4NWLA

Crystal structure of hepatis c virus protease (ns3) complexed with bms-650032 aka n-(tert-butoxycarbonyl)-3-me thyl-l-valyl-(4r)-4-((7-chloro-4-methoxy-1-isoquinolinyl)o xy)-n-((1r,2s)-1-((cyclopropylsulfonyl)carbamoyl)-2-vinylc yclopropyl)-l-prolinamide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
194
structure length
194
Chain Sequence
KGSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVESLETTMRSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HCV NS3 1a Protease
publication title Discovery and Early Clinical Evaluation of BMS-605339, a Potent and Orally Efficacious Tripeptidic Acylsulfonamide NS3 Protease Inhibitor for the Treatment of Hepatitis C Virus Infection.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 50
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nwlA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4nwlA01
3ZZ3A 1ESTA 1JRTA 2BY6X 1AY6H 1ARCA 1HAGE 1K1MA 2TGAA 1AIXH 4UD9H 3GICB 1O3GA 1QRZA 4BNRA 8GCHG 1P09A 1O38A 3M7TA 1MQ6A 3V13A 8LPRA 7ESTE 2C8ZB 1VJAU 5J4QA 3ZZ5A 1YLDA 2UUJB 2ZC9H 1QL8A 4YT7H 1C5PA 3NKKA 3U98H 2W26A 3SUDA 4TY7A 4CREA 3NK8A 2DE9A 1ELTA 5C1XA 4WJG2 1HAYB 1G3DA 1TBQH 2P8OC 1P2JA 1CT4E 3GCOA 1C4Y2 4NFEA 1HAVB 4HTCH 1UTQA 3SNCA 3EA9A 2GGVB 1PFXC 5BPEA 4DG4A 1CGIE 2P3FH 4X1NU 2GP9B 3LGVA 3QZRA 1P05A 3RXRA 1IQIA 2FTLE 5CMXH 2H1UA 2ODYB 3M35A 5A8YA 1MD7A 2WUCA 2ZECA 2FI3E 2C8WB 4UFFH 1SHHB 1EPTC 1YC0A 1O3MA 1UVUH 1BDAA 1P2OA 4DOQA 3NCLA 3L6PA 4H42U 3FAOA 4ABDA 1GJ6A 2YOLA 1SGTA 4D8NA 1LVBA 3LGIA 1T8OA 4U30A 1BOQA 1SLVB 1P2NA 4MNVA 2BVRH 2XWBI 3HK6B 3RC6A 2PTCE 1ARBA 2FODA 4OGYA 1QBVH 1EAUA 5EXMA 4I7YH 1GJ5H 2Z6BD 1ORFA 2BM2A 4RI0A 3T2NA 3SHAH 1KTTB 2RG3A 3KCGH 4LK4A 1GI4A 1MZDA 1O3JA 1TOCB 3RU4T 1C1SA 1W0ZU 3SHCH 2XBXA 3QX5H 1C2LA 3VFEA 1QL7A 1W7XH 4FUFA 5IDKA 2G5VA 4AZ2B 3VB6A 4X2XA 2PW8H 5LPRA 1HAPH 4CHAC 2WV5A 2DUCA 2VWMA 1K22H 1C2JA 2F9PA 1GI6A 1PPCE 2PKSC 1QTFA 1RGQA 4FUBA 1UJ1A 3O8BA 3SOSA 4K5ZA 4Q7ZA 3A88A 2QIQA 2VINA 1O35A 4H4FA 1D6RA 1BRUP 1FUJA 5FXLA 1FV9A 4JZIA 1F0SA 3RC5A 4AFSA 2HPPH 5A8ZA 1VITF 5EW2H 2ZU3A 1SBWA 1P2QA 4ASHA 3BG4C 1TNKA 2AYWA 4KGAA 1KIGH 1AZ8A 1N6XA 1WUNH 2TBSA 5DP4A 5LH8A 2F9OA 2VVCA 4ISOA 3TLOA 4CBNA 4A7IB 4ZHAA 1C9TA 1GI0A 3MU5A 2PWXA 1L1NA 3QUMP 1UHBB 2BDIA 1GHWH 4BXWA 3M37A 2QXIA 5E2OA 3UREA 2NU0E 4KELA 1QJ6B 1MD8A 2Y82A 3GY4A 3QLPH 1GBDA 5E2PA 2H2ZA 2PUXB 1GBCA 1G2LA 3A8CA 1GHVH 2PV9B 1CHOF 1YCPH 5H4IB 1IQLA 1KSNA 3PMBB 1A4WH 2AEIH 2ZDMA 1Z8JB 4Z0KA 3PV4A 1V2MT 2CXVA 4M7GA 1HXEH 4HFPB 1EPTA 1THRH 5HXFA 1BIOA 3PV2A 1A0JA 1ABIH 1RTFB 5TJXA 4BOHA 3UWIA 1O36A 1OWDA 6ESTA 3ZZ8A 1HAIH 1O3IA 1OKXA 2SNVA 3RU4D 1BRCE 3NUMA 1NRPH 1BTPA 1IQFA 3NXPA 1O3CA 1GPZA 3GYMA 4WWYA 3GY2A 2BD4A 3ZVAA 4WMDA 5T6FA 2Y7ZA 1XKBC 4B73A 1TE0A 1XVOA 2ZP0H 1XUHA 2BHGA 5L2YH 1BA8B 4ZKOU 4FUHA 1VITH 1KTSB 2ZCKP 1H1BA 1TNGA 1G32B 3LT3A 3P6ZB 2HPQH 1DITH 1GL0E 3M3SA 1Y3XA 2CJIA 5PTPA 1HLTH 1ELGA 1NRSH 3TNSA 4HZHA 4KKDA 2G00A 1ZPCA 4LOYH 1P57B 2OC1A 2ZHEH 4ZXYH 1K1JA 1SLWB 1UK3A 3A7TA 1UO6A 1TOMH 1OWKA 2FOAA 3ZVCA 1NN6A 1YYY1 4OS5A 2BDHA 1EXFA 2B0FA 4A6LA 1WQVH 2OINA 1YGCH 3A81A 4NA7A 1QB6A 1K28D 1XUFA 1W2KH 2Z9GA 3SV8A 2XCFA 3VB5A 1BMNH 4B2AA 3F1SB 1SFQB 4GHQA 3GCTG 4MNYA 1GBKA 3SV2H 4TPYA 1N8OC 1P04A 3A89A 3RXPA 3SU3A 1UTPA 4K3JA 3IITA 4LZ4B 2Z9JA 3HPTB 1ZZZA 1GHBG 1KLJH 2BYAX 3SU5A 1TMUH 1RIWB 2PR3A 3KHVA 3ZVFA 2F3CE 1DXWA 1FIZA 2OBOA 3ZZAA 1O2WA 3A7ZA 3KEEA 2OP9A 2XCNA 1B0FA 3LH1A 1SLUB 4OGXA 2BZAA 1L4ZA 3MI4A 1LVOA 1O5CB 2GKVE 2HNTF 1MU6B 1GGDB 4Y7AA 1B7XB 1GVLA 1HJ8A 3R3GB 1TGBA 3RXBA 4AGJA 4YOJA 1NTPA 3A8AA 4IC6A 4J1YA 3P70B 5AF9H 5BRRE 1T4UH 1DWBH 1VCQA 4CRBA 3SGQE 1AVXA 1GCTB 1BJUA 1L1JA 3TK5A 1PPGE 1CU1A 3BTHE 3T5FH 2A7CA 1SGIB 3VEQB 1TIOA 3MTYA 4A1VA 1TRYA 7LPRA 2C93B 4JZ1A 2AMPA 1O39A 2J95A 1A2CH 4E05H 2FOMB 1EAIA 2BVSH 4XFQA 3UIRA 2BDBA 3TK9A 2ZGXH 1PYTC 1BITA 3GYLB 4TPIZ 2BD3A 2XC4A 3BTTE 3TNTA 2VWLA 3ZV8A 5A0AE 1QGFA 1GBBA 3LH3A 2H6MA 1PJPA 3WY8A 1J15A 3I77A 1LQDB 3O8CA 2KAIB 3BTME 1AI8H 2Y7XA 5K7RA 1ELAA 1AFEH 2G55A 1GDQA 2ZGBH 3AAUA 1BMMH 1CT2E 2XBYA 3URDA 3CS7A 1UVSH 2AIPA 3GY6A 2FS9A 1EKBB 5DO4H 3KQBA 5AFYH 2GDEH 3PO1C 4ZHMU 1AUJA 1V3XA 1UK4A 1AE8H 1SHYA 3LPRA 3QGNB 2M5TA 1OWIA 2LNCA 1VZQH 2A5AA 2OQUA 2XW9A 3QTVH 4A1TA 3U1JB 2PFEA 5TCAA 5JBCS 2GT7A 5A8XA 2GVFA 5EPYA 2SGQE 2NU3E 3K6YA 2R3YA 1GI9B 2PKAA 1AVGH 4ZKNU 3A84A 5E0GA 3OU0A 3SU4A 1HRTH 1QY6A 3UNRA 2G4TA 1LDTT 2O8MA 2PGBB 1C2KA 1BRBE 4HGCA 4CH8B 2GX4A 3SNAA 1PPHE 1HJAB 4NZLA 5L2ZH 1ID5H 4ISNA 5JBTA 2WZQA 2Y5FA 4JZDH 3P95A 3MNXA 2JKHA 3JZ2B 1C5VA 3TH4H 1SGEE 1GWAA 1GMDG 2WYGA 3SV7A 1CQQA 2BY8X 1ANBA 1O2TA 3E8LA 3U1IB 1TONA 1Y3WA 4X6MA 1V2UT 3UR9A 4X0WU 1A3BH 2ZHDA 5F8XA 1DWDH 1TB6H 5EW1H 1BCUH 5JPMH 2A1DB 1K21H 2BLQA 3ATLA 3RXAA 3L3TA 1UCYK 3QWCH 3FZZA 1GMHG 1RXPA 3KF2A 3FVFB 4D7FA 1DICA 1A7SA 3GY8A 4ABEA 3UNSA 4CR9A 1FY5A 1TGTA 1GJ4H 1SGYE 3RMOH 4AYYB 1TRMA 2ZPSA 2ZFRH 1XVMA 2ZU4A 5DP3A 1P2KA 2BX3A 4ABGA 1VJ9U 4WXIA 1LKBA 1Y59T 1F5RA 2SGAA 1YP9A 3T28A 4YTAA 4IMQA 5GDSH 3E1XB 2GMTB 1RFNA 2W3KA 2UWPA 2J94A 5DKMA 1DX5M 3ESTA 3K6ZA 5GPIB 