1XVMA 3SJ9A 1UVPA 1P09A 1UTKA 3OAAD 1SGFA 2P16A 3ZV8A 4BXSA 3R0FA 1O5AB 4K1SA 2AS9A 1GBLA 3LC5A 1ZTLA 3SU4A 2Z9LA 1E38B 3DT0H 1MTNB 1IQKA 2VVCA 1O5EH 2TGDA 2BZAA 2HVXA 5FCRA 1ZPZA 3OU0A 2QYIA 2BY9X 1O2KA 2JJ1D 4D9RA 2ZDMA 7GCHG 1MTNC 2J38A 1PQ5A 2BLQA 3BTME 3SO3A 2CXVA 1CA0B 2GVFA 1UW7A 1EZSC 3UWIA 1X7AC 3A7VA 1QL9A 2WZQA 2PGBB 1CSOE 3B8JA 1BJVA 4XDEA 2TRMA 1TNGA 4INHA 1LPKB 1V2RT 4ABIA 4YOGA 3A87A 1XUKA 1CQQA 2FLBH 1ZRBA 1H8HD 4B73A 1RD3B 1N6XA 1SOZA 3L33A 2ZDLA 1B0FA 2GD4B 1WBGB 1IQIA 4CRGA 1HAYB 2SGAA 3U8OH 5CDFE 1HUTH 4NSVA 1JXPA 1HJ8A 3RC6A 2ZU1A 3GY3A 2ZZUH 2FOCA 2SGDE 1EB2A 1V2MT 4BAMB 2P8OC 5EQQA 2ZC9H 4TPIZ 3OEHD 4X1RU 1DUEA 3DFJA 4YLQH 1GI8B 1ID5H 1EASA 1ZYOA 1F0SA 1MD7A 3F0PA 4X6OA 3RC4A 2A2XH 1EP6A 1GJCB 1NRRH 1TNKA 1XUHA 1DWDH 2WPIS 3WWBA 1AE8H 2A4OA 4BAQB 1CT2E 3LONA 3T5FH 1PPZA 2KFWA 4WJG2 3SJOA 1QB9A 3KQEA 2C93B 4BANB 4WMEA 4RI0A 4HZHA 1C5QA 1P02A 2I6SA 2GCHG 4KTSA 1V3XA 1DITH 5HKKD 4AYVB 3S9AA 2BD9A 1NZQH 4XFQA 4K5ZA 2STBE 2ZTYA 1O3DA 2BQ6B 1C4Y2 5IYTA 1EKBB 3QLPH 4WXVA 2R2MB 1IQEA 1DDJA 1VGCC 3FOAA 1AHTH 2BHGA 3KQBA 1MAXA 1BMAA 3VGCB 1W0JD 2RDEA 2ZF0H 3M37A 4O3UA 4RT0A 4WY3A 1AKSA 3A8CA 2ZFQH 3ZVDA 2W7SA 1JIRA 1OWHA 1DICA 3EGKH 1O2OA 4CHAC 1WDIA 4IS5A 2JH0D 2WPLS 3TNTA 5CMXH 4IGDA 1O2PA 3TH3H 4DOQA 5EPYA 2BDBA 2BLWA 1ESAA 2PSYA 6GCHF 3A7WA 5E2OA 4GHTA 1QBVH 3O8DA 4THNH 1BBRE 1O5BB 2JETB 3GCTF 1IQHA 1RJXB 2K1QA 4WMDA 1BA8B 2C8YB 4O03A 4ACAA 4DURA 1K1MA 1ZMNA 1YBWA 1QQ4A 1A3BH 2Y5GA 1TALA 1SHHB 8KME2 2WPKS 3VGCC 5TCCA 4UFGH 4WF8A 4XD7D 1GG6C 4R0IA 4MVNA 5DG6A 3RXMA 1KDQB 2UUFB 1DWEH 1NTPA 4PROA 2SGQE 1CE5A 2EC9H 3A81A 2JKHA 2GZ9A 3E3TA 4K1EA 4NA9H 1E1QD 4RT1A 1WYKA 4NFEA 1UTQA 2OP9A 5LH8A 1EJMA 1C5UA 4YLUA 3FN8A 1DANH 1Y59T 2UUKB 1E37B 1GL1A 2QF0A 