4NWLA

Crystal structure of hepatis c virus protease (ns3) complexed with bms-650032 aka n-(tert-butoxycarbonyl)-3-me thyl-l-valyl-(4r)-4-((7-chloro-4-methoxy-1-isoquinolinyl)o xy)-n-((1r,2s)-1-((cyclopropylsulfonyl)carbamoyl)-2-vinylc yclopropyl)-l-prolinamide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
194
structure length
194
Chain Sequence
KGSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVESLETTMRSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV NS3 1a Protease
publication title Discovery and Early Clinical Evaluation of BMS-605339, a Potent and Orally Efficacious Tripeptidic Acylsulfonamide NS3 Protease Inhibitor for the Treatment of Hepatitis C Virus Infection.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nwlA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4nwlA01
1Y3XA 3MTYA 1ANEA 2ZPSA 2QC2A 4BANB 2JETC 4CREA 4RKJB 1GBCA 2RCEA 4K2YA 1SGYE 4DG4A 2PW8H 4X6NA 1E36B 4I33A 3RXQA 3LT3A 3AW1A 1YPHE 1Q31A 4GUXA 1P3CA 1HAHH 1GHVH 1ZLRA 2ZKSA 2XYAA 1F0TA 2CHAC 4AFSA 4FUGA 2TGDA 1G3BA 4JZEH 4FUDA 4GVUA 1VZQH 2OBOA 1HAPH 4OS5A 4BTUB 1JMOH 1Y5BT 1MQ5A 1QHRB 3GCOA 3VB3A 5JBTA 1ABIH 3ZZ3A 1EPTB 3BTTE 3O8RA 2QF3A 2XCFA 4IW4E 1QJ7B 4DIHH 1HAOH 1F5KU 1BIOA 2GV6A 1S6HA 1V2QT 3FP7E 3LGYA 4B71A 1O3GA 3H5CB 3BEIB 2G5NA 2TGAA 1TNJA 1MTSA 3RXEA 4MTBA 2BQ7B 2ZU2A 1CBWB 2ZFRH 3ZVFA 4CHAB 1YYY1 1VCQA 1W3CA 4JZ1A 5DP5A 2QN5T 1MU8B 2H1UA 1XKAC 1GVKB 3ITIA 5E2PA 2XBWA 1LPKB 1NRSH 1OWDA 1BJUA 1UJ1A 5DP3A 4K69A 4H6SB 4SGBE 2WPKS 2ZQ2A 3PTBA 2F4LA 1TPPA 2GMTB 4UE7H 2ZHEH 1TLDA 1EB2A 3PMHB 1QRWA 1YPMH 2PTNA 4UFDH 3TPIZ 4YTAA 4Y8XA 1SQAA 2UUKB 1H9HE 3VFEA 4YT7H 3MNCA 2V3OH 2A7JA 3ZZ5A 1GI4A 1A61H 4NIWA 1ACBE 4D76A 1V2PT 5TCCA 1O35A 4X8VH 3VB5A 4AG1A 1O3MA 4AFZA 2KAIA 2ZHDA 3H7TA 4BAKB 1GJ9B 9ESTA 2PUXB 1H8IH 1UTOA 3T26A 1GBJA 3HK3B 4NIYA 1FUJA 1Z6EA 2STAE 1C5LH 3ZZDA 4AYYB 2Y81A 1O2RA 2BXUH 2RG3A 1D4PB 1QB6A 1C1UH 1O5BB 1GMCG 2G81E 1O2NA 4FU8A 1G3EA 2PV9B 2BD8A 1KTTB 4HZHA 2GZ7A 5C2ZA 4H42U 1V2MT 2VGCB 2DE8A 1A0JA 1LHGH 3RXTA 1GI9B 1SQTA 1GI7B 1FIWA 4B1TA 1FY1A 5DP7A 1C5NH 3D23A 2V0BA 1ZZZA 2A5KA 2VIVA 1CO7E 3A87A 1ELCA 3MO3A 1EPTC 5E8EH 1AO5A 1ELBA 2BD2A 3QO6A 5JB8S 3RXLA 1CA8B 3TK5A 2V6NA 5T6DA 5DP9A 2ZA5A 2YNAA 2ZGJA 1BTZA 4FUCA 1SGIB 1OX1A 4MNYA 4Y79A 4Z0KA 5GCHF 3UIRA 4XBCA 1KXEA 1CBWC 1MTWA 3OYPA 5FPTA 4NZQA 4UFGH 1L1JA 1C1QA 3PV4A 2Y82A 1XUJA 2OUAA 4CRDA 4I32A 1G3DA 4CRAA 1LVOA 3VGCB 1QBVH 1J8AA 1S0QA 2ODYB 1QB9A 2R0KA 1O3AA 3SNBA 1N6YA 2XTTB 1TRYA 1O5FH 3GY7A 1A0HB 1MCVA 1IQHA 3QZRA 5HMAA 1F5LA 2NU1E 1Y59T 1PYTC 1Y3UA 1MQ6A 3SUFA 4CH2B 1GPZA 1YBWA 2C8WB 1QB1A 1GHYH 1GBBA 3R3GB 2OTVA 2J4IA 1CE5A 1UVTH 2A4RA 1Q3XA 1O2SA 1OP0A 4A92A 1O0DH 1F2SE 1NROH 1O39A 1RXPA 5C1UA 1O3JA 2GCTB 2WUCA 3V7TA 2C3SA 2A4GA 1OWHA 3I78A 1NRQH 2SGDE 2ZHFH 5K0HA 2IN2A 1QL9A 1S81A 1C2IA 2SGEE 3F9FA 3MU0A 1DLEA 4WXIA 5ESTE 1O2TA 1XM1A 2RDLA 1FXYA 3QZQA 5EU8A 1SMFE 3UY9A 3BTWE 4IN2A 1EAXA 1C1TA 1HAVB 2PGQB 5FBIA 2GGVB 7KMEH 3E6PH 1RGQA 3R0FA 8LPRA 2GDEH 1ID5H 4Y7BA 4DVAU 7GCHF 1U6QA 1C4Y2 4ZH8A 4UONA 4XBBA 4X1PU 2OD3B 1THPB 2SGAA 4IC5A 2A31A 3SORA 2VWNA 1ZHMA 3PO1B 4J2YB 1D6RA 4GAWA 4KTSA 1G32B 1O3HA 2C4FH 3ODFA 3SUDA 3M5MA 3O8CA 3TJUA 1O2UA 4VGCB 5A2MH 4JMYA 2GDDA 5EOKA 1PPEE 1P09A 1ZGVA 2FOMB 1EZQA 3RXRA 4A1XA 4X2WA 2FI4E 4ZXXH 3M35A 1D3QB 1RS0A 1QBNA 2EI6A 1GJ7B 3ATIA 3SOSA 4KELA 2R3YA 1UMAH 2AIPA 5L6NH 1LQEA 3M7UA 1UTQA 1MCTA 3CS7A 1MAYA 3SO3A 2PWXA 3UTUH 1ARBA 1ELGA 4UFEH 