4NWLA

Crystal structure of hepatis c virus protease (ns3) complexed with bms-650032 aka n-(tert-butoxycarbonyl)-3-me thyl-l-valyl-(4r)-4-((7-chloro-4-methoxy-1-isoquinolinyl)o xy)-n-((1r,2s)-1-((cyclopropylsulfonyl)carbamoyl)-2-vinylc yclopropyl)-l-prolinamide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
194
structure length
194
Chain Sequence
KGSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVESLETTMRSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and Early Clinical Evaluation of BMS-605339, a Potent and Orally Efficacious Tripeptidic Acylsulfonamide NS3 Protease Inhibitor for the Treatment of Hepatitis C Virus Infection.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HCV NS3 1a Protease
total genus 50
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nwlA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4nwlA01
1O2NA 1MKWH 4K8YA 1DUEA 2FODA 5DP5A 4X2XA 4X2VA 4YT6H 4D7FA 1BJUA 3SU2A 1BUIA 4FUHA 1RGQA 1BMAA 1BJVA 3KEEA 2D1JA 2Z9JA 3QK1A 2CV3A 2Z9GA 1H9HE 1V2WT 2ZA5A 4FU9A 4ABHA 1Y3YA 1EP5A 1MCVA 1QL7A 4HTCH 3V0XA 1L1NA 1VITG 2I6SA 2WV9A 5JBCS 1HIAA 1OPHB 1G3EA 1HJ8A 1AO5A 1RFNA 2HNTF 1Y5AT 1D3TB 3DHKH 1ELBA 1CBWB 1ZTJA 2WV4A 3UQVA 3MMGA 2PGQB 2G51A 2VWLA 2J34A 1T32A 5C20A 1K22H 3RU4T 3SNEA 5FXLA 3SUFA 3GCNA 4B73A 3M35A 3NZIA 4GCHF 3UPEA 1HUTH 2H2ZA 3BEFB 4SGBE 3UOPA 3RXQA 4U2WA 3KGPA 1PPHE 3SUGA 5I46H 3ZVDA 1C2DA 1Z6JH 2ZU2A 1B0EA 3U8RH 4XSKU 5GIBA 1MTSA 1C5OH 5DP8A 3PB1E 4NFEA 3QLPH 1TQ0B 1MKWK 1MU6B 2ZU4A 5DP7A 3LOXA 3UNRA 1C9TA 1THSH 4J1YA 5JB9S 2P8OC 1W14U 1DUAA 2F9NA 3A7YA 3OX7U 3SGQE 2WZQA 1HCGA 3TU7H 1HDTH 2TRMA 2XWAA 1OOKB 1GBBA 4CH8B 4B2CA 1DICA 3S9AA 3SGAE 1Y5UT 3BN9A 2A4OA 2ZKSA 1F0TA 3SHCH 3TNTA 1IQIA 1X7AC 1V2TT 2FOAA 5LPFA 4DG4A 2BHGA 3NCLA 3MU4A 3K65B 2RG3A 2R9PA 1TIOA 3KQBA 1BBRK 2FS8A 3PTNA 1P2MA 1V2ST 1IHTH 5FPTA 1CA8B 2GV7A 2BDIA 3RXIA 5EXNA 4DOQA 1C1TA 3U8TH 4GCHG 1C1VH 3UNQA 1YKTA 3TJOA 2OBOA 3LGYA 1FPHH 2OCVB 3A8DA 1SLUB 1QBNA 2AFQB 2GP9B 3MI4A 2ZCLP 2AH4X 1FY4A 1GHBF 3ZVCA 4YLQH 1TPSA 5DG6A 5PTPA 1TONA 4RI0A 1O3DA 1QR3E 3BTQE 1SGPE 1ZGIA 1O3FA 1FONA 2FOCA 1CQQA 2XXLA 1ZHMA 4RN6A 2ALPA 3LGIA 5HM9A 1BTUA 3F68H 1GHYH 2B8OH 1QTFA 1AN1E 1V3XA 4FUIA 1O3NA 2ZTYA 1AB9C 1GHAF 1KIGH 4Y0YE 1EQ9A 2QXIA 1UTNA 5ABWA 4OS2A 2FWWA 3ZV9A 2YOLA 4Q7XA 1AB9B 1J16A 1PJPA 2A7CA 2ZTXA 2GDDA 5EGMA 1T4UH 4ZAEA 1GI5A 5CHAC 1P10A 2AEIH 3Q3KA 1BRUP 1TMTH 3SI4H 1FPCH 1GVZA 3GYLB 3P8OA 2GCTB 1DFPA 1Z7KA 1EAIA 2I6QA 1IQMA 1GI9B 4ASHA 3AW1A 3LKWA 2XWBI 1EP6A 1GBDA 2EI8A 1HFDA 2FDAA 1L4ZA 2BD8A 3E16B 3PV4A 3SU6A 1FQ3A 1FAKH 1P3CA 4NG9H 1O5AB 3ATMA 1TA6A 4YOJA 2C8XB 2H5DA 2DE8A 3JZ1B 1MTUA 1QJ6B 4IN2A 3GY2A 1LHGH 2R2MB 1EJNA 4GSOA 2XCNA 1E38B 2QAAA 1Z1JA 4K69A 1AFQB 1O2QA 1BMMH 5LPRA 1ZJDA 1UTQA 1C5RA 4LZ4B 1XUIA 4VGCB 3PMAB 5E0HA 3SU3A 1GI1A 8KME2 9ESTA 3RXDA 1A61H 1C5SA 2BTCE 2JH6D 1ELGA 1KYNA 1QQUA 1AZ8A 2ZGXH 2BQ6B 3MO3A 1ESBA 2O8MA 5EOKA 2HGTH 3A7VA 3QWCH 3C1KA 1AUTC 1V6DA 2ZF0H 3M7QA 3O8CA 4MNVA 2BM2A 2H1UA 3GY3A 1SFIA 5FPSA 3SJ8A 2Y7XA 2LPRA 1S82A 2XYAA 4FUCA 2WPHS 1GJ7B 3I78A 2FYQA 4JYUH 2Q1JA 1MQ6A 4NWKA 3ATLA 1B7XB 3LJOA 1UTKA 5DP9A 3LJJA 1CT4E 1YPHE 4WJG2 3RM0H 1S0RA 3P6ZB 1TGTA 2QF0A 3GDUA 4UFEH 2F9UA 2ZGCA 1P2JA 3RXCA 2C93B 1SGYE 3DFLA 4MPWA 1CE5A 4K1TA 2SGQE 2WUCA 4FU7A 1NFXA 1A46H 2ANWA 3HK6B 4JK6A 3PV5A 4X1RU 3FVFB 4MTBA 3BTGE 1V2LT 1WAYB 1D4PB 5FBEA 3UUZA 3RC6A 1C5WB 1SGRE 1IQEA 1SBWA 3LGTA 3TH3H 4KP0A 2A2QH 2A1DB 1EATA 1O2KA 2R0KA 3MNXA 1LMWB 3A84A 3VB7A 1HLTH 2XCFA 1Z8GA 4JZDH 1C5QA 1O0DH 2XNIA 5F8ZA 2TGPZ 2ANMH 2ZGHA 1Y59T 3RLWH 1BBRE 2J4IA 4B1TA 4AG1A 2IJD1 4NFFA 2IJOB 4E7NA 2STBE 4KGAA 1QL8A 4A1VA 1BTXA 3PTBA 2GT8A 2SGFE 3ESTA 3NWUA 2BLWA 2EC9H 2BZ6H 1KTTB 1KXEA 1LVBA 1O2ZA 1SGFA 1O2JA 1CHOF 4MPUA 4NZLA 2BVXH 1GGDB 1MAYA 1TNKA 1C5YB 3LT3A 2BB4A 4MPVA 1MCTA 4BAHB 1BTPA 1UCYH 3FAOA 1ZMNA 4JYVH 2Y80A 2O9QA 1YPLH 2BD3A 3BSQA 1YC0A 2VBCA 3UREA 2ZPRA 3A7TA 3FFGA 3RXUA 3MH4A 1AWHB 1TQ7B 4AORA 4AZ2B 2Z3DA 3E0NB 4IN1A 1A5HA 1O2XA 1LHFH 1TOCB 1UTJA 4YOIA 1ZMJA 1A2CH 4CR9A 4CR5A 1V2KT 1D9IA 4ZROA 2BY5X 1NRNH 2M5TA 1ZPZA 3RXBA 2XC5A 1N8OC 3URDA 3V7TA 1BRBE 4ISNA 2ZP0H 4WMFA 1ELAA 5DP4A 1Z6EA 2WHXA 3H5CB 3MH5A 3SV7A 5HGGA 8ESTE 4D76A 1P02A 4JYTA 1F0SA 4IC6A 1JRTA 3RXTA 2O8LA 1EKBB 1NM6A 1F0UA 1LPGB 3A8CA 2FM2A 3UTUH 2PUXB 3LONA 2HPPH 5AF9H 1L1JA 3SZNA 3PMHB 3MFJA 1O5DH 2STAE 5ESBA 5FPYA 4MVNA 1FIZA 1W13U 3AW0A 1OWJA 5EXLA 4X6MA 4CRDA 4OS7A 2AIQA 4BOHA 1HXEH 1GMDF 1FMGA 2TGAA 3RXPA 1XVMA 1RTLA 1GI2A 4JK5A 5ETXA 4YTAA 1C5VA 2BZAA 5DP6A 1GMDG 3LC5A 4FUGA 2VIWA 3MWIU 4AYVB 4OS1A 1HRTH 5J4SA 2GGVB 1LQDB 1BIOA 3A88A 3RLYH 1T4VH 2BY9X 4Y7BA 2RA3A 4AN7A 1EZSC 2BY6X 2W7SA 3E6PH 3M5LA 1EX3A 5DJ7A 1EAXA 3SNDA 4AGJA 4ZKOU 5ESTE 2TIOA 1GMCF 1IQKA 8GCHF 1P04A 4FXGH 3RMLH 2FXRA 3KQDA 1D6RA 3P95A 3SN8A 1AUJA 1CGIE 5EU8A 1NRPH 3FP6E 2C4FH 1WCZA 1EPTB 3BEUA 3GOVB 5AFZH 2OXSA 3QN7A 4X1NU 1EZUC 1H8DH 1S0QA 1A0LA 1YYY1 1DLEA 1LHEH 1CBWC 1CHOG 3GY7A 3AVZA 1C2GA 1TNHA 5IYTA 2RCEA 3SORA 1E34B 2FEQH 1O32A 4XE4A 1DVAH 3L33A 4TPIZ 2WYGA 1QBVH 2FOGA 2PKAA 3O8DA 4B2BA 