4NWLA

Crystal structure of hepatis c virus protease (ns3) complexed with bms-650032 aka n-(tert-butoxycarbonyl)-3-me thyl-l-valyl-(4r)-4-((7-chloro-4-methoxy-1-isoquinolinyl)o xy)-n-((1r,2s)-1-((cyclopropylsulfonyl)carbamoyl)-2-vinylc yclopropyl)-l-prolinamide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
194
structure length
194
Chain Sequence
KGSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVESLETTMRSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV NS3 1a Protease
publication title Discovery and Early Clinical Evaluation of BMS-605339, a Potent and Orally Efficacious Tripeptidic Acylsulfonamide NS3 Protease Inhibitor for the Treatment of Hepatitis C Virus Infection.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nwlA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4nwlA01
1VR1H 4JZDH 2Z3EA 1TX7A 4JK5A 1P0SH 3URDA 2BD4A 1TQ7B 1WSSH 3U69H 1KXBA 1RD3B 1TQ0B 3AW0A 4NGAH 4H6TA 4ABJA 4FUDA 4AOQA 2ZU4A 1THPB 2O8WA 3V3MA 4B73A 1GHZA 4Y10E 3RC6A 1Y3VA 4OS1A 3ITIA 2A45B 1O32A 1O5EH 2WUBA 3A8AA 4B76A 2QGRA 3LGWA 2ZF0H 4XBDA 1JOUB 3ZVFA 1C1QA 1Q3XA 1C4V2 1IQMA 1C9PA 2F9OA 1DY8A 1K22H 4K8YA 5J4QA 1GJ8B 1RIWC 1K21H 1O0DH 1RTKA 1K9OE 3GCHB 3UOPA 3C27B 2VIOA 5LH8A 1ETTH 1SMFE 1WXRA 1T8OA 1BB0B 2I6SA 2ZI2H 2WPJS 2R2MB 4E06H 2RA0A 3B8JA 1AVXA 1CA8B 1OP8A 2G4TA 3RXKA 4ZUHA 1P2NA 1AUJA 1G37A 3U98H 3KGPA 5EQRA 5PTPA 5ETXA 3E6PH 1GJ7B 1EOJA 2YNAA 5A8XA 1PPBH 1EXFA 3TGJE 1O38A 2D2DA 2XBWA 2BTCE 4FXGH 4FU7A 4WXIA 4ABDA 1D3QB 1KIGH 2AIQA 5DP3A 1MKWK 1MQ5A 2HPPH 3PLPA 2Q1JA 3SI4H 3V13A 1WCZA 2C8ZB 4CRBA 5EU8A 2VIPA 1SPJA 1QY6A 2VIQA 4ZXXH 3MOCA 4RSPA 1GMDF 2BZ6H 3M5OA 1YYY1 2EI8A 1ZMLA 3RLWH 5DKMA 2Z9KA 1SLWB 5DJ7A 2FX6A 1N6YA 4KTUA 1SSXA 3RXEA 2C3SA 1W12U 3UTUH 1O3IA 4F4OC 2AH4X 3RU4E 4JYVH 4DG4A 3EA8A 3U8RH 1L1NA 2PSXA 2BX4A 3KEEA 1GGDC 1Y3YA 1YCPH 2F3CE 4FVBA 3SU0A 3MMGA 3MU1A 5AF9H 2F83A 1L1GA 1EPTA 2IPHA 3O8CA 6ESTA 2OLGA 3D23A 1XXFA 2R0KA 3ZZ9A 1PPEE 1DWEH 1W11U 3TJNA 4TPYA 2SNVA 1XUJA 1Z8GA 1CGIE 2YOLA 4TY6A 3MU0A 2QF3A 3GDSA 8KME2 3M5NA 1EB1H 1NS3A 1QBNA 2FDAA 4YZUA 4YOJA 3T26A 2ZDAH 1SGNE 1W10U 3RXGA 2FOHA 4NZQA 1O2MA 4BAQB 1C5ZB 1TONA 4K5ZA 1CSOE 5EPYA 4Y0ZE 1P02A 2GD4B 1UTQA 1DXWA 3OY5U 4KP0A 2OBOA 4E7RG 2ZFQH 1V2NT 1C5VA 1CT4E 2P59A 3UPEA 1VCQA 2SGPE 3HPTB 5E8EH 1CA0B 4DURA 1O2KA 1GI3A 3BF6H 3VB6A 1BMAA 2Z3CA 1O2PA 3A83A 3P70B 5GIBA 5EXMA 2WHXA 1Z8RA 1PFXC 3MI4A 1ZPZA 4X6MA 4Y8YA 2OUAA 5CHAC 4AORA 2TIOA 7ESTE 2BD7A 1P3EA 1O31A 1BMMH 2BY9X 2GX4A 5GJ4B 4HTCH 3RMMH 2XXLA 3M36A 1GBJA 2J9NA 4Z0KA 1ZMJA 1YGCH 5IDKA 1KTTB 3MH6A 3LKWA 2B0FA 1ZGIA 4UFEH 1MCVA 2J34A 1P01A 1BCUH 4K3JA 4LXBH 1T4VH 3A7WA 1P05A 1K1NA 1J8AA 2ZU1A 5FCRA 4H6SB 2UUFB 5DP8A 1SOZA 1XUFA 1C2MA 3ODFA 3VGCB 2GZ9A 2WUCA 1P2KA 1P9SA 6LPRA 3BG4B 3LPRA 1GI7B 1TB6H 3UNRA 1SHHB 1GBBA 2SNWA 4WH8A 1O3KA 2GGVB 1YCPK 3P8FA 1J15A 2P8OC 4DCDA 4JZIA 7KMEH 2LPRA 1O3LA 1QQ4A 1TBQH 1GBIA 1UTMA 1YC0A 5EW1H 1SFQB 2BDGA 1FIZA 2C93B 3MU4A 1KLIH 3SGQE 2GP9B 1GBLA 2FI4E 4XOJA 1JXPA 1AFQC 4FUEA 3LIWA 1H9IE 3EAJA 1TRYA 2W7SA 3RXOA 3M5LA 5GPIB 4JZEH 3LGIA 4ZKNU 2VJ1A 4OM9A 1ZSLA 2R3YA 2GKVE 1T32A 1UTJA 3SJ8A 2AMQA 2HVXA 3F9HA 4CH2B 1ORFA 3T28A 1W13U 5DK1A 1UCYE 3FZDA 2NU4E 1EAIA 1TFXA 4DIHH 2ZIQH 1PPHE 1CQQA 3SZNA 2GZ7A 2B7DH 3SGAE 2WPLS 1XM1A 3ZV8A 1QA7A 4NWKA 3BTDE 2BXTH 1ELCA 4U01A 2FOBA 5FBEA 4ZKOU 2W5EA 2WV4A 2FS8A 4Q80A 4XBBA 3U8OH 1LVYA 4X8SH 1Y3WA 1GMHG 1HAZB 3MWIU 1GBMA 1C2LA 1LVOA 1O3DA 4B2CA 1ACBE 4Q7YA 3MNBA 2PUXB 4IN2A 2V0BA 3LJJA 2ZFRH 1DSUA 4YOGA 4MPUA 4CBNA 4LZ4B 1E35B 1Y5BT 3LH1A 1KXDA 4KELA 2VGCB 3NWUA 2A5IA 1JIMA 4NIVA 1V2PT 1ANEA 1O30A 2UUJB 3HGNA 2ZDLA 3LONA 4JCNA 1SI5H 4ABHA 4NG9H 1S5SA 4Z6AH 5EQSA 4O97A 2XCNA 4X6PA 5FPTA 3GCTF 2VH6A 2WV9A 3GYMA 3H7OA 3M35A 3L33A 1FUJA 2A4OA 2WYJA 3GY4A 1GBHA 1KXFA 1L2EA 4HGCA 1THRH 1BRCE 1BA8B 4BOHA 1B0FA 2TGTA 1GI6A 1OWEA 1OYQA 2B9LA 2XC0A 3F6UH 1YPHC 4NA7A 1C2IA 1O2GH 4MPWA 1DDJA 2FP7B 3ATMA 4A5TS 1GBEA 4TPIZ 1C4Y2 1ZHRA 2C8XB 5AFZH 4MNWA 5JDUB 3WY8A 5L6NH 2BMGB 2FLRH 3QUMP 7GCHF 3ZVCA 1WQSA 1C2GA 1LKAA 2Z9JA 2HNTE 5DGJA 7LPRA 1P9UA 2O8LA 4NA9H 4HFPB 2NWNA 1QTFA 2SGEE 1C2HA 4A7IB 1BHXF 4K8BA 1DSTA 1IQLA 1MBMA 2F9UA 2WYGA 2Q6FA 3F68H 1UHBA 5A0AE 3BV9B 2FODA 3AASA 2ODYB 2ZDMA 1QBOA 3ZZ6A 5TJXA 1MH0A 3DHKH 4CHAB 1Z6EA 3VXFH 1CO7E 4Y7AA 3A7TA 3UUZA 4I8JA 2BDBA 3NK8A 2LNCA 1OYTH 1ARBA 2BD3A 3TGIE 1EJAA 1BMLA 2BY6X 2VU8E 1H8DH 8GCHF 1ZTJA 3SNEA 2EC9H 4K60A 1ANDA 1W7XH 3T2NA 1O2IA 2Z3DA 1CA0C 4CRFA 1HV7A 1FZZA 3I29A 4UE7H 5DP6A 2FI3E 1NZQH 2P94A 1S84A 4XE4A 4A1VA 1ZJDA 1ESBA 4B74A 2G52A 1QL8A 4ZKRU 1O3NA 1EP6A 4NIXA 1WBGB 3PMBB 2CJIA 4M7GA 1QGFA 3ATLA 1PQAA 4GAWA 3PV4A 3OU0A 1O2VA 1RIWB 3VB4A 3ZYDA 3SNDA 2ZDVH 2Q6DA 1FMGA 4DT7B 5B6LA 1XXDA 4FUIA 1LVMA 5EGMA 3STIA 1PPFE 3MYWA 1NC6A 9LPRA 4CRGA 1SVPA 2BM2A 5GXPA 3VGCC 4X0WU 3BG4C 1YPLH 1V2WT 3SV2H 1AMHA 1PYTD 4R0IA 1GHVH 1P04A 2PKSB 4NSYA 4B2AA 1PQ8A 3DFLA 4ZXYH 4CR5A 1TRNA 1A0HB 1GHWH 3Q00A 1XUKA 2GVFA 4NCYA 1M9UA 6GCHG 2KAIB 1LO6A 1AVGH 2SGFE 5EODA 5F6MA 3LT3A 3SU2A 4IGDA 1O2TA 1YPGH 1TBRH 1AKSA 2ZPSA 1BTYA 