1EZXC 2FP7B 5FCKA 2Z9LA 4GAWA 2ODPA 1HIAB 3T29A 5IYTA 5DP6A 2BXTH 2TGDA 3RXCA 2RA0A 4J2YB 4F4OC 2NWNA 1F92A 2PLXA 1NFWA 1WQSA 2IJD1 1W10U 3GY3A 4OS7A 1TYNA 4K1TA 4IC5A 1UTNA 3CP7A 4UFEH 3ODFA 2AMDA 1NRNH 3LGTA 3BIVH 4A1XA 3D62A 1SGDE 1DY9A 3Q76A 3FZDA 1GDUA 3P17H 3MU1A 3ZVDA 1ACBE 1C2MA 3SQHE 1C4V2 3SW2B 1TA6A 2SFAA 3I29A 1NFXA 1ZSLA 1W14U 1Z8RA 4D76A 4X1QU 1FAXA 2R0KA 1T31A 1EOJA 4YZUA 2GD4B 2FOGA 5GJ4B 4JZEH 1F0TA 3MH6A 1JIMA 1C4U2 1EZQA 3LU9B 3S9CA 2BLVA 4ABBA 5HM2A 1EASA 2GZ9A 4XBDA 3VB3A 1LTOA 2F4LA 1TPPA 1NC6A 4X2VA 5EPNA 1V2KT 4NSVA 1QL9A 2IOTA 2Y80A 4KP0A 1T4VH 2G51A 2ASUB 2F91A 3GOVB 2CV3A 1Z6JH 3E0PB 1O2GH 1NS3A 2ANKH 1DLEA 2ZFPH 3RXQA 1K2I1 6GCHG 1O3AA 1C1MA 1HB0B 3BSQA 2AH4X 2P59A 2Q6GA 3MU4A 1QJ7B 1HAHH 1ZHMA 2JH0D 4D7GA 1AFQB 4ESTE 4WH6A 1L4DA 1OS8A 2ZTYA 1L0ZA 3FANA 3ODDA 1QQUA 1FY8E 2FOBA 4IGDA 1G36A 1A46H 1G37A 1ZOMA 2BMGB 1HFDA 3SJOA 1KXCA 1WAYB 2FOFA 2FLBH 2F9BH 4H6TA 1GI1A 4X1PU 1SGFG 2CF9H 5JB9S 2XC0A 1NU7B 1O2NA 5C20A 1RTKA 2BOKA 3LIWA 1T32A 1C5RA 5T6DA 1WYKA 1TNHA 2PTNA 1YPLH 3BN9A 2ZG0H 4AB8A 3H09A 1KLIH 1O30A 4DW2U 2FPZA 2ZFSA 2ZHWH 2WPMS 1NRQH 4MNWA 1CHGA 3RXJA 1ZMLA 1ZRKA 2BB4A 3KQEA 3RMNH 1ABJH 3KL6A 5LGOA 3SYJA 1O3DA 4FU9A 1MTNC 4NIXA 3TH2H 4INHA 2HVXA 1O2IA 4OS1A 4KTCA 3A86A 1Q2WA 2Y5HA 3SU2A 1S85A 3EGKH 2ZGHA 4X1RU 2H5DA 2O8WA 1BUIA 1L1GA 1LCYA 1D3TB 1XXDA 4U2WA 2O8LA 3MH7A 1THSH 3AW1A 4GUXA 2YNAA 1BRAA 2A0QB 1VR1H 4WMEA 2THFB 1C5NH 4R8TB 3P8NA 3QGJA 4YLUA 2EI7A 2FEQH 1LMWB 4X6PA 3RXUA 1Y5UT 3M5NA 1Z7KA 2QAAA 1SMFE 1O31A 4BAHB 1TBRH 2ZU2A 5DK1A 1MKXK 2OK5A 4Y7BA 1K1NA 3SI3H 2AGIX 3E16B 1ETSH 2G8TA 4O97A 1XM1A 2GCTC 1CVWH 2OCVB 2SGDE 1DPOA 3K9XB 1XUGA 3Q3YA 3ITIA 4ZAEA 1FJSA 2FS8A 3F9GA 7GCHG 3PLBA 4BAKB 2VBCA 2Z3CA 3I78A 4GCHG 1C1OA 1S84A 1ETRH 4MTBA 1YPJH 1QJ1B 5GNDA 3RM2H 5JBAS 1SPJA 3Q3KA 1V2OT 2QXJA 4I8GA 1EB2A 2WPJS 2QV1A 4A92A 5E8EH 2A4OA 1GJDB 4KTUA 1W11U 3S69A 5AFZH 4ZUHA 1V2RT 3STJA 3ZVBA 3UTUH 3A8BA 1C5OH 5DGJA 3SGAE 1OWHA 1C2HA 3RXLA 2BD2A 4NCYA 2LPRA 4BTIB 1ZR0A 3VB4A 1EAWA 3LOXA 4H6SB 3RXIA 1AGJA 3NZIA 3NPSA 1MTWA 1IQHA 3DUXH 3S9BA 1ETTH 3P8OA 1INCA 4K2YA 1GBFA 2FTMA 2BD9A 1HAZB 2J92A 1NROH 3T62A 1C1WH 1E0FD 4B74A 2ZDKA 1VGCB 5FPTA 1ZJKA 3EDXB 2ZZUH 1E38B 5A0BA 4Y8YA 3TU7H 1BTYA 4DVAU 4AFZA 1PPEE 1XMNB 1V2VT 3ZZ6A 2XBVA 2A32A 1V2TT 2ZDVH 1KXFA 2W3IA 2O9QA 5T6GA 3P92A 2FYRA 1NU9A 3U8TH 2C8YB 1BHXF 1QQ4A 4JMYA 5GWZA 1GJAB 2A7JA 4CRCA 1J14A 1SQAA 2J9NA 3M3TA 3UQVA 1P3CA 5J4SA 3MH5A 1AFQC 4YOGA 1UTKA 2WYJA 1O2RA 1SVPA 3V3MA 1ANDA 4YM9A 4B2BA 4JYTA 1ZPBA 1TMBH 4ZROA 2CHAB 2BQ6B 2J38A 4ZHLU 2ZTXA 2G5NA 3MMGA 3PROA 2CN0H 1KXBA 1UTJA 4K60A 1OX1A 2RDLA 5CHAC 4MPUA 1Y8TA 1CBWC 2AFQB 2GCHF 4UONA 3QN7A 1MCVA 1TGNA 2H9EH 4NGAH 1HUTH 4WH8A 1YLCA 3M5OA 3UQOA 1KDQB 3EAJA 4BXSA 1NPMA 1IHTH 1ZGVA 1MU8B 1N6YA 3MOCA 2UUFB 5HGGA 1TGSZ 2C8XB 1SGNE 2RA3A 1GJCB 2ZGCA 5I25A 5LPEA 2WHXA 1L2EA 1SOTA 2R2MB 4ZKRU 1P3EA 4BAQB 2ZDAH 4CRFA 1TNJA 1E34B 1KLTA 5FPSA 3OTPA 1GG6B 1H9HE 1SC8U 4JYUH 3LDXH 1J17T 1K9OE 2GV6A 3H7TA 1IQEA 4Y0ZE 4XBCA 1ZSJA 1IAUA 1K1IA 1HV7A 2FOEA 1TA2A 1SLXB 4VGCB 4DURA 2FMJA 3C27B 1FMGA 2BY7X 4UE7H 4E06H 1D6WA 2PHBA 1BT7A 1NM6A 1GI2A 2BVXH 3M61U 1H8DH 4TWWA 2ZHFH 2ZWLH 2OBQA 4XOJA 1ZRBA 2WPLS 4FU7A 3RM0H 1H4WA 1AKSB 1FAKH 3BF6H 4X6OA 1RS0A 2F9UA 3E0NB 3GCHB 1DDJA 3RXSA 3LJOA 5F8ZA 4B2CA 2ANWA 2O8TA 1QHRB 4YO9A 1GBEA 1ZPZA 3TH3H 1O5FH 1LPGB 4FUIA 1DWEH 1QIXB 1ZJDA 1FNIA 1FY3A 2BDGA 5LPFA 1AMHA 4NG9H 3UWJH 1O3FA 2B7DH 4GHTA 4SGAE 1YBWA 5FX6A 2XXLA 5FCRA 1NZQH 1S0QA 3HK3B 2BZ6H 3TVJB 2ZIQH 3ZZBA 3SU6A 2FZZA 1AZZA 1JWTA 1P2MA 1ELVA 1F2SE 1B0EA 1FN6A 3PWCA 1J16A 4BAMB 5A09A 4NA8A 3KGPA 1MBQA 4AFUA 5DG6A 1D3QB 1GBHA 2H9TH 5TCCA 3PV5A 1AHTH 1YPEH 4YLQH 2GDDA 3P8FA 3H7OA 3M36A 1V2JT 2ZTZA 2VWNA 2A5KA 2TRMA 1EB1H 1C5YB 1G3CA 3AK5A 3UR6A 3MO3A 4WY3A 1VGCC 2ZU1A 3GY5A 1VITG 1EZSC 2JETB 1Z1IA 1EAXA 1ZTLA 4DY7B 4Y71A 1RTLA 2ZFFH 3STIA 4NIVA 1HDTH 4NFFA 2FI4E 1C2IA 2BDYA 1JXPA 1P2IA 4Y76A 4AGKA 2ZCHP 1ANCA 1NRRH 1O3OA 3GCNA 2WUBA 1A0LA 1Z71A 3TJVA 3BEUA 2A31A 3M3VA 4MLFB 3DFJA 4OS6A 2H9HA 1DUEA 5GCHG 1PQ7A 2BLWA 3AW0A 4B6FA 1EX3A 1CHOG 2HLCA 5EXNA 2ZQ1A 3DT0H 1Y5BT 2AIQA 3ATMA 5GXPA 1H9IE 5A0CA 3VGCB 1P9UA 4X2WA 1OP8A 2OC7A 5C1UA 3SBKA 4F49A 3MO6A 1EOLA 1HAVA 4Z6AH 1O5EH 1QR3E 1WTGH 1OP0A 5JDUB 2JH6D 4LZ1H 3RXVA 5C5NA 2BOHB 2R9PA 3MHWU 2R3UA 2GV7A 1ELFA 4K8YA 3D23A 1JOUB 2OC0A 1C2EA 3M7QA 3UY9A 4Y0YE 3PMAB 2AS9A 1A3EH 2VJ1A 4ISHH 1TGCA 1JIRA 4OM9A 3ZZ9A 1C5QA 1FONA 1MMJN 3E91A 2QCYA 3B9FH 4NIWA 1S83A 1O2SA 1T8LA 1TQ7B 2G52A 4OS2A 1YF4A 3N7OA 3TITA 3BEFB 2XBWA 1TABE 3A82A 1GHAF 4MDSA 3MU0A 2XRCA 1O5DH 2ANYA 2I6SA 1F0RA 3ZZCA 1BTXA 1O2UA 3A7XA 1S0RA 4X8TH 1P10A 1U6QA 1LHFH 2BX4A 3TJOA 6CHAB 1O2LA 2W5EA 3LC3A 4CRDA 1Q31A 2P95A 2TGTA 3IG6B 1LPZB 3FP7E 3GCHC 1GBIA 1GHXH 1ESBA 5C67A 2QA9E 3B8JA 2BQWB 1J9CH 1V2LT 1DS2E 1V2WT 2STBE 4ZXXH 3RDZA 1CSOE 4O3UA 1THPB 4MPXA 1FPCH 4FUEA 1BMAA 2FX4A 2TGPZ 4IN2A 1SB1H 3E90B 1IQJA 1P03A 2BD7A 9ESTA 4INKA 1B5GH 4NIYA 1O32A 1TX7A 2SGPE 2J2UA 1E36B 3A8DA 4MPWA 3U8RH 2VH6A 2P93A 4FUGA 2HNTE 3KN2A 1ANEA 1V2NT 5HYOA 2P8OB 