2UWLA 1O3LA 3TH3H 1UTKA 3A7YA 3A88A 3KGPA 5BPEA 4X6MA 3P92A 3FAOA 1UCYH 2BVXH 1BRUP 3B8JA 1CA0C 1EP6A 3SN8A 3URCA 3MU4A 1H8DH 3UQOA 3TVJB 3A8AA 4WY3A 2P3TB 1DANH 1YF4A 5FXLA 1ZPCA 3H7OA 1QGFA 5F8TA 2OBQA 1GWAA 1KXCA 2FTMA 3TLOA 3T5FH 2Z3CA 2FDAA 3BTHE 1HJ9A 4ABJA 2VB0A 4B2BA 2H5DA 2WV4A 1QIXB 1C2KA 1A4WH 2HPQH 1AY6H 1FN8A 3SQEE 2J2UA 5G4BA 4K1EA 4ABDA 1C5MD 2GCTC 1ANBA 3ESTA 3UWJH 3TU7H 1F92A 4ZMAH 1X7AC 3UQVA 1EZXC 2CN0H 4MPWA 4Y7AA 1GBHA 2Y80A 1S0RA 2W5EA 6LPRA 4FVDA 4LK4A 1YLCA 4CRFA 1Z1JA 1KSNA 2JKHA 1Y3YA 1MKXK 2BOHB 4ABAA 3SU2A 1IQKA 2H9EH 4ABIA 1NRPH 1ZJDA 3SZNA 4I8KA 2C93B 5IDKA 4PROA 1XVOA 2W7UA 3A7VA 3LOXA 1C5VA 3BTME 2CV3A 3NWUA 2THFB 2H5CA 4Y8ZA 3ZV8A 3HKIB 3SJ8A 2VU8E 1C2LA 3GCHC 1HLTH 1O3PB 1Z8RA 2BY9X 2ZFFH 3OTPA 1O3FA 1C5PA 1OP2A 1TNLA 1H4WA 1O2YA 5DP4A 4B6EA 1ZRKA 2ZCHP 4Y0ZE 1G37A 4CR9A 4DY7B 3OX7U 4VGCC 1O31A 1WYKA 1WOFA 1XUIA 2Z6BD 3RP2A 4I8HA 2FESH 2PSYA 2SGQE 1P8VC 2ZDVH 3SU6A 3SV7A 1OYTH 3D65E 2BD4A 2OC1A 2NU0E 1TA2A 1A7SA 4X1QU 4BAHB 2AH4X 4ZKNU 3STIA 3F68H 4O97A 1OWIA 1UVOA 3UWIA 1P04A 4MQAA 3RMMH 1ZR0A 1UTPA 1GCDA 2WUBA 1VJAU 1O37A 2BD5A 3KQDA 2TPIZ 4AYVB 2J38A 3BIUH 2A2QH 3ODDA 3ZYEA 3KEEA 2ULLA 5AFZH 2D26C 4INLA 2F9UA 3ATKA 2P3FH 1PPFE 3RLWH 1HJAC 5SGAE 4WXVA 1TGCA 4YESB 4E06H 4FUIA 3URDA 2HALA 1HXFH 1O2QA 4GHQA 5T6FA 1HJ8A 1ZRBA 3QTOH 2BZ6H 1JOUB 2A4QA 4WH6A 1MTNC 1GBDA 3LC5A 1O2MA 5FPSA 4NCYA 3I77A 1GHXH 1RIWB 3UFAA 3SZEA 1BMAA 1EX3A 1JXPA 1VCWA 5J4SA 3EQ0H 5A8YA 1EJAA 1FY5A 1ZSLA 1MZDA 4U32A 2G55A 1RTLA 1TE0A 5T3HA 1C1PA 1E38B 3E91A 2HWLB 3ELAH 1SGNE 2J34A 2QXIA 2ZTYA 1FN6A 1K1LA 1DM4B 1Y5UT 1UO6A 1NS3A 1O3IA 1DT2A 5AF9H 2EI8A 1GGDC 4MPXA 4AZ2B 2FP7B 4X1NU 3P70B 1A5GH 1NESE 2QXJA 1BRAA 1C5YB 1C1WH 3RXJA 3PMJA 2ZPQA 5IYTA 1O38A 2VH0A 2BD7A 4NSYA 1TNKA 2PKSC 1UTNA 1PQ7A 1TGBA 3PLBA 5I25A 2SNVA 2BHGA 6CHAC 3HGPA 5AFYH 1VGCC 4DGJA 5EXMA 3LONA 2WINI 2FI3E 1K1OA 2FTLE 2JH5D 1GBMA 4CRGA 2CGAA 2PFEA 1WXRA 2FOCA 3KL6A 1ZJKA 2P94A 4TY6A 4IBLH 2FOHA 2OINA 3FVFB 1GDUA 1WTGH 2WPMS 1ELAA 1FQ3A 3BV9B 1LO6A 2OLGA 1IQFA 2Z7FE 3A86A 4WF8A 2O8MA 1HCGA 2FYRA 1NN6A 1O36A 1XXDA 1LPZB 2F3CE 2Y5HA 1BITA 4A7IB 1OYQA 1E34B 3E1XB 3OY6U 1OPHB 1GG6C 1QL7A 3QN7A 5JBBS 4GPGA 1L4ZA 5GWZA 1YCPM 1AIXH 3ZVCA 3SI3H 3BTDE 1LVBA 4Y76A 1DSUA 3LGWA 5JB9S 4CBOA 2Z9GA 4KP0A 2KAIB 2BDYA 3U98H 3BG8A 3EA8A 1SHYA 3MO6A 1BMNH 3EGKH 3BTFE 3GYMA 3MHWU 2VINA 1HRTH 1JWTA 3SV9A 4U2WA 1BTUA 2GX4A 2A5IA 4DT7B 3SJ9A 2HLCA 1EZUC 1Y8TA 1ABJH 3LGTA 3ZVEA 1GL1A 1KIGH 1P2KA 4HFPB 1RIWC 4E7RG 1XKBC 2D1JA 2QV1A 2UUFB 1N8OB 1AGJA 1TMTH 2BM2A 1CQQA 3UR6A 3AVZA 2BVRH 1OS8A 1NFXA 3HK6B 3AASA 5H4IB 1BA8B 1FI8A 1KTSB 1B7XB 1K1JA 4FVBA 2HNTE 3RUOA 4ABFA 2Y5GA 1GJ8B 2F9NA 1DPOA 2FOGA 3T25A 1KLIH 1V2RT 4Q80A 1TX6A 4NIVA 2Z9KA 5C5OA 3RXHA 3RM0H 3QX5H 1G2LA 5T6GA 2BB4A 1K9OE 2ZNKH 4ZROA 2VWMA 2AGEX 1NZQH 1L0ZA 1DUAA 2ZDKA 4YLUA 1MD7A 1VCPA 1TPSA 1ESBA 3CENA 2AIQA 1A2CH 2C90B 3JZ2B 4ISNA 1C2JA 2VVUA 2B8OH 3MU5A 1D3PB 5FAHA 2FEQH 4ZUHA 3P17H 5A8ZA 2HOBA 4TWYA 3HGNA 4AGJA 1JBUH 5AHGH 1AFQB 3LGIA 4ASHA 4CH8B 3U69H 2FMJA 4Q2KA 1RD3B 4NA8A 1V2LT 2HRVA 1ETSH 3LH3A 3RXGA 2A1DB 4MPVA 2ODPA 4Y8YA 2F9OA 2ZTZA 2BDGA 1G9IE 2D8WA 1F0RA 2BLQA 2VVCA 2TGPZ 4ZKOU 1LVYA 3BG4B 3PWBA 3KHVA 4DCDA 3M37A 1CHOG 2QGRA 1HNEE 1QJ1B 4X0WU 2A7CA 1OWJA 3MNSA 3FZDA 1O5AB 1O2PA 2CMYA 1PQ8A 1ZTKA 2O8TA 2R0LA 1AE8H 3PLKA 1ELDE 3U8TH 2VIOA 4ZKSU 4OS7A 3QGNB 2NWNA 3LPRA 2F9PA 2PR3A 1K22H 3A82A 1H9IE 6GCHG 1YPEH 1S5SA 1YPGH 3P8GA 5EXLA 1MKXH 