3NK8A 2VVVA 1GBEA 1C5MD 2H5CA 4M9FA 1O2VA 1O2MA 2BD2A 5L6NH 3FP7E 4INLA 1BA8B 1HB0B 1EXFA 1FAXA 1PPCE 2ILNA 3ATWA 4I33A 4U32A 3HPTB 1M9UA 2EEKA 1GCTC 1ETTH 2HWLB 4NIWA 1GVLA 2IOTA 4Y0ZE 1D3PB 2BLVA 2JH0D 1S83A 2OP9A 1FUJA 1NO9H 5C2ZA 2DE9A 3P70B 1C1MA 3VGCC 5BRRE 1OP8A 3S69A 4I8LA 3ZZ8A 1SSXA 5L2YH 2A2XH 3LIWA 2D26C 1NS3A 2V35A 1V2OT 3DA9B 1NRRH 2ZU1A 2A0QB 4A92A 2WINI 1SLVB 1EUFA 1O3AA 3S0NA 3TPIZ 3A7WA 4A5TS 1BB0B 4UEHH 1TGSZ 1O3LA 4NA8A 4GHQA 4WXIA 5C5OA 1FIWA 1TA2A 3H7TA 3E8LA 1P09A 3LH3A 1EPTA 3ZVEA 1ZTKA 1C1NA 1H4WA 2VH6A 1V2RT 2BDAA 2PTCE 2QXGA 4K1EA 1YGCH 2P93A 1QCPA 3AAUA 2CGAA 4Q2KA 1OWEA 4OGYA 1HJAC 2D8WA 3SU1A 4XFQA 2ZHWH 4MNWA 3SW2B 2GZ8A 2VWOA 1BRCE 1OKXA 1B0FA 1IHSH 1TNIA 2A4RA 2JETB 2F9OA 1S84A 3Q00A 1O2LA 2B5TB 2BX4A 1HNEE 4OS6A 4AX9H 2ODYB 1XMNB 1SLXB 2OQ5A 1V2JT 2Z94A 4I31A 3HGNA 3ZVBA 2BDCA 3OY5U 3TK6A 4QT8C 2F9BH 4BAOB 1QQ4A 2C8YB 2ZGJA 1QRXA 1UTLM 1O5EH 1A3EH 1CA0C 2G55A 1JBUH 2J2UA 1ELCA 1CA0B 3SQHE 3B23B 5GDSH 1S6HA 3MH6A 2FOHA 1RTFB 3A81A 2G81E 1AE5A 3BTME 2ZGBH 1Z8IB 3VB3A 1O3PB 3OSYA 1OXGA 1CHGA 3KIDU 4LXBH 4FUJA 1AVWA 1A3BH 2AIPA 1Y5BT 2VH0A 3SYJA 1GI4A 3ZZ9A 1N6XA 2SGDE 2JKHA 1BT7A 4O97A 2ODPA 4Z6AH 1NZQH 2UUKB 4BTTB 1F5LA 1IQNA 3UIRA 1EZXC 1MD8A 3T28A 1BMLA 1HAHH 1UO6A 1PPBH 1GVKB 3UFAA 3QUMP 1TPPA 1VCPA 2Q6FA 2G8TA 4LK4A 2GTBA 4CH2B 3RXLA 2ZFTA 3SV8A 4VGCC 1TFXA 3GDSA 2SGEE 4U01A 4K60A 2GT7A 5EW1H 3OYPA 1SQOA 3RXHA 1KLIH 1JOUB 4A1XA 1Q3XA 3ZZ3A 1RS0A 3F9EA 4YM9A 2NU3E 3PLPA 2CN0H 1TE0A 2ZQ1A 1C5NH 2FX4A 3RC5A 1G37A 3KCGH 2J9NA 3EA8A 1BBRH 1JRSA 4GUXA 1K1IA 4UDWH 1L1GA 1TOMH 1SOTA 1NESE 4BXSA 4DURA 1MZDA 5E2OA 4ZKRU 4A7IB 5E2PA 2B9LA 1GJAB 1XUFA 5T1VA 3MU5A 1NY22 3H7OA 1O3CA 1LKBA 3TNSA 1O2GH 6CHAC 5A0BA 2FZZA 2J38A 3SO3A 2FMJA 2CJIA 2G4UA 2ZHEH 3KQCA 2TBSA 3AAVA 2H6MA 3F9FA 3QGNB 1UTOA 1OWKA 1QRWA 2ZC9H 1OX1A 1ZJKA 1MTNB 1RIWB 1UK3A 2OQUA 3P8FA 3T62A 1O36A 1ZRKA 4AGKA 4ABEA 2CMYA 4FUBA 1T8MA 4JMYA 2A32A 3RP2A 1ZTLA 2VVCA 1O3OA 4K1SA 2BXUH 4WMDA 5B6OA 5DGJA 1O2TA 1XKBC 4DCDA 3ELAH 3ZZ7A 1NN6A 1NU9A 4NWLA 1DSUA 3MTYA 2A5AA 2WPKS 1GJ6A 1CU1A 4I7YH 4CRGA 1MTWA 1W0ZU 3F1SB 3GYMA 2NU1E 1P11E 5A0AE 3SJ9A 2VIPA 4NA9H 1C5PA 3Q76A 4WH6A 2QA9E 5A8ZA 2VIOA 1GBHA 1T31A 2ZFFH 3A89A 1AU8A 1H9LB 5HYOA 1O3KA 1YPHC 3SNAA 9LPRA 3WY8A 3D23A 3FZZA 4JCNA 1LPKB 2W5EA 4FUEA 1EB1H 3D49H 2OC7A 1MU8B 1HXFH 3LDXH 2THFB 2PHBA 3SJKA 2O8TA 4HI3A 1GJ9B 1KY9A 3HKIB 3PO1C 1T8NA 1ANCA 3MNBA 1W2KH 1LCYA 2VNTA 1QJ1B 5LPEA 1YPMH 4RKOB 1C2LA 1G9IE 1MMJN 2PR3A 3A7ZA 3RU4D 3MYWA 1QGFA 1AWFH 5IDKA 3LC3A 1GL1A 1GGDC 4ABIA 4Y11E 2ZWLH 3M7TA 5K7RA 5EQSA 1TGNA 2OLGA 1YBWA 1O3EA 3PV2A 2J94A 2CF9H 2IN2A 1MZAA 1D3QB 1O5FH 1TMBH 1GMCG 2PWXA 5HMAA 1MBMA 1DX5M 1UJ1A 5FAHA 1VJ9U 2R2WU 3UNSA 5AVDA 2Y6TA 3RMNH 2UWLA 2ZDMA 3W95A 2XBWA 2OBQA 2Y5FA 4X2WA 1C2IA 3BTKE 1K1PA 1VCQA 2JETC 1J8AA 1LTOA 3M3SA 1TX7A 2KAIB 4SGAE 2BDHA 3VXFH 2FTMA 1EAUA 4AFQA 1FLEE 1NU7B 2BY8X 1DXPA 3FZDA 1XUKA 1HJ9A 3M5NA 4UFFH 4OGXA 1BDAA 3T5FH 1P05A 1TX6A 3STIA 1V2MT 4MPXA 1WUNH 3SJIA 2ZECA 2TPIZ 2WPJS 1AHTH 2K1QA 5TJXA 4INKA 4X0WU 1RD3B 4XOJA 2Y82A 1HAZB 2ZFRH 1IQLA 2ZHQH 4Q7ZA 1LVMA 1C1PA 2BQ7B 1UK4A 5GXPA 4D7GA 1SGDE 4ZKNU 2UUFB 3SNBA 1E0FD 1C4V2 3M3TA 4AYYB 5C3NA 3ZZ5A 2SFAA 1O2OA 4O3UA 1ZOMA 1FZZA 1BZXE 4B2AA 1SMFE 1W7GH 1P8VC 4WVPE 2GVFA 2VWMA 1HAPH 4WY3A 4ABAA 1UVOA 1NC6A 1ETRH 1MBQA 5C67A 1W8BH 1ANDA 1G3CA 3PLKA 2HRVA 3U1JB 3GY4A 2PSYA 2A31A 2HNTC 1ZZZA 5FHTA 1GHVH 1TGCA 2BDYA 1J15A 4YLUA 1SQTA 3SUDA 3GY8A 1C2KA 1THRH 1W11U 3PYHA 1UTMA 3NUMA 1G32B 4HFPB 2V6NA 1P2QA 3E1XB 4AFUA 1JWTA 4FVDA 1C4U2 1PPEE 1ZMLA 3T25A 4XDEA 1HPGA 2O8UA 3U69H 2HALA 2SGPE 4NZQA 4KTSA 2PKAB 1DSTA 1AD8H 2PUQH 2GMTC 2UUJB 2BVSH 5T6GA 3DT0H 4LOYH 1C2EA 4YT7H 2F83A 2GV6A 1SLWB 1TB6H 4ISHH 1C1WH 3ZVFA 1O30A 1WTHD 4BAMB 1DM4B 2PLXA 3MHWU 1YCPM 3A82A 4K2YA 4Y8XA 2FX6A 3RXOA 3LGUA 5A2MH 2UUYA 5L2ZH 3RXRA 3KL6A 2ZFSA 3K9XB 5FCRA 2AMPA 2FOMB 1VCWA 5H4IB 1GBMA 1XUHA 2BD5A 1C1SA 4NA7A 3UR6A 1ESTA 3BEIB 2TGTA 1GBIA 1GHXH 4I8KA 4XBDA 4Y76A 1FY1A 1SGQE 4NGAH 2C8ZB 4GAWA 4LZ1H 1FN8A 3FP8E 4MG3A 4DGJA 1VJAU 5DO4H 1KXDA 1LDTT 2C8WB 2P3UB 2HLCA 3RXGA 3BTTE 3CENA 2V0BA 1ELEE 4H42U 1GCTB 2Z9IA 3EA7A 2NU4E 4JZEH 3V3MA 4KTCA 2B7DH 2R3YA 2ZZUH 1P3EA 7GCHG 1GHBG 1MKXH 1YCPK 1Z8RA 2GKVE 2GCTC 1NPMA 3B8JA 4AG2A 3SQEE 1C1QA 5DP3A 3KN2A 2EA3A 3M37A 2XBYA 2BQWB 1JIMA 1P9UA 1W10U 3SHAH 3ZZAA 3A8BA 1D6WA 2FP7B 1LO6A 1NTPA 1GG6C 7ESTE 2QGRA 1PQ7A 1LVYA 2KAIA 1GL0E 5LH8A 5HM2A 3TIUA 4D9QA 1IOEA 1GJ4H 2QXHA 1KDQA 2J95A 3BTWE 1AFEH 3F6UH 4E06H 1PPGE 3PROA 2LNCA 1WSSH 3M61U 3ODFA 1HAVA 2HNTE 1IQHA 2ESTE 1A4WH 5C1XA 1LPZB 1O3MA 2ZDNA 3TH4H 5A8XA 4IBLH 2PGBB 3G01A 5GCHF 3MO9A 4FVBA 2VIVA 4ZHAA 1SI5H 1ZGVA 1FY5A 3RXVA 4X1QU 1WQVH 2IPHA 1FDPA 5C5NA 2AMDA 1O5CB 1VGCC 1INCA 2AMQA 3P8GA 1ZHPA 5TCCA 1BTYA 1O2UA 3P92A 2TGDA 1PQ8A 1O3IA 3NXPA 1HYLA 2P59A 1AQ7A 1NROH 4B6FA 1GBKA 6GCHG 1PQAA 3EA9A 3NKKA 4FUFA 1L4DA 3SJOA 2Y5GA 5A09A 2YNBA 5GPIB 2XW9A 8GCHG 2FI4E 5EQQA 4I8GA 2ZCKP 4TWWA 3IWMA 2OUAA 1GPZA 4X8VH 4ZH8A 1HAOH 1P0SH 3SZEA 1HAXB 2BOKA 1K1MA 2FOFA 1F5RA 3F9HA 1HBTH 3EGKH 1RXPA 