1VJ9U 4JK6A 2WYGA 3SV9A 1RGQA 3GCTG 3H09A 2Z9JA 1KXDA 4I8KA 1MCVA 4YT6H 5DP3A 3SV8A 5CE1A 3SU5A 1TMTH 3SZEA 1WTGH 2AIQA 1GI1A 3E0PB 1E34B 2BD2A 5J4SA 3SI4H 3SU3A 5JBCS 2OK5A 2O8MA 4YM9A 4X2XA 3VB3A 1SL3A 1C1RA 1GHBG 2AHME 2IN2A 4MNWA 3PWBA 2ZGXH 3PYHA 1OOKB 1WUNH 1P2QA 1C9TA 1YP9A 3IITA 1NBME 4DCDA 1BTUA 4X8SH 4JZFH 1AIXH 1SVPA 2BD4A 5PTPA 2ZFSA 1O2UA 1NS3A 1QL7A 1LHCH 2R0LA 5GDSH 1GHXH 1O0DH 3ODFA 4B2AA 1J16A 3FP6E 2FYQA 1ABJH 1C1NA 2VBCA 1SGNE 1E0FD 1HAVA 1W0ZU 2A7HA 1C4U2 2F9BH 1SGCA 2DUCA 2L74A 5E8EH 1DM4B 1QY6A 1WQVH 1KXAA 1CT0E 4Z0KA 4AFZA 2OINA 1O5DH 1HAGE 4NZQA 4X6MA 1GCTC 5F8XA 2D1JA 4MPVA 1EAWA 2QXGA 3EE0B 1NN6A 4DJZB 1EP5A 4DT4A 3HKIB 4YZUA 1C5ZB 2GMTC 5E2PA 2C4FH 1V2TT 1MKXK 3CS0A 4J2YB 1W12U 3FFGA 3KQCA 4B1TA 1GL0E 3V13A 5ESBA 4K3JA 4B6FA 1FAXA 4YO9A 1C2LA 2QF3A 1Y3XA 1ELVA 2FESH 4ZHAA 1F0TA 4ISHH 1HYLA 5KEDA 2ULLA 3LKWA 2ANWA 2JDID 3STIA 2VIWA 2C90B 3T28A 3BF6H 5F53A 5HM9A 2OUAA 3OYPA 1O2MA 3SYJA 4E7NA 5DKMA 1ZGIA 3V3MA 2ALPA 3AK5A 1W3CA 2D8WA 3BEFB 1NRNH 3E91A 4LXBH 5GJ4B 2CN0H 3QTVH 3TNSA 3RMOH 1ARCA 3E8LA 1P12E 3SQEE 2HPPH 1C9PA 5B6LA 4B6EA 2XNIA 1AVXA 2OC7A 1T31A 2ZPSA 2BTCE 4WMFA 3M5LA 1D9IA 1A5IA 3LGTA 1BBRH 2ANKH 1K22H 1P06A 3TLOA 2DE9A 3RXHA 4JZIA 1FAKH 4TPYA 3T62A 2ZU2A 3A88A 4MPWA 1W7GH 1A0HB 1KXBA 4Y8YA 3MQKC 4X2WA 1CBWB 3SBKA 3SHAH 2YOLA 5C0UA 1YPHC 2A0QB 3FO8D 2BD3A 1HIAA 3STJA 3KGPA 1VR1H 1D6WA 1C5MD 3WWFA 1G30B 3GY7A 3BTKE 1SGDE 4FU9A 2WYJA 1B7XB 4XOJA 3SHCH 7LPRA 4I8LA 1D6RA 2Y5FA 1WTHD 2HOBA 4X1NU 6ESTA 5FCKA 2BD7A 5FPTA 1HLTH 1ARBA 3PLKA 1T8LA 4RN6A 3CS7A 4Q63A 4U2WA 3W1EA 1MQ5A 3GCHB 4ZUHA 1P11E 2F9PA 1MABB 1XUGA 2KR7A 3PMAB 4NA8A 1OKXA 3PRDA 1AFQC 1EPTC 4DW2U 4TSFD 1ELAA 1ELBA 2ASUB 4Q7XA 5C2ZA 2VU8E 1F92A 3D49H 4GLYA 1K28D 