3SJ8A 8GCHF 1NESE 1SSXA 3M7UA 2OD3B 3C1KA 4U32A 4CRGA 2XTTB 4B75A 4TYDA 2VIVA 2GZ7A 3QZQA 1N1LA 2FM2A 4BANB 1TNLA 1C5LH 4FUCA 1GHYH 2A7HA 1RIWC 1G3EA 4MPVA 2VH0A 1LHCH 5E0HA 1MTSA 1P8VC 3KQCA 1A5HA 1EPTB 1TWXB 2ZKSA 1ZLRA 1MAYA 1O34A 1MAXA 1OXGA 4DGJA 4D9RA 4D9QA 1WSSH 1Y3UA 2Z9KA 3LONA 2O8UA 3SN8A 1GGDC 1DM4B 2Q1JA 4ABFA 2OC8A 2V35A 1FPHH 1FY4A 1UHBA 4NWLA 3PWBA 2FI5E 4JK6A 5B6OA 1S82A 1O3PB 1GBAA 3U9AH 1QFKH 2VB0A 1ESAA 2Z3EA 1MTVA 2P16A 3W95A 2OTVA 1TMTH 2ZFQH 4UFDH 3HKJB 1PPFE 1SR5C 1GCTC 3SZEA 3RUOA 1YM0A 2HWLB 3PTNA 1HCGA 1JBUH 4K1SA 4WMFA 2ALVA 1BJVA 1P12E 1Y5AT 1NFUA 3LKWA 1MBMA 5FBIA 2G4UA 1WV7H 2FXRA 1UTOA 2VGCB 4WF8A 3HKIB 1QA7A 1YPKH 3LGYA 4Y8XA 1RRKA 4CHAB 4Q80A 4RKOB 1XUIA 4SGBE 2OQ5A 2Q6FA 1OYTH 1C1TA 2ZHQH 3MNSA 4WVPE 2PKSB 3ATIA 3ZZ7A 1O2YA 3NWUA 1JRSA 1NT1A 3MNCA 4K1EA 1O2QA 1H8IH 2NU1E 1D4PB 4IBLH 2OLGA 3HGNA 2GZ8A 3RMLH 3F9EA 4MQAA 3MO9A 5AVDA 1EATA 1ELCA 4IN1A 5FAHA 4Y6DA 4ABJA 1WTHD 4IW4E 3S9AA 1QCPA 5JBBS 5DP5A 3ZZ4A 4X8VH 5GIBA 2Z7FE 4RSPA 3A7VA 2VIDA 1XUKA 1WCZA 1UVOA 2XWAA 2Y6TA 4CBOA 2ZNKH 2A4RA 5G4BA 5DP7A 1X7AC 2Q6DA 4A5TS 1P06A 3A7WA 1DSUA 1UTLM 3RXTA 3SJKA 1GI7B 2BDAA 1O2XA 9LPRA 1A5GH 4UFGH 3SV9A 1W0YH 3A85A 4QT8C 2SGFE 1BTUA 3MNBA 2FO9A 5EOKA 1OOKB 2J4IA 1GBJA 1OWJA 3GISB 2C4FH 1HJAC 2CMYA 3E6PH 1BTZA 1JMOH 5DPAA 1SOZA 2P3TB 1LO6A 2BTCE 2ILNA 4RN6A 4UEHH 1O2KA 3RP2A 5ABWA 1P01A 1AU8A 2BY9X 3S7HB 1ELBA 4JZFH 1SGQE 2VVVA 1LPKB 1A5IA 1ZTJA 3AVZA 1TFXA 1HPGA 1BBRK 3HGPA 3RXKA 1AWHB 1AB9B 2HNTC 2F83A 4BAOB 2F9VA 3F68H 1W12U 2FWWA 4AX9H 3AAVA 2BLOA 4M9FA 3QTOH 1K1OA 5I46H 3OY5U 5F03A 1ZMNA 3D49H 1D9IA 3SORA 1GMCG 1AO5A 1WBGB 1YPMH 4UDWH 2HRVA 2A2XH 1IQNA 1PYTD 3VPKA 3GDVA 3PMJA 4JYVH 2QYIA 2GMTC 3PM3A 4B76A 1C1VH 1YPHE 3LGWA 2FDAA 1MQ5A 4DJZB 3OTJE 3SUEA 4DT7B 2I6QA 1O3NA 1GJ7B 1UCYH 1OSSA 1D3PB 4X2YA 3RXEA 2TPIZ 2ZCLP 1TX8A 3QO6A 1RJXB 3Q00A 1QB1A 5HMAA 4E7NA 3G01A 2STAE 1H9LB 4YOIA 2BD5A 2PKAB 2R0LA 2VIWA 3QDZB 2YNBA 4Y10E 3U8OH 1O2JA 3Q77A 1KXAA 4Y8ZA 3UOUA 2V6NA 3PTBA 2KAIA 1C5MD 1ZMJA 4NWKA 1G2MA 4AG1A 3UFAA 3BG8A 2VGCC 3O8DA 3RXHA 1N8OB 1Z8IB 1TBZH 1LHDH 1ZTKA 3LGUA 1C5ZB 4R0IA 1O5BB 1V2QT 2Z3DA 1UCYE 3SUGA 4YT6H 1GL1A 1P11E 1S6HA 4ABIA 1YPGH 3SNBA 1EP5A 3L33A 3TK6A 4BTUB 1DLKB 1KXDA 3RMMH 2A45B 4I31A 3GCTF 1G9IE 2PSYA 3AASA 1QB9A 3F9HA 3MWIU 2AMQA 3BTGE 4FVDA 2EEKA 1LHGH 1AQ7A 3KNXA 3QK1A 5F8TA 4AORA 1P0SH 3UUZA 1C1UH 1GHBF 1SQOA 4O3TA 1UVTH 1O2VA 4K8BA 1LKAA 4I8JA 3MH4A 3RXMA 4DIHH 1IQGA 1O2MA 2D8WA 2HGTH 2PSXA 4X8SH 4Y11E 3UOPA 2XC5A 5B6LA 2HOBA 2DE8A 1BQYA 1QURH 1MTUA 1T8MA 2GT8A 1S81A 1F7ZA 3BTEE 2XYAA 1T7CA 3TGIE 2K1QA 1FN8A 3OX7U 5HM9A 3V0XA 1DWCH 4FU8A 4B1TA 3F9FA 1YKTA 1J8AA 1GJ8B 2A5IA 2EA3A 1LVMA 3P8GA 1IHSH 4ISIH 4MNXA 4PROA 3OSYA 4JCNA 1MZAA 2GTBA 2UWLA 4B71A 1SFIA 4ABAA 5GCHF 1SGRE 3FP6E 4FUDA 3T27A 1A0HB 2JH5D 1C5WB 1VCWA 2QF3A 5ESTE 3SNEA 1ZHRA 2QC2A 1CE5A 1YCPM 3ZYDA 2BQ7B 3V7TA 3RLWH 5A2MH 4X6NA 5EQRA 1IQMA 2A4QA 1FY1A 2A4GA 2IN2A 4AB9A 1CO7E 5K0HA 2WINI 2FX6A 1AB9C 2FOHA 4IS5A 3MYWA 2ZDNA 1NY22 1SGPE 5T1VA 4I8HA 3F6UH 1HBTH 3OYPA 3PO1B 4ZH8A 2EI6A 1HIAA 3ZVGA 3O8RA 1TX6A 3EYDA 2ZI2H 1UVPA 4AOQA 3VB7A 3ENSB 3T26A 1XX9A 1PQ5A 1FLEE 1EJMA 1YPHC 3RLYH 1GJBB 3A83A 2BDCA 1KXEA 1WXRA 4GLYA 1BBRH 1Y3YA 3PLKA 5EQSA 1SQTA 1W13U 4X8UH 4DIIH 1MKXH 1C1QA 1C9PA 1O2PA 3UNQA 1TRNA 1O2OA 3URCA 5L6NH 1EP6A 2EC9H 3TGKE 1AVWA 1PPZA 1KY9A 1EZUC 1BHXB 3R0FA 5DP9A 4K69A 1OYQA 1XXFA 3BTWE 3ZZDA 3RXFA 2A2QH 5FHTA 1S6FA 4XBBA 4YESB 2VVUA 1BB0B 3DFLA 2VIOA 1SL3A 3BTDE 5SGAE 1CA0B 7KMEH 2FESH 4BTTB 4LXBH 2RCEA 3ZV9A 3SI4H 1XUJA 1AD8H 3SV6A 1SGFA 2ZEBA 2W7UA 2SNWA 1BMLA 3EA7A 2WPKS 1EJNA 2QGRA 5EQQA 1E35B 1BBRE 3TPIZ 3PB1E 2P3UB 1SG8B 1O3BA 6LPRA 3SQEE 1O3EA 3K2UA 4INLA 2D26C 1GMDF 1W8BH 1QRWA 3PYHA 1DANH 2Y5GA 2B9LA 1CA8B 1GBLA 3MFJA 3RXGA 4CR5A 2ZQ2A 2QXGA 1DSTA 2TIOA 2V3OH 3RXOA 2V0BA 1KYNA 1QNJA 1HGTH 1Z1JA 1GMHF 4Q2KA 2B5TB 3A87A 3SU1A 2HALA 3M5MA 3TJNA 1C2FA 2GCHG 1OP2A 1Z6EA 1UMAH 1MKWK 3E3TA 1GI3A 2NU2E 1F5KU 1TNIA 2EI8A 3BV9B 3B23B 2G81E 1D3DB 3SU0A 2ZU5A 1Z8GA 1AN1E 1GDNA 1E37B 2CHAC 1O2HA 1G30B 1FI8A 1O0DH 3CENA 5FBEA 5AHGH 1GJ9B 1QRXA 5C3NA 2NU4E 2ZPQA 1C1NA 3FFGA 1PQ8A 1FZZA 1MH0A 5L30H 5ESBA 1S5SA 1BZXE 2XNIA 2VWOA 3TGJE 4XSKU 1TQ0B 2AGGX 1DY8A 2ANMH 2VU8E 1MCTA 1BTWA 4MG3A 3GY7A 4FXGH 1K1LA 2VNTA 5EODA 3SGBE 3RU4E 2Y81A 3GDUA 4GSOA 1ELEE 4WXVA 3BTKE 4GVUA 3S0NA 1WU1A 1TLDA 4XE4A 1CGJE 5DJ7A 4FVBA 1AUTC 3BEIB 2QN5T 3ATWA 4AYVB 1GG6C 2Z9IA 1C2DA 1C5TA 4THNH 5C5OA 1HXFH 3FP8E 4I8KA 1ZYOA 2AERH 3TIUA 1EQ9A 1EJAA 1HJ9A 4XDEA 3S7KB 3RC4A 2WPIS 3T25A 1CT0E 4VGCC 3SNDA 3ZYEA 5DP8A 3A7YA 3JZ1B 1ELDE 2ZF0H 3W94A 4OS4A 3SO3A 1C5SA 4X1SU 1FDPA 1FXYA 1K1PA 1TAWA 2QF0A 2IPHA 1DOJA 2F9NA 6GCHF 1HYLA 2SGEE 4JK5A 2FOCA 4AN7A 1TALA 4FUJA 8ESTE 3DHKH 1AE5A 1Q3XA 3IWMA 3K65B 4ABHA 3SUFA 4CH2B 2ZGJA 5C1YA 1UTMA 1GVKB 3CS0A 1MTNB 2FYQA 1PQAA 2ZDLA 4O03A 3ELAH 5EG4A 5F6MA 4E7RG 2CGAA 1BTHH 1DXPA 2CF8H 2V3HH 4ZMAH 1V2PT 1TPSA 2WV9A 4B6EA 3VXEH 3UPEA 3PMHB 4GPGA 1ZSKA 2C90B 1GI8B 1GBMA 1P9SA 3KQDA 2D1JA 2B8OH 2H5CA 3Q3XA 4Y79A 1XKAC 1C5UA 1MUEB 2UWOA 1DFPA 