1QB1A 3SI3H 1QA7A 1MTVA 2FLRH 1NRSH 3EAJA 1DWBH 2ZG0H 2R3UA 4NCYA 1GWAA 1UK2A 1AMHA 5F8TA 1CO7E 3V12A 1C1UH 1H8IH 1K2I1 2BLQA 4Y6DA 3SU0A 3ZYEA 2D2DA 1O2IA 4NSYA 2BDBA 3VPKA 3KNXA 1HAVB 3UY9A 5L30H 3QTOH 2O8WA 2C3SA 2ZPSA 2WV5A 4B76A 1NFWA 4WH8A 1DXWA 2WPIS 1UVSH 4DIHH 1WQSA 2GD4B 1F7ZA 1SC8U 2AYWA 4Z0KA 1BQYA 1CGHA 5JDUB 1V2UT 5J4QA 1NFYA 3OU0A 3MNSA 3ITIA 1FN6A 1OP2A 3BIVH 1TBQH 5EPYA 1OYQA 5EQRA 1ELDE 4X8UH 1W3CA 3N7OA 3SV9A 1GHZA 4H4FA 1EJMA 2ZDKA 5BPEA 1G30B 2XTTB 1TNGA 3ENSB 1WYKA 3A86A 1TLDA 1BMNH 3RXJA 3RXAA 6LPRA 1ZPCA 3DD2H 1FJSA 4K5ZA 1O2HA 1F5KU 1J17T 2FTLE 3MU1A 3PWCA 5B6LA 2H9HA 1G2MA 1E37B 2F9PA 5CHAB 3D62A 2FOEA 5AFYH 1SGEE 4Y7AA 4MQAA 2G00A 2RA0A 3LGVA 5F8XA 4X6PA 1C5XB 1JXPA 7LPRA 1SB1H 1N6YA 1IAUA 3PMBB 4ISLA 6GCHF 1SGNE 2ZO3H 1A0JA 5JBTA 2RDLA 3VFEA 4PROA 2Z6BD 4RSPA 2GZ7A 4E05H 1GJDB 1V2QT 1KSNA 5G4BA 3K2UA 1FV9A 1KXFA 1GJBB 5DKMA 4CHAB 1QFKH 1CGJE 1J14A 1O35A 2DUCA 2FLBH 1W0YH 2FOBA 1QY6A 2A45B 2FI5E 2HVXA 1BHXF 5E8EH 2F9VA 4NIXA 2BD7A 4IS5A 4BAKB 2VWNA 1A7SA 3TH2H 2Z9LA 4WMEA 1CT0E 1K28D 4BNRA 2QXJA 4K3JA 2ZU3A 4GHTA 1LHDH 3JZ2B 1Z8JB 1NFUA 1O3HA 4O9VA 3TJVA 1DLKB 3O8BA 2OK5A 1G3DA 1OWHA 1FNIA 1QIXB 1GI8B 1NRQH 1ETSH 1LQEA 2QN5T 3CS7A 4DW2U 4INHA 1ZSJA 2BYAX 3ZZDA 2ZDLA 3IITA 2PKSB 3LPRA 1LHCH 1ZHRA 3BF6H 2AS9A 1F0RA 3UQOA 1BITA 1YCPH 1O31A 5SGAE 2ULLA 4I32A 3DFJA 3W94A 3BG8A 4UONA 1WXRA 2ASUB 3R0FA 2GCHG 2VIQA 5T6DA 1PPFE 1GDUA 2FI3E 2G52A 4Y8YA 4A6LA 5AHGH 2VGCB 3GCTF 1SVPA 4WXVA 3SU4A 4ISIH 3PO1B 3TK9A 1OWDA 2A7HA 2VGCC 4KELA 4MNXA 4AB8A 1C2HA 4NIVA 1SHYA 4HZHA 1K9OE 3BG4B 1AKSA 2YNAA 1ABIH 3QZRA 3TLOA 3STJA 1C5TA 4DT7B 2ZHDA 2WYJA 1T8LA 4FUDA 2W26A 3SBKA 1GHWH 3UOUA 1AE8H 4HGCA 4AOQA 3M36A 1MH0A 1O3JA 2XBXA 2BD9A 5HXFA 1AIXH 4TPYA 2ZFPH 1FY3A 1C2MA 1O39A 1A5GH 1MTNC 1RIWC 1VITH 4F49A 2EI7A 1GBAA 3S7HB 1YPGH 2QIQA 1P2NA 3I29A 5DPAA 1GBCA 1O3GA 1XM1A 4UFDH 1TRMA 4DVAU 2G5VA 1S5SA 3UWJH 4R8TB 2BOHB 1A5IA 2UWPA 3NPSA 3RXMA 1N8OB 3VXEH 5T3HA 1C1OA 1AZZA 1YP9A 2CHAB 4ESTE 3ZZCA 1BTZA 1GI0A 1QRZA 1SOZA 1QA0A 1YLDA 2FO9A 3E91A 1TGBA 2Q6DA 3MH7A 1C4Y2 1F92A 1P57B 3VGCB 3MU0A 3OTJE 1UVUH 4ABGA 5GWZA 2Z3EA 4J2YB 5EPNA 3QO6A 4ZXYH 3RUOA 1LVOA 2ZU5A 4XBBA 3OY6U 1NT1A 1KLJH 2Z7FE 3VB5A 1B5GH 1K1NA 1KXCA 1T8OA 1EB2A 4GPGA 5FBIA 1WV7H 5JBAS 1P12E 2A5KA 3RDZA 1KDQB 1P2OA 4CBOA 3HKJB 3U98H 2OC8A 3F9GA 4THNH 2XC0A 4R0IA 5E0JA 1K1OA 2AGGX 3RC4A 3TJUA 1EAWA 1MKXK 3GCHB 1BCUH 2G5NA 1V2NT 1THPB 3SU5A 1GBLA 3ODDA 2HOBA 2ZI2H 1TRYA 2ZPQA 1C2FA 1WTGH 1SQAA 4ZUHA 1SG8B 4MDSA 3MOCA 3BIUH 4AB9A 1QJ7B 1HAGE 2CXVA 3VEQB 1TPOA 5FX5A 5T6FA 1E36B 1QB6A 3TGKE 1XVOA 1TMUH 1GJCB 4H6SB 1EZQA 2XC4A 1V2PT 4U30A 2ANYA 1AY6H 3I77A 1ELVA 1GHAG 4Y10E 1O37A 1OYTH 1UCYE 2V3HH 4GVUA 4AFSA 1DPOA 3RXKA 3GCTG 2BVRH 1FXYA 3TITA 1KTSB 4ABFA 1S6FA 4BAQB 3GY6A 1PYTD 3R3GB 1G36A 5DK1A 4Q7YA 3ZVAA 1E35B 1AVGH 3RM2H 4BXWA 1S85A 1HIAB 2VU8E 3RU4E 2QF3A 3MO6A 2QCYA 3H09A 4CRAA 4ZHLU 1TRNA 1YPJH 3Q3YA 1HGTH 1TALA 4ZKSU 1TNLA 2QY0B 3U1IB 3S9BA 3KHVA 1O2SA 4JZFH 4TWYA 1BHXB 1K1JA 1DOJA 5CE1A 2P8OB 1IQGA 1GI6A 4TYDA 1G2LA 3OTPA 3E90B 2GCHF 4B6EA 4RKJB 1EJAA 3TK5A 3EDXB 1TYNA 1S81A 1Z71A 3SNCA 1O34A 2SNVA 1CVWH 2VVUA 2Q6GA 1O5BB 2PTNA 4CHAC 1DY8A 3GCHC 3T2NA 4Y8ZA 3CP7A 1GBTA 3SV2H 3EYDA 3PMJA 1UHBB 1Q31A 1ARCA 3RXEA 1T7CA 1QBOA 1ID5H 3BV9B 3M5OA 4ABJA 4E7RG 1WBGB 3ZVGA 4ZHMU 1P2KA 1Q2WA 2A7JA 2CF8H 4CBNA 2P16A 4IW4E 1SR5C 3HGPA 3SUEA 3L6PA 4NIYA 5E0GA 2H9EH 1AFQC 1C5LH 2BY7X 4Y79A 1DT2A 3HK3B 1VR1H 4H6TA 1OS8A 4O03A 1MUEB 1YLCA 8LPRA 2P95A 3PM3A 1UTPA 1JMOH 2Y5HA 2ANKH 2G4TA 4KTUA 1XUGA 5JBBS 1L0ZA 3C27B 4TY6A 1W12U 3EE0B 4D8NA 7KMEH 2V3OH 1O2YA 2C90B 1ZSKA 4ABDA 4Q80A 1VITF 3QDZB 1O5GH 3QGJA 1Z1IA 3B9FH 3VB6A 2VIDA 4AFZA 4ZXXH 5EXMA 1SGCA 3ZYDA 4X6NA 2GDEH 4B74A 5JB8S 4K8BA 1H9IE 2AERH 1OP0A 3K6ZA 2AGEX 4UD9H 1ARBA 1GI7B 1Y3UA 2F91A 3BG4C 3Q3XA 1AI8H 4MNYA 2WUBA 3E0PB 1W7XH 1EOLA 4UE7H 2UWOA 2AGIX 2ZQ2A 1K21H 2A4GA 2BXTH 1GJ8B 1DWCH 1TX8A 4OS5A 2ZDVH 4KKDA 3HATH 1ZLRA 3IG6B 1PYTC 1BRAA 1UCYK 1UHBA 2OC0A 2ZIQH 1YF4A 1ABJH 1WOFA 5A0CA 3GY5A 2P94A 1DDJA 1UVPA 2OTVA 1JIRA 1YPKH 1U6QA 2FPZA 2OC1A 3MU8A 2Y7ZA 1TPAE 4X1SU 1SGFG 4MLFB 1LKAA 2QC2A 3KQEA 1GMHG 2FIRH 2ZNKH 1RJXB 1Y3XA 1ZRBA 1O38A 2Y81A 3SGBE 1BTWA 1YPEH 3AASA 3A80A 1N1LA 1QB9A 1C2JA 5TCAA 2CHAC 4X8SH 4IMQA 1C5ZB 2FYRA 1DY9A 3ZZBA 3ZZ4A 1CSOE 4IMZA 1TWXB 3O8RA 1ESAA 4UFGH 4WF8A 1KXAA 3BTHE 2J92A 1ANBA 3LH1A 5LGOA 4B75A 2GMTB 2PSXA 3U8OH 1SGIB 2ALVA 2XBVA 3S9CA 2NU0E 1VGCB 1OWIA 1OSSA 1MD7A 2PFEA 3AK5A 2PV9B 2FESH 1C1RA 1O2PA 2FS9A 3A83A 3RMMH 2PW8H 4OS4A 1SGTA 3SV6A 1Y8TA 1FY8E 4YO9A 2EI6A 2BDGA 4Y71A 2ZFQH 5GCHG 4D9RA 3D65E 1Y3WA 4JZ1A 4ZMAH 3MNCA 3GICB 3T29A 1VZQH 1H1BA 3BTDE 3LGWA 3UWIA 5A8YA 2A5IA 1FI8A 3Q77A 4BANB 1L2EA 4F4OC 4YOGA 4JZIA 2F3CE 2JH5D 1EPTC 1AKSB 2VJ1A 5GJ4B 1EOJA 4TY7A 4DY7B 3T26A 3BTEE 1QURH 4XBCA 1MQ5A 3SOSA 2A4QA 1P2IA 3QZQA 3URCA 1WU1A 3RXFA 1QHRB 4M7GA 1O2RA 3TGJE 5F6MA 4CRBA 1C9PA 5EW2H 5JYIA 3QTVH 3GISB 2R0LA 2HPQH 1IQJA 1UVTH 2VB0A 3P17H 3FANA 4A1TA 2PKSC 1C5UA 4FU8A 1ELTA 1G3BA 3CS0A 4DIIH 2NU2E 4NSVA 3LU9B 1ZPBA 3A8AA 