2GV6A 1HBTH 3U1JB 1KSNA 2R9PA 5FPSA 1LHGH 4X2VA 2GMTB 3W95A 4K1EA 1ID5H 2XWAA 3EGKH 3UY9A 2A0QB 1TPAE 2QYIA 2F9VA 1K2I1 5FBIA 4WJG2 3GISB 1XMNB 3CS7A 3RXPA 1YBWA 2A4GA 1O5DH 3SZEA 1HNEE 1F5RA 1UVTH 1FAXA 3RXAA 3SNBA 2ZA5A 3ZZ7A 1PPZA 2VVCA 1TGTA 3L3TA 1CE5A 3UWIA 1BBRE 3MO3A 1T31A 1O2JA 4WWYA 4ISIH 1FDPA 3A84A 3LOXA 1Z8JB 4JZ1A 1SGEE 1SGPE 3HKJB 3ZVEA 1BITA 3B23B 1GHAG 1GI5A 1GJDB 1G32B 3QO6A 4GHTA 1KLJH 3LJOA 1BTWA 3MTYA 4NFFA 1TNGA 1ABIH 2AFQB 1G2MA 4M9FA 4X6OA 1XUHA 1O34A 2VGCC 5JBTA 5E2PA 3DD2H 4U32A 1SL3A 1SGQE 1F0UA 2EI7A 1WOFA 2Z6BD 1NTPA 3RXUA 1DUAA 2ASUB 4FUFA 2FZZA 1KLTA 1YP9A 4X8VH 3BEUA 1GJ9B 3SU5A 4J1YA 1FLEE 2ZCHP 3ZZBA 4YESB 1SQTA 4ZROA 4THNH 1FXYA 3HATH 1TALA 3ELAH 2F9BH 1UJ1A 2TGDA 1GCTB 2G55A 1QCPA 5GWZA 3TIUA 2J95A 2BY8X 3ZZCA 1YM0A 4BAHB 3UR6A 2JKHA 2AEIH 1QFKH 4YLUA 1NRQH 1BRBE 3SO3A 1P2MA 3QZRA 4NSVA 4ZHAA 3HK3B 1FJSA 2VNTA 3M5MA 4Y6DA 3TGKE 1C4U2 1C5WB 2ODPA 4MPVA 3KQDA 1LHDH 5H4IB 5TCAA 1B5GH 1WAYB 4WMFA 4CHAC 4ABAA 3T29A 3LC3A 2NU3E 4Y0YE 1GMCF 3OX7U 4AX9H 1ELBA 1MTWA 1SLXB 2OC0A 3GY5A 1ZRKA 5C5OA 3FP8E 1YPEH 3U8TH 3KCGH 1BRUP 4NA8A 3LH3A 2FTLE 1UVUH 2PGBB 4MDSA 3RXCA 4I8HA 2BZAA 5EG4A 1BTXA 3RC4A 4NIWA 1RJXB 5EW2H 2HPQH 4FUBA 5L2ZH 2XYAA 2ZTZA 2PLXA 4ABGA 3AAVA 3DA9B 3ZVDA 3IWMA 2ZTXA 1C5UA 1L0ZA 4XSKU 4YT7H 2XBVA 3SI3H 2XNIA 3PWCA 4GLYA 1S6HA 1C5NH 1C2KA 3KQBA 1GVLA 4IN1A 2JH0D 3K6ZA 4RI0A 2O8UA 2PWXA 2QXGA 2FTMA 3HK6B 4AFUA 1DICA 4XFQA 5K7RA 1SQOA 4MPXA 3RXTA 3M3SA 3PWBA 2BQWB 2WPMS 5HM9A 2AMPA 3JZ1B 1TX8A 2PKSC 3UQVA 1IQGA 3PMJA 4QT8C 2PKAB 1QJ1B 2FOGA 4D9QA 1YKTA 2ANMH 1CHOG 1OWKA 4Q7XA 4Y7BA 3QTVH 1TRMA 5EOKA 1ESTA 1GMDG 2ANYA 4OS5A 1U6QA 3SOSA 1EKBB 5BPEA 1HAVB 1OSSA 1O3PB 1C1VH 2W3IA 1GBTA 3MU8A 1IQNA 1UTKA 2XC5A 3PTNA 2GMTC 1BTUA 3PMHB 3PMAB 4IBLH 2A7HA 1CHGA 1TOMH 4X1RU 1TGNA 1D6RA 1AUTC 1V2QT 1ARCA 1MD7A 1QR3E 1A5IA 2ZNKH 2BDAA 2H5DA 2RA3A 2ILNA 2XCFA 3KQEA 1V2ST 3SHAH 1C1RA 3MFJA 1ZZZA 1DLKB 1JWTA 3E90B 3RLYH 1TGSZ 1AIXH 1FN6A 2ZP0H 1JMOH 1JRTA 1THSH 4DVAU 1ANCA 1C5OH 4KTSA 1EP5A 1Z7KA 1PJPA 1TMUH 1ANBA 1A2CH 1T8MA 3M3TA 1RTLA 2STBE 1HJ9A 1OKXA 2OXSA 2ULLA 1L4DA 2ZPQA 4BAKB 1UTNA 3DUXH 4H42U 3URCA 2QY0B 3V7TA 1EZUC 1BUIA 4A1TA 1A1RA 3NKKA 1L4ZA 1SFIA 1Z1IA 1RRKA 1SGDE 2BB4A 5DP4A 3KHVA 2ZHFH 3BG8A 4AG1A 4AYVB 1AB9B 4KTCA 4Y8ZA 5FHTA 1QB6A 4A6LA 1QJ7B 1HJ8A 2ZQ2A 4A92A 2H2ZA 4CREA 1YLDA 2BLVA 3HKIB 3GCNA 1YPHE 3PTBA 3U9AH 1EAWA 3TK9A 1AHTH 2ODQA 1A46H 4RKJB 1SQAA 5DP9A 1F0RA 3SU3A 2ALVA 5JBCS 1AVWA 5T6FA 1DITH 5LGOA 1UTPA 2R3UA 4BTUB 1K1PA 1GI9B 3E0NB 5EXLA 3AW1A 1ABJH 2VWLA 1GBDA 3MNCA 2P3TB 1DLEA 3E0PB 4AB8A 1HIAA 1V2LT 1FQ3A 4BAOB 1W3CA 3UREA 3GY7A 1G36A 3GY3A 1F2SE 2PW8H 1GCTC 3IG6B 4ESTE 1AQ7A 1FY8E 3IITA 1WYKA 5L30H 2RDLA 1CVWH 4X2WA 2FOFA 1O2UA 4DY7B 1W2KH 2V3OH 1TA2A 4LK4A 2DE9A 1BIOA 1O2XA 1WU1A 1PYTC 1GPZA 5JBBS 2OP9A 1K1LA 1Y8TA 1LHFH 3SV6A 1SHYA 4BNRA 2AGIX 1AFEH 1C2JA 1HAXB 1AZZA 1NY22 1G3CA 5T3HA 1LDTT 2SGDE 3ZZ8A 4U30A 3QTOH 1FY3A 4K1TA 1KXAA 3UFAA 5JBAS 1C2EA 1KDQB 1XX9A 1S83A 1B0EA 2ZHEH 4MNXA 1BHXB 2ZGBH 1DPOA 1MAXA 4HI3A 2ZFFH 5C20A 2WPHS 2BDIA 3FVFB 1EB2A 4BTTB 2R0LA 1QB1A 3QZQA 2W3KA 2F4LA 3PLKA 2NU2E 1SGFA 2XRCA 3K2UA 3QN7A 1S0RA 3GY6A 3LC5A 4AN7A 2CHAB 5C1UA 1EAXA 1WQVH 4MG3A 1YLCA 1ZMNA 2ZPRA 2TRMA 5LPEA 3VFEA 4MTBA 5HYOA 5LPRA 2R2WU 5CMXH 1BQYA 4WF8A 1G9IE 3RU4T 3RDZA 3KIDU 1P09A 3V0XA 1HPGA 2CF8H 2VBCA 4DOQA 2O8MA 3JZ2B 2CGAA 4D8NA 3ODDA 3BTME 2P3UB 1GHBF 3S9BA 5E0GA 1RS0A 2FS9A 4X2XA 3SNCA 3QLPH 2JETC 2D1JA 1ZPCA 1Z1JA 2XW9A 3RMOH 3NPSA 4UDWH 1C1NA 5A0BA 1O2WA 1C1SA 1G3DA 1GL1A 2ZGJA 4VGCB 3SV8A 1LPKB 1W7GH 1V2OT 3MH5A 4I8GA 4JMYA 1AKSB 2PUQH 3SJ9A 1UK3A 1QL9A 1F0SA 1MU6B 3LU9B 4ZH8A 3GCTG 1F0TA 1EZXC 1GWAA 5G4BA 4TWYA 4CH8B 1WV7H 3FZZA 2ZU5A 5FX6A 3RXJA 1LPGB 2PTCE 3SORA 2DUCA 1YPKH 4GVUA 3K6YA 4UFDH 3TJUA 1MTSA 1GHXH 1SGTA 2ZU3A 1OWJA 3P95A 1C1TA 2G4UA 2VIVA 4BXSA 3FP7E 2M5TA 3SNAA 2PHBA 5SGAE 2F91A 4AGKA 1UVPA 1B7XB 5FXLA 3AVZA 3Q77A 3KNXA 3SUEA 1GJ5H 1HDTH 5JB8S 2EEKA 4B71A 2GCHF 2ZHWH 7GCHG 1FY5A 2FYQA 3S7HB 1F7ZA 2ZFTA 3A88A 1KY9A 1P10A 1GVZA 1O33A 4D7GA 1C5YB 1IHSH 1SGYE 1GI0A 1ZYOA 1TIOA 2QXHA 3EA9A 1YCPM 4I33A 4ASHA 1ELVA 3LGUA 4DGJA 2AS9A 1ELEE 2UWLA 1GVKB 3BN9A 2G81E 4I8KA 3O8DA 3B9FH 1S81A 3ZZ4A 1AB9C 8GCHG 4ISNA 2W7UA 1MKXH 4WY3A 5AVDA 3ZZAA 4OS7A 4YO9A 3RXIA 2AYWA 2C8YB 1JRSA 4JYTA 1ELFA 3LGTA 3VEQB 2Z9GA 1C1MA 3A7XA 4TWWA 2OC8A 1YPMH 5L2YH 4FU9A 1CGHA 3PO1B 3E1XB 3SW2B 1O2LA 2VH0A 1O35A 1VGCC 2OINA 1TWXB 4Y76A 1Y3XA 4OGYA 3PB1E 1QL7A 1FPHH 4X8TH 1NN6A 1TNJA 1UK4A 1EASA 2HNTF 1BJUA 1N6XA 4RKOB 1UTLM 1Y3UA 1V2JT 1DE7H 1D9IA 4J2YB 4H4FA 1LCYA 1QURH 3BEIB 2ZDNA 1AO5A 1WUNH 3DT0H 1W8BH 1ZSJA 2PSYA 2HRVA 4MNVA 1AI8H 1GJ4H 3ESTA 1KXCA 3VPKA 5I25A 4MVNA 4YLQH 5FX5A 1AY6H 1C1OA 2GCTB 2HOBA 1MZDA 1LHEH 1HFDA 2NU1E 3KL6A 2YNBA 1Q2WA 1OOKB 2GDDA 4ISHH 1G3BA 2AIPA 2QIQA 2ZECA 2ZQ1A 4Y11E 3SU1A 1A3BH 2H1UA 1O2QA 1AE8H 1QJ6B 3SQHE 1IQIA 2CHAC 2HALA 4DIIH 3A8DA 1LMWB 1A0JA 4INKA 3OTJE 4JK6A 5K0HA 3UWJH 1MKXK 2ZGHA 3TH3H 5DP5A 4AG2A 3OY6U 2XC4A 1ZSKA 3Q76A 2ZU2A 4IW4E 3RMNH 2QC2A 2CV3A 1JIRA 3RU4D 1O2YA 