4U01A 1CA0C 1LQEA 1C2GA 4Q7XA 1FQ3A 2ESTE 2OUAA 3ATKA 2Z94A 1PPBH 3M5LA 4MVNA 3BTQE 2C3SA 3HATH 1C1RA 1C5XB 4CRAA 1EUFA 2PUQH 2D2DA 1Y3VA 5FPYA 2JETC 2GCTB 5EU8A 4AFQA 2UUYA 2ZFTA 3SJ9A 4HI3A 5EXLA 3U69H 4I32A 4TWYA 2WPHS 1OWEA 4AG2A 1ZGIA 2WV4A 2VIPA 1V2ST 1P02A 4IMZA 4NSYA 4ISLA 2FLRH 8KME2 3LC5A 1V6DA 4RKJB 2QXHA 3EA8A 2P94A 2ULLA 3EQ0H 4TY6A 2AGEX 1GMCF 4NA9H 1NO9H 3LJJA 1KDQA 1O3LA 1SGCA 3BIUH 1A61H 2ALPA 1QA0A 7GCHF 1O2ZA 2BD8A 3BTFE 4GCHF 2UUKB 1O3HA 5CE1A 2QY0B 1DT2A 1GHZA 3RXDA 4ZKSU 1FIWA 2ZO3H 1T8NA 3A80A 3EE0B 1LHEH 1HAXB 3VXFH 1GCDA 2BXUH 1SI5H 1GBTA 3VGCC 3PLPA 1O5AB 1ZHPA 4NZQA 2ZA5A 1HAOH 1DE7H 1CGHA 1UK2A 2J34A 1O3KA 5E0JA 1G3BA 4O9VA 3TJUA 4I33A 1MKWH 1WOFA 1F0UA 3SJIA 2OXSA 5JB8S 2FIRH 3H5CB 3OY6U 2ODQA 3MU8A 4I8LA 4KTSA 1DUAA 1TPAE 1GHAG 2IJOB 4DCDA 5EGMA 3D65E 3GDSA 1GVZA 2VIQA 1A1RA 1VCPA 1DVAH 1M9UA 3KIDU 1AKSA 1OPHB 3DD2H 1QBOA 1F5LA 1W7GH 1RD3B 5ETXA 2PGQB 3SZNA 3BG4B 3DA9B 1LVYA 3V12A 5FX5A 1O5GH 1IQKA 2BY5X 1HNEE 2R2WU 1NFYA 1YCPK 1O37A 1W3CA 4Q7YA 1IOEA 2ZPRA 5C2ZA 2W7SA 1QBNA 3ZVEA 6CHAC 1GI5A 1O33A 5CHAB 1TPOA 1C1PA 5JYIA 1CBWB 5T3HA 1AWFH
chains in the Genus database with same CATH superfamily
3ZZ3A 1ESTA 4FETA 1JRTA 2BY6X 1AY6H 1ARCA 1HAGE 1K1MA 2TGAA 1AIXH 4UD9H 3GICB 1O3GA 1QRZA 4BNRA 8GCHG 1P09A 3DSGA 2XNDD 1O38A 3M7TA 1MQ6A 3V13A 8LPRA 7ESTE 2C8ZB 1VJAU 5J4QA 3ZZ5A 1YLDA 2UUJB 2ZC9H 1QL8A 4YT7H 1C5PA 3NKKA 3U98H 2W26A 3SUDA 4TY7A 4CREA 3NK8A 2DE9A 1ELTA 5C1XA 4WJG2 1HAYB 1G3DA 1TBQH 2P8OC 1P2JA 1CT4E 3GCOA 1C4Y2 4NFEA 1HAVB 2F43B 1UTQA 4HTCH 3SNCA 3EA9A 3UB0A 2GGVB 4ZCNA 1PFXC 5BPEA 4DG4A 1CGIE 2P3FH 4X1NU 2GP9B 3LGVA 3QZRA 1P05A 3RXRA 2KFWA 1IQIA 2FTLE 5CMXH 2HLDD 2H1UA 2ODYB 3M35A 5A8YA 1MD7A 2WUCA 2ZECA 2FI3E 2C8WB 4UFFH 1SHHB 1EPTC 1YC0A 2HVYB 1O3MA 1UVUH 1BDAA 1P2OA 4DOQA 3NCLA 3L6PA 4H42U 3FAOA 4ABDA 1GJ6A 2YOLA 1SGTA 4D8NA 1LVBA 1SQRA 3LGIA 1T8OA 4U30A 1BOQA 1SLVB 1P2NA 4MNVA 2BVRH 2XWBI 3OFND 2YMSC 3HK6B 3RC6A 2PTCE 1ARBA 2FODA 4OGYA 1QBVH 1EAUA 4XRNA 5EXMA 4I7YH 1GJ5H 2Z6BD 1ORFA 2BM2A 4RI0A 3T2NA 3SHAH 4Z1MD 1KTTB 2RG3A 3KCGH 4LK4A 1GI4A 1MZDA 1O3JA 1TOCB 3RU4T 1C1SA 1W0ZU 3SHCH 2XBXA 3QX5H 1C2LA 3VFEA 1QL7A 1W7XH 4FUFA 5IDKA 2G5VA 4AZ2B 3VB6A 4X2XA 2PW8H 5LPRA 1HAPH 4CHAC 2WV5A 2DUCA 2VWMA 1K22H 1C2JA 2F9PA 4P02A 1GI6A 1PPCE 2PKSC 1QTFA 1H8ED 1RGQA 4FUBA 1UJ1A 3O8BA 3SOSA 4K5ZA 4Q7ZA 3A88A 2QIQA 3F2HA 2VINA 1O35A 4H4FA 1D6RA 1BRUP 3UAIC 1FUJA 3N7EA 5FXLA 1FV9A 1W0JD 4JZIA 1F0SA 3RC5A 4AFSA 2HPPH 5A8ZA 1VITF 2KZ4A 2ZU3A 5EW2H 1SBWA 1P2QA 4ASHA 3BG4C 1TNKA 2AYWA 4KGAA 3NRLA 1KIGH 1AZ8A 1N6XA 1WUNH 2TBSA 3OEHD 5DP4A 5LH8A 2F9OA 2VVCA 4ISOA 3TLOA 4CBNA 4A7IB 4ZHAA 1E79D 1C9TA 2CK3D 1GI0A 3MU5A 2PWXA 1L1NA 3QUMP 1UHBB 2BDIA 3PRDA 1GHWH 4BXWA 3M37A 2QXIA 5E2OA 1FX0B 3UREA 2NU0E 4KELA 1QJ6B 1MD8A 2Y82A 3GY4A 3QLPH 1GBDA 5E2PA 3MQKC 2H2ZA 2PUXB 1GBCA 1G2LA 3A8CA 1GHVH 2PV9B 1CHOF 1YCPH 5H4IB 1IQLA 4DT4A 1KSNA 3PMBB 1A4WH 2AEIH 2ZDMA 1Z8JB 4Z0KA 3PV4A 1V2MT 3FO8D 2CXVA 4M7GA 1HXEH 4HFPB 1EPTA 1THRH 5HXFA 1BIOA 3PV2A 1A0JA 1ABIH 1RTFB 5TJXA 4BOHA 3UWIA 1O36A 1OWDA 6ESTA 3ZZ8A 1HAIH 1O3IA 1OKXA 2SNVA 3RU4D 3VG8A 1BRCE 3NUMA 1NRPH 1BTPA 1IQFA 3NXPA 1O3CA 1GPZA 3GYMA 4WWYA 3GY2A 2BD4A 3ZVAA 4WMDA 5T6FA 2Y7ZA 1XKBC 4B73A 1TE0A 1XVOA 2ZP0H 1XUHA 2BHGA 5L2YH 1BA8B 4ZKOU 4FUHA 1VITH 1KTSB 2ZCKP 1H1BA 1TNGA 2WPDD 1G32B 3LT3A 3P6ZB 2HPQH 1DITH 2JIZD 1GL0E 3M3SA 1Y3XA 2CJIA 4RT0A 5PTPA 1HLTH 1ELGA 3W1EA 1NRSH 3TNSA 4HZHA 4KKDA 2G00A 1ZPCA 4LOYH 1P57B 2OC1A 2ZHEH 4ZXYH 1K1JA 1SLWB 1UK3A 3A7TA 1UO6A 1TOMH 1OWKA 2FOAA 3ZVCA 1NN6A 1YYY1 4OS5A 2BDHA 2QE7D 1EXFA 2B0FA 4A6LA 1WQVH 2OINA 1YGCH 3A81A 4NA7A 1QB6A 1K28D 1XUFA 1W2KH 2Z9GA 3SV8A 2XCFA 3VB5A 1BMNH 4B2AA 3F1SB 1SFQB 4GHQA 3GCTG 4MNYA 1GBKA 3SV2H 4TPYA 1N8OC 1P04A 3A89A 3RXPA 3SU3A 1UTPA 4K3JA 5F53A 3IITA 4LZ4B 2Z9JA 3HPTB 1ZZZA 1GHBG 1KLJH 2BYAX 3SU5A 1TMUH 1RIWB 2PR3A 3KHVA 3ZVFA 2F3CE 1DXWA 1FIZA 2OBOA 3ZZAA 1O2WA 3A7ZA 3KEEA 2OP9A 2XCNA 1E1QD 1B0FA 3LH1A 1SLUB 4OGXA 2BZAA 1L4ZA 3MI4A 1LVOA 1O5CB 2GKVE 2HNTF 1MU6B 1GGDB 4Y7AA 1B7XB 1GVLA 1HJ8A 3R3GB 1TGBA 3RXBA 4AGJA 4YOJA 1NTPA 3A8AA 4IC6A 4J1YA 3P70B 2RDEA 5AF9H 1T4UH 5BRRE 1DWBH 1VCQA 4CRBA 3SGQE 1AVXA 1GCTB 1BJUA 1L1JA 3TK5A 1PPGE 1CU1A 3BTHE 3T5FH 2A7CA 1SGIB 3VEQB 1TIOA 3MTYA 1K0HA 4A1VA 1TRYA 7LPRA 2C93B 4JZ1A 2AMPA 1O39A 2J95A 1A2CH 4E05H 2FOMB 1EAIA 2BVSH 4XFQA 3UIRA 2BDBA 3TK9A 2ZGXH 1PYTC 1BITA 3GYLB 4TPIZ 2BD3A 2XC4A 3BTTE 3TNTA 2VWLA 3ZV8A 4ACBA 5A0AE 1QGFA 1YY3A 1GBBA 3LH3A 2H6MA 1PJPA 3WY8A 1J15A 3I77A 1LQDB 3O8CA 2KAIB 3BTME 1AI8H 2Y7XA 5K7RA 1ELAA 1AFEH 2G55A 1GDQA 2ZGBH 3AAUA 1BMMH 1CT2E 2XBYA 3URDA 3CS7A 1UVSH 2AIPA 3GY6A 2FS9A 4XD7D 1EKBB 5DO4H 3KQBA 5AFYH 2GDEH 3PO1C 4ZHMU 1AUJA 1V3XA 1UK4A 1AE8H 1SHYA 3LPRA 3QGNB 2M5TA 1OWIA 2LNCA 1VZQH 2A5AA 2OQUA 2XW9A 3QTVH 4A1TA 3U1JB 2PFEA 5TCAA 5JBCS 2GT7A 5A8XA 2GVFA 5EPYA 2SGQE 2NU3E 3K6YA 2R3YA 1GI9B 2PKAA 1AVGH 4ZKNU 3A84A 5E0GA 3OU0A 3SU4A 1HRTH 1QY6A 3UNRA 2G4TA 1LDTT 2O8MA 2PGBB 2J98B 1C2KA 1BRBE 4HGCA 4CH8B 2GX4A 3SNAA 1PPHE 1HJAB 4NZLA 5L2ZH 1ID5H 4ISNA 2WZQA 5JBTA 2Y5FA 