3U9AH 1SPJA 4B71A 5C1YA 3RXSA 2WPLS 1HJAB 1TBZH 1DITH 3T27A 1IQFA 3E3TA 1GBJA 1AVXA 2OINA 1HAYB 2QV1A 2ZHFH 4YZUA 3A87A 2Z3CA 2NWNA 1TBRH 2SGAA 1MAXA 1GDNA 3A7XA 3S7KB 1XKAC 3ATIA 1YM0A 2ZTZA 1TABE 1UMAH 7GCHF 2H9TH 1P01A 3TJNA 1ZYOA 2ZEBA 1EASA 2ODQA 3EQ0H 3TVJB 5EODA 1GCDA 1RRKA 1TNJA 1P9SA 3KF2A 4GLYA 5C1UA 2GZ9A 1DANH 1HAIH 1AGJA 2GX4A 1GBFA 2VINA 1Y3VA 3VB4A 4BTUB 1XXDA 2F4LA 1V2VT 2Z9KA 5GNDA 3ATKA 4I8HA 1RTKA 5EG4A 2BMGB 1P06A 2B0FA 4YESB 3ZV8A 4ISOA 1F2SE 3ZZ6A 2OD3B 4ABBA 1TAWA 4X6OA 1XXFA 1A1RA 1O33A 3PWBA 6CHAB 1GDQA 3PLBA 3TGIE 6ESTA 1D3DB 1SHHB 4X2YA 4I8JA 4CRCA 4BTIB 2QYIA 4DJZB 3GCOA 4IC5A 5K0HA 3GDVA 3P8NA 3RMOH 2BD4A 2W7UA 4O3TA 2P3FH 3BTFE 1BTHH 1QL9A 3UR9A 3A85A 1SFQB 1DWEH 3QX5H 1ACBE 1PFXC 1SL3A 1GI3A 1ZR0A 1ZSLA 3L3TA 4CREA 3M3VA 3M7UA 4IGDA 1ORFA 1DS2E 1ELFA 1KLTA 2W3KA 1HV7A 1KXBA 3DUXH 4X1PU 1A0HB 5CMXH 4WWYA 1DWDH 2SNWA 5F03A 1BOQA 1QNJA 1K1LA 1O2WA 1GMHF 1PPZA 1CT2E 5FX6A 3M5MA 2W3IA 1XUJA 1J9CH 2WPMS 5FCKA 3V13A 2XRCA 1ANEA 2ZDAH 1PQ5A 5I25A 4OM9A 1GG6B 1O3BA 1P03A 2P3TB 3K6YA 1GJ5H 2BLOA 2BX3A 1DE7H 1XX9A 2ZCHP 5JPMH 4CRFA 4X8TH
chains in the Genus database with same CATH superfamily
1O2NA 1MKWH 4K8YA 1DUEA 2FODA 5DP5A 4X2XA 4I86A 4X2VA 4YT6H 4D7FA 1BJUA 3SU2A 1BUIA 4FUHA 1RGQA 1BMAA 1BJVA 3KEEA 2D1JA 2Z9JA 3QK1A 2CV3A 2Z9GA 1H9HE 3N7DA 1V2WT 2ZA5A 4FU9A 4ABHA 1Y3YA 1EP5A 1MCVA 1QL7A 4HTCH 3V0XA 1L1NA 1VITG 1UW7A 2I6SA 2WV9A 5JBCS 1HIAA 1OPHB 1G3EA 1BMFD 1HJ8A 1AO5A 1RFNA 2HNTF 1Y5AT 1D3TB 3DHKH 1ELBA 1E1RD 1CBWB 1ZTJA 2WV4A 3UQVA 3MMGA 2PGQB 2G51A 2VWLA 2J34A 1T32A 5C20A 1K22H 3RU4T 3SNEA 5FXLA 3SUFA 3GCNA 4B73A 3M35A 3NZIA 4GCHF 1WDIA 3UPEA 1HUTH 2H2ZA 3BEFB 4SGBE 3UOPA 3RXQA 4U2WA 3KGPA 1PPHE 3SUGA 5I46H 3ZVDA 1C2DA 1Z6JH 2ZU2A 1B0EA 3U8RH 4XSKU 5GIBA 1MTSA 1C5OH 5DN6D 5DP8A 3PB1E 4NFEA 3QLPH 1TQ0B 1MKWK 1MU6B 2ZU4A 5DP7A 3LOXA 3UNRA 1C9TA 1THSH 4J1YA 5JB9S 2P8OC 5CDFE 1W14U 1DUAA 2F9NA 3A7YA 3OX7U 2WZQA 3SGQE 1HCGA 3TU7H 1HDTH 2TRMA 2XWAA 1OOKB 1GBBA 4CH8B 4B2CA 1DICA 3S9AA 3SGAE 1Y5UT 3BN9A 2A4OA 2ZKSA 1F0TA 3SHCH 3TNTA 1IQIA 1X7AC 3KYGA 1V2TT 2FOAA 5LPFA 4DG4A 2BHGA 3NCLA 1YY3A 3MU4A 5HIYA 3K65B 2RG3A 2R9PA 1TIOA 3KQBA 1BBRK 2FS8A 3PTNA 1P2MA 1V2ST 1IHTH 5FPTA 1CA8B 2GV7A 2BDIA 3RXIA 5CHBA 5EXNA 4DOQA 1C1TA 3U8TH 4GCHG 1C1VH 3UNQA 2J98A 1YKTA 3TJOA 2OBOA 3LGYA 1FPHH 2OCVB 3A8DA 1SLUB 1QBNA 2AFQB 2GP9B 3MI4A 2ZCLP 2LP6A 2AH4X 1FY4A 1GHBF 3ZVCA 4YLQH 1TPSA 5DG6A 5PTPA 1TONA 4RI0A 1O3DA 1QR3E 3BTQE 1SGPE 1ZGIA 1O3FA 1FONA 2FOCA 1CQQA 2L74A 1ZHMA 2XXLA 2ALPA 3LGIA 4RN6A 5HM9A 1BTUA 3F68H 1GHYH 2B8OH 1QTFA 1AN1E 1V3XA 2PP6A 1O3NA 4FUIA 2ZTYA 1AB9C 1GHAF 1KIGH 4Y0YE 1EQ9A 2QXIA 1UTNA 5ABWA 4OS2A 2FWWA 3ZV9A 2KCPA 2YOLA 4Q7XA 1AB9B 1J16A 1PJPA 2A7CA 2ZTXA 2GDDA 5EGMA 1T4UH 4ZAEA 1GI5A 5CHAC 1P10A 2AEIH 3Q3KA 1BRUP 1TMTH 3SI4H 1NBMD 1FPCH 2XNDD 1GVZA 3GYLB 3P8OA 2GCTB 1DFPA 1Z7KA 1EAIA 2I6QA 1IQMA 1GI9B 4ASHA 3AW1A 3LKWA 2XWBI 1EP6A 1GBDA 2EI8A 1HFDA 2FDAA 1L4ZA 2BD8A 3E16B 3PV4A 3SU6A 1FQ3A 1FAKH 1P3CA 4NG9H 1O5AB 3ATMA 1TA6A 4YOJA 2C8XB 2H5DA 2DE8A 3JZ1B 1MTUA 1QJ6B 5HIZA 4IN2A 3GY2A 1LHGH 2R2MB 1EJNA 2KZ4A 2XCNA 4GSOA 1E38B 2QAAA 1Z1JA 4K69A 1AFQB 1O2QA 1BMMH 5LPRA 2QF4A 2RFKC 1ZJDA 1UTQA 1C5RA 4ZCNA 4LZ4B 1XUIA 1VKYA 4VGCB 3PMAB 5E0HA 3SU3A 1GI1A 8KME2 9ESTA 3RXDA 1A61H 1C5SA 2BTCE 2JH6D 1ELGA 1KYNA 1QQUA 1AZ8A 2ZGXH 2BQ6B 3MO3A 1ESBA 2O8MA 5EOKA 2HGTH 3A7VA 3QWCH 3C1KA 1AUTC 1V6DA 2ZF0H 3M7QA 3O8CA 4MNVA 4FOUC 2BM2A 2H1UA 3GY3A 1SFIA 5FPSA 3SJ8A 2Y7XA 2LPRA 1S82A 2XYAA 4FUCA 2WPHS 1GJ7B 3I78A 2FYQA 4JYUH 2Q1JA 1MQ6A 4NWKA 3ATLA 3WWBA 1B7XB 3LJOA 1UTKA 5DP9A 3LJJA 1CT4E 2LELA 1YPHE 4WJG2 3RM0H 1S0RA 3P6ZB 1TGTA 2QF0A 3GDUA 4UFEH 2F9UA 2ZGCA 2WSSD 1P2JA 3RXCA 2C93B 1SGYE 3DFLA 4MPWA 1CE5A 4K1TA 2SGQE 2WUCA 4FU7A 1NFXA 5DSFA 1A46H 2ANWA 3HK6B 4JK6A 3PV5A 4X1RU 3FVFB 4MTBA 2V3MA 3BTGE 1V2LT 1WAYB 1D4PB 3EE7A 5FBEA 3UUZA 3RC6A 1C5WB 1SGRE 1IQEA 1SBWA 3LGTA 3TH3H 4KP0A 2A2QH 3OAAD 2A1DB 1EATA 1QZ8A 1O2KA 2R0KA 3MNXA 1LMWB 3A84A 3VB7A 1HLTH 2XCFA 1Z8GA 4JZDH 1C5QA 1O0DH 2XNIA 5F8ZA 2TGPZ 2ANMH 2ZGHA 1Y59T 3RLWH 1BBRE 2J4IA 4B1TA 4AG1A 2IJD1 4NFFA 2IJOB 4E7NA 2STBE 4KGAA 1QL8A 4A1VA 1BTXA 3PTBA 2GT8A 2SGFE 3ESTA 3NWUA 2BLWA 2EC9H 2BZ6H 1KTTB 1KXEA 2W6ID 1LVBA 1O2ZA 1SGFA 1O2JA 1CHOF 4MPUA 4NZLA 2BVXH 1GGDB 1MAYA 1TNKA 1C5YB 3FOAA 1W0JD 3LT3A 2BB4A 4MPVA 1MCTA 4BAHB 1BTPA 1UCYH 3FAOA 1ZMNA 4JYVH 2Y80A 2O9QA 1YPLH 2BD3A 3BSQA 1YC0A 2VBCA 3UREA 2ZPRA 3A7TA 3FFGA 3RXUA 3MH4A 1AWHB 1TQ7B 4AORA 3CNRA 4AZ2B 2Z3DA 3E0NB 4IN1A 1A5HA 1O2XA 1LHFH 1TOCB 1UTJA 4YOIA 1ZMJA 1A2CH 4CR9A 4CR5A 1V2KT 1D9IA 4ZROA 2BY5X 1NRNH 2M5TA 1ZPZA 3RXBA 2XC5A 1N8OC 3URDA 3V7TA 1BRBE 4ISNA 2ZP0H 2QF5A 4WMFA 1ELAA 5DP4A 1Z6EA 2WHXA 3H5CB 3MH5A 3SV7A 5HGGA 8ESTE 4D76A 1P02A 4JYTA 1F0SA 4IC6A 1JRTA 3RXTA 2O8LA 1EKBB 1NM6A 1F0UA 1LPGB 3A8CA 2FM2A 3UTUH 2PUXB 3LONA 5EJ1A 2HPPH 4RT0A 5AF9H 1L1JA 3SZNA 3PMHB 3MFJA 1O5DH 2STAE 5ESBA 5FPYA 4MVNA 1FIZA 1W13U 3AW0A 3F2GA 1OWJA 5EXLA 3F2HA 4X6MA 4CRDA 4OS7A 2AIQA 4BOHA 2L6OA 1HXEH 1GMDF 1FMGA 2TGAA 3RXPA 1XVMA 1RTLA 3WW7A 1GI2A 4JK5A 