2XBXA 1V2ST 1BBRK 1AHTH 1BDAA 1TBZH 2BYAX 1AN1E 4ZAEA 1T4UH 2W3KA 4X8SH 1BJVA 1C9PA 3RXSA 4INHA 2EC9H 1V2TT 4AG2A 1WCZA 4BOHA 2BLVA 4X8UH 4NWKA 3MH7A 3V0XA 1SLVB 4YOGA 2P8OB 1ETRH 1P2MA 1SG8B 1SLUB 2BTCE 4XOJA 1O2GH 5GIBA 1FZZA 3BTGE 1C5XB 3TGJE 5GXPA 4HI3A 2XBVA 1SFQB 2AGGX 2VNTA 4RI0A 4X1SU 1G2MA 1C1VH 3OU0A 1CGJE 3EYDA 3CP7A 4D8NA 1SLXB 2A32A 3V12A 4A5TS 3KNXA 1CGHA 3DFLA 1TX8A 2PTCE 4TWWA 1LHEH 4I7YH 2VWLA 1C2DA 1Z6JH 2BMGB 5LPFA 4IS5A 3NKKA 2ANKH 4OGXA 3KN2A 3PMAB 4A1TA 3TH4H 3FZZA 2QF0A 1CGIE 2QXHA 4CHAC 2SNWA 1DUEA 1ARCA 2OK5A 2BXTH 4YOIA 4OM9A 1O3CA 3RU4E 3MFJA 3LH1A 3TGKE 1DSTA 4O3TA 1HAYB 4OGYA 1HAZB 3ATMA 4OS2A 3SJIA 1P2JA 1HDTH 2STBE 2FLBH 2ZZUH 2G4TA 3MO9A 4BTTB 1ZGIA 2ODQA 4YZUA 2Q6GA 1SVPA 1UK4A 2GMTC 1VR1H 1NT1A 3PTNA 5JYIA 1SPJA 3A8CA 1SGRE 1O2WA 1SC8U 3E8LA 1S6FA 1UVPA 1GBEA 1P0SH 4MVNA 1OSSA 2BD9A 1Z8JB 2IPHA 2AFQB 1DITH 2FO9A 4KKDA 3GY8A 5C5NA 1O2LA 4UFFH 5EQRA 3SNCA 1AD8H 4ABBA 1DOJA 5ABWA 3M36A 1C4U2 4GLYA 1O3BA 3E3TA 3TK6A 2CJIA 1K1IA 3SHAH 2OC8A 5B6LA 2AEIH 1NTPA 3Q3XA 3SGAE 3E16B 1GHAG 1TGTA 3EDXB 5L30H 3SU4A 1EAIA 3C1KA 1SGTA 1FPHH 3K65B 1EOJA 2ESTE 3PROA 1GHWH 1SGFG 1KLJH 1MZAA 1A5IA 1HIAA 1LDTT 1XUHA 4K3JA 3UREA 2HPPH 3RMNH 2O8LA 4M7GA 3H09A 7LPRA 1PPGE 2TRMA 1YKTA 2QCYA 2VGCC 2H6MA 3W94A 4RKOB 1YCPH 1HAXB 1DY9A 2QIQA 1GI6A 2LPRA 4NIXA 1TYNA 5DG6A 4Y11E 1AUTC 2OC7A 5FHTA 3CS0A 1QQUA 1JIMA 2P16A 2XC4A 3SI4H 1Z71A 3FANA 2OP9A 5GJ4B 3ZZBA 3D62A 5DO4H 1T4VH 2A4OA 2B5TB 2Z94A 3MNXA 2AYWA 1UK3A 2Y7ZA 2J94A 4HTCH 2HNTC 1C1MA 2ZHWH 3AAVA 2V3HH 2ZGCA 1Y3WA 3M7QA 1FAKH 1IQJA 2XWBI 1XUFA 3PYHA 1V3XA 1J15A 3NZIA 2YOLA 3ZZAA 1PJPA 2XCNA 1W7GH 1MAXA 5TCAA 2Z9LA 3RC5A 1Z8GA 4J1YA 1FONA 3M3TA 3VGCC 2Z3EA 1AUJA 1O5DH 1SGDE 5JBAS 2ILNA 1MUEB 2TBSA 1AB9B 1TABE 1QRXA 3LGVA 3OY5U 4R0IA 3ZZ8A 5DK1A 2ZCKP 2C8XB 1BMMH 2VWOA 2ZP0H 1J9CH 2M5TA 3RMOH 3VXEH 3M5LA 1GMHF 5A0BA 2OC0A 4O3UA 1IQMA 4H4FA 5HXFA 3PMBB 3RXDA 5C1YA 1F5RA 4HGCA 1IAUA 1TNHA 2DE9A 1GHZA 3ENSB 5A0AE 1KLTA 2J95A 8GCHF 1HV7A 2GP9B 2WYJA 2ZWLH 2SFAA 1ETTH 4DOQA 1UTLM 4BXSA 1AWFH 3HPTB 3SU1A 3OTJE 1GCTB 4DJZB 1PPCE 2ZU5A 1RTKA 5HM2A 2QAAA 1ELVA 2GVFA 3SJKA 1GI5A 4FUEA 1YGCH 1PQ5A 1DWDH 3B23B 1BRBE 3E90B 3ZZ6A 1DE7H 4X8TH 2SGPE 3HKJB 1MTVA 4IMQA 1KDQA 2XRCA 1KYNA 1V2WT 3D49H 1QCPA 1N6XA 1W11U 3A7WA 1NU7B 5CHAB 1K1NA 1UVUH 1NC6A 4GHTA 1W12U 2C8ZB 1K2I1 5FCKA 1XXFA 1BOQA 1MU6B 4F49A 5EGMA 1O3DA 3EAJA 3ATLA 1SHHB 1QA7A 5JBCS 1ELTA 1UK2A 1ZOMA 5HYOA 1F0SA 3Q3KA 3S0NA 3PV2A 1GI1A 4D7GA 1O3OA 2FS9A 1AKSA 1DX5M 2FWWA 1GBIA 1OXGA 1VITG 3PO1C 2BVSH 4ABEA 1WAYB 1PQAA 4Y71A 1AZ8A 4AX9H 3T28A 1FDPA 1C2EA 1NY22 3KCGH 3T27A 5F6MA 1V2OT 2WYGA 1E37B 1IHTH 1MKWK 5F03A 1RRKA 5J4QA 1AU8A 1ZMLA 5FPYA 1BHXF 4AFUA 3MU8A 4JYTA 2DUCA 4DIIH 1P2IA 3RXCA 4F4OC 2A7HA 4ISHH 4GSOA 4IC6A 1XUGA 1EB1H 4B73A 2LNCA 4BAOB 3IG6B 2PHBA 4AB9A 3BF6H 4DURA 4Q7YA 1IQIA 1TGSZ 4WMFA 1HAIH 2F9BH 1EOLA 3Q77A 2PKAA 4LXBH 2ZDMA 2ZIQH 3V3MA 4ZKRU 3SNEA 2BDHA 1FY3A 1SOTA 4FXGH 1DDJA 1INCA 1ELEE 1NRRH 3RC6A 1CHOF 3T62A 2ZU3A 3A85A 1DFPA 3F1SB 3NXPA 3PB1E 3BTQE 1ZTJA 1S85A 4K60A 2XC5A 2ZU4A 4AORA 1SGCA 1THSH 2NU4E 4B2CA 1GBLA 4TPYA 3ZVGA 1OWKA 1C9TA 1GI3A 2FOAA 4WJG2 2B0FA 4E05H 1IOEA 4I8JA 4X2VA 3RM2H 3ZVBA 2ANYA 3SV2H 2BD3A 1O33A 1O32A 2Q6DA 1LKBA 1TOCB 8ESTE 1C5WB 3O8BA 6GCHF 1WSSH 3GDVA 1L4DA 3RC4A 1HAGE 1IQGA 3SGQE 1TFXA 4D9QA 1O30A 2GKVE 2I6QA 3GY3A 1CT4E 2W7SA 1P2QA 3DD2H 1D9IA 5DJ7A 4IMZA 4K1SA 2CF8H 2ANMH 2J92A 3P6ZB 2ZEBA 4LZ4B 3KF2A 