4JZDH 3P95A 3MNXA 2JKHA 3JZ2B 1C5VA 3TH4H 1SGEE 1GWAA 1GMDG 2WYGA 3SV7A 1CQQA 3F3BA 2BY8X 1ANBA 1O2TA 3E8LA 3U1IB 1TONA 1Y3WA 4X6MA 1V2UT 3UR9A 3ZIAD 4X0WU 1A3BH 2ZHDA 3DSPA 5F8XA 1DWDH 1TB6H 5EW1H 1BCUH 5JPMH 2A1DB 1K21H 2BLQA 3ATLA 3RXAA 3L3TA 1UCYK 3QWCH 3FZZA 1GMHG 1RXPA 3KF2A 3FVFB 4D7FA 1DICA 1A7SA 3GY8A 4ABEA 3UNSA 4CR9A 1FY5A 1TGTA 1GJ4H 1SGYE 3RMOH 4AYYB 1TRMA 2ZPSA 2ZFRH 1XVMA 2ZU4A 5DP3A 1P2KA 2BX3A 4ABGA 1VJ9U 4WXIA 1LKBA 1Y59T 1F5RA 2SGAA 1YP9A 1MABB 4YXWD 3T28A 4YTAA 4IMQA 5GDSH 3E1XB 2GMTB 1RFNA 2W3KA 2UWPA 2J94A 5DKMA 1DX5M 3ESTA 3K6ZA 5GPIB 1EZXC 2FP7B 5FCKA 2Z9LA 4GAWA 2ODPA 5EIYA 1HIAB 3T29A 5IYTA 5DP6A 2BXTH 2TGDA 3RXCA 2RA0A 4J2YB 4F4OC 2NWNA 1F92A 2PLXA 1NFWA 1WQSA 2IJD1 1W10U 3GY3A 4OS7A 1TYNA 4K1TA 4IC5A 1UTNA 3CP7A 4UFEH 3ODFA 2AMDA 1NRNH 3LGTA 3BIVH 4A1XA 3D62A 1SGDE 1DY9A 3Q76A 3FZDA 1GDUA 3P17H 3MU1A 3ZVDA 1ACBE 1C2MA 3SQHE 1C4V2 3SW2B 1TA6A 2SFAA 3I29A 1NFXA 1ZSLA 1W14U 1Z8RA 4D76A 2KCPA 4X1QU 1FAXA 2R0KA 1T31A 1EOJA 4YZUA 2GD4B 2FOGA 5GJ4B 4JZEH 1F0TA 3MH6A 1JIMA 1C4U2 1EZQA 3LU9B 3DCLA 3S9CA 3F2GA 2BLVA 4ABBA 5HM2A 1EASA 5KECA 2GZ9A 4XBDA 3VB3A 1LTOA 2F4LA 1TPPA 1NC6A 4X2VA 5EPNA 1V2KT 4NSVA 1QL9A 2IOTA 2Y80A 4KP0A 2JJ2D 5KGOA 1T4VH 2G51A 2ASUB 2F91A 3GOVB 2CV3A 1Z6JH 3E0PB 1O2GH 1NS3A 2ANKH 1DLEA 2ZFPH 3RXQA 1K2I1 6GCHG 1O3AA 1C1MA 1HB0B 3BSQA 2AH4X 2P59A 2Q6GA 3MU4A 1QJ7B 1HAHH 1ZHMA 2JH0D 4D7GA 1AFQB 4ESTE 4WH6A 1L4DA 1OS8A 2ZTYA 1L0ZA 3FANA 3ODDA 1QQUA 1FY8E 2FOBA 4IGDA 1G36A 1A46H 1G37A 1ZOMA 3FOAA 2BMGB 1HFDA 3SJOA 1KXCA 1WAYB 2FOFA 2FLBH 2F9BH 4H6TA 1GI1A 4X1PU 1SGFG 2CF9H 5JB9S 2XC0A 1NU7B 1O2NA 5C20A 1RTKA 2BOKA 3LIWA 1T32A 1C5RA 5T6DA 5C0TA 1WYKA 1TNHA 2LELA 1YPLH 2PTNA 2ZG0H 3BN9A 3H09A 1KLIH 4AB8A 1O30A 4DW2U 2FPZA 2ZFSA 2ZHWH 2WPMS 1NRQH 4MNWA 1CHGA 3RXJA 1ZMLA 1ZRKA 2BB4A 3KQEA 3RMNH 1ABJH 3KL6A 2M2AA 5LGOA 3SYJA 1O3DA 4FU9A 1MTNC 4NIXA 3TH2H 4INHA 2HVXA 1O2IA 4OS1A 4KTCA 3A86A 1Q2WA 2Y5HA 3SU2A 1S85A 3EGKH 2ZGHA 4X1RU 2H5DA 2O8WA 1BUIA 1L1GA 1LCYA 1D3TB 1XXDA 3KYFA 4U2WA 2O8LA 3MH7A 1THSH 3AW1A 4GUXA 2YNAA 1BRAA 2A0QB 1VR1H 4WMEA 2THFB 1C5NH 1E1RD 4R8TB 3P8NA 3QGJA 4YLUA 2EI7A 2FEQH 1LMWB 4X6PA 3RXUA 1Y5UT 3M5NA 1Z7KA 2QAAA 1SMFE 1O31A 4BAHB 1TBRH 2ZU2A 5DK1A 1MKXK 2OK5A 4Y7BA 1K1NA 3SI3H 1NBMD 2AGIX 3E16B 1ETSH 2G8TA 2V7QD 4O97A 1XM1A 2GCTC 1CVWH 2OCVB 2SGDE 1DPOA 3K9XB 1XUGA 2JJ1D 3Q3YA 3ITIA 4ZAEA 1FJSA 2FS8A 3F9GA 7GCHG 3PLBA 4BAKB 2VBCA 2Z3CA 3I78A 4GCHG 1C1OA 1S84A 1ETRH 4MTBA 1YPJH 1QJ1B 5GNDA 3RM2H 5JBAS 1SPJA 3Q3KA 1V2OT 5C0UA 2QXJA 4I8GA 1EB2A 2WPJS 2QV1A 4A92A 5E8EH 2A4OA 1GJDB 4KTUA 1W11U 3WWBA 3S69A 5AFZH 4ZUHA 1V2RT 3STJA 3ZVBA 3UTUH 3A8BA 1C5OH 5DGJA 3SGAE 1OWHA 1C2HA 3RXLA 2BD2A 4NCYA 2LPRA 4BTIB 1ZR0A 3VB4A 1EAWA 3LOXA 4H6SB 3RXIA 4F48B 1AGJA 3NZIA 3NPSA 1MTWA 1IQHA 3DUXH 3S9BA 1ETTH 3P8OA 1INCA 4K2YA 1GBFA 2FTMA 2BD9A 1HAZB 2J92A 1NROH 2PP6A 3T62A 1C1WH 1E0FD 4B74A 2ZDKA 1VGCB 5FPTA 1ZJKA 3EDXB 2ZZUH 1E38B 5A0BA 4Y8YA 3TU7H 1BTYA 4DVAU 4AFZA 1PPEE 1XMNB 1V2VT 3ZZ6A 2XBVA 2A32A 1V2TT 2ZDVH 1KXFA 2W3IA 2O9QA 5T6GA 3P92A 2FYRA 1NU9A 3U8TH 2C8YB 1BHXF 1QQ4A 4JMYA 5GWZA 1GJAB 2A7JA 4CRCA 1J14A 1SQAA 2J9NA 3M3TA 3UQVA 1P3CA 5J4SA 3MH5A 1AFQC 4YOGA 1UTKA 2EQNA 1O2RA 1SVPA 2WYJA 3V3MA 1ANDA 4YM9A 4B2BA 4JYTA 1ZPBA 1TMBH 4ZROA 2CHAB 2BQ6B 2J38A 4ZHLU 2ZTXA 2G5NA 3MMGA 3PROA 4FOUC 2CN0H 1KXBA 1UTJA 4K60A 1OX1A 2RDLA 5CHAC 4MPUA 1Y8TA 1CBWC 2AFQB 2GCHF 4UONA 3QN7A 1MCVA 1TGNA 2H9EH 4NGAH 5DSFA 1HUTH 1NBME 4WH8A 1YLCA 3M5OA 3UQOA 1KDQB 3EAJA 4BXSA 1NPMA 1W0KD 1IHTH 1ZGVA 1MU8B 1N6YA 3MOCA 2UUFB 5HGGA 1TGSZ 2C8XB 1SGNE 2RA3A 1GJCB 2ZGCA 5I25A 5LPEA 2WHXA 1L2EA 1SOTA 2R2MB 4ZKRU 1P3EA 4BAQB 2ZDAH 4CRFA 1TNJA 1E34B 1VKYA 1KLTA 5FPSA 3OTPA 1GG6B 1H9HE 1SC8U 4JYUH 3LDXH 1J17T 1K9OE 2GV6A 3H7TA 1IQEA 4Y0ZE 4XBCA 1ZSJA 3N7DA 1IAUA 1K1IA 1HV7A 2FOEA 1TA2A 1SLXB 4VGCB 4DURA 2FMJA 3C27B 1FMGA 2BY7X 4UE7H 4E06H 1D6WA 2PHBA 1BT7A 1NM6A 1GI2A 2BVXH 3M61U 1H8DH 4TWWA 2ZHFH 2ZWLH 2OBQA 4XOJA 1ZRBA 2WPLS 4FU7A 3RM0H 1H4WA 1AKSB 1FAKH 3BF6H 4X6OA 1RS0A 2F9UA 3E0NB 3GCHB 1DDJA 3RXSA 3LJOA 5F8ZA 2K8IA 4B2CA 2ANWA 2O8TA 1QHRB 4YO9A 1GBEA 1ZPZA 3TH3H 1O5FH 1LPGB 4FUIA 2KCOA 1DWEH 1QIXB 1ZJDA 1SKYE 2KCYA 1FNIA 1FY3A 2BDGA 5LPFA 1AMHA 4NG9H 3UWJH 1O3FA 2RFKC 2B7DH 4GHTA 4SGAE 1YBWA 5FX6A 2XXLA 5FCRA 1NZQH 1S0QA 3HK3B 2BZ6H 3TVJB 2ZIQH 3ZZBA 3PRBA 3SU6A 2FZZA 1AZZA 1JWTA 1P2MA 1ELVA 1F2SE 1B0EA 1FN6A 3PWCA 1J16A 4BAMB 5A09A 4NA8A 3KGPA 1MBQA 4AFUA 5DG6A 1D3QB 1GBHA 2H9TH 2KM0A 3PV5A 5TCCA 1AHTH 1YPEH 4YLQH 2GDDA 3P8FA 2V3MA 3H7OA 3M36A 1V2JT 2ZTZA 2VWNA 2A5KA 2TRMA 1EB1H 1C5YB 1G3CA 3AK5A 3UR6A 3MO3A 4WY3A 1VGCC 2ZU1A 3GY5A 1VITG 1EZSC 2JETB 1Z1IA 1EAXA 1ZTLA 4DY7B 2JDID 4Y71A 1RTLA 2ZFFH 2KR7A 3STIA 4ACAA 3OAAD 4NIVA 1HDTH 4NFFA 2FI4E 1C2IA 2BDYA 1JXPA 2EY4C 1P2IA 4Y76A 4AGKA 2ZCHP 1ANCA 1NRRH 1O3OA 3GCNA 2WUBA 1A0LA 1Z71A 3TJVA 3BEUA 2A31A 3M3VA 4MLFB 3DFJA 4OS6A 4TT3D 2H9HA 1DUEA 5GCHG 1PQ7A 2BLWA 3AW0A 4B6FA 1EX3A 1CHOG 2HLCA 5EXNA 2ZQ1A 3DT0H 1Y5BT 2AIQA 3ATMA 5GXPA 1H9IE 5A0CA 1UW7A 3VGCB 1P9UA 4X2WA 1OP8A 2OC7A 5C1UA 5EJZA 3SBKA 4F49A 