5ETXA 4YTAA 1C5VA 2BZAA 5DP6A 1GMDG 3LC5A 4FUGA 2VIWA 4HG6A 3MWIU 4AYVB 4OS1A 1HRTH 5J4SA 2GGVB 1LQDB 1BIOA 3A88A 3RLYH 1T4VH 2BY9X 4Y7BA 2RA3A 4AN7A 1EZSC 2BY6X 2W7SA 3E6PH 3M5LA 1EX3A 5DJ7A 1EAXA 3SNDA 4AGJA 4ZKOU 5ESTE 2TIOA 1GMCF 1IQKA 2YMSD 8GCHF 1P04A 4FXGH 3RMLH 2FXRA 4YXWD 3KQDA 1D6RA 3P95A 3SN8A 1AUJA 1CGIE 5EU8A 4P00A 1NRPH 3FP6E 2C4FH 1WCZA 1EPTB 2W6JD 3BEUA 2XOKD 3GOVB 5AFZH 2OXSA 3QN7A 4X1NU 1EZUC 1H8DH 1S0QA 2IPQX 1A0LA 1YYY1 1DLEA 1LHEH 1CBWC 1CHOG 3GY7A 3AVZA 1C2GA 1TNHA 5IYTA 2RCEA 4TSFD 3SORA 2J98B 1E34B 2FEQH 1O32A 4XE4A 1DVAH 4F48B 3L33A 4TPIZ 2WYGA 1QBVH 2FOGA 2PKAA 3O8DA 4B2BA 3NK8A 2VVVA 1GBEA 1OHHD 1C5MD 2H5CA 4M9FA 1O2VA 1O2MA 2BD2A 5L6NH 3FP7E 4INLA 1BA8B 1HB0B 1EXFA 1FAXA 1PPCE 2ILNA 3OEED 3ATWA 4I33A 4U32A 3HPTB 1M9UA 2EEKA 1GCTC 1ETTH 2HWLB 4NIWA 1GVLA 2IOTA 4Y0ZE 1D3PB 2BLVA 2JH0D 1S83A 2OP9A 1FUJA 1NO9H 5C2ZA 2DE9A 3P70B 1C1MA 3VGCC 5BRRE 3F3BA 1OP8A 3S69A 4I8LA 3ZZ8A 1SSXA 4FETA 2A2XH 5L2YH 3LIWA 2D26C 1NS3A 2V35A 1V2OT 3DA9B 1NRRH 4ACAA 2ZU1A 2A0QB 4A92A 2WINI 1SLVB 1EUFA 1O3AA 3S0NA 3TPIZ 3A7WA 4A5TS 1BB0B 1H8HD 4UEHH 1TGSZ 1O3LA 4NA8A 4GHQA 4WXIA 5C5OA 1FIWA 1TA2A 3H7TA 3E8LA 1P09A 3LH3A 1EPTA 3ZVEA 1ZTKA 1C1NA 1H4WA 2VH6A 1V2RT 3W1EA 2BDAA 2PTCE 2QXGA 4K1EA 1YGCH 2P93A 1QCPA 3AAUA 2CGAA 4Q2KA 1OWEA 4OGYA 1HJAC 2D8WA 3SU1A 4XFQA 2ZHWH 4MNWA 3SW2B 2GZ8A 2VWOA 3WWFA 1BRCE 1OKXA 1B0FA 1IHSH 1TNIA 2A4RA 2JETB 2F9OA 1S84A 3Q00A 1O2LA 2B5TB 2BX4A 1HNEE 4OS6A 4AX9H 2ODYB 1XMNB 1SLXB 2OQ5A 1V2JT 2Z94A 4I31A 3HGNA 3ZVBA 2BDCA 3U28C 3OY5U 3TK6A 4QT8C 2JIZD 2F9BH 4BAOB 1QQ4A 3N7EA 2C8YB 2ZGJA 1QRXA 1UTLM 1O5EH 1A3EH 1CA0C 2G55A 1JBUH 2J2UA 1ELCA 4ASUD 3KYFA 1CA0B 3SQHE 3B23B 5GDSH 1S6HA 3MH6A 2FOHA 1YLNA 1RTFB 3A81A 2G81E 1AE5A 3BTME 2ZGBH 1Z8IB 3VB3A 1O3PB 3OSYA 1OXGA 1CHGA 3KIDU 4LXBH 4FUJA 1AVWA 1A3BH 2AIPA 1Y5BT 2VH0A 3SYJA 1GI4A 3ZZ9A 1N6XA 2SGDE 2JKHA 1BT7A 1W0KD 4O97A 2ODPA 4Z6AH 1NZQH 2UUKB 4BTTB 1F5LA 1IQNA 3UIRA 1EZXC 1MD8A 3T28A 1BMLA 1HAHH 1UO6A 1PPBH 1GVKB 3UFAA 3QUMP 1TPPA 1VCPA 2KM0A 2Q6FA 2G8TA 4LK4A 2GTBA 4CH2B 3RXLA 2ZFTA 3SV8A 4VGCC 1TFXA 3GDSA 2SGEE 4U01A 4K60A 2GT7A 5EW1H 3OYPA 1SQOA 3RXHA 1KLIH 1JOUB 4A1XA 1Q3XA 3ZZ3A 1RS0A 3F9EA 4YM9A 2NU3E 3PLPA 2CN0H 1TE0A 2ZQ1A 1C5NH 2FX4A 3RC5A 1G37A 3KCGH 2J9NA 3EA8A 3OE7D 1BBRH 1JRSA 4GUXA 1K1IA 4UDWH 1L1GA 1TOMH 1SOTA 1NESE 4BXSA 4DURA 1MZDA 5E2OA 4ZKRU 4A7IB 5E2PA 2B9LA 1GJAB 1XUFA 5T1VA 3MU5A 1NY22 3H7OA 1O3CA 1LKBA 3TNSA 1O2GH 6CHAC 5A0BA 4TT3D 2FZZA 2J38A 3SO3A 2FMJA 2CJIA 2G4UA 2ZHEH 3KQCA 2TBSA 3AAVA 2H6MA 3F9FA 3QGNB 1UTOA 1OWKA 1QRWA 2ZC9H 1OX1A 1ZJKA 1MTNB 1RIWB 1UK3A 2OQUA 3P8FA 3T62A 1O36A 1ZRKA 4AGKA 4ABEA 2CMYA 4FUBA 1T8MA 4JMYA 2A32A 3UB0A 3RP2A 1ZTLA 2VVCA 1O3OA 4K1SA 2BXUH 4WMDA 5B6OA 5DGJA 1O2TA 1XKBC 4DCDA 3ELAH 3ZZ7A 1NN6A 1NU9A 4NWLA 1DSUA 3MTYA 2A5AA 2WPKS 1GJ6A 1CU1A 4I7YH 4CRGA 1MTWA 1W0ZU 3F1SB 4P02A 3GYMA 2NU1E 1P11E 5A0AE 3SJ9A 2VIPA 4NA9H 1C5PA 3Q76A 4WH6A 2QA9E 5A8ZA 3PRDA 2VIOA 1GBHA 1T31A 2ZFFH 3A89A 1AU8A 1H9LB 5HYOA 1O3KA 1YPHC 3SNAA 3VG8A 9LPRA 3WY8A 3D23A 3FZZA 4JCNA 1LPKB 2W5EA 4FUEA 3MQKC 1EB1H 3D49H 2OC7A 1MU8B 1HXFH 3LDXH 2THFB 2PHBA 3SJKA 2O8TA 4HI3A 1GJ9B 1KY9A 3HKIB 3OEHD 3PO1C 1S6LA 1T8NA 1ANCA 3MNBA 1W2KH 1LCYA 2VNTA 4Q63A 1QJ1B 5LPEA 1YPMH 4RKOB 1C2LA 1G9IE 2PR3A 1MMJN 3A7ZA 3RU4D 3MYWA 1QGFA 1AWFH 5IDKA 3LC3A 1GL1A 2AHME 1GGDC 3DSOA 4ABIA 4Y11E 2ZWLH 3M7TA 5K7RA 5EQSA 2QE7D 1TGNA 2OLGA 1YBWA 1O3EA 3PV2A 2J94A 2CF9H 2IN2A 1MZAA 1D3QB 1O5FH 1TMBH 1GMCG 2PWXA 5HMAA 1MBMA 1DX5M 1UJ1A 5FAHA 1VJ9U 2R2WU 3UNSA 5AVDA 2Y6TA 3RMNH 2UWLA 2ZDMA 3W95A 2XBWA 2OBQA 2Y5FA 4X2WA 1C2IA 3BTKE 1K1PA 1VCQA 2JETC 1J8AA 1LTOA 3M3SA 1TX7A 2KAIB 4SGAE 2BDHA 3VXFH 2FTMA 1EAUA 4AFQA 1FLEE 1NU7B 2BY8X 1DXPA 3FZDA 1XUKA 1HJ9A 3M5NA 4UFFH 4OGXA 1BDAA 3T5FH 1P05A 1TX6A 3STIA 1V2MT 4MPXA 1WUNH 3SJIA 2ZECA 2TPIZ 2WPJS 1AHTH 2K1QA 5TJXA 4INKA 4X0WU 1RD3B 4XOJA 2Y82A 1HAZB 2ZFRH 1IQLA 2ZHQH 4Q7ZA 1LVMA 1C1PA 2BQ7B 2J97A 1UK4A 5GXPA 4D7GA 1SGDE 4ZKNU 2UUFB 3SNBA 1E0FD 1C4V2 3M3TA 4AYYB 5C3NA 3ZZ5A 2SFAA 1O2OA 4O3UA 1ZOMA 1FZZA 1MABB 1BZXE 1EFRD 4B2AA 1SMFE 1W7GH 1P8VC 4WVPE 2GVFA 2VWMA 1HAPH 4WY3A 4ABAA 1UVOA 1NC6A 1ETRH 1MBQA 5C67A 1W8BH 1ANDA 1G3CA 3PLKA 2HRVA 3U1JB 3GY4A 2PSYA 2A31A 2HNTC 1ZZZA 5FHTA 1GHVH 1TGCA 2BDYA 1J15A 4YLUA 1SQTA 3SUDA 3GY8A 1C2KA 1THRH 1W11U 3PYHA 3F2FA 1UTMA 3NUMA 1G32B 4HFPB 2V6NA 1P2QA 3E1XB 4AFUA 5KEDA 1JWTA 4FVDA 1C4U2 1PPEE 1ZMLA 3T25A 4XDEA 1HPGA 2O8UA 3U69H 2HALA 2SGPE 4NZQA 4KTSA 2PKAB 1DSTA 1AD8H 2UUJB 2GMTC 2PUQH 2BVSH 5T6GA 3DT0H 4LOYH 1C2EA 4YT7H 2F83A 2GV6A 1SLWB 1TB6H 4ISHH 1C1WH 3ZVFA 1O30A 3KQ5A 1WTHD 4BAMB 1DM4B 2PLXA 3MHWU 1YCPM 3A82A 4K2YA 4Y8XA 2FX6A 3RXOA 3LGUA 5A2MH 2UUYA 5L2ZH 3RXRA 5C94A 3KL6A 2ZFSA 3K9XB 5FCRA 2AMPA 2FOMB 1VCWA 5H4IB 1GBMA 1XUHA 2BD5A 1C1SA 4NA7A 3UR6A 1ESTA 3BEIB 2TGTA 1GBIA 1GHXH 4I8KA 4XBDA 4Y76A 1FY1A 1SGQE 4NGAH 2C8ZB 4GAWA 4LZ1H 1FN8A 3FP8E 4MG3A 4DGJA 1VJAU 5DO4H 1KXDA 1LDTT 2C8WB 2P3UB 2HLCA 3RXGA 3BTTE 3CENA 2V0BA 1ELEE 4H42U 1GCTB 2Z9IA 3EA7A 2NU4E 4JZEH 3V3MA 4KTCA 2B7DH 2R3YA 2ZZUH 5IK2D 1P3EA 