1NFUA 2ZO3H 2ZDNA 3KQEA 1P2OA 4AGKA 1P3EA 4XDEA 2AERH 1P9UA 2CHAB 4TPIZ 1BT7A 2I6SA 2UUJB 1DICA 1J17T 3ZZ7A 4AB8A 2WPHS 3RDZA 1FJSA 3SW2B 2XC0A 3TJOA 4WWYA 2BQWB 1AWHB 1GMHG 4MNWA 5T1VA 2FLRH 1QBOA 1VITH 1RTFB 1GJ6A 3RXFA 1CSOE 2ASUB 5BRRE 4Z6AH 2XW9A 4BNRA 4A1VA 3UOUA 3DHKH 1W0ZU 1AQ7A 3LJOA 8GCHG 1ORFA 1H9LB 3NPSA 4H6TA 1GI0A 3JZ1B 4I8LA 3QGJA 2B9LA 3VPKA 1THRH 2UWPA 3F9EA 3MMGA 1BCUH 3MOCA 1BTWA 3TGIE 2R3UA 1HPGA 2GZ9A 2HVXA 3ZYDA 1PYTD 4WH8A 4JZFH 4RSPA 4D9RA 7ESTE 4CRCA 4CBNA 3M3VA 4Y10E 1EJMA 2BY5X 2ZFSA 3DFJA 2NU3E 1T8OA 1TGNA 2GT7A 3SHCH 5C1XA 3SUEA 3A7ZA 1BMLA 2CXVA 1TPOA 1UHBA 5LH8A 4NFFA 4QT8C 1BBRE 2VH6A 1DY8A 1W13U 3DUXH 2HGTH 3DT0H 1SGEE 3V13A 3SJOA 5B6OA 1NM6A 2FOBA 3RXIA 2VBCA 1XMNB 2R2WU 1V2VT 1GHAF 1ZMNA 3A7XA 3RXAA 1GMDF 4JYUH 3TJVA 1BB0B 2RA0A 2AMPA 6ESTA 4MNVA 2D2DA 1O3KA 1V2NT 1ANDA 1MBQA 3PV5A 1S83A 1O2VA 1HB0B 2ZU1A 1SR5C 3OSYA 3KIDU 3S9BA 2FX4A 3PLPA 2ANWA 2JH6D 2BLWA 1T8LA 2BY7X 4BAMB 1Z7KA 1DXPA 3M5OA 3U8RH 2OQUA 1LHCH 2JH0D 3F9GA 1AVWA 1MTUA 2WPJS 3U9AH 3QDZB 4CR5A 1LVMA 2Y5FA 1TPAE 4ZHAA 2GCHF 5F8XA 3M7TA 2F9VA 3RMLH 1JRSA 2BQ6B 3W95A 3GOVB 4FUBA 2ZI2H 2A45B 2O8UA 1ANCA 1EQ9A 2FXRA 5FBEA 1GI8B 3RXKA 1SI5H 5HGGA 5E0GA 1GVZA 1K1PA 3UNQA 1C5ZB 2ZCLP 1GDNA 2Z3DA 3SNAA 3HATH 3TITA 1O34A 1LMWB 1TBRH 5ESBA 2IJOB 2ALPA 4GCHG 4AFQA 4E7NA 4INKA 1LTOA 4UEHH 1OWEA 2QA9E 3TJNA 2ZFQH 2BLOA 5EODA 1GJ5H 4FUFA 1PPHE 1TMUH 5A09A 5JDUB 1W10U 3RXUA 4BAQB 3SYJA 3SU5A 2ZHQH 1TIOA 4ISLA 1TAWA 1B0FA 1YPLH 2HNTF 2W26A 9LPRA 5JPMH 4I8GA 2G8TA 3LKWA 1CU1A 4Y0YE 1C1OA 3UOPA 1GI2A 1TBQH 4Q7ZA 1PPBH 1FIZA 4UDWH 1P11E 2EI7A 2UWOA 3MU1A 2ALVA 3QWCH 1C1RA 1N8OC 3FP8E 3GYLB 2EEKA 1HIAB 1O2HA 2VIWA 4B76A 1TQ0B 4CRBA 3E0NB 1SB1H 1H1BA 1XVMA 1W14U 3SUGA 1SLWB 3SGBE 1YPJH 4NGAH 1YLDA 1BTHH 4BXWA 1EZSC 3EA7A 2XXLA 2FOFA 2ZGHA 2VIQA 3GY6A 4XSKU 4IGDA 1GBTA 3GCNA 3NK8A 4M9FA 2ZG0H 3BN9A 1HYLA 1ZSKA 4WVPE 4XBDA 3FP6E 3EE0B 4OS6A 3F6UH 1A0LA 2AGIX 5EQQA 1JRTA 3S69A 3S7HB 4NFEA 1MKWH 5FCRA 2VIDA 1C2HA 1LHFH 4D7FA 3BEUA 1LKAA 3BTEE 2QY0B 4JK6A 1V2UT 4THNH 3P95A 1IQLA 2FYQA 2H2ZA 2OCVB 3TH2H 1HFDA 5K7RA 3A80A 2GZ8A 1O2KA 2VIPA 4KTCA 1AFQC 1GJDB 3MH6A 1M9UA 1IQNA 1QQ4A 3C27B 1RJXB 3MH5A 1DVAH 1FV9A 1ZPBA 1VITF 5EW2H 3UR9A 3FFGA 2UUYA 1ZTLA 3GY5A 1YM0A 3QLPH 1EPTA 3B9FH 1A46H 3VB7A 3RXMA 5L2YH 3TIUA 1GVLA 3VEQB 3BG4C 2ZF0H 4I31A 4Q7XA 1SGPE 2R2MB 3ATWA 5EPNA 3MH4A 1P9SA 3RXPA 4TYDA 1F7ZA 1P12E 3TNSA 3IITA 1BZXE 5CMXH 2G52A 3SNDA 3LDXH 1GJCB 2P59A 1EUFA 4MG3A 1OOKB 1C5UA 1DWCH 3RU4D 2AMQA 2BDIA 1LHDH 2XNIA 1D3TB 5TJXA 1CT0E 1CA0B 1ESTA 1OKXA 1GDQA 3ZVAA 1TRMA 2O9QA 5HM9A 1O3EA 4YOJA 1SGFA 5PTPA 1V2KT 1AMHA 2TGTA 1GMDG 2ZDAH 2BX3A 3F9HA 4FU7A 1B5GH 1FLEE 1NFYA 2ZC9H 3STJA 1EAUA 3GCTG 3TNTA 1E35B 1F0UA 1DXWA 1HGTH 1B0EA 1SOZA 2CF9H 4ZHMU 2BY8X 3VB4A 1KDQB 2Z9JA 2P8OC 1RFNA 2FI5E 1BTXA 1G30B 4MDSA 4B2AA 2Y6TA 1T8MA 4AN7A 1A5HA 3U1JB 1FNIA 2EA3A 1CHGA 1NFWA 1WTHD 3MYWA 1K28D 1PFXC 2P93A 1J16A 5FX5A 3KQBA 1QL8A 1W2KH 1XX9A 3LGUA 3GICB 5DKMA 3S9CA 5LGOA 3Q00A 4YLQH 4K5ZA 1XUKA 2GCHG 2H9HA 1AKSB 2G51A 3RXBA 1IHSH 2GTBA 3QUMP 1TMBH 1EAWA 1EJNA 4X1RU 1LCYA 1D3DB 3VB6A 3GCHB 3ZZ4A 1C4V2 2G4UA 1UVSH 1MMJN 5EXNA 4MLFB 2A5AA 1IQEA 1BQYA 1EXFA 2P95A 1C5RA 1TA6A 2BY6X 3N7OA 3PWCA 2Y7XA 2TIOA 2Z9IA 5CE1A 3U8OH 1TQ7B 3T2NA 1YPHC 1EASA 1T8NA 1VJ9U 3UUZA 4LZ1H 2GD4B 4YO9A 4SGAE 4YM9A 2H9TH 1Q2WA 1ZPZA 4XE4A 3K9XB 2FODA 3GY2A 3DA9B 1C1NA 3A7TA 2PKAB 3P8FA 2WZQA 1GJBB 4ABHA 1MBMA 2RA3A 2BDBA 2OXSA 1P02A 