1TWXB 2CK3D 1V2QT 1O2VA 3FAOA 2ALVA 1C2DA 1NPMA 1TYNA 1AGJA 3LJJA 1P2KA 2JH6D 5GXPA 4VGCB 2RG3A 4H4FA 4JZEH 1O3MA 1QZ8A 1O36A 1Y3WA 1H8ED 3Q76A 4ZHMU 3OFND 2BXUH 1PPCE 2TPIZ 2QV1A 1F5LA 3NK8A 2SNVA 3N7OA 3AAUA 3UQVA 4HI3A 1PPEE 2KZ4A 3ZZDA 4I86A 1P04A 3I29A 1EOJA 2VH6A 3KEEA 1UVSH 3F2FA 5K7RA 2DE8A 1ZJDA 3MNXA 1QB6A 1F5RA 2G5VA 1S83A 1LKAA 1GCDA 3S9CA 1A0JA 5HIZA 5GNDA 3VB6A 1QNJA 2P3TB 4FU8A 4K60A 2ZEBA 1SOTA 1GBJA 3ZV9A 1C1MA 3PLBA 1XX9A 1TPAE 3SU0A 1BTHH 3RU4E 1GJ6A 2ZGCA 1L0ZA 3TJVA 3KYGA 1CGJE 2Z3EA 1O35A 1SKYE 2CHAB 2GKVE 1K1LA 4X1QU 1GPZA 1ZTJA 1IHSH 1UTJA 1UTLM 2BQWB 1SLVB 3SNCA 4ACBA 4AGKA 3MU8A 3SNDA 4I7YH 2FOGA 1Y3YA 1Y5UT 1OYQA 1TA2A 4FVBA 1W0KD 2JJ2D 2OCVB 1TIOA 2A4QA 1P2MA 3RLWH 3TIUA 3BTTE 3PWCA 1N1LA 1SMFE 4ASUD 5C5NA 2VIVA 1FXYA 5T1VA 4KELA 1T4UH 3RU4D 1V2WT 4U30A 3TH4H 5DK1A 3VEQB 1PQAA 1G9IE 1GHZA 2WPJS 1O3IA 3A8DA 1HAPH 1SQOA 2FO9A 5DN6D 3ZVFA 2C8ZB 2VB0A 1C1WH 1K1IA 1ZRKA 2XW9A 2WUBA 1EAXA 3TU7H 3QN7A 1B5GH 2AMDA 1ZHMA 3PV4A 1MZDA 4AGJA 4TWWA 1GI4A 1EFRD 2PLXA 4UFDH 3ZZAA 4UFFH 1XVOA 2Z7FE 1YPEH 2FOMB 5AF9H 3RU4T 1NROH 1HNEE 2TGTA 4P00A 7ESTE 2K0QA 2VWLA 1S81A 1SR5C 1UK4A 8ESTE 2XNDD 5L2ZH 3M7UA 5H4IB 1MD8A 1G36A 1KLJH 3VPKA 4FETA 2G52A 1GI7B 2ZHQH 4YT7H 4A1VA 2NU2E 1BMFD 1KIGH 1TX7A 3DA9B 1G3DA 2F9NA 2PUQH 1S6LA 3LT3A 4DIIH 2Q6FA 3GISB 2ZGHA 1NRQH 1TGBA 1GDUA 1TX6A 1ELGA 1C1VH 3FVFB 2ZKSA 2QAAA 3UY9A 3RXPA 3SUDA 1KY9A 1UCYK 2A2QH 3RXCA 1AVGH 5DP6A 1SQTA 1BOQA 5T6GA 1C5RA 4GPGA 4LZ1H 1O3NA 1QHRB 3BG4B 3PO1C 1SGIB 3K9XB 1HPGA 1DS2E 5DSFA 3FZZA 3DSOA 4CBOA 2A45B 1GI6A 4ISOA 2H9EH 3UFAA 3UOUA 1FI8A 1KLTA 4HG6A 2B0FA 2XC0A 2WHXA 1TQ0B 2JETC 3T25A 4E05H 4CRDA 4KKDA 3A86A 3RXTA 2YMSB 2GV7A 1BQYA 3M5OA 3ATMA 5ESTE 1TPOA 3RXVA 1AQ7A 3KHVA 5JBTA 2P3UB 