7GCHG 1GHBG 1MKXH 1YCPK 1Z8RA 2GKVE 2GCTC 1NPMA 3B8JA 4AG2A 3SQEE 1C1QA 5DP3A 3KN2A 2EA3A 3M37A 2XBYA 2BQWB 1JIMA 1P9UA 1W10U 3SHAH 3ZZAA 3A8BA 1D6WA 2FP7B 1LO6A 1NTPA 1GG6C 7ESTE 2QGRA 2YMSB 1PQ7A 1LVYA 2KAIA 1GL0E 5LH8A 2HVYB 5HM2A 3TIUA 4D9QA 1IOEA 1GJ4H 2QXHA 2YMSC 1KDQA 2J95A 3BTWE 1AFEH 3F6UH 4E06H 1PPGE 3PROA 2LNCA 1WSSH 3M61U 3ODFA 1HAVA 2HNTE 1IQHA 2ESTE 1A4WH 5C1XA 1LPZB 1O3MA 2ZDNA 3TH4H 5A8XA 4IBLH 2PGBB 3G01A 5GCHF 3MO9A 4FVBA 2VIVA 4ZHAA 1SI5H 1ZGVA 1FY5A 3RXVA 4X1QU 1WQVH 3DSGA 5C0UA 2IPHA 1FDPA 5C5NA 2AMDA 1O5CB 1VGCC 1INCA 2AMQA 1YWUA 3P8GA 1ZHPA 5TCCA 1BTYA 1O2UA 3P92A 2TGDA 1PQ8A 1O3IA 2F43B 3NXPA 1HYLA 2P59A 1AQ7A 1NROH 3F0PA 1GBKA 3ZIAD 4B6FA 6GCHG 1PQAA 3EA9A 3NKKA 4FUFA 1L4DA 3SJOA 2Y5GA 5A09A 2YNBA 5GPIB 2XW9A 8GCHG 2FI4E 5EQQA 3NRLA 4I8GA 2ZCKP 4TWWA 3IWMA 2OUAA 1GPZA 4X8VH 4ZH8A 1HAOH 1P0SH 3SZEA 1HAXB 2BOKA 1K1MA 2FOFA 1F5RA 3F9HA 1HBTH 3EGKH 1RXPA 1QB1A 3SI3H 1QA7A 1MTVA 2FLRH 1NRSH 3EAJA 1DWBH 2ZG0H 2R3UA 4NCYA 1GWAA 1UK2A 1AMHA 5F8TA 1CO7E 3V12A 1C1UH 1H8IH 1K2I1 2BLQA 4Y6DA 3SU0A 3ZYEA 1H8ED 2D2DA 1O2IA 4NSYA 2BDBA 3VPKA 3UAIC 3KNXA 1HAVB 3UY9A 5L30H 3QTOH 2O8WA 2C3SA 2ZPSA 2WV5A 4B76A 1NFWA 4WH8A 1DXWA 3F0OA 2WPIS 1UVSH 4DIHH 1WQSA 2GD4B 1F7ZA 1SC8U 2AYWA 4Z0KA 1BQYA 1SKYE 1CGHA 5JDUB 1V2UT 5J4QA 1NFYA 3OU0A 3MNSA 3ITIA 4AC9A 1FN6A 1OP2A 3BIVH 1TBQH 5EPYA 1OYQA 5EQRA 1ELDE 4X8UH 1W3CA 3N7OA 3SV9A 4XD7D 1GHZA 4H4FA 1EJMA 2ZDKA 5BPEA 1G30B 2XTTB 1TNGA 3ENSB 1WYKA 3A86A 1TLDA 2M2AA 1BMNH 3RXJA 3RXAA 6LPRA 1ZPCA 3DD2H 1FJSA 4K5ZA 1O2HA 1F5KU 1J17T 2FTLE 3MU1A 3PWCA 5B6LA 2H9HA 1G2MA 1E37B 2F9PA 5CHAB 1K0HA 3D62A 5KGOA 2FOEA 5AFYH 1SGEE 4Y7AA 4MQAA 2G00A 2RA0A 3LGVA 5F8XA 4X6PA 1C5XB 1JXPA 7LPRA 1SB1H 1N6YA 1IAUA 3PMBB 4ISLA 6GCHF 1SGNE 2ZO3H 1A0JA 5JBTA 2RDLA 3VFEA 4PROA 2Z6BD 4RSPA 2GZ7A 4E05H 1GJDB 1V2QT 1KSNA 5G4BA 3K2UA 1FV9A 1KXFA 1GJBB 5DKMA 4CHAB 1QFKH 3N99A 1CGJE 1J14A 1O35A 2DUCA 2FLBH 1W0YH 2FOBA 1QY6A 2A45B 2FI5E 2HVXA 1BHXF 5E8EH 2F9VA 4NIXA 2BD7A 4IS5A 4BAKB 2VWNA 1A7SA 3TH2H 2Z9LA 4WMEA 1CT0E 1K28D 4BNRA 2QXJA 4K3JA 2ZU3A 4GHTA 1LHDH 3JZ2B 1Z8JB 1NFUA 1O3HA 2JJ2D 4O9VA 3TJVA 1DLKB 3O8BA 2OK5A 1G3DA 1OWHA 1FNIA 1QIXB 1GI8B 1NRQH 1ETSH 1LQEA 2QN5T 3CS7A 4DW2U 4INHA 1ZSJA 2BYAX 3ZZDA 2ZDLA 3IITA 2PKSB 3LPRA 1LHCH 1ZHRA 2EY4C 3BF6H 2AS9A 1F0RA 3UQOA 1BITA 1YCPH 1O31A 5SGAE 2ULLA 4I32A 3DFJA 3W94A 3BG8A 4UONA 1WXRA 2ASUB 3R0FA 2GCHG 3FO8D 2VIQA 5T6DA 1PPFE 1GDUA 2FI3E 2G52A 4Y8YA 4A6LA 5AHGH 2VGCB 3GCTF 1SVPA 4WXVA 3SU4A 4ISIH 3PO1B 3TK9A 1OWDA 2A7HA 2VGCC 4KELA 4MNXA 4AB8A 1C2HA 4NIVA 1SHYA 4HZHA 1K9OE 3BG4B 1AKSA 2YNAA 1ABIH 3QZRA 3TLOA 3STJA 1C5TA 4DT7B 2ZHDA 2WYJA 1T8LA 4FUDA 2W26A 3SBKA 1GHWH 3UOUA 1AE8H 4HGCA 4AOQA 3M36A 1MH0A 1O3JA 2XBXA 2BD9A 5HXFA 1AIXH 4TPYA 2ZFPH 1FY3A 1C2MA 1O39A 1A5GH 1MTNC 1RIWC 1VITH 4F49A 2EI7A 1GBAA 3S7HB 1YPGH 2QIQA 1P2NA 3I29A 5DPAA 1GBCA 1O3GA 1XM1A 4UFDH 2V7QD 1TRMA 4DVAU 2G5VA 1S5SA 3UWJH 4R8TB 2WPDD 2BOHB 1A5IA 2UWPA 3NPSA 3RXMA 1N8OB 3VXEH 5T3HA 1C1OA 1AZZA 1YP9A 2CHAB 4ESTE 3ZZCA 1BTZA 1GI0A 1QRZA 1SOZA 1QA0A 1YLDA 2FO9A 2KCOA 3E91A 1TGBA 2Q6DA 3MH7A 1C4Y2 1F92A 1P57B 3VGCB 3MU0A 3OTJE 1UVUH 4ABGA 5GWZA 2Z3EA 4J2YB 5EPNA 3QO6A 4ZXYH 3RUOA 1LVOA 2ZU5A 4XBBA 3OY6U 1NT1A 1KLJH 2Z7FE 3VB5A 1B5GH 1K1NA 1KXCA 1T8OA 1EB2A 4GPGA 5FBIA 1WV7H 5JBAS 4DT4A 1P12E 2A5KA 3RDZA 1KDQB 1P2OA 4CBOA 1COWD 3HKJB 3U98H 2OC8A 3F9GA 4THNH 2XC0A 3FN8A 4R0IA 1K1OA 2AGGX 5E0JA 3RC4A 3TJUA 1EAWA 1MKXK 3GCHB 1BCUH 2G5NA 1V2NT 1THPB 3SU5A 1GBLA 3ODDA 2HOBA 2ZI2H 1TRYA 2ZPQA 1C2FA 1WTGH 1SQAA 4ZUHA 1SG8B 4MDSA 3MOCA 3BIUH 4AB9A 1QJ7B 1HAGE 2CXVA 3VEQB 3DSPA 1TPOA 5FX5A 5T6FA 1E36B 1QB6A 3TGKE 1XVOA 1TMUH 1GJCB 4H6SB 1EZQA 2XC4A 1V2PT 4U30A 2ANYA 1AY6H 3I77A 1ELVA 1GHAG 4Y10E 1KMHB 1O37A 1OYTH 1UCYE 2V3HH 4GVUA 4AFSA 1DPOA 2KCYA 3RXKA 5EJLA 3GCTG 2BVRH 1FXYA 3TITA 1KTSB 4ABFA 1S6FA 4BAQB 2K8IA 3GY6A 1PYTD 3R3GB 1G36A 5DK1A 2KR7A 4Q7YA 4RT1A 1E35B 1AVGH 3RM2H 3ZVAA 4BXWA 1S85A 1HIAB 2VU8E 3RU4E 2QF3A 3MO6A 2QCYA 3H09A 4CRAA 1E79D 4ZHLU 1TRNA 1YPJH 3Q3YA 1E1QD 1HGTH 1TALA 5F53A 4ZKSU 2JDID 2RDEA 1TNLA 2QY0B 3U1IB 3S9BA 3KHVA 1O2SA 4JZFH 3PRBA 4TWYA 1BHXB 1K1JA 2KFWA 1DOJA 5CE1A 2P8OB 1IQGA 2J5UA 1GI6A 5HKKD 4TYDA 1G2LA 3OTPA 3E90B 2GCHF 4B6EA 4RKJB 1EJAA 2JJ1D 3TK5A 3EDXB 1TYNA 1S81A 1Z71A 3SNCA 1O34A 2SNVA 1CVWH 2VVUA 2Q6GA 1O5BB 2PTNA 4CHAC 1DY8A 3GCHC 3T2NA 4Y8ZA 3CP7A 1GBTA 3SV2H 3EYDA 3PMJA 1UHBB 1Q31A 1ARCA 3RXEA 1T7CA 1QBOA 1ID5H 3BV9B 3M5OA 4ABJA 4E7RG 1WBGB 3ZVGA 4ZHMU 1P2KA 1Q2WA 2A7JA 2CF8H 4CBNA 2P16A 4IW4E 1SR5C 3HGPA 3SUEA 3L6PA 4NIYA 5E0GA 2H9EH 1AFQC 1C5LH 2BY7X 4Y79A 1DT2A 3HK3B 1VR1H 4H6TA 1OS8A 4O03A 1MUEB 1YLCA 8LPRA 2P95A 3PM3A 1UTPA 1JMOH 2Y5HA 2ANKH 2G4TA 4KTUA 1XUGA 5JBBS 1L0ZA 3DCLA 3C27B 4TY6A 1W12U 3EE0B 4D8NA 7KMEH 1O2YA 2C90B 2V3OH 5C0TA 1ZSKA 4ABDA 4Q80A 1VITF 3QDZB 1O5GH 3QGJA 1Z1IA 3B9FH 3VB6A 2VIDA 4AFZA 4ZXXH 5EXMA 1SGCA 3ZYDA 4X6NA 2GDEH 4B74A 5JB8S 5KECA 4K8BA 1H9IE 2AERH 1OP0A 3K6ZA 2AGEX 4UD9H 1ARBA 1GI7B 1Y3UA 2F91A 3BG4C 3Q3XA 4XRNA 1AI8H 4MNYA 2WUBA 3E0PB 1W7XH 1EOLA 4UE7H 2UWOA 2AGIX 