3EA9A 2FZZA 5LPEA 1WUNH 1TOMH 1TONA 2ZQ1A 4U30A 5FX6A 1FPCH 2BDCA 3Q3YA 3ZZ9A 4JCNA 1A1RA 1WQVH 4WMDA 2GV7A 1W7XH 3A81A 4BTIB 3MNBA 2J9NA 3LC3A 4ABGA 1G3CA 1D6WA 1E0FD 1C5QA 1NO9H 3A8DA 4JZDH 1QRZA 2F91A 3WY8A 1GBAA 1HJAB 1O2ZA 1P05A 4XFQA 3MI4A 5DPAA 1MH0A 2O8WA 1KXAA 1CT2E 4K1TA 4FUHA 1GHBF 3U1IB 2VJ1A 1P57B 1AI8H 4KTUA 3LU9B 4ISIH 1O3NA 1NU9A 4UD9H 1P01A 4FUJA 1MTNB 1ELFA 3T29A 2G5VA 3LJJA 3GISB 1EATA 2FM2A 4A6LA 2K1QA 3SV8A 1WBGB 3BTKE 2BZAA 1C5OH 3A8BA 1DS2E 3ZVDA 3QTVH 4IN1A 4OS1A 2XWAA 5C3NA 1C1SA 4X6PA 5A8XA 1OP8A 1FY8E 1KY9A 2Q6FA 3KQCA 3P8NA 3SQHE 1W8BH 1GGDB 1AFEH 2FOEA 1HAVA 5GPIB 1J14A 5ETXA 2PLXA 2WV9A 3S9AA 1TRNA 1YPKH 1L2EA 1ZMJA 3A89A 3BEFB 4JYVH 5GCHG 3A84A 1EP5A 2PKSB 1AE5A 4OS4A 2IJD1 1ZYOA 1L1GA 3GDSA 1C2GA 3AAUA 4B75A 1AVGH 3UPEA 6CHAB 3SU3A 1TB6H 1ESAA 1AVXA 1VGCB 2G00A 1AB9C 4O03A 2WPIS 3AK5A 4NSVA 1QNJA 2FIRH 2P3UB 1C5SA 2ZECA 2ZGBH 1Y3VA 4NA9H 1SL3A 1SFIA 4X6OA 3Q76A 2V35A 2ZGXH 3NUMA 4K8YA 4NA7A 4RN6A 4JZIA 1DWBH 2W3IA 3L6PA 1A3BH 4JK5A 1BBRH 2NU2E 2OQ5A 1WQSA 4MNXA 3SV6A 1P2NA 4ZHLU 4FU9A 4GCHF 2PUQH 3RU4T 4K8BA 2XBYA 2YNBA 1DWEH 1HBTH 3S7KB 1C2MA 4Y6DA 5C67A 1AZZA 2SGFE 5DP6A 5E0HA 1GCTC 1O5GH 4U01A 4LOYH 2FX6A 1P10A 1GG6B 1UHBB 1SBWA 2AMDA 4NG9H 1Y5AT 5DGJA 1SGQE 1TNIA 5GDSH 4ZXYH 2ZPRA 4R8TB 2F83A 1UCYE 1T32A 1O5EH 4B6FA 3BIVH 1QFKH 1N1LA 5CHAC 3RXOA 3K6YA 4AOQA 4DW2U 1L1NA 1O2XA 1PPZA 3ZV9A 2FPZA 1BTPA 1V6DA 5C20A 1O2OA 3PM3A 1UTJA 2PSXA 3I29A 5A0CA 3G01A 1FMGA 1DLKB 1ZSJA 3LIWA 1BHXB 1YC0A 1TWXB 2JETB 3SU0A 7GCHG 2ZDLA 3E0PB 2R9PA 1TALA 1QTFA 1BRCE 3MWIU 5E0JA 2ZTXA 1QY6A 1GBFA 5AVDA 1KXFA 1QURH 5L2ZH 1WV7H 3BSQA 1FY4A 2B7DH 2A2XH 5GNDA 2PGBB 1LQDB 3GDUA 1GMCF 1TNGA 1UTMA 3QK1A 4NWLA 4TY7A 1ZHRA 1CVWH 1W0YH 1YCPK 4ESTE 1GL0E 2WPLS 2ZFTA 1LPGB 2BX4A 4O9VA 1S84A 1G36A 1QR3E 1BTYA 1KXBA 3RLYH 3NCLA 1EKBB 1GJ4H 1NRNH 1O2IA 1P03A 2BDAA 1Z1IA 2QXGA 5E2OA 1V2JT 1SSXA 3IWMA 3L3TA 3O8DA 1C5TA 2A0QB 2ZFPH 5DP8A 4KGAA 1NPMA 1GBKA 1WU1A 5I46H 3L33A 1FAXA 4X2XA 3M3SA 2AS9A 4WMEA 1YP9A 1T31A 3ZZCA 3UNRA 1TX7A 3VXFH 5EG4A 2GT8A 1BUIA 1P06A 2Q1JA 3P8OA 5EQSA 1GHBG 1O5CB 3A83A 4B74A 1SQOA 1K21H 3K2UA 1T7CA 1K1MA 2C8YB 4X2YA 1C2FA 2BOKA 1QA0A 8KME2 3SBKA 3AW0A 3M5NA 1A3EH 5F8ZA 2WV5A 1GJAB 1UCYK 1HUTH 3UNSA 5LPRA 4MPUA 1MD8A 1O2JA 4YT6H 1Z8IB 3TK9A 2VVVA 3M61U 1QJ6B 3RXVA 5EPYA 3GY4A 3K6ZA 5EW1H 2QYIA 2FS8A 1KXDA 4ISOA 1JIRA 2IOTA 2WHXA 4NZLA 1ZHPA 3GCTF 1HXEH 1S82A
chains in the Genus database with same CATH superfamily
1Y3XA 3MTYA 1ANEA 2ZPSA 2QC2A 4BANB 2JETC 4CREA 4RKJB 1GBCA 2RCEA 4K2YA 1SGYE 4DG4A 2PW8H 4X6NA 1E36B 4I33A 3RXQA 3LT3A 3AW1A 1YPHE 1Q31A 4GUXA 1P3CA 1HAHH 1GHVH 1ZLRA 2ZKSA 2XYAA 1F0TA 2CHAC 4RT1A 4FUGA 2TGDA 4AFSA 1G3BA 3F0PA 4JZEH 4FUDA 4GVUA 1VZQH 2OBOA 1HAPH 4OS5A 4BTUB 1JMOH 1Y5BT 1MQ5A 1QHRB 3GCOA 3VB3A 5JBTA 1ABIH 1YWUA 3ZZ3A 1EPTB 3BTTE 3O8RA 2QF3A 2XCFA 4IW4E 1QJ7B 4DIHH 1HAOH 1F5KU 1BIOA 2GV6A 1S6HA 1QZ8A 1V2QT 3FP7E 1NBMD 3LGYA 4B71A 1O3GA 3H5CB 3BEIB 2G5NA 2TGAA 1TNJA 1MTSA 3RXEA 4MTBA 2BQ7B 2ZU2A 1CBWB 2ZFRH 3ZVFA 4CHAB 1YYY1 1VCQA 1W3CA 4JZ1A 5DP5A 2QN5T 5HIZA 1MU8B 2H1UA 1XKAC 1GVKB 3ITIA 5E2PA 2XBWA 1LPKB 1NRSH 1OWDA 1BJUA 1UJ1A 5DP3A 4K69A 4H6SB 4SGBE 4Q63A 2WPKS 1SQRA 2ZQ2A 3PTBA 2F4LA 1TPPA 2GMTB 4UE7H 2ZHEH 1TLDA 1EB2A 3PMHB 1QRWA 1YPMH 2PTNA 4UFDH 3TPIZ 4YTAA 4Y8XA 1SQAA 2UUKB 1H9HE 3VFEA 4YT7H 3MNCA 2V3OH 2A7JA 3ZZ5A 1GI4A 1A61H 4NIWA 1ACBE 4D76A 1V2PT 5TCCA 1O35A 4X8VH 3VB5A 4AG1A 1O3MA 3FKSD 4AFZA 2KAIA 