2FPZA 1Q2WA 2B9LA 1TRNA 4KP0A 1G32B 1VZQH 4A92A 4Y7AA 1DY8A 3RXEA 2UWPA 4A5TS 3H7OA 2ZG0H 1LVOA 2GV6A 2V3OH 1FMGA 4BAHB 1FY8E 2VVUA 2A7CA 4NIYA 1O2HA 1GBIA 4CRCA 4B2BA 3MMGA 1Z6JH 1YF4A 1GBCA 2C3SA 2OTVA 3A7ZA 3SGAE 3MYWA 1UO6A 1OXGA 1V6DA 3SUGA 1LHGH 1FPHH 1A2CH 2FXRA 1O3HA 3H7TA 1KXEA 2HGTH 1CGHA 3E0NB 3C27B 5DJ7A 2TGAA 5LPEA 1MAYA 1AE5A 1WAYB 3FZDA 3GDSA 4X1PU 2W5EA 3SJKA 3QGJA 4ZH8A 2Q6DA 4BOHA 1C5YB 5FPYA 1GJAB 3ZZCA 1P9SA 3D23A 4Y11E 3URCA 4CR5A 3BN9A 5FPSA 1INCA 4CRBA 1PJPA 1C2KA 4BAOB 1HXFH 1ZJKA 5EXNA 3MNBA 1H4WA 1QB1A 3F6UH 5AFZH 3Q00A 1TOMH 4F48B 1CBWC 2OBQA 1CHGA 4Y76A 4D76A 2WV9A 2BOHB 1T8MA 3R3GB 1V2JT 1AMHA 1WXRA 2SGEE 1GBKA 1ETTH 1GMDF 1HCGA 1TNLA 4X0WU 3LGVA 2ZTXA 1H8IH 3NKKA 1P8VC 4NIVA 5C67A 4QT8C 1SGQE 1MBMA 1Z8RA 4NWKA 3UNQA 3F9FA 3F9HA 3NXPA 1MBQA 2ZPQA 2VIOA 1BTWA 3GCOA 5A0CA 2ODYB 1QJ6B 1YCPH 4ABGA 1HRTH 5DP4A 5AFYH 2XRCA 2NU3E 1O5GH 4Y10E 1AB9C 3SV2H 3RXQA 3MI4A 3TGJE 3TJOA 3ZVAA 1YYY1 5GIBA 1MKXH 3SJIA 1NFWA 1YCPM 3M3VA 1AN1E 1TGNA 1UTNA 2BDIA 3SORA 4B74A 3URDA 4YXWD 3LGYA 4X1SU 3SOSA 1IQNA 3SQHE 2R2WU 1SI5H 5L6NH
chains in the Genus database with same CATH topology
1GBMA 4FUGA 3P6ZB 2HWLB 3M3TA 1BTYA 3TH2H 1AUJA 1UTPA 2SFAA 2Q1JA 1KDQA 4UONA 4Z1MD 4ASHA 1LKBA 3F3BA 2OBOA 4ABFA 4TYDA 2XOKD 1FN8A 3L3TA 4CH8B 3UREA 1D3QB 3SUEA 2VIQA 1GI3A 2YMSC 2VVVA 1GCTB 5EGMA 2O8WA 1GMHG 4NGAH 3NRLA 2OC8A 1A61H 1HAOH 4RKJB 2WSSD 2QA9E 1FPCH 1O3EA 1W13U 4XSKU 1AU8A 3GOVB 1DX5M 5GCHF 1JBUH 1MKWH 4AYYB 5J4QA 1LDTT 2KAIB 3M5MA 5JB8S 2H6MA 1TGCA 1ZTKA 1TNIA 4RKOB 1GBHA 1O2ZA 3Q3YA 1HAIH 2XYAA 3TK5A 1O3KA 5FXLA 6LPRA 1QGFA 1ZSLA 2GT8A 1H9HE 3M7TA 1LHDH 1OSSA 2AGGX 1V2PT 5T6DA 1ETRH 2Y81A 1JIMA 3FKSD 2A7JA 2PR3A 1TRMA 3OY5U 5LPRA 5A8XA 1EXFA 1SPJA 4LZ4B 