4YT6H 5JB9S 1HB0B 2WINI 1O3EA 1UO6A 1EJMA 1VITF 1NFUA 1RTFB 2HWLB 1QB9A 1ZHPA 4WXVA 1V6DA 1O3CA 4ZKSU 1IQKA 4OGXA 3GCOA 4B2BA 1GI8B 1EZQA 4I7YH 1A0LA 2Z9IA 1AN1E 4VGCC 1V2RT 1O2ZA 3CP7A 2A1DB 3T25A 2UUKB 2AMDA 3H09A 4AYYB 5GCHF 1HAOH 1P03A 2CF9H 2BOHB 5HMAA 4GCHF 1FONA 2J2UA 2CN0H 3CS0A 1O5FH 5C3NA 1VZQH 3VB5A 1MTNB 2A5KA 1BJVA 3RXRA 2V6NA 1DWCH 2Q6GA 3RP2A 4B75A 3SJIA 2FOAA 3NXPA 4K69A 1EPTB 1N8OB 4XDEA 1EX3A 4B6FA 4ZHLU 2BLQA 1ZJKA 6CHAC 3GDVA 2VIDA 1H4WA 1VITH 3BTEE 2Y6TA 1SGCA 1A61H 2JH5D 3PV5A 1VJAU 2J94A 1KYNA 1J9CH 3A7ZA 2FWWA 4O9VA 1FI8A 1NM6A 3AAUA 3RM2H 1GBKA 2ANKH 2GT7A 1ZGVA 1V2KT 3DFJA 3OSYA 3RXQA 1EATA 3SN8A 3UOUA 1TMTH 1RFNA 3SGBE 2BHGA 3F9FA 1ZRBA 1GBAA 1OWHA 3E3TA 1DT2A 5C1YA 4PROA 2Y7ZA 2O8TA 4WVPE 3K65B 4YOIA 5F8ZA 4OS6A 2FX4A 2BXUH 1GMCG 3LGYA 1Y59T 1V2TT 2A32A 1NFWA 2OBQA 4NFEA 3QGJA 4MLFB 3H7TA 4TYDA 1TYNA 1X7AC 2IJD1 1WTHD 1QHRB 1FPCH 1OS8A 1QQUA 3E8LA 2PV9B 1IQHA 1VCPA 3O8BA 2BVXH 2UWOA 1HLTH 2A5AA 2A7CA 1BBRH 2AGEX 4BANB 1YF4A 3A7VA 2EI6A 4ZAEA 3ATWA 2KAIA 5DO4H 2IN2A 1SBWA 3LDXH 4AFZA 3FAOA 5E0HA 2A7JA 3SU4A 1A4WH 2BQ7B 3PO1C 1HJAB 1QNJA 4IC6A 2BD5A 2VVUA 1GI1A 4SGAE 4D7FA 2Z7FE 3K9XB 3MU5A 2ANWA 4LOYH 1V2UT 2F9PA 2FEQH 2ZZUH 4SGBE 4INLA 4UFFH 2O9QA 8LPRA 4X1PU 4ABEA 3SQEE 3VB3A 1NU9A 3P17H 4X1NU 3SU6A 1GDNA 1A5HA 1IOEA 4ISLA 1CT0E 2H6MA 2JETB 1Z6JH 2BDCA 1N1LA 4UEHH 1C5RA 1HXEH 1UVSH 5AHGH 2NU0E 1SLVB 1TLDA 1W14U 1HUTH 3M7QA 4GUXA 2BLOA 2BYAX 3A81A 1O2SA 1O2HA 1OXGA 3TH2H 2FLBH 3ZVBA 1C5PA 3GDUA 3A87A 3T62A 4U2WA 3GYLB 4O03A 1W0ZU 1P06A 4CRAA 4E05H 5DG6A 1BTPA 1CHOF 1DM4B 2Y80A 1DANH 1O3MA 1EJNA 2GCTC 1C5MD 3BTFE 2GDEH 2ZO3H 1BTHH 1HAIH 3MNXA 3NZIA 4Y71A 2Y5GA 2OK5A 1TNHA 2Y5HA 1DWDH 3BEFB 1H8IH 3E16B 1UVOA 2FOMB 4BAMB 1TAWA 1HAHH 5ABWA 3ENSB 2TGPZ 1G30B 4GSOA 5C5NA 1O3JA 1C2DA 1O36A 1MU8B 2PGQB 2Z94A 3I77A 3PV2A 1IAUA 2FI5E 5FCKA 2ZWLH 3TLOA 3TPIZ 2V3HH 3A85A 3N7OA 1HAYB 4DW2U 4GPGA 4YM9A 1TNIA 4E7NA 3BSQA 3NCLA 1FY4A 3LGVA 2TBSA 1O5AB 1E36B 2FESH 1ELDE 1GDUA 1BBRK 5JPMH 1GJBB 5C2ZA 2XBYA 1HCGA 1TOCB 3ZVAA 2G51A 1TPPA 1NRRH 1D3PB 2Y7XA 1EQ9A 4I8LA 2Y81A 1DWBH 3GICB 3RXLA 1ZPBA 2QXIA 3F9EA 1XKAC 2FYRA 1GJ6A 2P3FH 5T6DA 3M61U 4WH6A 1BOQA 1FAKH 3ZV9A 4AZ2B 3VXEH 3EQ0H 1TE0A 2OTVA 3M7TA 2FM2A 4Q2KA 1VCWA 2BY7X 1GG6B 2J4IA 1JBUH 1IQFA 1LPZB 1MCTA 3Q3YA 1G2LA 2TGAA 1K1IA 3P8GA 1RGQA 1MTNC 1G3EA 1NROH 3A82A 4X6NA 4IMZA 2XTTB 4HZHA 1MD8A 1P3CA 1EPTC 4GHQA 4AFSA 1N8OC 1C1WH 1O2OA 1VGCB 4AFQA 2THFB 4ABBA 5A8YA 1DX5M 1S6FA 1C2FA 1T8LA 5I46H 1V3XA 2ZKSA 2ZHQH 3T5FH 1OP2A 1MTUA 1CBWB 4O3TA 2BDHA 3RM0H 2GV7A 3SJOA 1GBFA 1GJAB 4OS4A 2DE8A 4D76A 1PPCE 1SB1H 3GY8A 3SBKA 1MAYA 1D3DB 3RXDA 3BIVH 1UHBB 2PR3A 4INHA 3KN2A 3RXSA 1AZ8A 1CGJE 3SHCH 4KKDA 1AGJA 3MH7A 2VVVA 2QA9E 3FP6E 4I31A 2FXRA 3ZYEA 2PTNA 3PROA 1C9TA 5AFYH 2OC7A 2AERH 2QAAA 2QF0A 1IHTH 1F5LA 1SGFG 3SV9A 1TX6A 1UMAH 1P2QA 2CXVA 3D49H 1K1JA 3H5CB 3RXBA 1TPOA 5C1XA 1CU1A 2RG3A 4O3UA 2FPZA 2WPIS 2UUYA 3PLBA 5B6OA 1O5CB 1GHYH 1O3GA 3ZVGA 4NZLA 5HGGA 4AB9A 3RC5A 2UWPA 3SJKA 2A2XH 1GBCA 3AK5A 2PKAA 4MNYA 1E0FD 3U1IB 4F49A 3UNQA 4BTIB 3UIRA 1L1JA 3S7KB 1Y5UT 4K1SA 1ZOMA 3BTQE 1J16A 1P2IA 2A2QH 1S82A 3G01A 1J17T 4XBCA 3MO9A 1O3HA 3P6ZB 1CT2E 1LQEA 2K1QA 1HAVA 3PM3A 3TU7H 1O3BA 1ZR0A 4MQAA 1INCA 1K1OA 1HJAC 5ESBA 2BVRH 1UTOA 2FOEA 2H5CA 2SGQE 1DFPA 1DXPA 4Y79A 1NRSH 5E0JA 1P8VC 3C1KA 1A3EH 1EZSC 2XWBI 1C5QA 3O8RA 1EOLA 1GL0E 3BTWE 3ZZ5A 5DPAA 1FV9A 2J92A 1NFXA 1XUIA 1V2MT 1GHBG 1H9HE 1AWFH 3GCHC 1GMHF 1DOJA 1TGBA 4I32A 8ESTE 1MTVA 3QGNB 1BMNH 1BTZA 3FANA 2GZ8A 4DJZB 2H9HA 1LHCH 1HXFH 4NIYA 1NPMA 3E91A 1LVBA 1E37B 2IOTA 5T6GA 3Q3XA 2FMJA 1VJ9U 3UNSA 1P2OA 2VWOA 5J4SA 4CR9A 2C4FH 2ZFSA 4FUCA 1Q31A 5F03A 2ZC9H 1O3AA 2ZGCA 4FUJA 1S0QA 6CHAB 4AGJA 4FVDA 2VIWA 1DUEA 2RCEA 1QRZA 2ZTYA 1RXPA 1EAUA 1BDAA 3EE0B 1A5GH 1C5TA 1Z71A 2ZCLP 5ESTE 3MO6A 1C5SA 5A09A 2ZG0H 1AWHB 1EUFA 1YPJH 1O3FA 3W94A 1O39A 1OX1A 1FNIA 1D6WA 2IJOB 4TY7A 2GCHG 4ISOA 1OP0A 3UQOA 3FFGA 1PQ5A 3QDZB 2OQ5A 2D26C 2ZCKP 2V35A 3MNSA 3SV7A 4IC5A 1PQ7A 3OYPA 3TVJB 3P8OA 3V12A 4D9RA 1GDQA 1TA6A 1HAGE 1QRXA 3BTHE 4ZHMU 4FU8A 3A8BA 1FY1A 1T8NA 1NFYA 5GNDA 2STAE 2W26A 1UCYH 1P11E 2BDYA 1GI4A 1NT1A 2SFAA 2Z9LA 1SLUB 1NU7B 3ZZ3A 1MMJN 4A1XA 2D8WA 3OTPA 3TH4H 3SYJA 1SR5C 1ZTKA 3S0NA 5A0CA 1PPGE 5JYIA 1ELTA 1GG6C 2QXJA 2F9NA 1OWDA 1LQDB 3EA7A 2FO9A 4X1QU 4R8TB 1DY9A 3EDXB 5CE1A 3ATIA 3P8NA 3RXFA 2TPIZ 3RMLH 3QWCH 3UR9A 2BLWA 3PYHA 1FIWA 1S85A 1KDQA 3SUGA 1O37A 3I78A 3GY2A 2GT8A 5HM2A 4FUGA 3MH4A 5A2MH 1ELAA 3T27A 3TK5A 1LTOA 9ESTA 3VB7A 2OC1A 1CBWC 1TBZH 3NUMA 1GCDA 3S9AA 2FIRH 1ELGA 1NESE 2Y5FA 2ZGXH 4K2YA 1XVOA 3CENA 3S69A 1HRTH 1K28D 3RXHA 3S9CA 3BTGE 2WZQA 1AU8A 3GOVB 5T1VA 2G5VA 1NRPH 5FPYA 1HYLA 4X1SU 2VWNA 1W0YH 3BIUH 2VB0A 3R0FA 1C1PA 1XUGA 4JYUH 4IS5A 2G00A 5A8ZA 1Y5AT 1SG8B 1ZTLA 2PFEA 3M7UA 1QBVH 1Z8IB 1BRAA 1SC8U 6GCHF 3A86A 1D3TB 2C8WB 2BY5X 4X2YA 1XVMA 2BVSH 3Q3KA 3TNSA 3KQCA 1P2JA 3A8CA 2P16A 2J38A 1NRNH 2P93A 3TITA 5EXNA 2G8TA 1IQEA 4UONA 3ZZDA 2A31A 2G5NA 1V2VT 5FAHA 1UCYK 2P95A 2ALPA 1GGDB 2A4RA 1BT7A 2H9TH 3QX5H 1GI2A 1ZLRA 4LZ1H 3TJVA 