3MO6A 1EOLA 1HAVA 4Z6AH 1O5EH 1QR3E 1WTGH 1OP0A 5JDUB 2JH6D 4LZ1H 3RXVA 5C5NA 2BOHB 2R9PA 3MHWU 4I86A 2R3UA 2GV7A 1ELFA 4K8YA 3D23A 1JOUB 2OC0A 1C2EA 3M7QA 3UY9A 4Y0YE 3PMAB 2AS9A 1A3EH 2VJ1A 4ISHH 1TGCA 1JIRA 4OM9A 3ZZ9A 1C5QA 3F0OA 1FONA 1MMJN 3FKSD 3E91A 2QCYA 3B9FH 4NIWA 1S83A 1O2SA 1T8LA 1TQ7B 2G52A 4OS2A 1YF4A 3N7OA 3TITA 3BEFB 2XBWA 1TABE 3A82A 1GHAF 4MDSA 3MU0A 2XRCA 1O5DH 2ANYA 2I6SA 1F0RA 3ZZCA 1BTXA 1O2UA 3A7XA 1S0RA 3KQ5A 1P10A 1U6QA 1LHFH 2BX4A 4X8TH 3TJOA 1O2LA 6CHAB 2W5EA 3LC3A 4CRDA 3WWFA 1Q31A 2P95A 2TGTA 3IG6B 1LPZB 3FP7E 3DSOA 3GCHC 1GBIA 1GHXH 1ESBA 5C67A 2QA9E 3B8JA 2BQWB 1J9CH 1V2LT 1DS2E 1V2WT 2STBE 4ZXXH 3RDZA 1CSOE 4O3UA 1THPB 4MPXA 1FPCH 4FUEA 1BMAA 2FX4A 2TGPZ 4IN2A 1SB1H 3E90B 1IQJA 4AC9A 1P03A 2BD7A 9ESTA 4INKA 1B5GH 4NIYA 1O32A 1TX7A 2SGPE 2J2UA 1E36B 3A8DA 4MPWA 3U8RH 2VH6A 2P93A 4FUGA 2HNTE 3KN2A 1ANEA 1V2NT 5HYOA 2P8OB 3SJ8A 8GCHF 1NESE 1SSXA 3M7UA 2OD3B 3C1KA 4U32A 4CRGA 2XTTB 4B75A 4TYDA 2K0QA 2VIVA 2GZ7A 3QZQA 1N1LA 2KCAA 2FM2A 4BANB 1TNLA 1C5LH 4FUCA 1GHYH 2A7HA 4Q4LA 1RIWC 1G3EA 4MPVA 2VH0A 1LHCH 5E0HA 1MTSA 1P8VC 3KQCA 1A5HA 1EPTB 1TWXB 2ZKSA 1ZLRA 5EJLA 1MAYA 1O34A 1MAXA 1OXGA 1KMHB 4DGJA 4D9RA 4D9QA 1WSSH 1WDIA 1Y3UA 2Z9KA 3LONA 2O8UA 3SN8A 1GGDC 1DM4B 2Q1JA 4ABFA 2OC8A 2V35A 1FPHH 1FY4A 1UHBA 4NWLA 3PWBA 2FI5E 4JK6A 5B6OA 1S82A 1O3PB 1GBAA 3U9AH 1QFKH 3CNRA 2VB0A 1ESAA 2Z3EA 1MTVA 2P16A 3W95A 3F2FA 2YMSB 2OTVA 1TMTH 2ZFQH 4UFDH 3HKJB 1PPFE 1SR5C 1GCTC 3SZEA 3RUOA 1YM0A 2HWLB 3PTNA 1HCGA 1JBUH 4K1SA 4WMFA 2ALVA 1BJVA 1P12E 1Y5AT 1NFUA 3LKWA 1MBMA 5FBIA 2G4UA 1WV7H 2FXRA 1UTOA 2VGCB 4WF8A 3HKIB 1QA7A 1YPKH 3LGYA 4Y8XA 5HIYA 1RRKA 3OEED 4Q80A 4CHAB 4RKOB 1XUIA 4SGBE 2OQ5A 2Q6FA 1OYTH 1C1TA 2ZHQH 3MNSA 4WVPE 2PKSB 5HKKD 3ATIA 3ZZ7A 1O2YA 3NWUA 1JRSA 1NT1A 3MNCA 4K1EA 1O2QA 1H8IH 2NU1E 1D4PB 4IBLH 2OLGA 3HGNA 2GZ8A 3RMLH 3F9EA 4MQAA 3MO9A 5AVDA 1EATA 1ELCA 4IN1A 5FAHA 4Y6DA 4Q63A 4ABJA 1WTHD 4IW4E 3S9AA 1QCPA 5JBBS 5DP5A 3ZZ4A 4X8VH 5GIBA 2Z7FE 4RSPA 3A7VA 2AHME 2VIDA 1XUKA 1WCZA 1UVOA 1YLNA 2XWAA 2Y6TA 4CBOA 2ZNKH 2W6JD 2A4RA 5G4BA 5DP7A 1X7AC 2Q6DA 4A5TS 1P06A 3A7WA 1DSUA 1UTLM 3RXTA 3SJKA 1GI7B 2BDAA 1O2XA 9LPRA 1A5GH 4UFGH 3SV9A 1W0YH 3A85A 4QT8C 2SGFE 1BTUA 3MNBA 2FO9A 5EOKA 1OOKB 2J4IA 1GBJA 1OWJA 3GISB 2C4FH 1HJAC 2QF4A 2CMYA 3E6PH 1BTZA 1JMOH 1S6LA 5DPAA 1SOZA 2P3TB 1LO6A 2BTCE 2ILNA 4RN6A 4UEHH 1O2KA 3RP2A 5ABWA 1P01A 1AU8A 2BY9X 3S7HB 1ELBA 4JZFH 1SGQE 2VVVA 1LPKB 1A5IA 1ZTJA 3AVZA 1TFXA 1HPGA 1BBRK 3HGPA 1EFRD 3RXKA 1AWHB 1AB9B 2HNTC 2F83A 4BAOB 2F9VA 2L74A 3F68H 1W12U 2FWWA 4AX9H 3AAVA 2BLOA 4M9FA 3QTOH 1K1OA 5I46H 3OY5U 5F03A 1ZMNA 3D49H 1COWD 1D9IA 3SORA 1GMCG 1AO5A 1WBGB 1YPMH 4UDWH 5HIZA 2HRVA 2A2XH 1IQNA 1PYTD 3VPKA 3GDVA 3PMJA 4JYVH 2QYIA 2GMTC 3PM3A 4B76A 1C1VH 1YPHE 3LGWA 2FDAA 3FN8A 1MQ5A 4DJZB 3OTJE 3SUEA 4DT7B 2I6QA 1BMFD 1O3NA 1GJ7B 1UCYH 1OSSA 1D3PB 4X2YA 3RXEA 4ASUD 2TPIZ 2ZCLP 1TX8A 3QO6A 1RJXB 3Q00A 1QB1A 5HMAA 4E7NA 3G01A 2STAE 1H9LB 4YOIA 2BD5A 2PKAB 3OE7D 2R0LA 2VIWA 3QDZB 2YNBA 4Y10E 3U8OH 1O2JA 3Q77A 3KYGA 1KXAA 4Y8ZA 3UOUA 2V6NA 3PTBA 2KAIA 1C5MD 1ZMJA 4NWKA 1G2MA 4AG1A 3UFAA 3BG8A 2VGCC 3O8DA 2J97A 3RXHA 1N8OB 1Z8IB 1TBZH 1LHDH 1ZTKA 3LGUA 1C5ZB 4R0IA 1O5BB 1V2QT 2Z3DA 1UCYE 3SUGA 4YT6H 1GL1A 1P11E 1S6HA 4ABIA 1YPGH 3SNBA 1EP5A 3L33A 3TK6A 4BTUB 1DLKB 1KXDA 3RMMH 2A45B 4I31A 5FL7D 3GS9A 3GCTF 1G9IE 2PSYA 3AASA 1QB9A 3F9HA 3MWIU 2AMQA 3BTGE 4FVDA 2EEKA 1LHGH 1AQ7A 3KNXA 3QK1A 5F8TA 4AORA 1P0SH 3UUZA 1C1UH 1GHBF 1SQOA 4O3TA 1UVTH 1O2VA 4K8BA 1LKAA 4I8JA 3MH4A 3RXMA 4DIHH 1IQGA 1H8HD 1O2MA 2D8WA 2J98A 4F55A 2HGTH 2PSXA 4X8SH 4Y11E 3UOPA 2XC5A 5B6LA 2HOBA 2DE8A 1BQYA 1QURH 1MTUA 1T8MA 2GT8A 1S81A 1F7ZA 3BTEE 2XYAA 1T7CA 3TGIE 2K1QA 1FN8A 3OX7U 5HM9A 3V0XA 1DWCH 4FU8A 4B1TA 3F9FA 1YKTA 1J8AA 1GJ8B 2A5IA 2EA3A 1LVMA 3P8GA 1IHSH 4ISIH 4MNXA 4PROA 3OSYA 4JCNA 1MZAA 2GTBA 2UWLA 4B71A 1SFIA 2KX4A 4ABAA 5GCHF 1SGRE 3FP6E 4FUDA 3T27A 1A0HB 2JH5D 1C5WB 1VCWA 2QF3A 5ESTE 3SNEA 1ZHRA 2QC2A 1CE5A 1YCPM 3ZYDA 2BQ7B 3V7TA 3RLWH 5A2MH 4X6NA 5EQRA 3WW7A 1IQMA 2A4QA 1FY1A 2A4GA 2IN2A 4AB9A 1CO7E 5K0HA 2WINI 2FX6A 1AB9C 2FOHA 4IS5A 3MYWA 2ZDNA 1NY22 1SGPE 5T1VA 4I8HA 3F6UH 1HBTH 3OYPA 3PO1B 4ZH8A 2EI6A 1HIAA 3ZVGA 3O8RA 1TX6A 3EYDA 2ZI2H 1UVPA 4AOQA 3VB7A 3ENSB 3T26A 1XX9A 1PQ5A 4HG6A 1FLEE 1EJMA 1YPHC 3RLYH 1GJBB 3A83A 2BDCA 1KXEA 4TSFD 4GLYA 1WXRA 1BBRH 1Y3YA 3PLKA 5EQSA 1SQTA 1W13U 4X8UH 4DIIH 1MKXH 1C1QA 1C9PA 1O2PA 3UNQA 1TRNA 1O2OA 3URCA 5L6NH 1EP6A 2EC9H 3TGKE 1AVWA 1PPZA 1KY9A 1EZUC 1BHXB 3R0FA 5DP9A 4K69A 1OYQA 1XXFA 3BTWE 3ZZDA 3RXFA 2A2QH 5FHTA 1S6FA 4XBBA 4YESB 2VVUA 1BB0B 3DFLA 2VIOA 1SL3A 3BTDE 5SGAE 1CA0B 7KMEH 2FESH 4BTTB 4LXBH 2RCEA 3ZV9A 3SI4H 1XUJA 1AD8H 3SV6A 1SGFA 2LP6A 2ZEBA 2W7UA 2WSSD 2SNWA 1BMLA 3EA7A 2WPKS 1EJNA 2QGRA 5EQQA 1E35B 1BBRE 3TPIZ 3PB1E 2P3UB 1SG8B 1O3BA 6LPRA 3SQEE 1O3EA 3K2UA 4INLA 2D26C 1GMDF 1W8BH 1QRWA 3PYHA 1DANH 2Y5GA 2B9LA 3N99A 5C94A 1CA8B 1GBLA 3MFJA 3RXGA 4CR5A 2ZQ2A 2QXGA 1DSTA 2TIOA 2V3OH 3RXOA 2V0BA 1KYNA 1QNJA 1HGTH 1Z1JA 1GMHF 4Q2KA 2B5TB 3A87A 3SU1A 2HALA 2W6ID 3M5MA 