5C1UA 1TB6H 3UWJH 1LQEA 2XXLA 1J9CH 2G4TA 1YC0A 1QJ1B 4Q7YA 3M3SA 1NFYA 4ZKNU 4AB9A 2W3IA 1SLUB 3F1SB 3MNCA 3ZVBA 1TRYA 3HK3B 4JK5A 1C5OH 1THPB 2BDAA 1ZGVA 1P03A 1J17T 2WV4A 2ZWLH 4X8VH 3QK1A 1IQGA 4A1TA 3MWIU 1YPKH 2QCYA 1AUTC 3PTNA 4K69A 1VITH 2G55A 3AASA 2FS8A 1WU1A 4B71A 3LGUA 3PMHB 3MU0A 2FI3E 1A7SA 3LGWA 3QWCH 1SB1H 1O3AA 1YPMH 3LJOA 2ZTZA 1V2VT 3SV7A 4MQAA 1E36B 3CENA 2OLGA 4JMYA 3B9FH 1NBMD 1O2RA 1SFQB 3H5CB 2W3KA 3M7QA 3VXFH 5ABWA 1DXPA 3SJ8A 4B2CA 1EJNA 6GCHG 1VITG 3HPTB 2B7DH 4A1XA 2V6NA 4ZXYH 3KN2A 1AFEH 1EAIA 3DHKH 4K8YA 1C2HA 2FWWA 5T6FA 2J9NA 1O3BA 2FX6A 4XBBA 4JCNA 3RUOA 1Y3UA 3UR9A 2GT7A 2M5TA 1QBOA 2KCAA 1S0RA 1GMHF 1YGCH 2WINI 3A8AA 3PMJA 3ZZ9A 6CHAC 3PROA 5AVDA 1EZUC 4ESTE 1RS0A 4FU7A 3GY6A 1YPHE 4AZ2B 3TJUA 3MHWU 1O2XA 4HTCH 2QN5T 1SLXB 1YM0A 2FMJA 1T8NA 3MTYA 3BTEE 4M7GA 1GWAA 2GCHF 1FJSA 4O9VA 4NIXA 3BTWE 3ITIA 1BMMH 2EEKA 1HAZB 3RXFA 3ZYDA 2PHBA 3K2UA 3N7EA 4Y7BA 1DT2A 5C3NA 2PKAA 2LELA 3G01A 1KXCA 1NRPH 4AG2A 1BRUP 3WY8A 1TGSZ 2OC1A 1K1OA 1BRAA 4H6TA 5E0HA 4NWLA 2WPDD 1K1NA 1HBTH 1UTMA 2P59A 2SGPE 1GHVH 4OS4A 5CHBA 4CREA 1ZSKA 1BITA 4CRAA 4JZDH 2VGCC 1O2YA 1ELFA 4F4OC 3UR6A 1P2JA 5EW2H 3Q3XA 3S69A 1BZXE 1WV7H 1GI9B 1GJ8B 2CJIA 1SGEE 1D3DB 1TBZH 1TMBH 3TK6A 4Q80A 1C2MA 3QX5H 2Y7ZA 5CHAB 2G8TA 4IC5A 5C20A 3OTJE 4WH8A 4GVUA 4TWYA 2ZU3A 3S0NA 3MO6A 4LOYH 1J14A 2G51A 1ORFA 4ABEA 3W94A 3UB0A 1WSSH 1DLEA 2FDAA 2HNTF 4U32A 1K21H 1AZ8A 2BDCA 2F43B 1C1PA 1A5GH 1RTKA 2AIPA 4CBNA 4MLFB 3E16B 2JIZD 1XUIA 2QGRA 5DGJA 2QXHA 1COWD 2P94A 4D7GA 2R3UA 1QBNA 2QIQA 3ZVEA 2AGEX 1S6FA 1C2GA 2TGPZ 4ISNA 1C2FA 2AMQA 3P95A 2QF5A 1T4VH 1BBRK 3I78A 1IAUA 1UK3A 2F83A 3U8RH 3K6YA 5JBBS 1C5VA 1IQFA 5JYIA 3SV6A 2J95A 2Z94A 2ZO3H 4MDSA 3TK9A 4F49A 2FEQH 2GTBA 2V3HH 2ZIQH 