1C5XB 2OD3B 4OS2A 2XBXA 1MUEB 1KXEA 5LPFA 1O3OA 1O5GH 5EQQA 2OQUA 1MQ6A 2VWMA 1XKBC 3M3VA 1WTGH 3SUFA 1E38B 4RN6A 5DP7A 4BXWA 1GJCB 2AGGX 1H1BA 3RUOA 2ZHDA 5HXFA 1ZHMA 1C5LH 1VITG 1DVAH 3QK1A 1D4PB 5EPNA 5C67A 4IMQA 5GDSH 3D65E 1KTSB 4CBOA 5BRRE 3D62A 2GTBA 2VINA 1H9LB 5F8TA 3TK6A 1GHAF 1TNLA 4B6EA 4Y8XA 1TPSA 1QRWA 2JH6D 1O5BB 2HNTC 1QA0A 1MZAA 2FOCA 5GCHG 5E2OA 2SGAA 2A4QA 1UK2A 4GCHG 1E34B 2WPKS 4KGAA 2BQ6B 3STJA 3TJOA 2C90B 4WMDA 2QN5T 2HLCA 1ETRH 2OCVB 1TGCA 4Q7ZA 3A7YA 5CHAB 4UFGH 4ABIA 1T4UH 2EA3A 1K1MA 2ZEBA 3ATKA 3TNTA 1BZXE 1SGIB 2H9EH 3HGPA 1QIXB 3BTKE 1F5KU 1ESAA 3P92A 4ZMAH 1HGTH 4ABFA 2BX3A 4UD9H 3L6PA 2HGTH 1MKWH 2ZDKA 3M37A 2Y82A 1NO9H 1J14A 2ZFPH 1O2NA 2ESTE 1OWIA 1SOTA 1FN8A 3RXVA 4NWLA 1SGRE 4B1TA 1AE5A 1TNKA 1C1UH 1LKBA 4CRDA 1TABE 4X8UH 1OPHB 2P8OB 2BD2A 4CRCA 1IQJA 2BOKA 3KF2A 1T7CA 2BD8A 2QCYA 1A7SA 3F9GA 5F8XA 4YTAA 1F92A 2BD9A 3EYDA 1P12E 4WMEA 1P57B 1TMBH 1ETSH 4FUHA 2I6QA 2B8OH 4JZFH 2QV1A 3R3GB 2B5TB 3RXMA 5TCCA 1HAPH 3A80A 2WV5A 3F1SB 3MHWU 1AFQB 5IYTA 3A89A 1HIAB 2CMYA 1DS2E 3BTTE 3SUDA 1O2RA 1AD8H 1MBQA
chains in the Genus database with same CATH superfamily
1VR1H 4JZDH 2Z3EA 1TX7A 4JK5A 1P0SH 3URDA 2BD4A 1TQ7B 1WSSH 3U69H 1KXBA 1RD3B 1TQ0B 3AW0A 4NGAH 4H6TA 4ABJA 4FUDA 4AOQA 2ZU4A 1THPB 2O8WA 3V3MA 4B73A 1GHZA 4Y10E 3RC6A 1Y3VA 4OS1A 3ITIA 2A45B 1O32A 1O5EH 3CNRA 2WUBA 3A8AA 4B76A 2QGRA 2L6OA 3LGWA 2ZF0H 4XBDA 1JOUB 3ZVFA 1C1QA 1Q3XA 1C4V2 1IQMA 1C9PA 2F9OA 1DY8A 4HG6A 1K22H 4K8YA 5J4QA 1GJ8B 1RIWC 1K21H 1O0DH 1RTKA 1K9OE 3GCHB 3UOPA 3C27B 2VIOA 5LH8A 1ETTH 1SMFE 1WXRA 1T8OA 1BB0B 2I6SA 2ZI2H 2WPJS 2R2MB 4E06H 2RA0A 3B8JA 1AVXA 1CA8B 1OP8A 2G4TA 3RXKA 4ZUHA 1P2NA 1AUJA 1G37A 3U98H 3KGPA 5EQRA 5PTPA 5ETXA 3E6PH 1GJ7B 1EOJA 2YNAA 5A8XA 1PPBH 1EXFA 3TGJE 1O38A 2D2DA 2XBWA 2BTCE 4FXGH 4FU7A 4WXIA 4ABDA 1D3QB 1KIGH 2AIQA 5DP3A 1MKWK 1MQ5A 2HPPH 3PLPA 1H8ED 2Q1JA 3SI4H 3V13A 1WCZA 2C8ZB 4CRBA 5EU8A 2VIPA 1SPJA 1QY6A 2VIQA 4ZXXH 3MOCA 4RSPA 4ASUD 1GMDF 2BZ6H 3M5OA 1YYY1 2EI8A 1ZMLA 3RLWH 5DKMA 2Z9KA 1SLWB 5DJ7A 2FX6A 1N6YA 4KTUA 5FL7D 1SSXA 3RXEA 2C3SA 1W12U 3UTUH 1O3IA 4F4OC 2AH4X 3RU4E 4JYVH 4DG4A 3EA8A 1NBME 3U8RH 1L1NA 2PSXA 2BX4A 3KEEA 1GGDC 1Y3YA 1YCPH 2F3CE 4FVBA 3SU0A 3MMGA 3MU1A 5AF9H 2F83A 1L1GA 1EPTA 2IPHA 3O8CA 6ESTA 2OLGA 3D23A 1XXFA 2R0KA 3ZZ9A 1PPEE 1DWEH 1W0JD 1W11U 3TJNA 4TPYA 2SNVA 3UAIC 1XUJA 1Z8GA 1CGIE 2YOLA 4TY6A 3MU0A 2QF3A 3GDSA 8KME2 3M5NA 1EB1H 1NS3A 1QBNA 2FDAA 4YZUA 4YOJA 3T26A 2ZDAH 1SGNE 1W10U 3RXGA 2FOHA 4NZQA 1O2MA 4BAQB 1C5ZB 1TONA 4K5ZA 1CSOE 5EPYA 4Y0ZE 1P02A 2GD4B 1UTQA 3WWBA 1DXWA 3OY5U 4KP0A 2OBOA 4E7RG 2ZFQH 5HIYA 1V2NT 1C5VA 1CT4E 2P59A 3UPEA 1VCQA 2SGPE 2HVYB 3HPTB 5E8EH 1CA0B 4DURA 1O2KA 3DSGA 1GI3A 3BF6H 3VB6A 1BMAA 2Z3CA 1O2PA 3A83A 3P70B 5GIBA 5EXMA 2WHXA 2KZ4A 1Z8RA 1PFXC 3MI4A 1ZPZA 4X6MA 4Y8YA 2OUAA 5CHAC 4AORA 2TIOA 7ESTE 2BD7A 1P3EA 2KX4A 1O31A 1BMMH 2BY9X 2GX4A 5GJ4B 4HTCH 3DCLA 3RMMH 2XXLA 3M36A 1GBJA 2J9NA 4Z0KA 1ZMJA 1YGCH 5IDKA 1KTTB 3MH6A 3LKWA 2B0FA 1ZGIA 4UFEH 1MCVA 2J34A 1P01A 1BCUH 4K3JA 4LXBH 1T4VH 3A7WA 1P05A 1K1NA 1J8AA 2ZU1A 5FCRA 3OFND 4H6SB 2UUFB 5DP8A 1SOZA 1XUFA 1C2MA 3ODFA 5KEDA 3VGCB 2GZ9A 1COWD 2WUCA 1P2KA 1P9SA 6LPRA 3BG4B 3LPRA 1GI7B 1TB6H 3UNRA 1SHHB 1GBBA 2SNWA 4WH8A 1O3KA 2GGVB 1YCPK 3P8FA 1J15A 2P8OC 4DCDA 4JZIA 2XOKD 7KMEH 1O3LA 2LPRA 1QQ4A 1TBQH 1GBIA 1UTMA 3KQ5A 1YC0A 5EW1H 1SFQB 2BDGA 1FIZA 2C93B 3MU4A 1KLIH 3SGQE 2GP9B 1GBLA 2FI4E 3DSPA 4XOJA 1JXPA 3F0PA 1AFQC 4FUEA 3LIWA 1H9IE 3EAJA 1TRYA 2W7SA 1H8HD 3RXOA 3M5LA 5GPIB 4JZEH 3LGIA 5F53A 4ZKNU 2VJ1A 4OM9A 1ZSLA 2R3YA 2GKVE 1T32A 1UTJA 3SJ8A 2AMQA 2HVXA 3F9HA 4CH2B 1ORFA 3T28A 1W13U 5DK1A 1UCYE 3FZDA 2NU4E 1EAIA 1TFXA 4DIHH 2QF5A 2ZIQH 1PPHE 1CQQA 3SZNA 2GZ7A 2B7DH 3SGAE 2WPLS 1XM1A 3ZV8A 1QA7A 4NWKA 3BTDE 2BXTH 1ELCA 4U01A 2FOBA 5FBEA 4ZKOU 2W5EA 2WV4A 2FS8A 4Q80A 4XBBA 3U8OH 1LVYA 4X8SH 1Y3WA 1GMHG 1HAZB 3MWIU 1GBMA 1C2LA 1LVOA 1O3DA 4B2CA 1ACBE 4Q7YA 3MNBA 2PUXB 4IN2A 2V0BA 3LJJA 2ZFRH 1DSUA 4YOGA 4MPUA 4CBNA 4LZ4B 2QF4A 1E35B 1Y5BT 3LH1A 1KXDA 4KELA 2VGCB 3NWUA 2A5IA 1JIMA 4NIVA 1V2PT 1ANEA 1O30A 2UUJB 3HGNA 2ZDLA 3LONA 4JCNA 1SI5H 4ABHA 4NG9H 1S5SA 4Z6AH 5EQSA 4O97A 2EQNA 2XCNA 4X6PA 5FPTA 3GCTF 2VH6A 4RT1A 2WV9A 3GYMA 3H7OA 3M35A 3L33A 1FUJA 2A4OA 2WYJA 3GY4A 3OEED 1GBHA 1KXFA 1L2EA 4HGCA 1THRH 1BRCE 1BA8B 4BOHA 1B0FA 2TGTA 1GI6A 1OWEA 1OYQA 2B9LA 2XC0A 3F6UH 1YPHC 4NA7A 1C2IA 1O2GH 4MPWA 1DDJA 2FP7B 3ATMA 4A5TS 1GBEA 4TPIZ 1C4Y2 1ZHRA 2C8XB 5AFZH 4MNWA 5JDUB 3WY8A 5L6NH 2BMGB 2FLRH 3QUMP 7GCHF 3ZVCA 1WQSA 1C2GA 1LKAA 2Z9JA 2HNTE 5DGJA 7LPRA 1P9UA 2O8LA 4NA9H 4HFPB 2NWNA 1QTFA 2SGEE 1C2HA 4A7IB 1BHXF 4K8BA 1DSTA 1IQLA 1MBMA 2F9UA 2WYGA 2Q6FA 3F68H 1UHBA 5A0AE 3BV9B 2FODA 3AASA 3PRDA 2ODYB 2ZDMA 1QBOA 3ZZ6A 2WSSD 5TJXA 1MH0A 3DHKH 4CHAB 3OE7D 1Z6EA 3VXFH 1CO7E 4Y7AA 3A7TA 3UUZA 3KYGA 4I8JA 2BDBA 1UW7A 3NK8A 2LNCA 1OYTH 1ARBA 2BD3A 3TGIE 1EJAA 3F0OA 1BMLA 2BY6X 2VU8E 1H8DH 8GCHF 1ZTJA 3SNEA 2EC9H 4K60A 1ANDA 1W7XH 3T2NA 1O2IA 2Z3DA 1CA0C 5CHBA 1HV7A 4CRFA 1FZZA 3I29A 4UE7H 5DP6A 2FI3E 4ACAA 1NZQH 2P94A 1S84A 