3TJNA 1C2FA 2GCHG 1OP2A 1Z6EA 1UMAH 1MKWK 3E3TA 1GI3A 2NU2E 1QZ8A 1F5KU 1TNIA 2EI8A 3BV9B 3B23B 2G81E 1D3DB 3SU0A 2ZU5A 1Z8GA 1AN1E 1GDNA 1E37B 2CHAC 1O2HA 1G30B 1FI8A 1O0DH 3CENA 5FBEA 5AHGH 1GJ9B 1QRXA 5C3NA 2NU4E 2ZPQA 1C1NA 3FFGA 1PQ8A 1FZZA 1MH0A 5L30H 5ESBA 1S5SA 1BZXE 2XNIA 2VWOA 3TGJE 2IPQX 4XSKU 1TQ0B 2AGGX 1DY8A 2ANMH 2VU8E 1MCTA 1BTWA 4MG3A 3GY7A 4FXGH 1K1LA 2VNTA 5EODA 3SGBE 3RU4E 2Y81A 3GDUA 4GSOA 1ELEE 4WXVA 3BTKE 4GVUA 3S0NA 1WU1A 2YMSD 1TLDA 4XE4A 1CGJE 5DJ7A 4FVBA 1AUTC 3BEIB 2QN5T 3ATWA 4AYVB 1GG6C 2Z9IA 1C2DA 1C5TA 4THNH 5C5OA 1HXFH 3FP8E 4I8KA 1ZYOA 2AERH 3TIUA 1EQ9A 1EJAA 1HJ9A 4XDEA 3S7KB 3RC4A 2WPIS 3T25A 1CT0E 4VGCC 3SNDA 3ZYEA 5DP8A 3A7YA 3JZ1B 1ELDE 2ZF0H 4P00A 2XOKD 3W94A 5C17A 4OS4A 3SO3A 1C5SA 4X1SU 1FDPA 1FXYA 1K1PA 1TAWA 2QF0A 2IPHA 1DOJA 2F9NA 6GCHF 1HYLA 2SGEE 4JK5A 2FOCA 4AN7A 1TALA 4FUJA 8ESTE 3DHKH 1AE5A 1Q3XA 3IWMA 1YWUA 3K65B 4ABHA 1OHHD 3SUFA 4CH2B 2ZGJA 5C1YA 1UTMA 1GVKB 3CS0A 1MTNB 2FYQA 1PQAA 2ZDLA 4O03A 3ELAH 2QF5A 5EG4A 5F6MA 4E7RG 2CGAA 1BTHH 1DXPA 2CF8H 2V3HH 4ZMAH 1V2PT 1TPSA 2WV9A 4B6EA 3VXEH 3UPEA 3PMHB 4GPGA 1ZSKA 2C90B 1GI8B 1GBMA 1P9SA 3KQDA 2D1JA 2B8OH 2H5CA 3Q3XA 4Y79A 1XKAC 1C5UA 1MUEB 2UWOA 1DFPA 4U01A 5KEDA 1CA0C 1LQEA 1C2GA 4Q7XA 1FQ3A 2ESTE 2OUAA 3ATKA 2Z94A 1PPBH 3M5LA 4MVNA 3BTQE 2C3SA 3HATH 1C1RA 1C5XB 4CRAA 1EUFA 2PUQH 2D2DA 1Y3VA 5FPYA 2JETC 2GCTB 5EU8A 4AFQA 2UUYA 2ZFTA 3SJ9A 4HI3A 5EXLA 3U69H 4I32A 4TWYA 5IK2D 2WPHS 1OWEA 4AG2A 2J5UA 1ZGIA 2WV4A 2VIPA 1V2ST 1P02A 4IMZA 4NSYA 4ISLA 2FLRH 8KME2 3LC5A 1V6DA 4RKJB 5CHBA 3F0PA 2QXHA 3EA8A 2P94A 2ULLA 3EQ0H 4TY6A 2AGEX 1GMCF 3EE7A 4NA9H 1NO9H 3LJJA 1KDQA 1O3LA 1SGCA 3BIUH 5EJ1A 1A61H 2GJGA 2ALPA 1QA0A 7GCHF 1O2ZA 2BD8A 3BTFE 4GCHF 2UUKB 1O3HA 5CE1A 2QY0B 1DT2A 1GHZA 3RXDA 4RT1A 4ZKSU 1FIWA 2ZO3H 1T8NA 3A80A 3EE0B 1LHEH 1HAXB 3VXFH 1GCDA 2BXUH 1SI5H 1GBTA 3VGCC 3PLPA 1O5AB 1ZHPA 4NZQA 2ZA5A 1HAOH 1DE7H 1CGHA 1UK2A 2J34A 1O3KA 5E0JA 1G3BA 4O9VA 3TJUA 3U28C 4I33A 1MKWH 1WOFA 1F0UA 3SJIA 2OXSA 5JB8S 2FIRH 3H5CB 3OY6U 2ODQA 3MU8A 2L6OA 4I8LA 4KTSA 1DUAA 1TPAE 1GHAG 2IJOB 4DCDA 5EGMA 3D65E 3GDSA 1GVZA 2VIQA 1A1RA 1VCPA 1DVAH 1M9UA 3KIDU 1AKSA 1OPHB 3DD2H 1QBOA 1F5LA 1W7GH 1RD3B 5ETXA 2PGQB 3SZNA 3BG4B 3DA9B 1LVYA 3V12A 5DN6D 5FX5A 1O5GH 1IQKA 5CDFE 2BY5X 1HNEE 2R2WU 1NFYA 1YCPK 1O37A 1W3CA 4Q7YA 1IOEA 2ZPRA 5C2ZA 2W7SA 1QBNA 3ZVEA 6CHAC 1GI5A 1O33A 5CHAB 1TPOA 1C1PA 5JYIA 1CBWB 5T3HA 1AWFH
chains in the Genus database with same CATH topology
3ZZ3A 1ESTA 4FETA 1JRTA 2BY6X 1AY6H 1ARCA 1HAGE 1K1MA 2TGAA 1AIXH 4UD9H 3GICB 1O3GA 1QRZA 4BNRA 8GCHG 1P09A 2XNDD 1O38A 3M7TA 1MQ6A 3V13A 8LPRA 7ESTE 2C8ZB 1VJAU 5J4QA 3ZZ5A 1YLDA 2UUJB 2ZC9H 1QL8A 4YT7H 1C5PA 3NKKA 3U98H 2W26A 3SUDA 4TY7A 4CREA 3NK8A 2DE9A 1ELTA 5C1XA 4WJG2 1HAYB 1G3DA 1TBQH 2P8OC 1P2JA 1CT4E 3GCOA 1C4Y2 4NFEA 1HAVB 4HTCH 1UTQA 2F43B 3SNCA 3EA9A 3UB0A 2GGVB 4ZCNA 1PFXC 5BPEA 4DG4A 1CGIE 2P3FH 4X1NU 2GP9B 3LGVA 3QZRA 1P05A 3RXRA 2KFWA 1IQIA 2FTLE 5CMXH 2HLDD 2H1UA 2ODYB 3M35A 5A8YA 1MD7A 2WUCA 2ZECA 2FI3E 2C8WB 4UFFH 1SHHB 1EPTC 1YC0A 1O3MA 1UVUH 1BDAA 1P2OA 4DOQA 3NCLA 3L6PA 4H42U 3FAOA 4ABDA 1GJ6A 2YOLA 1SGTA 4D8NA 1LVBA 3LGIA 1T8OA 4U30A 1BOQA 1SLVB 1P2NA 4MNVA 2BVRH 2XWBI 3OFND 2YMSC 3HK6B 3RC6A 2PTCE 1ARBA 2FODA 4OGYA 1QBVH 1EAUA 5EXMA 4I7YH 1GJ5H 2Z6BD 1ORFA 2BM2A 4RI0A 3T2NA 3SHAH 4Z1MD 1KTTB 2RG3A 3KCGH 4LK4A 1GI4A 1MZDA 1O3JA 1TOCB 3RU4T 1C1SA 1W0ZU 3SHCH 2XBXA 3QX5H 1C2LA 3VFEA 1QL7A 1W7XH 4FUFA 5IDKA 2G5VA 4AZ2B 3VB6A 4X2XA 2PW8H 5LPRA 1HAPH 4CHAC 2WV5A 2DUCA 2VWMA 1K22H 1C2JA 2F9PA 1GI6A 1PPCE 2PKSC 1QTFA 1H8ED 1RGQA 4FUBA 1UJ1A 3O8BA 3SOSA 4K5ZA 4Q7ZA 3A88A 2QIQA 3F2HA 2VINA 1O35A 4H4FA 1D6RA 1BRUP 1FUJA 3N7EA 5FXLA 1FV9A 1W0JD 4JZIA 1F0SA 3RC5A 4AFSA 2HPPH 5A8ZA 1VITF 5EW2H 2ZU3A 2KZ4A 1SBWA 1P2QA 4ASHA 3BG4C 1TNKA 2AYWA 4KGAA 3NRLA 1KIGH 1AZ8A 1N6XA 1WUNH 2TBSA 5DP4A 5LH8A 3OEHD 2F9OA 2VVCA 4ISOA 3TLOA 4CBNA 4A7IB 4ZHAA 1E79D 1C9TA 2CK3D 1GI0A 3MU5A 2PWXA 1L1NA 3QUMP 1UHBB 2BDIA 3PRDA 1GHWH 4BXWA 3M37A 2QXIA 5E2OA 1FX0B 3UREA 2NU0E 4KELA 1QJ6B 1MD8A 2Y82A 3GY4A 3QLPH 1GBDA 5E2PA 2H2ZA 2PUXB 1GBCA 1G2LA 3A8CA 1GHVH 2PV9B 1CHOF 1YCPH 5H4IB 1IQLA 4DT4A 1KSNA 3PMBB 1A4WH 2AEIH 2ZDMA 1Z8JB 4Z0KA 3PV4A 1V2MT 3FO8D 2CXVA 4M7GA 1HXEH 4HFPB 1EPTA 1THRH 5HXFA 1BIOA 3PV2A 1A0JA 1ABIH 1RTFB 5TJXA 4BOHA 3UWIA 1O36A 1OWDA 6ESTA 3ZZ8A 1HAIH 1O3IA 1OKXA 2SNVA 3RU4D 3VG8A 1BRCE 3NUMA 1NRPH 1BTPA 1IQFA 3NXPA 1O3CA 1GPZA 3GYMA 4WWYA 3GY2A 2BD4A 3ZVAA 4WMDA 5T6FA 2Y7ZA 1XKBC 4B73A 1TE0A 1XVOA 2ZP0H 1XUHA 2BHGA 5L2YH 1BA8B 4ZKOU 4FUHA 1VITH 1KTSB 2ZCKP 1H1BA 1TNGA 2WPDD 1G32B 3LT3A 3P6ZB 2HPQH 1DITH 2JIZD 1GL0E 3M3SA 1Y3XA 2CJIA 5PTPA 1HLTH 1ELGA 3W1EA 1NRSH 3TNSA 4HZHA 4KKDA 2G00A 1ZPCA 4LOYH 1P57B 2OC1A 2ZHEH 4ZXYH 1K1JA 1SLWB 1UK3A 3A7TA 1UO6A 1TOMH 1OWKA 2FOAA 3ZVCA 1NN6A 1YYY1 4OS5A 2BDHA 2QE7D 1EXFA 2B0FA 4A6LA 1WQVH 2OINA 1YGCH 3A81A 4NA7A 1QB6A 1K28D 1XUFA 1W2KH 2Z9GA 3SV8A 2XCFA 3VB5A 1BMNH 4B2AA 3F1SB 1SFQB 4GHQA 3GCTG 4MNYA 1GBKA 3SV2H 4TPYA 1N8OC 1P04A 3A89A 3RXPA 3SU3A 1UTPA 4K3JA 5F53A 3IITA 4LZ4B 2Z9JA 3HPTB 