1LVBA 2TIOA 1O38A 2R0KA 2H5CA 3B23B 1JWTA 1YPJH 4NFFA 3EDXB 2O9QA 4ZKOU 4I31A 1B0EA 1TFXA 1LTOA 3RMNH 1A3EH 1TNHA 4E7RG 1P3EA 1HXEH 4D9QA 3ZZ7A 2G00A 5EXLA 2ZGJA 2GP9B 2C8WB 2TBSA 1UMAH 4H6SB 2PW8H 2GX4A 3QZQA 1C1QA 3A7XA 1HDTH 2ZCLP 1T32A 3PMBB 3VB4A 1C2JA 1MKWK 2H5DA 3BEUA 3P8NA 3U69H 1ZMJA 2A5IA 1P2OA 2BM2A 1HAVB 1NC6A 1ZHPA 3GCNA 4AFQA 1NFUA 1C5NH 1G37A 4ZROA 2VWOA 2ZU5A 3O8RA 4Y71A 4NSYA 3TPIZ 4TY6A 8LPRA 3LGIA 1C4V2 1O3OA 3M61U 2F9OA 1JOUB 1XM1A 1HFDA 1V2KT 2BY6X 2PGQB 1ANDA 2HPQH 3JZ1B 2YMSD 2W26A 3Q77A 1BRBE 4CH2B 1QFKH 3P92A 2UWLA 2XCFA 2PV9B 1PYTD 2GZ8A 4X2YA 2BX4A 1LHFH 1ACBE 1FX0B 1NESE 4FUCA 1UK2A 1RIWC 2QC2A 3EYDA 1C5SA 1BCUH 2LNCA 2NWNA 2B8OH 3ZIAD 1LMWB 1O5CB 3M5NA 5CHAC 4IN2A 5F03A 4GHQA 1HAXB 2EA3A 1OWJA 3TITA 1RRKA 1C1TA 4OS2A 1LPGB 3RXLA 3NPSA 3ZVGA 1MTWA 1O2IA 1MU8B 5I25A 2LPRA 2PTNA 1GJ9B 3GCHC 1L4ZA 5FHTA 4OGYA 4ABJA 1OP8A 3GYLB 2ODPA 3N7DA 2IOTA 5AHGH 1SGRE 5A0AE 2QXJA 4FUBA 3RMLH 2KAIA 2BDHA 3OY6U 1K2I1 3WW7A 8GCHF 1Z1IA 4FUHA 4X6PA 4B76A 3T2NA 1YLDA 1AO5A 1GVKB 2ZFPH 3KL6A 4KTUA 5HMAA 3P8FA 4FXGH 3DD2H 1VCWA 2C8XB 3LU9B 2F3CE 4AFSA 1W8BH 3ATLA 1PYTC 1RTFB 3PM3A 4GCHG 2L6OA 2J2UA 7KMEH 3QZRA 3SW2B 1QRWA 1C5TA 3BG8A 1MZAA 1EQ9A 3Q3KA 1CU1A 5HM2A 1ELTA 4Q2KA 1KMHB 1PQ7A 4OS5A 2PKSB 1FNIA 4X8TH 1HIAB 2ZECA 1TBRH 1GI0A 1PPGE 4AOQA 1LPZB 2J92A 1SG8B 2VH0A 4B75A 3S7KB 2BY5X 2ZHEH 1G2MA 2ZPRA 2EI7A 1GBTA 4ABBA 3RLYH 2CGAA 3HGNA 1NU9A 1Q31A 2VINA 1THRH 2FTMA 1ZPBA 1J8AA 4IC6A 1YCPK 2ZCKP 4INLA 1UHBB 2WV5A 2IPHA 1CVWH 1FZZA 3GY4A 4AX9H 5A8YA 2ZQ2A 4TY7A 3ENSB 5FAHA 1W11U 1Z8IB 1L4DA 4NCYA 3RXUA 1O5FH 4DY7B 3HK6B 2KCPA 2F9UA 4RSPA 5HYOA 2ESTE 5LGOA 5A8ZA 1SC8U 1ANEA 1A0LA 1V2NT 5TCAA 3D62A 1F2SE 4KTCA 2BDYA 1AWFH 4LK4A 1BUIA 1TOCB 4BTTB 3BIUH 1HGTH 