2ZQ2A 1K21H 2A4GA 2BXTH 1GJ8B 1DWCH 1TX8A 4OS5A 2ZDVH 4KKDA 3HATH 3GS9A 1ZLRA 3IG6B 1PYTC 1BRAA 1UCYK 1UHBA 2OC0A 2ZIQH 1YF4A 1ABJH 1WOFA 5A0CA 3GY5A 2P94A 1DDJA 1UVPA 2OTVA 1JIRA 1YPKH 1U6QA 2FPZA 2OC1A 3MU8A 2Y7ZA 1TPAE 4X1SU 1SGFG 4MLFB 1LKAA 2CK3D 2QC2A 3KQEA 1GMHG 2FIRH 2ZNKH 1RJXB 1Y3XA 1ZRBA 1O38A 1SQRA 2Y81A 3SGBE 1BTWA 1YPEH 3AASA 3A80A 1N1LA 1QB9A 1C2JA 5TCAA 2CHAC 4X8SH 4IMQA 1C5ZB 2FYRA 1DY9A 3ZZBA 3ZZ4A 1CSOE 4IMZA 1TWXB 3O8RA 1ESAA 4UFGH 4WF8A 1KXAA 3BTHE 2J92A 1ANBA 3LH1A 5LGOA 4B75A 2GMTB 2PSXA 3U8OH 1SGIB 2ALVA 2XBVA 3S9CA 2NU0E 1VGCB 1OWIA 1OSSA 1MD7A 2PFEA 3AK5A 2PV9B 2FESH 1C1RA 1O2PA 2FS9A 3A83A 3RMMH 2PW8H 4OS4A 1SGTA 3SV6A 1NBME 1Y8TA 1FY8E 4YO9A 2EI6A 2BDGA 4Y71A 2ZFQH 5GCHG 4D9RA 3D65E 1Y3WA 2KCAA 4JZ1A 4ZMAH 3MNCA 3GICB 3T29A 1VZQH 1H1BA 3BTDE 3LGWA 3UWIA 5A8YA 2A5IA 1FI8A 3Q77A 4BANB 1L2EA 4F4OC 4YOGA 4ACBA 4JZIA 2F3CE 2JH5D 1EPTC 1AKSB 2VJ1A 5GJ4B 1EOJA 4TY7A 4DY7B 3T26A 3BTEE 1QURH 4XBCA 1MQ5A 3SOSA 2A4QA 1P2IA 3QZQA 3URCA 1WU1A 3RXFA 1QHRB 4M7GA 1O2RA 4F55A 3TGJE 5F6MA 4CRBA 1C9PA 5EW2H 5JYIA 3QTVH 3GISB 2R0LA 2HPQH 1IQJA 1UVTH 2VB0A 3P17H 3FANA 4A1TA 2PKSC 1C5UA 4FU8A 1ELTA 1G3BA 3CS0A 3FKSD 4DIIH 1FX0B 2NU2E 4NSVA 3LU9B 1ZPBA 3A8AA 3U9AH 4Z1MD 1SPJA 4B71A 5C1YA 3RXSA 1HJAB 2WPLS 1TBZH 4Q4LA 1DITH 2K0QA 2EQNA 2GJGA 3T27A 1IQFA 3E3TA 1GBJA 1AVXA 2OINA 1HAYB 2QV1A 2ZHFH 4YZUA 3A87A 2Z3CA 2NWNA 1TBRH 2SGAA 1MAXA 1GDNA 3A7XA 3S7KB 1XKAC 3ATIA 1YM0A 2ZTZA 1TABE 1UMAH 7GCHF 2H9TH 1P01A 3TJNA 1ZYOA 2ZEBA 1EASA 2ODQA 3EQ0H 5EJZA 3TVJB 5EODA 2KX4A 1GCDA 1RRKA 1TNJA 1P9SA 3KF2A 4GLYA 5C1UA 2GZ9A 1DANH 1HAIH 1AGJA 2GX4A 1GBFA 2VINA 1Y3VA 3VB4A 4BTUB 1XXDA 2F4LA 1V2VT 2Z9KA 5GNDA 3ATKA 4I8HA 1RTKA 5EG4A 2BMGB 1P06A 2B0FA 4YESB 3ZV8A 4ISOA 1F2SE 3ZZ6A 2OD3B 4ABBA 1TAWA 4X6OA 1XXFA 2HLDD 5C17A 1A1RA 1O33A 3PWBA 6CHAB 1GDQA 3PLBA 3TGIE 6ESTA 1D3DB 1SHHB 4X2YA 4I8JA 4CRCA 4BTIB 2QYIA 4DJZB 3OFND 5FL7D 3GCOA 4IC5A 5K0HA 3GDVA 3P8NA 3RMOH 2BD4A 2W7UA 4O3TA 5EIYA 2P3FH 3BTFE 1BTHH 1QL9A 3UR9A 3A85A 1SFQB 1DWEH 3QX5H 1ACBE 1PFXC 1SL3A 1GI3A 1ZR0A 1ZSLA 3L3TA 4CREA 3M3VA 3M7UA 4IGDA 1ORFA 1DS2E 1ELFA 1KLTA 2W3KA 1HV7A 1KXBA 3DUXH 4X1PU 1A0HB 5CMXH 4WWYA 1DWDH 2SNWA 5F03A 1BOQA 1QNJA 1K1LA 1O2WA 1GMHF 1PPZA 1CT2E 5FX6A 3M5MA 2W3IA 1XUJA 1J9CH 2WPMS 5FCKA 3V13A 2XRCA 1ANEA 2ZDAH 1PQ5A 4OM9A 5I25A 1GG6B 1O3BA 1P03A 2P3TB 3K6YA 1GJ5H 2BLOA 2BX3A 1DE7H 1XX9A 2ZCHP 5JPMH 4CRFA 4X8TH
chains in the Genus database with same CATH topology
1O2NA 1MKWH 4K8YA 1DUEA 2FODA 5DP5A 4X2XA 4X2VA 4YT6H 4D7FA 1BJUA 3SU2A 1BUIA 4FUHA 1RGQA 1BMAA 1BJVA 3KEEA 2D1JA 2Z9JA 3QK1A 2CV3A 2Z9GA 1H9HE 3N7DA 1V2WT 2ZA5A 4FU9A 4ABHA 1Y3YA 1EP5A 1MCVA 1QL7A 4HTCH 3V0XA 1L1NA 1VITG 2I6SA 2WV9A 5JBCS 1HIAA 1OPHB 1G3EA 1HJ8A 1BMFD 1AO5A 1RFNA 2HNTF 1Y5AT 1D3TB 3DHKH 1ELBA 1E1RD 1CBWB 1ZTJA 2WV4A 3UQVA 3MMGA 2PGQB 2G51A 2VWLA 2J34A 1T32A 5C20A 1K22H 3RU4T 3SNEA 5FXLA 3SUFA 3GCNA 4B73A 3M35A 3NZIA 4GCHF 3UPEA 1HUTH 2H2ZA 3BEFB 4SGBE 3UOPA 3RXQA 4U2WA 3KGPA 1PPHE 3SUGA 5I46H 3ZVDA 1C2DA 1Z6JH 2ZU2A 1B0EA 3U8RH 4XSKU 5GIBA 1MTSA 1C5OH 5DN6D 5DP8A 3PB1E 4NFEA 3QLPH 1TQ0B 1MKWK 1MU6B 2ZU4A 5DP7A 3LOXA 3UNRA 1C9TA 1THSH 4J1YA 5JB9S 2P8OC 5CDFE 1W14U 1DUAA 2F9NA 3A7YA 3OX7U 3SGQE 2WZQA 1HCGA 3TU7H 1HDTH 2TRMA 2XWAA 1OOKB 1GBBA 4CH8B 4B2CA 1DICA 3S9AA 3SGAE 1Y5UT 3BN9A 2A4OA 2ZKSA 1F0TA 3SHCH 3TNTA 1IQIA 1X7AC 1V2TT 2FOAA 5LPFA 4DG4A 2BHGA 3NCLA 3MU4A 3K65B 2RG3A 2R9PA 1TIOA 3KQBA 1BBRK 2FS8A 3PTNA 1P2MA 1V2ST 1IHTH 5FPTA 1CA8B 2GV7A 2BDIA 3RXIA 5CHBA 5EXNA 4DOQA 1C1TA 3U8TH 4GCHG 1C1VH 3UNQA 1YKTA 3TJOA 2OBOA 3LGYA 1FPHH 2OCVB 3A8DA 1SLUB 1QBNA 2AFQB 2GP9B 3MI4A 2ZCLP 2AH4X 1FY4A 1GHBF 3ZVCA 4YLQH 1TPSA 5DG6A 5PTPA 1TONA 4RI0A 1O3DA 1QR3E 3BTQE 1SGPE 1ZGIA 1O3FA 1FONA 2FOCA 1CQQA 2XXLA 1ZHMA 4RN6A 2ALPA 3LGIA 5HM9A 1BTUA 3F68H 1GHYH 2B8OH 1QTFA 1AN1E 1V3XA 4FUIA 1O3NA 2ZTYA 1AB9C 1GHAF 1KIGH 4Y0YE 1EQ9A 2QXIA 1UTNA 5ABWA 4OS2A 2FWWA 3ZV9A 2KCPA 2YOLA 4Q7XA 1AB9B 1J16A 1PJPA 2A7CA 2ZTXA 2GDDA 5EGMA 1T4UH 4ZAEA 1GI5A 5CHAC 1P10A 2AEIH 3Q3KA 1BRUP 1TMTH 3SI4H 1NBMD 1FPCH 2XNDD 1GVZA 3GYLB 3P8OA 2GCTB 1DFPA 1Z7KA 1EAIA 2I6QA 1IQMA 1GI9B 4ASHA 3AW1A 3LKWA 2XWBI 1EP6A 1GBDA 2EI8A 1HFDA 2FDAA 1L4ZA 2BD8A 3E16B 3PV4A 3SU6A 1FQ3A 1FAKH 1P3CA 4NG9H 1O5AB 3ATMA 1TA6A 4YOJA 2C8XB 2H5DA 2DE8A 3JZ1B 1MTUA 1QJ6B 4IN2A 3GY2A 1LHGH 2R2MB 1EJNA 4GSOA 2XCNA 2KZ4A 1E38B 2QAAA 1Z1JA 4K69A 1AFQB 1O2QA 1BMMH 5LPRA 2QF4A 1ZJDA 1UTQA 1C5RA 4ZCNA 4LZ4B 1XUIA 4VGCB 3PMAB 5E0HA 3SU3A 1GI1A 8KME2 9ESTA 3RXDA 1A61H 1C5SA 2BTCE 2JH6D 1ELGA 1KYNA 1QQUA 1AZ8A 2ZGXH 2BQ6B 3MO3A 1ESBA 2O8MA 5EOKA 2HGTH 3A7VA 3QWCH 3C1KA 1AUTC 1V6DA 2ZF0H 3M7QA 3O8CA 4MNVA 2BM2A 2H1UA 3GY3A 1SFIA 5FPSA 3SJ8A 2Y7XA 2LPRA 1S82A 2XYAA 4FUCA 2WPHS 1GJ7B 3I78A 2FYQA 4JYUH 2Q1JA 1MQ6A 4NWKA 3ATLA 3WWBA 1B7XB 3LJOA 1UTKA 5DP9A 3LJJA 1CT4E 2LELA 1YPHE 4WJG2 3RM0H 1S0RA 3P6ZB 1TGTA 2QF0A 3GDUA 4UFEH 2F9UA 2ZGCA 2WSSD 1P2JA 3RXCA 2C93B 1SGYE 3DFLA 4MPWA 1CE5A 4K1TA 2SGQE 2WUCA 4FU7A 1NFXA 5DSFA 1A46H 2ANWA 3HK6B 4JK6A 3PV5A 4X1RU 3FVFB 4MTBA 3BTGE 1V2LT 1WAYB 1D4PB 