2ZHDA 3H7TA 4BAKB 1GJ9B 9ESTA 2PUXB 1H8IH 1UTOA 3T26A 1GBJA 3HK3B 4NIYA 1FUJA 1Z6EA 2STAE 1C5LH 3WWBA 3ZZDA 4AYYB 2Y81A 1O2RA 2BXUH 2RG3A 1D4PB 1QB6A 1C1UH 2W6JD 1O5BB 3EE7A 1GMCG 2G81E 1O2NA 4FU8A 1G3EA 2PV9B 2BD8A 1KTTB 4HZHA 2GZ7A 5C2ZA 4H42U 1V2MT 2VGCB 2DE8A 1A0JA 1LHGH 3RXTA 1GI9B 1SQTA 1GI7B 2V7QD 1FIWA 3N99A 4B1TA 1FY1A 5DP7A 1C5NH 3D23A 2V0BA 1ZZZA 2A5KA 2VIVA 1CO7E 3A87A 1ELCA 3MO3A 1EPTC 5E8EH 1AO5A 1ELBA 2BD2A 3QO6A 5JB8S 3RXLA 1CA8B 3TK5A 2V6NA 5T6DA 5DP9A 2ZA5A 2KCAA 2YNAA 2ZGJA 1BTZA 4FUCA 1SGIB 1OX1A 4MNYA 4Y79A 4Z0KA 5GCHF 3UIRA 4XBCA 1KXEA 1CBWC 1MTWA 3OYPA 5FPTA 4NZQA 4UFGH 1L1JA 1C1QA 3PV4A 2Y82A 1XUJA 2OUAA 4CRDA 4I32A 1G3DA 4CRAA 1LVOA 3VGCB 1QBVH 1J8AA 1S0QA 2ODYB 1QB9A 2R0KA 1O3AA 3SNBA 1N6YA 2XTTB 1TRYA 3F0OA 1O5FH 3GY7A 1A0HB 1MCVA 1IQHA 3QZRA 5HMAA 1F5LA 2NU1E 1Y59T 1PYTC 1Y3UA 1MQ6A 3SUFA 4CH2B 1GPZA 1YBWA 3UB0A 2C8WB 1QB1A 1GHYH 1GBBA 3R3GB 2OTVA 2J4IA 1CE5A 1UVTH 2A4RA 1Q3XA 1O2SA 1OP0A 4A92A 1O0DH 1F2SE 1NROH 1O39A 1RXPA 5C1UA 1O3JA 2GCTB 2WUCA 3V7TA 2C3SA 2A4GA 1OWHA 3I78A 1NRQH 2SGDE 2ZHFH 5K0HA 1WDIA 2IN2A 1QL9A 1S81A 1C2IA 2SGEE 3F9FA 3MU0A 1DLEA 4WXIA 5ESTE 1O2TA 1XM1A 2RDLA 1FXYA 3QZQA 5EU8A 1SMFE 2K0QA 3UY9A 3BTWE 4IN2A 1EAXA 1C1TA 1HAVB 2PGQB 5FBIA 2GGVB 7KMEH 3E6PH 1RGQA 3R0FA 8LPRA 2GDEH 1ID5H 4Y7BA 4DVAU 7GCHF 3WW7A 1U6QA 5F53A 1C4Y2 4ZH8A 4UONA 4XBBA 4X1PU 2OD3B 1THPB 2JJ2D 2L6OA 2SGAA 4IC5A 2A31A 3SORA 2VWNA 1ZHMA 3PO1B 4J2YB 1D6RA 4GAWA 4KTSA 1G32B 1O3HA 2C4FH 3ODFA 3SUDA 3M5MA 3O8CA 3TJUA 1O2UA 4VGCB 5A2MH 4JMYA 2GDDA 5EOKA 1PPEE 1P09A 1ZGVA 2FOMB 1EZQA 3RXRA 4A1XA 4X2WA 2FI4E 4ZXXH 3M35A 1D3QB 1RS0A 1QBNA 2EI6A 1GJ7B 3ATIA 3SOSA 4KELA 2R3YA 1UMAH 2AIPA 5L6NH 1LQEA 3M7UA 1UTQA 1MCTA 3CS7A 1MAYA 3SO3A 2PWXA 3UTUH 1ARBA 1ELGA 4UFEH 2F43B 2UWLA 1O3LA 3TH3H 1UTKA 3A7YA 1OHHD 3A88A 3KGPA 5BPEA 4X6MA 3P92A 3FAOA 1UCYH 2BVXH 1BRUP 3B8JA 1CA0C 1EP6A 3SN8A 3URCA 3MU4A 1H8DH 3UQOA 3TVJB 3A8AA 4WY3A 2P3TB 1DANH 1YF4A 5FXLA 1ZPCA 3H7OA 1QGFA 5F8TA 2OBQA 1GWAA 1KXCA 2FTMA 3TLOA 3T5FH 2Z3CA 2FDAA 3BTHE 1HJ9A 4ABJA 2VB0A 4B2BA 2H5DA 2WV4A 3PRDA 1QIXB 1C2KA 1A4WH 2HPQH 1AY6H 1FN8A 3SQEE 2J2UA 5G4BA 4K1EA 4ABDA 1C5MD 2GCTC 1ANBA 3ESTA 2AHME 3UWJH 3TU7H 1F92A 4ZMAH 1X7AC 3UQVA 1EZXC 2CN0H 4MPWA 4Y7AA 1GBHA 2Y80A 1S0RA 2W5EA 6LPRA 4FVDA 4LK4A 1YLCA 4CRFA 1Z1JA 1KSNA 2JKHA 1Y3YA 1MKXK 2BOHB 4ABAA 3SU2A 1IQKA 2H9EH 4ABIA 1NRPH 1ZJDA 3SZNA 4I8KA 2C93B 4ZCNA 4PROA 5IDKA 1XVOA 2W7UA 3A7VA 3LOXA 1C5VA 3BTME 2CV3A 3NWUA 2THFB 2H5CA 4Y8ZA 3ZV8A 3HKIB 3SJ8A 2VU8E 1C2LA 3GCHC 1HLTH 1O3PB 1Z8RA 2BY9X 2ZFFH 3OTPA 1O3FA 1C5PA 1OP2A 3DSOA 1TNLA 1H4WA 1O2YA 5DP4A 4B6EA 1ZRKA 2ZCHP 4Y0ZE 1G37A 2J98A 4CR9A 4DY7B 3OX7U 4VGCC 1O31A 1WYKA 1WOFA 1XUIA 2Z6BD 3RP2A 4I8HA 2FESH 2PSYA 2SGQE 1P8VC 2ZDVH 3SU6A 3SV7A 1OYTH 3D65E 2BD4A 2OC1A 2NU0E 1TA2A 1A7SA 4X1QU 4BAHB 2AH4X 4ZKNU 3STIA 3F68H 4O97A 1OWIA 1UVOA 3UWIA 1P04A 4MQAA 3RMMH 1ZR0A 1UTPA 1GCDA 2WUBA 1VJAU 1O37A 2JJ1D 2BD5A 2TPIZ 3KQDA 4AYVB 2J38A 3BIUH 2A2QH 3ODDA 3ZYEA 3KEEA 2ULLA 5AFZH 2D26C 4INLA 2F9UA 3ATKA 2P3FH 1PPFE 3RLWH 1HJAC 5SGAE 1H8HD 4WXVA 1TGCA 4YESB 4E06H 4FUIA 3URDA 2HALA 1HXFH 1O2QA 4GHQA 5T6FA 1HJ8A 1ZRBA 3QTOH 2BZ6H 1JOUB 2A4QA 4WH6A 1MTNC 1GBDA 3LC5A 1O2MA 5FPSA 4NCYA 3I77A 1GHXH 1RIWB 3UFAA 3SZEA 1BMAA 1EX3A 5HKKD 1JXPA 5C0UA 1VCWA 5J4SA 3EQ0H 5A8YA 1EJAA 1FY5A 1ZSLA 1MZDA 4U32A 2G55A 1RTLA 1TE0A 5T3HA 1C1PA 1E38B 3E91A 2HWLB 3ELAH 1SGNE 2J34A 1COWD 2QXIA 2ZTYA 1FN6A 1K1LA 1DM4B 1Y5UT 