5KGOA 4XE4A 4A1VA 1ZJDA 1ESBA 1YLNA 4B74A 2G52A 1QL8A 4ZKRU 1O3NA 1EP6A 5KECA 4NIXA 1WBGB 3PMBB 2CJIA 4M7GA 1QGFA 3ATLA 1PQAA 4GAWA 3PV4A 3OU0A 4YXWD 1O2VA 1RIWB 3VB4A 3ZYDA 3SNDA 2ZDVH 2Q6DA 1FMGA 4DT7B 5B6LA 1XXDA 4FUIA 4P00A 1LVMA 5EGMA 3STIA 1PPFE 3MYWA 1NC6A 9LPRA 1EFRD 4CRGA 1SVPA 2BM2A 5GXPA 3VGCC 4X0WU 3BG4C 1YPLH 1V2WT 3SV2H 1AMHA 1PYTD 4R0IA 1GHVH 1P04A 2PKSB 1SQRA 4NSYA 4B2AA 1PQ8A 3DFLA 4ZXYH 4CR5A 1TRNA 1A0HB 2L74A 1GHWH 3Q00A 1XUKA 2GVFA 4NCYA 1M9UA 6GCHG 2KAIB 1LO6A 1AVGH 2SGFE 5EODA 5F6MA 3LT3A 3SU2A 4IGDA 1O2TA 1YPGH 1TBRH 1AKSA 2ZPSA 1BTYA 2GV6A 1HBTH 3U1JB 1KSNA 2R9PA 5FPSA 1LHGH 4X2VA 2GMTB 3W95A 4K1EA 1ID5H 2XWAA 3EGKH 3UY9A 2A0QB 1TPAE 2QYIA 2F9VA 1K2I1 5FBIA 4WJG2 3GISB 1XMNB 3CS7A 3RXPA 1YBWA 2A4GA 1O5DH 3SZEA 1HNEE 1F5RA 1UVTH 1FAXA 3RXAA 3SNBA 2ZA5A 4XRNA 3ZZ7A 1PPZA 2VVCA 1TGTA 3L3TA 5IK2D 1CE5A 3UWIA 1BBRE 3MO3A 1T31A 1O2JA 4WWYA 4ISIH 1FDPA 3A84A 3LOXA 1Z8JB 4JZ1A 1SGEE 1SGPE 3HKJB 3ZVEA 1BITA 5DSFA 3B23B 1GHAG 1GI5A 1GJDB 1G32B 3QO6A 4GHTA 1KLJH 3LJOA 1BTWA 3MTYA 4NFFA 1TNGA 1ABIH 2AFQB 1G2MA 4M9FA 3OEHD 2F43B 4X6OA 1XUHA 1O34A 2VGCC 5JBTA 5E2PA 3DD2H 4U32A 1SL3A 1SGQE 1F0UA 2EI7A 1WOFA 2Z6BD 1NTPA 3RXUA 1DUAA 2ASUB 4FUFA 2FZZA 1KLTA 1YP9A 4X8VH 3BEUA 1GJ9B 3SU5A 4J1YA 1FLEE 2ZCHP 3ZZBA 4YESB 1SQTA 4ZROA 4THNH 5C0UA 1FXYA 3HATH 1TALA 3ELAH 5EJ1A 2F9BH 5HKKD 1UJ1A 2TGDA 1GCTB 2G55A 1QCPA 5GWZA 3TIUA 2J95A 2BY8X 3ZZCA 1YM0A 4BAHB 3UR6A 2JKHA 2AEIH 1QFKH 5C0TA 4YLUA 1NRQH 1BRBE 3SO3A 1P2MA 3QZRA 4NSVA 4ZHAA 3HK3B 1FJSA 2VNTA 3M5MA 4Y6DA 3TGKE 1C4U2 1C5WB 2ODPA 4MPVA 3KQDA 1LHDH 5H4IB 5TCAA 1B5GH 1WAYB 4WMFA 4CHAC 4ABAA 3T29A 3LC3A 2NU3E 4Y0YE 1GMCF 3OX7U 4AX9H 1ELBA 1MTWA 1SLXB 2OC0A 3GY5A 1ZRKA 5C5OA 3FP8E 1YPEH 3U8TH 2KM0A 3KCGH 1BRUP 4NA8A 3LH3A 2FTLE 1UVUH 2PGBB 2WPDD 4MDSA 3RXCA 4I8HA 2BZAA 5EG4A 1BTXA 3RC4A 4NIWA 1RJXB 5EW2H 2HPQH 4FUBA 5L2ZH 2XYAA 2ZTZA 2PLXA 4ABGA 1OHHD 2QE7D 3AAVA 3FKSD 3DA9B 3ZVDA 3IWMA 2ZTXA 1C5UA 1L0ZA 4XSKU 4YT7H 2XBVA 3SI3H 2XNIA 3PWCA 4GLYA 1S6HA 4TT3D 1C5NH 1C2KA 3KQBA 1GVLA 4IN1A 2JH0D 3K6ZA 4RI0A 2O8UA 2PWXA 2QXGA 2FTMA 3HK6B 4AFUA 1DICA 4XFQA 5K7RA 1SQOA 4MPXA 3RXTA 3M3SA 4F48B 3EE7A 3PWBA 2BQWB 2WPMS 5HM9A 2AMPA 3JZ1B 1TX8A 2PKSC 3UQVA 1IQGA 3PMJA 4QT8C 2PKAB 1QJ1B 2FOGA 4D9QA 1YKTA 2ANMH 1CHOG 1YWUA 1OWKA 4Q7XA 4Y7BA 3QTVH 1TRMA 5EOKA 1ESTA 1GMDG 2ANYA 4OS5A 1U6QA 3SOSA 1EKBB 5BPEA 1HAVB 1OSSA 1O3PB 1C1VH 2W3IA 1GBTA 3MU8A 1IQNA 1UTKA 2XC5A 3PTNA 2GMTC 1BTUA 3PMHB 3PMAB 4IBLH 2A7HA 1CHGA 1TOMH 4X1RU 1TGNA 1D6RA 1AUTC 3WWFA 1V2QT 1ARCA 1MD7A 1QR3E 1A5IA 2ZNKH 2BDAA 2H5DA 2RA3A 2ILNA 2XCFA 3KQEA 1V2ST 3SHAH 1FX0B 1C1RA 3MFJA 1ZZZA 1DLKB 2EY4C 1JWTA 3E90B 3RLYH 1TGSZ 1AIXH 1FN6A 2ZP0H 1JMOH 1JRTA 1THSH 4DVAU 1ANCA 1C5OH 4KTSA 1EP5A 1Z7KA 1PJPA 1TMUH 1ANBA 1A2CH 1T8MA 2RDEA 3M3TA 1RTLA 2STBE 1HJ9A 1OKXA 2OXSA 2ULLA 1L4DA 2ZPQA 4BAKB 1UTNA 3DUXH 4H42U 3URCA 2QY0B 3V7TA 1EZUC 1BUIA 4A1TA 1A1RA 3NKKA 1L4ZA 1SFIA 1Z1IA 1RRKA 1SGDE 2BB4A 3NRLA 5DP4A 3KHVA 2ZHFH 3BG8A 4AG1A 4AYVB 1AB9B 4KTCA 4Y8ZA 5FHTA 1QB6A 4A6LA 1QJ7B 1HJ8A 2ZQ2A 4A92A 2H2ZA 4CREA 1YLDA 2BLVA 3HKIB 3GCNA 1YPHE 3PTBA 3U9AH 1EAWA 3TK9A 1AHTH 2ODQA 1A46H 4RKJB 1SQAA 5DP9A 2GJGA 1F0RA 3SU3A 2ALVA 5JBCS 1AVWA 5T6FA 1DITH 5LGOA 1UTPA 2R3UA 4BTUB 3FN8A 2HLDD 1K1PA 1GI9B 3E0NB 5EXLA 2RFKC 3AW1A 3F2HA 1ABJH 2VWLA 1GBDA 3MNCA 2P3TB 1DLEA 3E0PB 4AB8A 1HIAA 1V2LT 1FQ3A 4BAOB 1W3CA 3UREA 3GY7A 1G36A 3N7DA 3GY3A 1F2SE 2PW8H 1GCTC 3IG6B 4ESTE 1AQ7A 1FY8E 3GS9A 3IITA 1WYKA 5L30H 2RDLA 1CVWH 4X2WA 2FOFA 1O2UA 4DY7B 1W2KH 2V3OH 2KCOA 1TA2A 4LK4A 1YY3A 2DE9A 1BIOA 1O2XA 1WU1A 1PYTC 1GPZA 5JBBS 2OP9A 1K1LA 1Y8TA 1LHFH 3SV6A 1SHYA 4BNRA 2AGIX 1AFEH 1C2JA 1HAXB 1AZZA 1NY22 1G3CA 5T3HA 1LDTT 2SGDE 4I86A 3ZZ8A 4U30A 3QTOH 1FY3A 4K1TA 1KXAA 3UFAA 5JBAS 1C2EA 1KDQB 1XX9A 1S83A 1B0EA 2ZHEH 4MNXA 1BHXB 2ZGBH 1DPOA 1MAXA 4HI3A 2ZFFH 5C20A 2WPHS 2BDIA 3FVFB 1EB2A 4BTTB 2R0LA 1QB1A 3QZQA 2W3KA 2F4LA 3PLKA 2NU2E 1SGFA 2XRCA 3K2UA 3QN7A 1S0RA 3GY6A 3LC5A 4AN7A 2CHAB 5C1UA 1EAXA 1WQVH 4MG3A 1YLCA 1ZMNA 2ZPRA 2TRMA 5LPEA 3VFEA 4MTBA 5HYOA 5LPRA 2R2WU 5CMXH 1BQYA 4WF8A 1G9IE 3RU4T 3RDZA 3KIDU 1P09A 3V0XA 1HPGA 2CF8H 2VBCA 4DOQA 2O8MA 3JZ2B 2CGAA 4D8NA 3ODDA 3BTME 1GHBF 2P3UB 3S9BA 5E0GA 1RS0A 2FS9A 4X2XA 3SNCA 3QLPH 2JETC 2D1JA 1ZPCA 1Z1JA 2XW9A 3RMOH 3NPSA 4UDWH 4RT0A 1C1NA 5A0BA 1O2WA 1C1SA 2CK3D 1G3DA 1GL1A 2ZGJA 4VGCB 3SV8A 1LPKB 1W7GH 1V2OT 3MH5A 4FOUC 4I8GA 1AKSB 2PUQH 4JMYA 3SJ9A 1UK3A 1QL9A 1F0SA 1MU6B 3LU9B 4ZH8A 3DSOA 3GCTG 1F0TA 1EZXC 1GWAA 5G4BA 4TWYA 4CH8B 1WV7H 3FZZA 2ZU5A 5FX6A 3RXJA 1LPGB 2PTCE 3SORA 1QZ8A 2DUCA 1YPKH 4GVUA 3K6YA 4UFDH 3TJUA 1MTSA 1GHXH 4XD7D 1S6LA 1SGTA 2ZU3A 1OWJA 3P95A 1C1TA 2G4UA 2VIVA 4BXSA 3FP7E 2M5TA 2KCYA 3SNAA 2PHBA 5SGAE 3WW7A 2F91A 4AGKA 1UVPA 1B7XB 5FXLA 3AVZA 3Q77A 3KNXA 2J5UA 5EJLA 3SUEA 1GJ5H 1HDTH 5JB8S 2EEKA 4B71A 2J97A 2GCHF 2ZHWH 7GCHG 1FY5A 2FYQA 3S7HB 1F7ZA 2ZFTA 3A88A 1KY9A 1P10A 1GVZA 1O33A 4D7GA 1C5YB 1IHSH 1SGYE 1GI0A 1ZYOA 1TIOA 2QXHA 3EA9A 1YCPM 2JJ2D 4I33A 4ASHA 5EIYA 1ELVA 3LGUA 4DGJA 2AS9A 1ELEE 2UWLA 1GVKB 3BN9A 