3P8GA 4X8UH 4BAKB 1XKBC 1C1UH 3SI3H 5EOKA 2HNTC 1C5WB 3HKJB 3NWUA 1OP0A 3FP8E 5DPAA 3C1KA 2G4UA 1SBWA 1RTLA 4DIHH 2OD3B 5F8ZA 2Z9IA 4WVPE 3NCLA 1DWBH 1BTXA 1GMCF 3F68H 3HGPA 1E79D 2SNWA 4UDWH 2BY8X 2XC5A 1Z8JB 3SU2A 3FP7E 4MG3A 1S82A 2EI6A 3IG6B 4ZHLU 1BB0B 2VGCB 2FODA 3BSQA 1JMOH 4O3TA 2F9VA 3ZVCA 3QTOH 4MNVA 3A7YA 2FS9A 4I8JA 3P17H 4FUFA 3P70B 3MO9A 3VB7A 2PTCE 2HLCA 2UWOA 5EU8A 3EA9A 2YNAA 1O2NA 1C5PA 1S84A 2XBYA 3KCGH 3NUMA 4ZCNA 1DLKB 1TE0A 4TT3D 3RMMH 1FY5A 1EUFA 1OS8A 1WCZA 4E06H 3L6PA 2ZI2H 4JYTA 3OEED 3SZNA 3A82A 1GBFA 2Z9GA 4NA7A 4MNYA 1S0QA 2ZHWH 1OWEA 1HJAC 4OS7A 2AH4X 2CF8H 1PPHE 5FBEA 1UTOA 1UVOA 3RXBA 3U1JB 3IWMA 1N8OB 3ESTA 3BTQE 4DT7B 1GHBF 2BD8A 4WXIA 1P57B 1W2KH 2J34A 1GBEA 5JB9S 3K65B 3RDZA 2CF9H 3BEIB 2XWBI 1W7XH 1O3CA 3UPEA 3RM0H 3VFEA 3GDVA 3GDUA 1QJ7B 1ZMLA 3U9AH 5A09A 1CO7E 4BNRA 1GGDC 1THSH 5JBAS 2GZ7A 5DP8A 1FY4A 1NU7B 1TAWA 5L30H 1LQDB 3ATIA 2FI5E 3QUMP 2W6JD 3ZYEA 1OWDA 5EQRA 1P2NA 3RXSA 1VJAU 3DCLA 1Y8TA 1H9IE 3RM2H 1MQ6A 1Z71A 1S85A 1W10U 3DUXH 1FY3A 2BX3A 1DSTA 2Y6TA 3NZIA 3RXKA 1C1OA 3MO3A 1ETSH 3TGIE 5A0BA 1VGCB 2CV3A 4H42U 1BIOA 2RDLA 2XCNA 1ANBA 3KIDU 3EAJA 5TJXA 4DG4A 4MTBA 2QF4A 1QQUA 5JDUB 5HXFA 1Z7KA 3RC5A 3MH5A 4ABHA 2F91A 3E6PH 1GJ7B 3DSPA 2VJ1A 2ZA5A 3CP7A 1G2LA 2FIRH 2XBWA 3ZZ5A 1QRZA 2STAE 4Q4LA 3SNAA 2BOKA 4IMZA 3BTFE 2V7QD 1ZZZA 1AWHB 2P93A 4Y6DA 3K6ZA 3W95A 1O34A 1U6QA 1Q3XA 3ATWA 3LH3A 3ZZ3A 5T3HA 4DVAU 4Y0YE 4MNXA 3VB5A 1QTFA 2A4RA 5L2YH 2J5UA 3F2GA 1GI5A 1TGTA 1F0UA 3VXEH 1DUAA 4SGBE 4R8TB 1NFXA 1F5KU 1XKAC 4XBDA 2OQUA 1KLIH 4XE4A 3RXJA 3ZZ6A 4AG1A 2P3FH 5HGGA 3GYMA 1GHWH 2M2AA 1CA0C 3HATH 1WQSA 1UVUH 2O8LA 3LDXH 1QCPA 1BRCE 2BLVA 2QXIA 3UOPA 1D3TB 2Y7XA 3PRBA 1N8OC 1GGDB 4FUDA 1KTSB 1GI2A 1YPGH 2THFB 2VWMA 