2PP6A 1UO6A 1NS3A 1O3IA 4ASUD 1FX0B 1DT2A 5AF9H 2EI8A 1GGDC 4MPXA 4AZ2B 2FP7B 4X1NU 3P70B 1A5GH 1NESE 2QXJA 1BRAA 1C5YB 1C1WH 3RXJA 3PMJA 2ZPQA 5IYTA 1O38A 2VH0A 2BD7A 4NSYA 1TNKA 2PKSC 1UTNA 1PQ7A 1TGBA 3PLBA 3KYFA 5I25A 2SNVA 2BHGA 6CHAC 3HGPA 5AFYH 1VGCC 4DGJA 5EXMA 3LONA 2WINI 2FI3E 1K1OA 2FTLE 2JH5D 1GBMA 4CRGA 2CGAA 2PFEA 1WXRA 2FOCA 3KL6A 1ZJKA 2P94A 4TY6A 4IBLH 2FOHA 2OINA 3FVFB 1GDUA 1WTGH 2WPMS 1ELAA 1FQ3A 3BV9B 1LO6A 2OLGA 1IQFA 2Z7FE 3A86A 4WF8A 2O8MA 1HCGA 2FYRA 1NN6A 1O36A 1XXDA 1LPZB 2F3CE 2Y5HA 1BITA 2KCOA 4A7IB 1OYQA 1E34B 3E1XB 3OY6U 1OPHB 1GG6C 1QL7A 3QN7A 5JBBS 4GPGA 1L4ZA 5GWZA 1YCPM 1AIXH 3ZVCA 3SI3H 3BTDE 1LVBA 4Y76A 1DSUA 3LGWA 5JB9S 4CBOA 2Z9GA 4KP0A 2KAIB 2BDYA 3U98H 3BG8A 3EA8A 1SHYA 3MO6A 1BMNH 3EGKH 3BTFE 3GYMA 3MHWU 2VINA 1HRTH 1JWTA 3SV9A 4U2WA 1BTUA 2GX4A 2A5IA 4DT7B 3SJ9A 2HLCA 1EZUC 1Y8TA 1ABJH 3LGTA 3ZVEA 1GL1A 1KIGH 1P2KA 4HFPB 1RIWC 4E7RG 1XKBC 2D1JA 2QV1A 2UUFB 1N8OB 1AGJA 1TMTH 2BM2A 1CQQA 3UR6A 3AVZA 2BVRH 1OS8A 1NFXA 3HK6B 3AASA 5H4IB 1BA8B 1FI8A 1KTSB 1B7XB 1K1JA 4FVBA 2HNTE 3RUOA 4ABFA 2Y5GA 1GJ8B 2F9NA 1DPOA 2FOGA 3T25A 1KLIH 1V2RT 4Q80A 1TX6A 4NIVA 2Z9KA 2WSSD 5C5OA 3RXHA 2YMSC 3RM0H 3QX5H 1G2LA 5T6GA 2BB4A 1K9OE 2ZNKH 4ZROA 2VWMA 2AGEX 1NZQH 1L0ZA 1DUAA 2ZDKA 4YLUA 1MD7A 1VCPA 1TPSA 1ESBA 3CENA 2AIQA 3ZIAD 3F2HA 1A2CH 2C90B 3JZ2B 4ISNA 1C2JA 2VVUA 2B8OH 3MU5A 5EJLA 1D3PB 5FAHA 2FEQH 4ZUHA 3P17H 5A8ZA 2HOBA 4TWYA 3HGNA 4AGJA 1JBUH 5AHGH 1AFQB 3LGIA 4ASHA 4CH8B 3U69H 2FMJA 4Q2KA 1RD3B 4NA8A 1V2LT 2HRVA 1ETSH 3LH3A 3RXGA 2A1DB 4MPVA 2ODPA 4Y8YA 2F9OA 2ZTZA 2BDGA 1G9IE 2D8WA 3F3BA 1F0RA 2BLQA 2VVCA 2TGPZ 4ZKOU 1LVYA 3BG4B 3PWBA 3KHVA 4DCDA 3M37A 1CHOG 2QGRA 1HNEE 1QJ1B 4X0WU 1E79D 2A7CA 1OWJA 3MNSA 2LELA 3FZDA 1O5AB 1O2PA 2CMYA 1PQ8A 1ZTKA 4Q4LA 2O8TA 2R0LA 1AE8H 3PLKA 1ELDE 3U8TH 2VIOA 4ZKSU 4OS7A 3QGNB 2NWNA 3LPRA 2F9PA 2PR3A 1K22H 3A82A 1H9IE 6GCHG 1YPEH 1S5SA 1YPGH 3P8GA 1YLNA 5EXLA 1MKXH 2XBXA 1V2ST 1BBRK 1AHTH 1BDAA 1TBZH 2BYAX 3VG8A 1AN1E 4ZAEA 1T4UH 2W3KA 4X8SH 1BJVA 1C9PA 2WPDD 3RXSA 4INHA 2EC9H 1V2TT 4AG2A 1WCZA 4BOHA 2BLVA 4X8UH 4NWKA 3MH7A 3V0XA 1SLVB 4YOGA 2P8OB 1ETRH 1P2MA 1SG8B 1SLUB 2BTCE 4XOJA 1O2GH 5GIBA 1FZZA 3BTGE 1C5XB 3TGJE 5GXPA 4HI3A 2XBVA 1SFQB 2AGGX 2VNTA 4RI0A 4X1SU 1G2MA 1C1VH 3DCLA 3OU0A 1CGJE 3EYDA 1MABB 3CP7A 4D8NA 1SLXB 2A32A 3V12A 4A5TS 3KNXA 5EIYA 1CGHA 3DFLA 1TX8A 2PTCE 4TWWA 1LHEH 4I7YH 2VWLA 1C2DA 1Z6JH 2BMGB 5LPFA 4IS5A 3NKKA 2ANKH 4OGXA 3KN2A 3PMAB 4A1TA 3TH4H 3FZZA 1UW7A 2QF0A 1CGIE 2QXHA 4CHAC 2JDID 2SNWA 1DUEA 1ARCA 2OK5A 5EJ1A 2BXTH 4OM9A 4YOIA 1O3CA 3RU4E 3MFJA 4XRNA 3LH1A 3TGKE 1DSTA 4O3TA 1HAYB 4OGYA 1HAZB 3ATMA 4OS2A 3SJIA 1P2JA 1HDTH 2STBE 2FLBH 2ZZUH 2G4TA 3MO9A 4BTTB 1ZGIA 2ODQA 4YZUA 2Q6GA 1SVPA 1UK4A 2GMTC 1VR1H 1NT1A 3PTNA 5JYIA 1SPJA 3A8CA 1SGRE 1O2WA 1SC8U 3E8LA 1S6FA 1UVPA 1GBEA 1P0SH 4MVNA 1OSSA 2BD9A 1Z8JB 2IPHA 2AFQB 1DITH 2FO9A 4KKDA 3GY8A 5C5NA 1O2LA 4UFFH 5EQRA 3SNCA 1AD8H 4ABBA 1DOJA 5ABWA 1KMHB 3M36A 1C4U2 4GLYA 1O3BA 3E3TA 3TK6A 2CJIA 1K1IA 3SHAH 2OC8A 5B6LA 2AEIH 1NTPA 3Q3XA 3SGAE 3E16B 1GHAG 1TGTA 3EDXB 5L30H 3SU4A 1EAIA 3C1KA 1SGTA 1FPHH 3K65B 1EOJA 2ESTE 3PROA 1GHWH 1SGFG 1KLJH 1MZAA 1A5IA 1HIAA 1LDTT 1XUHA 4K3JA 3UREA 2HPPH 3RMNH 2KR7A 2O8LA 4M7GA 3H09A 7LPRA 1PPGE 2TRMA 1YKTA 3DSGA 2QCYA 2VGCC 3FOAA 2H6MA 3W94A 4RKOB 1YCPH 1HAXB 1DY9A 2QIQA 1GI6A 2LPRA 4NIXA 1TYNA 5DG6A 4Y11E 1AUTC 2OC7A 5FHTA 3CS0A 1QQUA 1JIMA 2P16A 2XC4A 3SI4H 1Z71A 3FANA 2OP9A 5GJ4B 