2G81E 4I8KA 3O8DA 3B9FH 1S81A 3ZZ4A 1AB9C 8GCHG 4ISNA 2W7UA 1MKXH 4WY3A 5AVDA 3ZZAA 4OS7A 4YO9A 3RXIA 2AYWA 2C8YB 1JRSA 2AHME 4JYTA 1ELFA 3LGTA 3VEQB 2Z9GA 1C1MA 3A7XA 4TWWA 2OC8A 1YPMH 5L2YH 4FU9A 1CGHA 3PO1B 3E1XB 3SW2B 1O2LA 2VH0A 1O35A 1VGCC 2OINA 1TWXB 4Y76A 1Y3XA 4OGYA 4Q4LA 3PB1E 1QL7A 4P02A 1FPHH 4X8TH 1NN6A 1TNJA 1UK4A 1EASA 2HNTF 1BJUA 1N6XA 4RKOB 1UTLM 1Y3UA 1V2JT 2K8IA 1DE7H 1D9IA 4J2YB 4H4FA 1LCYA 1QURH 3BEIB 2ZDNA 1AO5A 1WUNH 3DT0H 1K0HA 1W8BH 1ZSJA 2PSYA 2HRVA 4MNVA 1AI8H 1GJ4H 3ESTA 1KXCA 3VPKA 5HIZA 5I25A 4MVNA 4YLQH 5FX5A 1AY6H 2YMSB 1C1OA 2GCTB 2HOBA 1MZDA 1LHEH 1HFDA 2W6JD 2NU1E 3KL6A 2YNBA 1Q2WA 1OOKB 2GDDA 4ISHH 1G3BA 2AIPA 2QIQA 2ZECA 2ZQ1A 4Y11E 3SU1A 1A3BH 2H1UA 1O2QA 1AE8H 3N7EA 1QJ6B 3SQHE 1IQIA 2CHAC 2HALA 4DIIH 3A8DA 1LMWB 1A0JA 4INKA 3OTJE 4JK6A 5K0HA 3UWJH 1MKXK 2ZGHA 3TH3H 5DP5A 4AG2A 3OY6U 2XC4A 1ZSKA 3Q76A 2ZU2A 4IW4E 3RMNH 3MQKC 1E1QD 2QC2A 2CV3A 3VG8A 1JIRA 3RU4D 1O2YA 4YT6H 5JB9S 1HB0B 2WINI 1O3EA 1UO6A 2JJ1D 1EJMA 1VITF 1NFUA 1RTFB 2HWLB 1QB9A 1ZHPA 4WXVA 1V6DA 1O3CA 2PP6A 4ZKSU 1IQKA 3F2GA 4AC9A 4OGXA 1MABB 3GCOA 4B2BA 1GI8B 1EZQA 4I7YH 1A0LA 2Z9IA 1AN1E 4VGCC 4FETA 1V2RT 1O2ZA 3CP7A 2A1DB 3T25A 2UUKB 2AMDA 3H09A 4AYYB 5GCHF 1HAOH 1P03A 2CF9H 2BOHB 5HMAA 4GCHF 1FONA 2J2UA 2CN0H 3CS0A 1O5FH 2LELA 1VZQH 3VB5A 5C3NA 1MTNB 2A5KA 1BJVA 3RXRA 2V6NA 1DWCH 2Q6GA 1KMHB 3RP2A 4B75A 3SJIA 2FOAA 3NXPA 4K69A 1EPTB 1N8OB 4XDEA 1EX3A 4B6FA 2M2AA 4ZHLU 2BLQA 1ZJKA 6CHAC 3GDVA 2VIDA 1H4WA 1VITH 3BTEE 2Y6TA 1SGCA 1A61H 2JH5D 3PV5A 2KCPA 1VJAU 2J94A 1KYNA 1J9CH 3A7ZA 2FWWA 4O9VA 1FI8A 1NM6A 3AAUA 3RM2H 1GBKA 2ANKH 2GT7A 1ZGVA 1V2KT 3DFJA 3OSYA 3RXQA 1EATA 3SN8A 2V3MA 3UOUA 1TMTH 1RFNA 3SGBE 2BHGA 3F9FA 1ZRBA 1GBAA 1OWHA 3E3TA 1DT2A 5C1YA 4PROA 2Y7ZA 2O8TA 4WVPE 3K65B 4YOIA 5F8ZA 4OS6A 2FX4A 2BXUH 1GMCG 3LGYA 1Y59T 1V2TT 2A32A 1NFWA 2OBQA 4NFEA 3QGJA 4MLFB 3H7TA 4TYDA 1TYNA 1X7AC 2IJD1 1WTHD 1QHRB 1FPCH 1OS8A 1QQUA 3E8LA 2PV9B 1IQHA 1VCPA 3O8BA 2BVXH 2UWOA 1HLTH 2A5AA 2A7CA 1BBRH 2AGEX 4BANB 1YF4A 3A7VA 2EI6A 4ZAEA 3ATWA 2KAIA 3W1EA 5DO4H 3F3BA 2IN2A 1SBWA 3LDXH 4AFZA 3FAOA 5E0HA 2A7JA 3SU4A 1A4WH 2BQ7B 3PO1C 1HJAB 1QNJA 4IC6A 2BD5A 2VVUA 1GI1A 4SGAE 4D7FA 2J98A 2Z7FE 3K9XB 3MU5A 2ANWA 4LOYH 1V2UT 2F9PA 2FEQH 2ZZUH 4SGBE 4INLA 4UFFH 2O9QA 8LPRA 4X1PU 4ABEA 3SQEE 3VB3A 1NU9A 3P17H 4X1NU 3SU6A 1GDNA 1A5HA 1IOEA 4ISLA 1CT0E 2H6MA 2JETB 1Z6JH 2BDCA 1N1LA 4UEHH 1C5RA 1HXEH 1UVSH 5AHGH 2NU0E 1SLVB 1TLDA 1W14U 1HUTH 3M7QA 4GUXA 2BLOA 2BYAX 3A81A 1O2SA 1O2HA 1OXGA 3TH2H 2FLBH 3ZVBA 1C5PA 3GDUA 3A87A 3T62A 4U2WA 3GYLB 4O03A 1W0ZU 1P06A 4CRAA 4E05H 5DG6A 1BTPA 2YMSC 1CHOF 1DM4B 2Y80A 1DANH 1O3MA 1EJNA 2GCTC 1C5MD 3BTFE 2GDEH 2ZO3H 1BTHH 4Q63A 1HAIH 3MNXA 3NZIA 4Y71A 2Y5GA 2OK5A 1TNHA 2Y5HA 1DWDH 3BEFB 1H8IH 3E16B 1UVOA 2FOMB 4BAMB 1TAWA 1HAHH 5ABWA 3ENSB 2TGPZ 1G30B 4GSOA 5C5NA 1O3JA 1C2DA 1O36A 1MU8B 2PGQB 2Z94A 3I77A 2KR7A 3PV2A 1IAUA 2FI5E 5FCKA 2ZWLH 3TLOA 3TPIZ 2V3HH 3A85A 3N7OA 1HAYB 2XNDD 4GPGA 4DW2U 4YM9A 1TNIA 4E7NA 3BSQA 3NCLA 1FY4A 1VKYA 3LGVA 2TBSA 1O5AB 1E36B 2FESH 1ELDE 1GDUA 1BBRK 5JPMH 1GJBB 5C2ZA 2XBYA 1HCGA 1TOCB 3ZVAA 2G51A 1NRRH 1TPPA 1D3PB 2Y7XA 1EQ9A 4I8LA 2Y81A 1DWBH 3GICB 3RXLA 1ZPBA 2QXIA 3F9EA 1XKAC 2FYRA 2IPQX 1GJ6A 2P3FH 5T6DA 3M61U 4WH6A 1BOQA 1FAKH 3ZV9A 4AZ2B 3VXEH 3EQ0H 1TE0A 2OTVA 3M7TA 2FM2A 4Q2KA 1VCWA 2BY7X 1GG6B 2J4IA 1JBUH 1IQFA 1LPZB 1MCTA 3Q3YA 1G2LA 2TGAA 1K1IA 3P8GA 1RGQA 1MTNC 1G3EA 1NROH 3KYFA 3A82A 4X6NA 4IMZA 2XTTB 4HZHA 1MD8A 1P3CA 1EPTC 4GHQA 4AFSA 1N8OC 1C1WH 1O2OA 1VGCB 4AFQA 2THFB 4ABBA 5A8YA 1DX5M 1S6FA 1C2FA 1T8LA 3PRBA 5I46H 1V3XA 2ZKSA 2ZHQH 3T5FH 1OP2A 1MTUA 1CBWB 4O3TA 2BDHA 3RM0H 2GV7A 3SJOA 1GBFA 1GJAB 4OS4A 2DE8A 4D76A 1PPCE 1SB1H 3GY8A 3SBKA 1MAYA 1D3DB 3RXDA 3BIVH 1UHBB 2PR3A 4INHA 3KN2A 3RXSA 1AZ8A 1CGJE 3SHCH 4KKDA 1AGJA 3MH7A 2VVVA 2QA9E 5EJZA 3FP6E 2LP6A 2FXRA 4I31A 3ZYEA 2PTNA 3PROA 1C9TA 5AFYH 2OC7A 2AERH 2QAAA 2QF0A 1IHTH 1F5LA 1SGFG 1W0KD 3SV9A 1TX6A 1UMAH 1P2QA 2CXVA 3D49H 1K1JA 3H5CB 3RXBA 1TPOA 5C1XA 1CU1A 2RG3A 4O3UA 2FPZA 2WPIS 2UUYA 3PLBA 5B6OA 1O5CB 1GHYH 1O3GA 3ZVGA 4NZLA 5HGGA 4AB9A 3RC5A 2UWPA 3SJKA 2A2XH 1GBCA 3AK5A 2PKAA 4MNYA 1E0FD 3U1IB 4F49A 3UNQA 4BTIB 3UIRA 1L1JA 3S7KB 1Y5UT 4K1SA 1ZOMA 3BTQE 1J16A 1P2IA 2A2QH 1S82A 2K0QA 1J17T 3G01A 4XBCA 3MO9A 1O3HA 3P6ZB 1CT2E 1LQEA 2K1QA 1HAVA 3PM3A 3TU7H 1O3BA 1ZR0A 4MQAA 1INCA 1K1OA 1HJAC 5ESBA 2BVRH 1UTOA 2FOEA 2H5CA 2SGQE 1DFPA 1DXPA 4Y79A 1NRSH 5E0JA 1E1RD 1P8VC 3C1KA 1A3EH 1EZSC 2XWBI 1C5QA 3O8RA 1EOLA 1GL0E 3BTWE 3ZZ5A 5DPAA 1FV9A 2JIZD 2J92A 1NFXA 1XUIA 1V2MT 1GHBG 1H9HE 1AWFH 1SKYE 3GCHC 1GMHF 1DOJA 1TGBA 4I32A 2KFWA 8ESTE 1MTVA 3QGNB 1BMNH 1BTZA 3FANA 5C94A 2GZ8A 4DJZB 2H9HA 1LHCH 1HXFH 4NIYA 1NPMA 3E91A 1LVBA 1E37B 2IOTA 5T6GA 3Q3XA 3FOAA 2FMJA 1VJ9U 2YMSD 3UNSA 1P2OA 2VWOA 5J4SA 4CR9A 2C4FH 2ZFSA 4FUCA 1Q31A 2JDID 5F03A 2ZC9H 1O3AA 2ZGCA 4FUJA 1S0QA 6CHAB 4AGJA 4ACBA 4FVDA 2VIWA 1DUEA 2RCEA 1QRZA 2ZTYA 1RXPA 1EAUA 1BDAA 3EE0B 1A5GH 5CDFE 1C5TA 1Z71A 2ZCLP 5ESTE 3MO6A 1C5SA 5A09A 2ZG0H 1AWHB 1EUFA 1YPJH 1O3FA 3W94A 1O39A 