2YNBA 1NO9H 4ISIH 2J94A 1HJAB 4CHAB 1T8OA 5K0HA 5EPNA 3RXRA 1H9LB 3D65E 1C1SA 4ABAA 1EAUA 1N6YA 3M35A 1W14U 4MPUA 1EPTA 1L2EA 1PQ8A 2BZ6H 2VIPA 2KCOA 2FI4E 2BMGB 2O8UA 2HLDD 4AFUA 1AY6H 4I32A 4A6LA 4X2VA 1Z6EA 4Y0ZE 4ZKSU 5DP9A 2VWNA 1V2LT 2ZNKH 4K2YA 1SGPE 1ZSJA 1YPLH 3V0XA 1O39A 3LC3A 5F6MA 1LVMA 1Y3VA 1UJ1A 3ODDA 1O3PB 2UUJB 1SGTA 4ZXXH 4DGJA 4UE7H 2FOFA 5C5OA 1KSNA 1P05A 3S7HB 2BXTH 1XUJA 4Y79A 3AAVA 1AZZA 5JPMH 1O2JA 1PPBH 2XC4A 2Z3DA 1BHXB 2XBXA 5IK2D 1DE7H 1S5SA 4ZKRU 2HALA 4D8NA 1TABE 3QO6A 2WPMS 1VCQA 4YESB 4BTIB 1MTVA 1SFIA 2FTLE 4U01A 1Z1JA 3V7TA 3RXOA 5FX6A 3RXIA 1NRSH 1ZLRA 1KYNA 3KF2A 1ZR0A 1RXPA 3VG8A 1ZOMA 2V0BA 2FZZA 1BHXF 5LPFA 1EATA 3ZZBA 1AKSB 3KNXA 3E90B 4K1TA 3LIWA 1SSXA 4KGAA 4VGCC 2A5KA 1ABIH 4Q7ZA 1IHTH 4FUIA 3OTPA 1BT7A 3QGNB 5DO4H 2PUXB 3O8BA 1FIWA 2RCEA 1J15A 5C1XA 1V2ST 1GJDB 3TJNA 2BLOA 2ANYA 1DPOA 1XXDA 2H9HA 4AB8A 1A4WH 2ZDNA 1GJ5H 1WOFA 5F8TA 2AERH 3SNEA 1GMCG 3A83A 1ESTA 5EODA 3RP2A 4ISLA 1TBQH 2ZQ1A 3GY5A 5SGAE 3JZ2B 1IQLA 4XBCA 2G5NA 3PB1E 3ZZ8A 4GCHF 5E0GA 2FP7B 4MPXA 1HB0B 2PKAB 2I6QA 3S9BA 1DVAH 1BMLA 2ZFTA 1P10A 2QE7D 2ZHFH 4NZLA 2KM0A 2VIDA 2OXSA 1TA6A 1C5LH 2ZHDA 3KQDA 2B5TB 4OM9A 1IQMA 1V2OT 2PFEA 2PKSC 2BB4A 3SGQE 1OX1A 1MH0A 3BTGE 3UTUH 1DOJA 3A7TA 3BG4C 3PO1B 1MTUA 3AW1A 1LVYA 2CHAC 4AORA 2ANMH 5DP7A 3MU5A 1A1RA 3EA8A 2K8IA 3FANA 1A46H 7GCHF 1RFNA 2BVRH 1S6HA 1O2QA 3QDZB 3BTHE 1MTSA 2O8TA 5GWZA 4J1YA 1P01A 1H1BA 1D4PB 3LPRA 1AVWA 5A2MH 1K9OE 4IN1A 2Z6BD 1EZQA 3A80A 2WPHS 2FOHA 1O2WA 1MCTA 2XWAA 3A85A 2XTTB 1FLEE 1UCYE 1ELCA 3PTBA 1GHAG 5C17A 4ABDA 2OQ5A 2GCTC 4JZ1A 1NT1A 2GDEH 1KTTB 3GY8A 4CR9A 1Y5BT 2GGVB 5I46H 2SGFE 2F4LA 1P9UA 2BQ7B 2AFQB 1O3LA 2FX4A 2ODQA 5IDKA 3GS9A 1CHOG 4SGAE 2D26C 1IQJA 1OWIA 1SGYE 3SNBA 3ELAH