1ZZZA 1GHBG 1KLJH 2BYAX 3SU5A 1TMUH 1RIWB 2PR3A 3KHVA 3ZVFA 2F3CE 1DXWA 1FIZA 2OBOA 3ZZAA 1O2WA 3A7ZA 3KEEA 2OP9A 2XCNA 1E1QD 1B0FA 3LH1A 1SLUB 4OGXA 2BZAA 1L4ZA 3MI4A 1LVOA 1O5CB 2GKVE 2HNTF 1MU6B 1GGDB 4Y7AA 1B7XB 1GVLA 1HJ8A 3R3GB 1TGBA 3RXBA 4AGJA 4YOJA 1NTPA 3A8AA 4IC6A 4J1YA 3P70B 5AF9H 5BRRE 1T4UH 1DWBH 1VCQA 4CRBA 3SGQE 1AVXA 1GCTB 1BJUA 1L1JA 3TK5A 1PPGE 1CU1A 3BTHE 3T5FH 2A7CA 1SGIB 3VEQB 1TIOA 3MTYA 4A1VA 1TRYA 7LPRA 2C93B 4JZ1A 2AMPA 1O39A 2J95A 1A2CH 4E05H 2FOMB 1EAIA 2BVSH 4XFQA 3UIRA 2BDBA 3TK9A 2ZGXH 1PYTC 1BITA 3GYLB 4TPIZ 2BD3A 2XC4A 3BTTE 3TNTA 2VWLA 3ZV8A 5A0AE 1QGFA 1GBBA 3LH3A 2H6MA 1PJPA 3WY8A 1J15A 3I77A 1LQDB 3O8CA 2KAIB 3BTME 1AI8H 2Y7XA 5K7RA 1ELAA 1AFEH 2G55A 1GDQA 2ZGBH 3AAUA 1BMMH 1CT2E 2XBYA 3URDA 3CS7A 1UVSH 2AIPA 3GY6A 2FS9A 4XD7D 1EKBB 5DO4H 3KQBA 5AFYH 2GDEH 3PO1C 4ZHMU 1AUJA 1V3XA 1UK4A 1AE8H 1SHYA 3LPRA 3QGNB 2M5TA 1OWIA 2LNCA 1VZQH 2A5AA 2OQUA 2XW9A 3QTVH 4A1TA 3U1JB 2PFEA 5TCAA 5JBCS 2GT7A 5A8XA 2GVFA 5EPYA 2SGQE 2NU3E 3K6YA 2R3YA 1GI9B 2PKAA 1AVGH 4ZKNU 3A84A 5E0GA 3OU0A 3SU4A 1HRTH 1QY6A 3UNRA 2G4TA 1LDTT 2O8MA 2PGBB 1C2KA 1BRBE 4HGCA 4CH8B 2GX4A 3SNAA 1PPHE 1HJAB 4NZLA 5L2ZH 1ID5H 4ISNA 5JBTA 2WZQA 2Y5FA 4JZDH 3P95A 3MNXA 2JKHA 3JZ2B 1C5VA 3TH4H 1SGEE 1GWAA 1GMDG 2WYGA 3SV7A 1CQQA 3F3BA 2BY8X 1ANBA 1O2TA 3E8LA 3U1IB 1TONA 1Y3WA 4X6MA 1V2UT 3UR9A 3ZIAD 4X0WU 1A3BH 2ZHDA 5F8XA 3DSPA 1DWDH 1TB6H 5EW1H 1BCUH 5JPMH 2A1DB 1K21H 2BLQA 3ATLA 3RXAA 3L3TA 1UCYK 3QWCH 3FZZA 1GMHG 1RXPA 3KF2A 3FVFB 4D7FA 1DICA 1A7SA 3GY8A 4ABEA 3UNSA 4CR9A 1FY5A 1TGTA 1GJ4H 1SGYE 3RMOH 4AYYB 1TRMA 2ZPSA 2ZFRH 1XVMA 2ZU4A 5DP3A 1P2KA 2BX3A 4ABGA 1VJ9U 4WXIA 1LKBA 1Y59T 1F5RA 2SGAA 1YP9A 1MABB 4YXWD 3T28A 4YTAA 4IMQA 5GDSH 3E1XB 2GMTB 1RFNA 2W3KA 2UWPA 2J94A 5DKMA 1DX5M 3ESTA 3K6ZA 5GPIB 1EZXC 2FP7B 5FCKA 2Z9LA 4GAWA 2ODPA 1HIAB 3T29A 5IYTA 5DP6A 2BXTH 2TGDA 3RXCA 2RA0A 4J2YB 4F4OC 2NWNA 1F92A 2PLXA 1NFWA 1WQSA 2IJD1 1W10U 3GY3A 4OS7A 1TYNA 4K1TA 4IC5A 1UTNA 3CP7A 4UFEH 3ODFA 2AMDA 1NRNH 3LGTA 3BIVH 4A1XA 3D62A 1SGDE 1DY9A 3Q76A 3FZDA 1GDUA 3P17H 3MU1A 3ZVDA 1ACBE 1C2MA 3SQHE 1C4V2 3SW2B 1TA6A 2SFAA 3I29A 1NFXA 1ZSLA 1W14U 1Z8RA 4D76A 2KCPA 4X1QU 1FAXA 2R0KA 1T31A 1EOJA 4YZUA 2GD4B 2FOGA 5GJ4B 4JZEH 1F0TA 3MH6A 1JIMA 1C4U2 1EZQA 3LU9B 3DCLA 3S9CA 3F2GA 2BLVA 4ABBA 5HM2A 1EASA 2GZ9A 4XBDA 3VB3A 1LTOA 2F4LA 1TPPA 1NC6A 4X2VA 5EPNA 1V2KT 4NSVA 1QL9A 2IOTA 2Y80A 4KP0A 2JJ2D 1T4VH 2G51A 2ASUB 2F91A 3GOVB 2CV3A 1Z6JH 3E0PB 1O2GH 1NS3A 2ANKH 1DLEA 2ZFPH 3RXQA 1K2I1 6GCHG 1O3AA 1C1MA 1HB0B 3BSQA 2AH4X 2P59A 2Q6GA 3MU4A 1QJ7B 1HAHH 1ZHMA 2JH0D 4D7GA 1AFQB 4ESTE 4WH6A 1L4DA 1OS8A 2ZTYA 1L0ZA 3FANA 3ODDA 1QQUA 1FY8E 2FOBA 4IGDA 1G36A 1A46H 1G37A 1ZOMA 3FOAA 2BMGB 1HFDA 3SJOA 1KXCA 1WAYB 2FOFA 2FLBH 2F9BH 4H6TA 1GI1A 4X1PU 1SGFG 2CF9H 5JB9S 2XC0A 1NU7B 1O2NA 5C20A 1RTKA 2BOKA 3LIWA 1T32A 1C5RA 5T6DA 5C0TA 1WYKA 1TNHA 2PTNA 1YPLH 3BN9A 2ZG0H 4AB8A 2LELA 1KLIH 3H09A 1O30A 4DW2U 2FPZA 2ZFSA 2ZHWH 2WPMS 1NRQH 4MNWA 1CHGA 3RXJA 1ZMLA 1ZRKA 2BB4A 3KQEA 3RMNH 1ABJH 3KL6A 2M2AA 5LGOA 3SYJA 1O3DA 4FU9A 1MTNC 4NIXA 3TH2H 4INHA 2HVXA 1O2IA 4OS1A 4KTCA 3A86A 1Q2WA 2Y5HA 3SU2A 1S85A 3EGKH 2ZGHA 4X1RU 2H5DA 2O8WA 1BUIA 1L1GA 1LCYA 1D3TB 1XXDA 4U2WA 2O8LA 3MH7A 1THSH 3AW1A 4GUXA 2YNAA 1BRAA 2A0QB 1VR1H 4WMEA 2THFB 1C5NH 1E1RD 4R8TB 3P8NA 3QGJA 4YLUA 2EI7A 2FEQH 1LMWB 4X6PA 3RXUA 1Y5UT 3M5NA 1Z7KA 2QAAA 1SMFE 1O31A 4BAHB 1TBRH 2ZU2A 5DK1A 1MKXK 2OK5A 4Y7BA 1K1NA 3SI3H 1NBMD 2AGIX 3E16B 1ETSH 2G8TA 2V7QD 4O97A 1XM1A 2GCTC 1CVWH 2OCVB 2SGDE 1DPOA 3K9XB 1XUGA 2JJ1D 3Q3YA 3ITIA 4ZAEA 1FJSA 2FS8A 3F9GA 7GCHG 3PLBA 4BAKB 2VBCA 2Z3CA 3I78A 4GCHG 1C1OA 1S84A 1ETRH 4MTBA 1YPJH 1QJ1B 5GNDA 3RM2H 5JBAS 1SPJA 3Q3KA 1V2OT 5C0UA 2QXJA 4I8GA 1EB2A 2WPJS 2QV1A 4A92A 5E8EH 2A4OA 1GJDB 4KTUA 1W11U 3WWBA 3S69A 5AFZH 4ZUHA 1V2RT 3STJA 3ZVBA 3UTUH 3A8BA 1C5OH 5DGJA 3SGAE 1OWHA 1C2HA 3RXLA 2BD2A 4NCYA 2LPRA 4BTIB 1ZR0A 3VB4A 1EAWA 3LOXA 4H6SB 3RXIA 1AGJA 3NZIA 3NPSA 1MTWA 1IQHA 3DUXH 3S9BA 1ETTH 3P8OA 1INCA 4K2YA 1GBFA 2FTMA 2BD9A 1HAZB 2J92A 1NROH 3T62A 1C1WH 1E0FD 4B74A 2ZDKA 1VGCB 5FPTA 1ZJKA 3EDXB 2ZZUH 1E38B 5A0BA 4Y8YA 3TU7H 1BTYA 4DVAU 4AFZA 1PPEE 1XMNB 1V2VT 3ZZ6A 2XBVA 2A32A 1V2TT 2ZDVH 1KXFA 2W3IA 2O9QA 5T6GA 3P92A 2FYRA 1NU9A 3U8TH 2C8YB 1BHXF 1QQ4A 4JMYA 5GWZA 1GJAB 2A7JA 4CRCA 1J14A 1SQAA 2J9NA 3M3TA 3UQVA 1P3CA 5J4SA 3MH5A 1AFQC 4YOGA 1UTKA 2WYJA 1O2RA 1SVPA 3V3MA 1ANDA 4YM9A 4B2BA 4JYTA 1ZPBA 1TMBH 4ZROA 2CHAB 2BQ6B 2J38A 4ZHLU 2ZTXA 2G5NA 3MMGA 3PROA 2CN0H 1KXBA 1UTJA 4K60A 1OX1A 2RDLA 5CHAC 4MPUA 1Y8TA 1CBWC 2AFQB 2GCHF 4UONA 3QN7A 1MCVA 1TGNA 2H9EH 4NGAH 1HUTH 5DSFA 1NBME 4WH8A 1YLCA 3M5OA 3UQOA 1KDQB 3EAJA 4BXSA 1NPMA 1W0KD 1IHTH 1ZGVA 1MU8B 1N6YA 3MOCA 2UUFB 5HGGA 1TGSZ 2C8XB 1SGNE 2RA3A 1GJCB 2ZGCA 5I25A 5LPEA 2WHXA 1L2EA 1SOTA 2R2MB 4ZKRU 1P3EA 4BAQB 2ZDAH 4CRFA 1TNJA 1E34B 1KLTA 5FPSA 3OTPA 1GG6B 1H9HE 1SC8U 4JYUH 3LDXH 1J17T 1K9OE 2GV6A 3H7TA 1IQEA 4Y0ZE 4XBCA 1ZSJA 3N7DA 1IAUA 1K1IA 1HV7A 2FOEA 1TA2A 1SLXB 4VGCB 4DURA 2FMJA 3C27B 1FMGA 2BY7X 4UE7H 4E06H 1D6WA 2PHBA 1BT7A 1NM6A 1GI2A