1OX1A 1FNIA 1D6WA 2IJOB 4TY7A 2GCHG 4ISOA 1OP0A 3UQOA 3FFGA 1PQ5A 3QDZB 2OQ5A 2D26C 2ZCKP 2V35A 3MNSA 3SV7A 4IC5A 1PQ7A 3OYPA 3TVJB 3P8OA 3V12A 4D9RA 1GDQA 1TA6A 1HAGE 1QRXA 3BTHE 4ZHMU 4FU8A 3A8BA 1FY1A 1T8NA 1NFYA 5GNDA 2STAE 2W26A 1UCYH 1P11E 2BDYA 1GI4A 1NT1A 2SFAA 2Z9LA 1SLUB 1NU7B 3ZZ3A 1MMJN 4A1XA 2D8WA 3OTPA 3SYJA 3TH4H 1SR5C 1ZTKA 3S0NA 5A0CA 1PPGE 5JYIA 1ELTA 1GG6C 2QXJA 4DT4A 2F9NA 1OWDA 1LQDB 3EA7A 2FO9A 4X1QU 4R8TB 5C17A 1DY9A 3EDXB 5CE1A 3ATIA 3P8NA 3RXFA 3F2FA 2TPIZ 3RMLH 3QWCH 3UR9A 2BLWA 3PYHA 1FIWA 1S85A 1KDQA 3SUGA 1O37A 3I78A 3GY2A 2GT8A 5HM2A 4FUGA 3MH4A 5A2MH 1ELAA 3T27A 3TK5A 1LTOA 9ESTA 3VB7A 2OC1A 1CBWC 1TBZH 3NUMA 1GCDA 3S9AA 2FIRH 1ELGA 1NESE 2Y5FA 2ZGXH 4K2YA 1XVOA 3CENA 3S69A 1HRTH 1K28D 3RXHA 4ZCNA 3S9CA 3BTGE 2WZQA 1AU8A 3GOVB 5T1VA 2G5VA 3U28C 1NRPH 5DN6D 5FPYA 1HYLA 4X1SU 3UB0A 2VWNA 1W0YH 3BIUH 2VB0A 3R0FA 1C1PA 1XUGA 4JYUH 4IS5A 2G00A 5A8ZA 1Y5AT 1SG8B 1ZTLA 2PFEA 3M7UA 1QBVH 1Z8IB 1BRAA 1SC8U 6GCHF 3A86A 1D3TB 2C8WB 2BY5X 4X2YA 1XVMA 2BVSH 3Q3KA 3TNSA 3KQCA 1P2JA 3A8CA 2P16A 2J38A 1NRNH 2P93A 3TITA 5EXNA 2G8TA 1IQEA 4UONA 3ZZDA 2A31A 2G5NA 1V2VT 5FAHA 1UCYK 2P95A 2ALPA 1GGDB 2A4RA 1BT7A 2H9TH 3QX5H 2J98B 1GI2A 1ZLRA 4LZ1H 4TSFD 3TJVA 1C5XB 2OD3B 4OS2A 2XBXA 1MUEB 1KXEA 5LPFA 1O3OA 1O5GH 5EQQA 2OQUA 1MQ6A 2VWMA 1XKBC 3M3VA 1WTGH 3SUFA 1E38B 1NBMD 4RN6A 5DP7A 4BXWA 1GJCB 2AGGX 1H1BA 3RUOA 2ZHDA 5HXFA 1ZHMA 1C5LH 1VITG 1DVAH 3QK1A 1D4PB 5EPNA 5C67A 4IMQA 5GDSH 1WDIA 1KTSB 3D65E 5BRRE 4CBOA 3D62A 2GTBA 2W6ID 2VINA 1H9LB 5F8TA 3TK6A 1GHAF 1TNLA 4B6EA 4Y8XA 1TPSA 1QRWA 2JH6D 1O5BB 2HNTC 3FO8D 1QA0A 1MZAA 2FOCA 5GCHG 5E2OA 2SGAA 2A4QA 1UK2A 4GCHG 1E34B 2WPKS 4KGAA 2BQ6B 3STJA 3TJOA 2C90B 4WMDA 2QN5T 2HLCA 1ETRH 2OCVB 1TGCA 4Q7ZA 3A7YA 5CHAB 4UFGH 4ABIA 1T4UH 2EA3A 1K1MA 2ZEBA 3ATKA 1E79D 3TNTA 1BZXE 3N99A 1SGIB 2H9EH 3HGPA 1QIXB 3BTKE 1F5KU 3OAAD 1ESAA 3P92A 4ZMAH 1HGTH 4ABFA 2BX3A 4UD9H 3L6PA 2HGTH 1MKWH 1BMFD 2ZDKA 3M37A 2Y82A 1NO9H 1J14A 2ZFPH 1O2NA 2ESTE 1OWIA 1SOTA 1FN8A 3RXVA 4NWLA 1SGRE 4B1TA 1AE5A 1TNKA 1C1UH 1LKBA 4CRDA 1TABE 4X8UH 1OPHB 2P8OB 2BD2A 4Z1MD 4CRCA 1IQJA 2BOKA 3KF2A 1T7CA 2BD8A 2QCYA 1A7SA 3F9GA 5F8XA 4YTAA 1F92A 2BD9A 3EYDA 1P12E 4WMEA 1P57B 1TMBH 1ETSH 4FUHA 2I6QA 2B8OH 2V7QD 4JZFH 2QV1A 3R3GB 2B5TB 3RXMA 5TCCA 1HAPH 3A80A 2WV5A 3F1SB 3MHWU 1AFQB 5IYTA 3A89A 2KCAA 1HIAB 2CMYA 1DS2E 3BTTE 3SUDA 3ZIAD 1O2RA 4F55A 1AD8H 1MBQA
chains in the Genus database with same CATH topology
1VR1H 4JZDH 2Z3EA 1TX7A 4JK5A 1P0SH 3URDA 2BD4A 1TQ7B 1WSSH 3U69H 1KXBA 1RD3B 1TQ0B 3AW0A 4NGAH 4H6TA 4ABJA 4FUDA 4AOQA 2ZU4A 1THPB 2O8WA 3V3MA 4B73A 1GHZA 4Y10E 3RC6A 1Y3VA 4OS1A 3ITIA 2A45B 1O32A 1O5EH 2WUBA 3A8AA 4B76A 2QGRA 2L6OA 3LGWA 2ZF0H 4XBDA 1JOUB 3ZVFA 1C1QA 1Q3XA 1C4V2 1IQMA 1C9PA 2F9OA 1DY8A 1K22H 4K8YA 5J4QA 1GJ8B 1RIWC 1K21H 1O0DH 1RTKA 1K9OE 3GCHB 3UOPA 3C27B 2VIOA 5LH8A 1ETTH 1SMFE 1WXRA 1T8OA 1BB0B 2I6SA 2ZI2H 2WPJS 2R2MB 4E06H 2RA0A 3B8JA 1AVXA 1CA8B 1OP8A 2G4TA 3RXKA 4ZUHA 1P2NA 1AUJA 1G37A 3U98H 3KGPA 5EQRA 5PTPA 5ETXA 3E6PH 1GJ7B 1EOJA 2YNAA 5A8XA 1PPBH 1EXFA 3TGJE 1O38A 2D2DA 2XBWA 2BTCE 4FXGH 4FU7A 4WXIA 4ABDA 1D3QB 1KIGH 2AIQA 5DP3A 1MKWK 1MQ5A 2HPPH 3PLPA 2Q1JA 3SI4H 3V13A 1H8ED 1WCZA 2C8ZB 4CRBA 5EU8A 2VIPA 1SPJA 1QY6A 2VIQA 4ZXXH 3MOCA 4RSPA 4ASUD 1GMDF 2BZ6H 3M5OA 1YYY1 2EI8A 1ZMLA 3RLWH 5DKMA 2Z9KA 1SLWB 5DJ7A 2FX6A 1N6YA 4KTUA 5FL7D 1SSXA 3RXEA 2C3SA 1W12U 3UTUH 1O3IA 4F4OC 2AH4X 3RU4E 4JYVH 4DG4A 3EA8A 1NBME 3U8RH 1L1NA 2PSXA 2BX4A 3KEEA 1GGDC 1Y3YA 1YCPH 2F3CE 4FVBA 3SU0A 3MMGA 3MU1A 5AF9H 2F83A 1L1GA 1EPTA 2IPHA 3O8CA 6ESTA 2OLGA 3D23A 1XXFA 2R0KA 3ZZ9A 1PPEE 1DWEH 1W0JD 1W11U 3TJNA 4TPYA 2SNVA 1XUJA 1Z8GA 1CGIE 2YOLA 4TY6A 3MU0A 2QF3A 3GDSA 8KME2 3M5NA 1EB1H 1NS3A 1QBNA 2FDAA 4YZUA 4YOJA 3T26A 2ZDAH 1SGNE 1W10U 3RXGA 2FOHA 4NZQA 1O2MA 4BAQB 1C5ZB 1TONA 4K5ZA 1CSOE 5EPYA 4Y0ZE 1P02A 2GD4B 1UTQA 3WWBA 1DXWA 3OY5U 4KP0A 2OBOA 4E7RG 2ZFQH 1V2NT 1C5VA 1CT4E 2P59A 3UPEA 1VCQA 2SGPE 3HPTB 5E8EH 1CA0B 4DURA 1O2KA 1GI3A 3BF6H 3VB6A 1BMAA 2Z3CA 1O2PA 3A83A 3P70B 5GIBA 5EXMA 2WHXA 2KZ4A 1Z8RA 1PFXC 3MI4A 1ZPZA 4X6MA 4Y8YA 2OUAA 5CHAC 4AORA 2TIOA 7ESTE 2BD7A 1P3EA 1O31A 1BMMH 2BY9X 2GX4A 5GJ4B 4HTCH 3DCLA 3RMMH 2XXLA 3M36A 1GBJA 2J9NA 4Z0KA 1ZMJA 1YGCH 5IDKA 1KTTB 3MH6A 3LKWA 2B0FA 1ZGIA 4UFEH 1MCVA 2J34A 1P01A 1BCUH 4K3JA 4LXBH 1T4VH 3A7WA 1P05A 1K1NA 1J8AA 2ZU1A 5FCRA 3OFND 4H6SB 2UUFB 5DP8A 1SOZA 1XUFA 1C2MA 3ODFA 3VGCB 2GZ9A 2WUCA 1COWD 1P2KA 1P9SA 6LPRA 3BG4B 3LPRA 1GI7B 1TB6H 3UNRA 1SHHB 1GBBA 2SNWA 4WH8A 1O3KA 2GGVB 1YCPK 3P8FA 1J15A 2P8OC 4DCDA 4JZIA 7KMEH 2XOKD 2LPRA 1O3LA 1QQ4A 1TBQH 1GBIA 1UTMA 1YC0A 5EW1H 1SFQB 2BDGA 1FIZA 2C93B 3MU4A 1KLIH 3SGQE 2GP9B 1GBLA 2FI4E 3DSPA 4XOJA 1JXPA 3F0PA 1AFQC 4FUEA 3LIWA 1H9IE 3EAJA 1TRYA 2W7SA 3RXOA 1H8HD 3M5LA 5GPIB 4JZEH 3LGIA 5F53A 4ZKNU 2VJ1A 4OM9A 1ZSLA 2R3YA 2GKVE 1T32A 1UTJA 3SJ8A 2AMQA 2HVXA 3F9HA 4CH2B 1ORFA 3T28A 1W13U 5DK1A 1UCYE 3FZDA 2NU4E 1EAIA 1TFXA 4DIHH 2QF5A 2ZIQH 1PPHE 1CQQA 3SZNA 2GZ7A 2B7DH 3SGAE 2WPLS 1XM1A 3ZV8A 1QA7A 4NWKA 3BTDE 2BXTH 1ELCA 4U01A 