5FBEA 3UUZA 3RC6A 1C5WB 1SGRE 1IQEA 1SBWA 3LGTA 3TH3H 4KP0A 2A2QH 3OAAD 2A1DB 1EATA 1O2KA 2R0KA 3MNXA 1LMWB 3A84A 3VB7A 1HLTH 2XCFA 1Z8GA 4JZDH 1C5QA 1O0DH 2XNIA 5F8ZA 2TGPZ 2ANMH 2ZGHA 1Y59T 3RLWH 1BBRE 2J4IA 4B1TA 4AG1A 2IJD1 4NFFA 2IJOB 4E7NA 2STBE 4KGAA 1QL8A 4A1VA 1BTXA 3PTBA 2GT8A 2SGFE 3ESTA 3NWUA 2BLWA 2EC9H 2BZ6H 1KTTB 1KXEA 2W6ID 1LVBA 1O2ZA 1SGFA 1O2JA 1CHOF 4MPUA 4NZLA 2BVXH 1GGDB 1MAYA 1TNKA 1C5YB 3FOAA 1W0JD 3LT3A 2BB4A 4MPVA 1MCTA 4BAHB 1BTPA 1UCYH 3FAOA 1ZMNA 4JYVH 2Y80A 2O9QA 1YPLH 2BD3A 3BSQA 1YC0A 2VBCA 3UREA 2ZPRA 3A7TA 3FFGA 3RXUA 3MH4A 1AWHB 1TQ7B 4AORA 4AZ2B 2Z3DA 3E0NB 4IN1A 1A5HA 1O2XA 1LHFH 1TOCB 1UTJA 4YOIA 1ZMJA 1A2CH 4CR9A 4CR5A 1V2KT 1D9IA 4ZROA 2BY5X 1NRNH 2M5TA 1ZPZA 3RXBA 2XC5A 1N8OC 3URDA 3V7TA 1BRBE 4ISNA 2ZP0H 2QF5A 4WMFA 1ELAA 5DP4A 1Z6EA 2WHXA 3H5CB 3MH5A 3SV7A 5HGGA 8ESTE 4D76A 1P02A 4JYTA 1F0SA 4IC6A 1JRTA 3RXTA 2O8LA 1EKBB 1NM6A 1F0UA 1LPGB 3A8CA 2FM2A 3UTUH 2PUXB 3LONA 2HPPH 5AF9H 1L1JA 3SZNA 3PMHB 3MFJA 1O5DH 2STAE 5ESBA 5FPYA 4MVNA 1FIZA 1W13U 3AW0A 3F2GA 1OWJA 5EXLA 3F2HA 4X6MA 4CRDA 4OS7A 2AIQA 4BOHA 2L6OA 1HXEH 1GMDF 1FMGA 2TGAA 3RXPA 1XVMA 1RTLA 3WW7A 1GI2A 4JK5A 5ETXA 4YTAA 1C5VA 2BZAA 5DP6A 1GMDG 3LC5A 4FUGA 2VIWA 3MWIU 4AYVB 4OS1A 1HRTH 5J4SA 2GGVB 1LQDB 1BIOA 3A88A 3RLYH 1T4VH 2BY9X 4Y7BA 2RA3A 4AN7A 1EZSC 2BY6X 2W7SA 3E6PH 3M5LA 1EX3A 5DJ7A 1EAXA 3SNDA 4AGJA 4ZKOU 5ESTE 2TIOA 1GMCF 1IQKA 2YMSD 8GCHF 1P04A 4FXGH 3RMLH 2FXRA 4YXWD 3KQDA 1D6RA 3P95A 3SN8A 1AUJA 1CGIE 5EU8A 1NRPH 3FP6E 2C4FH 1WCZA 1EPTB 2W6JD 3BEUA 2XOKD 3GOVB 5AFZH 2OXSA 3QN7A 4X1NU 1EZUC 1H8DH 1S0QA 1A0LA 1YYY1 1DLEA 1LHEH 1CBWC 1CHOG 3GY7A 3AVZA 1C2GA 1TNHA 5IYTA 2RCEA 3SORA 4TSFD 1E34B 2FEQH 1O32A 4XE4A 1DVAH 3L33A 4TPIZ 2WYGA 1QBVH 2FOGA 2PKAA 3O8DA 4B2BA 3NK8A 2VVVA 1GBEA 1OHHD 1C5MD 2H5CA 4M9FA 1O2VA 1O2MA 2BD2A 5L6NH 3FP7E 4INLA 1BA8B 1HB0B 1EXFA 1FAXA 1PPCE 2ILNA 3OEED 3ATWA 4I33A 4U32A 3HPTB 1M9UA 2EEKA 1GCTC 1ETTH 2HWLB 4NIWA 1GVLA 2IOTA 4Y0ZE 1D3PB 2BLVA 2JH0D 1S83A 2OP9A 1FUJA 1NO9H 5C2ZA 2DE9A 3P70B 1C1MA 3VGCC 5BRRE 3F3BA 1OP8A 3S69A 4I8LA 3ZZ8A 1SSXA 5L2YH 2A2XH 4FETA 3LIWA 2D26C 1NS3A 2V35A 1V2OT 3DA9B 1NRRH 2ZU1A 2A0QB 4A92A 2WINI 1SLVB 1EUFA 1O3AA 3S0NA 3TPIZ 3A7WA 4A5TS 1BB0B 1H8HD 4UEHH 1TGSZ 1O3LA 4NA8A 4GHQA 4WXIA 5C5OA 1FIWA 1TA2A 3H7TA 3E8LA 1P09A 3LH3A 1EPTA 3ZVEA 1ZTKA 1C1NA 1H4WA 2VH6A 1V2RT 3W1EA 2BDAA 2PTCE 2QXGA 4K1EA 1YGCH 2P93A 1QCPA 3AAUA 2CGAA 4Q2KA 1OWEA 4OGYA 1HJAC 2D8WA 3SU1A 4XFQA 2ZHWH 4MNWA 3SW2B 2GZ8A 2VWOA 3WWFA 1BRCE 1OKXA 1B0FA 1IHSH 1TNIA 2A4RA 2JETB 2F9OA 1S84A 3Q00A 1O2LA 2B5TB 2BX4A 1HNEE 4OS6A 4AX9H 2ODYB 1XMNB 1SLXB 2OQ5A 1V2JT 2Z94A 4I31A 3HGNA 3ZVBA 2BDCA 3OY5U 3TK6A 4QT8C 2JIZD 2F9BH 4BAOB 1QQ4A 3N7EA 2C8YB 2ZGJA 1QRXA 1UTLM 1O5EH 1A3EH 1CA0C 2G55A 1JBUH 2J2UA 1ELCA 4ASUD 1CA0B 3SQHE 3B23B 5GDSH 1S6HA 3MH6A 2FOHA 1RTFB 3A81A 2G81E 1AE5A 3BTME 2ZGBH 1Z8IB 3VB3A 1O3PB 3OSYA 1OXGA 1CHGA 3KIDU 4LXBH 4FUJA 1AVWA 1A3BH 2AIPA 1Y5BT 2VH0A 3SYJA 1GI4A 3ZZ9A 1N6XA 2SGDE 2JKHA 1BT7A 1W0KD 4O97A 2ODPA 4Z6AH 1NZQH 2UUKB 4BTTB 1F5LA 1IQNA 3UIRA 1EZXC 1MD8A 3T28A 1BMLA 1HAHH 1UO6A 1PPBH 1GVKB 3UFAA 3QUMP 1TPPA 1VCPA 2Q6FA 2KM0A 2G8TA 4LK4A 2GTBA 4CH2B 3RXLA 2ZFTA 3SV8A 4VGCC 1TFXA 3GDSA 2SGEE 4U01A 4K60A 2GT7A 5EW1H 3OYPA 1SQOA 3RXHA 1KLIH 1JOUB 4A1XA 1Q3XA 3ZZ3A 1RS0A 3F9EA 4YM9A 2NU3E 3PLPA 2CN0H 1TE0A 2ZQ1A 1C5NH 2FX4A 3RC5A 1G37A 3KCGH 2J9NA 3EA8A 3OE7D 1BBRH 1JRSA 4GUXA 1K1IA 4UDWH 1L1GA 1TOMH 1SOTA 1NESE 4BXSA 4DURA 1MZDA 5E2OA 4ZKRU 4A7IB 5E2PA 2B9LA 1GJAB 1XUFA 5T1VA 3MU5A 1NY22 3H7OA 1O3CA 1LKBA 3TNSA 1O2GH 6CHAC 5A0BA 4TT3D 2FZZA 2J38A 3SO3A 2FMJA 2CJIA 2G4UA 2ZHEH 3KQCA 2TBSA 3AAVA 2H6MA 3F9FA 3QGNB 1UTOA 1OWKA 1QRWA 2ZC9H 1OX1A 1ZJKA 1MTNB 1RIWB 1UK3A 2OQUA 3P8FA 3T62A 1O36A 1ZRKA 4AGKA 4ABEA 2CMYA 4FUBA 1T8MA 4JMYA 2A32A 3UB0A 3RP2A 1ZTLA 2VVCA 1O3OA 4K1SA 2BXUH 4WMDA 5B6OA 5DGJA 1O2TA 1XKBC 4DCDA 3ELAH 3ZZ7A 1NN6A 1NU9A 4NWLA 1DSUA 3MTYA 2A5AA 2WPKS 1GJ6A 1CU1A 4I7YH 4CRGA 1MTWA 1W0ZU 3F1SB 3GYMA 2NU1E 1P11E 5A0AE 3SJ9A 2VIPA 4NA9H 1C5PA 3Q76A 4WH6A 2QA9E 5A8ZA 3PRDA 2VIOA 1GBHA 1T31A 2ZFFH 3A89A 1AU8A 1H9LB 5HYOA 1O3KA 1YPHC 3SNAA 3VG8A 9LPRA 3WY8A 3D23A 3FZZA 4JCNA 1LPKB 2W5EA 4FUEA 1EB1H 3D49H 2OC7A 1MU8B 1HXFH 3LDXH 2THFB 2PHBA 3SJKA 2O8TA 4HI3A 1GJ9B 1KY9A 3HKIB 3OEHD 3PO1C 1S6LA 1T8NA 1ANCA 3MNBA 1W2KH 1LCYA 2VNTA 4Q63A 1QJ1B 5LPEA 1YPMH 4RKOB 1C2LA 1G9IE 1MMJN 2PR3A 3A7ZA 3RU4D 3MYWA 1QGFA 1AWFH 5IDKA 3LC3A 1GL1A 2AHME 1GGDC 3DSOA 4ABIA 4Y11E 2ZWLH 3M7TA 5K7RA 5EQSA 2QE7D 1TGNA 2OLGA 1YBWA 1O3EA 3PV2A 2J94A 2CF9H 2IN2A 1MZAA 1D3QB 1O5FH 1TMBH 1GMCG 2PWXA 5HMAA 1MBMA 1DX5M 1UJ1A 5FAHA 1VJ9U 2R2WU 3UNSA 5AVDA 2Y6TA 3RMNH 2UWLA 2ZDMA 3W95A 2XBWA 2OBQA 2Y5FA 4X2WA 1C2IA 3BTKE 1K1PA 1VCQA 2JETC 1J8AA 1LTOA 3M3SA 1TX7A 2KAIB 4SGAE 2BDHA 3VXFH 2FTMA 1EAUA 4AFQA 1FLEE 1NU7B 2BY8X 1DXPA 3FZDA 1XUKA 1HJ9A 3M5NA 4UFFH 4OGXA 1BDAA 3T5FH 1P05A 1TX6A 3STIA 1V2MT 4MPXA 1WUNH 3SJIA 2ZECA 2TPIZ 2WPJS 1AHTH 2K1QA 5TJXA 4INKA 4X0WU 1RD3B 4XOJA 2Y82A 1HAZB 2ZFRH 1IQLA 2ZHQH 4Q7ZA 1LVMA 1C1PA 2BQ7B 1UK4A 5GXPA 4D7GA