2FOBA 5FBEA 4ZKOU 2W5EA 2WV4A 2FS8A 4Q80A 4XBBA 3U8OH 1LVYA 4X8SH 1Y3WA 1GMHG 1HAZB 3MWIU 1GBMA 1C2LA 1LVOA 1O3DA 4B2CA 1ACBE 4Q7YA 3MNBA 2PUXB 4IN2A 2V0BA 3LJJA 2ZFRH 1DSUA 4YOGA 4MPUA 4CBNA 4LZ4B 2QF4A 1E35B 1Y5BT 3LH1A 1KXDA 4KELA 2VGCB 3NWUA 2A5IA 1JIMA 4NIVA 1V2PT 1ANEA 1O30A 2UUJB 3HGNA 2ZDLA 3LONA 4JCNA 1SI5H 4ABHA 4NG9H 1S5SA 4Z6AH 5EQSA 4O97A 2XCNA 4X6PA 5FPTA 3GCTF 2VH6A 2WV9A 3GYMA 3H7OA 3M35A 3L33A 1FUJA 2A4OA 2WYJA 3GY4A 3OEED 1GBHA 1KXFA 1L2EA 4HGCA 1THRH 1BRCE 1BA8B 4BOHA 1B0FA 2TGTA 1GI6A 1OWEA 1OYQA 2B9LA 2XC0A 3F6UH 1YPHC 4NA7A 1C2IA 1O2GH 4MPWA 1DDJA 2FP7B 3ATMA 4A5TS 1GBEA 4TPIZ 1C4Y2 1ZHRA 2C8XB 5AFZH 4MNWA 5JDUB 3WY8A 5L6NH 2BMGB 2FLRH 3QUMP 7GCHF 3ZVCA 1WQSA 1C2GA 1LKAA 2Z9JA 2HNTE 5DGJA 7LPRA 1P9UA 2O8LA 4NA9H 4HFPB 2NWNA 1QTFA 2SGEE 1C2HA 4A7IB 1BHXF 4K8BA 1DSTA 1IQLA 1MBMA 2F9UA 2WYGA 2Q6FA 3F68H 1UHBA 5A0AE 3BV9B 2FODA 3AASA 3PRDA 2ODYB 2ZDMA 1QBOA 3ZZ6A 2WSSD 5TJXA 1MH0A 3DHKH 4CHAB 3OE7D 1Z6EA 3VXFH 1CO7E 4Y7AA 3A7TA 3UUZA 4I8JA 2BDBA 3NK8A 2LNCA 1OYTH 1ARBA 2BD3A 3TGIE 1EJAA 3F0OA 1BMLA 2BY6X 2VU8E 1H8DH 8GCHF 1ZTJA 3SNEA 2EC9H 4K60A 1ANDA 1W7XH 3T2NA 1O2IA 2Z3DA 1CA0C 4CRFA 1HV7A 5CHBA 1FZZA 3I29A 4UE7H 5DP6A 2FI3E 1NZQH 2P94A 1S84A 4XE4A 4A1VA 1ZJDA 1ESBA 4B74A 2G52A 1QL8A 4ZKRU 1O3NA 1EP6A 4NIXA 1WBGB 3PMBB 2CJIA 4M7GA 1QGFA 3ATLA 1PQAA 4GAWA 3PV4A 3OU0A 4YXWD 1O2VA 1RIWB 3VB4A 3ZYDA 3SNDA 2ZDVH 2Q6DA 1FMGA 4DT7B 5B6LA 1XXDA 4FUIA 1LVMA 5EGMA 3STIA 1PPFE 3MYWA 1NC6A 9LPRA 1EFRD 4CRGA 1SVPA 2BM2A 5GXPA 3VGCC 4X0WU 3BG4C 1YPLH 1V2WT 3SV2H 1AMHA 1PYTD 4R0IA 1GHVH 1P04A 2PKSB 4NSYA 4B2AA 1PQ8A 3DFLA 4ZXYH 4CR5A 1TRNA 1A0HB 1GHWH 3Q00A 1XUKA 2GVFA 4NCYA 1M9UA 6GCHG 2KAIB 1LO6A 1AVGH 2SGFE 5EODA 5F6MA 3LT3A 3SU2A 4IGDA 1O2TA 1YPGH 1TBRH 1AKSA 2ZPSA 1BTYA 2GV6A 1HBTH 3U1JB 1KSNA 2R9PA 5FPSA 1LHGH 4X2VA 2GMTB 3W95A 4K1EA 1ID5H 2XWAA 3EGKH 3UY9A 2A0QB 1TPAE 2QYIA 2F9VA 1K2I1 5FBIA 4WJG2 3GISB 1XMNB 3CS7A 3RXPA 1YBWA 2A4GA 1O5DH 3SZEA 1HNEE 1F5RA 1UVTH 1FAXA 3RXAA 3SNBA 2ZA5A 3ZZ7A 1PPZA 2VVCA 1TGTA 3L3TA 5IK2D 1CE5A 3UWIA 1BBRE 3MO3A 1T31A 1O2JA 4WWYA 4ISIH 1FDPA 3A84A 3LOXA 1Z8JB 4JZ1A 1SGEE 1SGPE 3HKJB 3ZVEA 1BITA 5DSFA 3B23B 1GHAG 1GI5A 1GJDB 1G32B 3QO6A 4GHTA 1KLJH 3LJOA 1BTWA 3MTYA 4NFFA 1TNGA 1ABIH 2AFQB 1G2MA 4M9FA 3OEHD 2F43B 4X6OA 1XUHA 1O34A 2VGCC 5JBTA 5E2PA 3DD2H 4U32A 1SL3A 1SGQE 1F0UA 2EI7A 1WOFA 2Z6BD 1NTPA 3RXUA 1DUAA 2ASUB 4FUFA 2FZZA 1KLTA 1YP9A 4X8VH 3BEUA 1GJ9B 3SU5A 4J1YA 1FLEE 2ZCHP 3ZZBA 4YESB 1SQTA 4ZROA 4THNH 5C0UA 1FXYA 3HATH 1TALA 3ELAH 5HKKD 2F9BH 1UJ1A 2TGDA 1GCTB 2G55A 1QCPA 5GWZA 3TIUA 2J95A 2BY8X 3ZZCA 1YM0A 4BAHB 3UR6A 2JKHA 2AEIH 1QFKH 5C0TA 4YLUA 1NRQH 1BRBE 3SO3A 1P2MA 3QZRA 4NSVA 4ZHAA 3HK3B 1FJSA 2VNTA 3M5MA 4Y6DA 3TGKE 1C4U2 1C5WB 2ODPA 4MPVA 3KQDA 1LHDH 5H4IB 5TCAA 1B5GH 1WAYB 4WMFA 4CHAC 4ABAA 3T29A 3LC3A 2NU3E 4Y0YE 1GMCF 3OX7U 4AX9H 1ELBA 1MTWA 1SLXB 2OC0A 3GY5A 1ZRKA 5C5OA 3FP8E 1YPEH 3U8TH 2KM0A 3KCGH 1BRUP 4NA8A 3LH3A 2FTLE 1UVUH 2PGBB 2WPDD 4MDSA 3RXCA 4I8HA 2BZAA 5EG4A 1BTXA 3RC4A 4NIWA 1RJXB 5EW2H 2HPQH 4FUBA 5L2ZH 2XYAA 2ZTZA 2PLXA 4ABGA 1OHHD 2QE7D 3AAVA 3FKSD 3DA9B 3ZVDA 3IWMA 2ZTXA 1C5UA 1L0ZA 4XSKU 4YT7H 2XBVA 3SI3H 2XNIA 3PWCA 4GLYA 1S6HA 4TT3D 1C5NH 1C2KA 3KQBA 1GVLA 4IN1A 2JH0D 3K6ZA 4RI0A 2O8UA 2PWXA 2QXGA 2FTMA 3HK6B 4AFUA 1DICA 4XFQA 5K7RA 1SQOA 4MPXA 3RXTA 3M3SA 3PWBA 2BQWB 2WPMS 5HM9A 2AMPA 3JZ1B 1TX8A 2PKSC 3UQVA 1IQGA 3PMJA 4QT8C 2PKAB 1QJ1B 2FOGA 4D9QA 1YKTA 2ANMH 1CHOG 1OWKA 4Q7XA 4Y7BA 3QTVH 1TRMA 5EOKA 1ESTA 1GMDG 2ANYA 4OS5A 1U6QA 3SOSA 1EKBB 5BPEA 1HAVB 1OSSA 1O3PB 1C1VH 2W3IA 1GBTA 3MU8A 1IQNA 1UTKA 2XC5A 3PTNA 2GMTC 1BTUA 3PMHB 3PMAB 4IBLH 2A7HA 1CHGA 1TOMH 4X1RU 1TGNA 1D6RA 1AUTC 3WWFA 1V2QT 1ARCA 1MD7A 1QR3E 1A5IA 2ZNKH 2BDAA 2H5DA 2RA3A 2ILNA 2XCFA 3KQEA 1V2ST 3SHAH 1FX0B 1C1RA 3MFJA 1ZZZA 1DLKB 1JWTA 3E90B 3RLYH 1TGSZ 1AIXH 1FN6A 2ZP0H 1JMOH 1JRTA 1THSH 4DVAU 1ANCA 1C5OH 4KTSA 1EP5A 1Z7KA 1PJPA 1TMUH 1ANBA 1A2CH 1T8MA 3M3TA 1RTLA 2STBE 1HJ9A 1OKXA 2OXSA 2ULLA 1L4DA 2ZPQA 4BAKB 1UTNA 3DUXH 4H42U 3URCA 2QY0B 3V7TA 1EZUC 1BUIA 4A1TA 1A1RA 3NKKA 1L4ZA 1SFIA 1Z1IA 1RRKA 1SGDE 2BB4A 5DP4A 3NRLA 3KHVA 2ZHFH 3BG8A 4AG1A 4AYVB 1AB9B 4KTCA 4Y8ZA 5FHTA 1QB6A 4A6LA 1QJ7B 1HJ8A 2ZQ2A 4A92A 2H2ZA 4CREA 1YLDA 2BLVA 3HKIB 3GCNA 1YPHE 3PTBA 3U9AH 1EAWA 3TK9A 1AHTH 2ODQA 1A46H 4RKJB 1SQAA 5DP9A 1F0RA 3SU3A 2ALVA 5JBCS 1AVWA 5T6FA 1DITH 5LGOA 1UTPA 2R3UA 4BTUB 3FN8A 2HLDD 1K1PA 1GI9B 3E0NB 5EXLA 3AW1A 3F2HA 1ABJH 2VWLA 1GBDA 3MNCA 2P3TB 1DLEA 3E0PB 4AB8A 1HIAA 1V2LT 1FQ3A 4BAOB 1W3CA 3UREA 3GY7A 1G36A 3N7DA 3GY3A 1F2SE 2PW8H 1GCTC 3IG6B 4ESTE 1AQ7A 1FY8E 3IITA 3GS9A 1WYKA 5L30H 2RDLA 1CVWH 4X2WA 2FOFA 1O2UA 4DY7B 1W2KH 2V3OH 2KCOA 1TA2A 4LK4A 2DE9A 1BIOA 1O2XA 1WU1A 1PYTC 1GPZA 5JBBS 2OP9A 1K1LA 1Y8TA 1LHFH 3SV6A 1SHYA 4BNRA 2AGIX 1AFEH 1C2JA 1HAXB 1AZZA 1NY22 1G3CA 5T3HA 1LDTT 2SGDE 3ZZ8A 4U30A 3QTOH 1FY3A 4K1TA 1KXAA 3UFAA 5JBAS 1C2EA 1KDQB 1XX9A 1S83A 1B0EA 2ZHEH 4MNXA 1BHXB 2ZGBH 1DPOA 1MAXA 4HI3A 2ZFFH 5C20A 2WPHS 2BDIA 3FVFB 1EB2A 4BTTB 2R0LA 1QB1A 3QZQA 2W3KA 2F4LA 3PLKA 2NU2E