3ZZBA 3D62A 5DO4H 1T4VH 2A4OA 2B5TB 2Z94A 3MNXA 2AYWA 1UK3A 4ACBA 2Y7ZA 2J94A 4HTCH 2HNTC 2J98B 1C1MA 2ZHWH 3AAVA 2V3HH 2ZGCA 1Y3WA 3M7QA 1FAKH 1IQJA 2XWBI 1XUFA 3PYHA 1V3XA 1J15A 3NZIA 2YOLA 3ZZAA 1PJPA 2XCNA 1W7GH 5DN6D 1MAXA 5TCAA 2Z9LA 3RC5A 1Z8GA 4J1YA 1FONA 3M3TA 3VGCC 1E1QD 2Z3EA 1AUJA 1O5DH 1SGDE 5JBAS 2ILNA 1MUEB 2TBSA 1AB9B 1TABE 1QRXA 3LGVA 3OY5U 4R0IA 3ZZ8A 5DK1A 2ZCKP 2C8XB 1BMMH 2VWOA 2ZP0H 1J9CH 2M5TA 3NRLA 3RMOH 3VXEH 1K0HA 3M5LA 1GMHF 5A0BA 2OC0A 4O3UA 1IQMA 4H4FA 5HXFA 3PMBB 3RXDA 5C1YA 1F5RA 4HGCA 1IAUA 1TNHA 2DE9A 1GHZA 3ENSB 5A0AE 1KLTA 2J95A 8GCHF 5DSFA 1HV7A 2GP9B 2WYJA 2ZWLH 2SFAA 1ETTH 4DOQA 1UTLM 4BXSA 1AWFH 3HPTB 3SU1A 3OTJE 1GCTB 4DJZB 1PPCE 2ZU5A 1RTKA 5HM2A 2QAAA 1ELVA 2GVFA 3SJKA 1GI5A 4FUEA 1YGCH 1PQ5A 1DWDH 3B23B 1BRBE 3E90B 4XD7D 1DE7H 4X8TH 2SGPE 3ZZ6A 3HKJB 1MTVA 4IMQA 3N7EA 1KDQA 2XRCA 1KYNA 1V2WT 3D49H 1QCPA 1N6XA 1W11U 3A7WA 1NU7B 5CHAB 1K1NA 1UVUH 1NC6A 4GHTA 1W12U 2C8ZB 1K2I1 5FCKA 1XXFA 1BOQA 1MU6B 4F49A 5EGMA 1O3DA 3EAJA 3ATLA 1SHHB 1QA7A 5JBCS 1ELTA 1W0KD 1UK2A 1ZOMA 1SKYE 5HYOA 1F0SA 3Q3KA 3S0NA 2GJGA 3PV2A 1GI1A 4D7GA 1O3OA 2FS9A 1AKSA 1DX5M 2FWWA 1GBIA 1OXGA 1VITG 3PO1C 3FN8A 2BVSH 4ABEA 1WAYB 2KM0A 4ACAA 1PQAA 4Y71A 1AZ8A 4AX9H 3T28A 2KFWA 1FDPA 1C2EA 1NY22 3KCGH 3T27A 5F6MA 1V2OT 2WYGA 1E37B 1IHTH 1MKWK 5F03A 1RRKA 5J4QA 1AU8A 1ZMLA 5FPYA 1BHXF 4AFUA 3MU8A 4JYTA 2DUCA 4DIIH 1P2IA 3RXCA 4F4OC 2A7HA 4ISHH 4GSOA 4IC6A 1XUGA 1EB1H 4B73A 2LNCA 4BAOB 3IG6B 2PHBA 4AB9A 3BF6H 4DURA 4Q7YA 1IQIA 1TGSZ 3OAAD 4WMFA 4TT3D 1HAIH 2F9BH 1EOLA 3Q77A 2PKAA 4LXBH 2ZDMA 2ZIQH 3V3MA 3KYGA 4ZKRU 3SNEA 2BDHA 1FY3A 1SOTA 4FXGH 1DDJA 1INCA 1ELEE 1NRRH 1W0JD 3RC6A 1CHOF 3T62A 2ZU3A 3A85A 1DFPA 3F1SB 3NXPA 3PB1E 3BTQE 4AC9A 1ZTJA 1S85A 3W1EA 4K60A 2XC5A 2ZU4A 4AORA 1SGCA 1THSH 2NU4E 4B2CA 1GBLA 4TPYA 3ZVGA 1OWKA 1C9TA 1GI3A 2FOAA 1H8ED 4WJG2 2B0FA 4E05H 1IOEA 4I8JA 4X2VA 3RM2H 3ZVBA 2ANYA 3SV2H 2BD3A 1O33A 1O32A 2Q6DA 1LKBA 2KCPA 4I86A 1TOCB 8ESTE 1C5WB 3O8BA 6GCHF 5EJZA 1WSSH 3GDVA 1L4DA 3RC4A 1HAGE 1IQGA 3SGQE 1TFXA 4D9QA 1O30A 2GKVE 2I6QA 3GY3A 1CT4E 2W7SA 1P2QA 3DD2H 1D9IA 5DJ7A 4IMZA 4K1SA 3MQKC 2CF8H 2ANMH 2J92A 3P6ZB 2ZEBA 3FO8D 3KF2A 4LZ4B 1NFUA 2ZO3H 2QF5A 2ZDNA 3KQEA 1P2OA 4AGKA 1P3EA 4XDEA 2AERH 1P9UA 2CHAB 4TPIZ 5CHBA 5KECA 1BT7A 2I6SA 2UUJB 1DICA 1J17T 3ZZ7A 4AB8A 4Z1MD 2WPHS 3RDZA 1FJSA 3SW2B 2XC0A 3TJOA 4WWYA 2BQWB 1AWHB 1GMHG 3F2GA 4MNWA 5T1VA 2IPQX 2FLRH 1QBOA 1VITH 1RTFB 1GJ6A 3RXFA 1CSOE 5C94A 2ASUB 5BRRE 4Z6AH 2XW9A 2EQNA 4BNRA 4A1VA 3UOUA 3DHKH 1W0ZU 1AQ7A 3LJOA 8GCHG 1ORFA 1H9LB 3NPSA 4H6TA 3OEHD 1GI0A 3JZ1B 4I8LA 3QGJA 2B9LA 3VPKA 1THRH 2UWPA 3F9EA 3MMGA 1BCUH 2EY4C 3MOCA 1BTWA 3TGIE 2R3UA 1HPGA 2HVYB 2GZ9A 2HVXA 3ZYDA 2KZ4A 1PYTD 4WH8A 4JZFH 4RSPA 4D9RA 7ESTE 4CRCA 4CBNA 3M3VA 4Y10E 1EJMA 2BY5X 2ZFSA 3DFJA 2NU3E 1T8OA 1TGNA 2GT7A 3SHCH 5C1XA 3SUEA 3A7ZA 4TSFD 1BMLA 2CXVA 1TPOA 1UHBA 5LH8A 4NFFA 4QT8C 1BBRE 2CK3D 2VH6A 1DY8A 1W13U 3DUXH 2HGTH 3DT0H 1SGEE 3V13A 3SJOA 5B6OA 1NM6A 2FOBA 2VBCA 3RXIA 1XMNB 2R2WU 1V2VT 1GHAF 1ZMNA 3A7XA 3RXAA 1GMDF 4JYUH 3TJVA 1BB0B 2RA0A 2AMPA 6ESTA 4MNVA 2D2DA 1O3KA 1V2NT 4FETA 1ANDA 1MBQA 3PV5A 1S83A 1O2VA 1HB0B 2ZU1A 1SR5C 3OSYA 3KIDU 3S9BA 2FX4A 3PLPA 2ANWA 2JH6D 1NBME 2BLWA 1T8LA 2BY7X 4BAMB 2QF4A 1Z7KA 1DXPA 3M5OA 3U8RH 2OQUA 1LHCH 2JH0D 3F9GA 1AVWA 1MTUA 2WPJS 3U9AH 3QDZB 4CR5A 1LVMA 2Y5FA 1TPAE 4ZHAA 2GCHF 5F8XA 3M7TA 2F9VA 3RMLH 1JRSA 2BQ6B 3W95A 3GOVB 4FUBA 2ZI2H 2A45B 2O8UA 1ANCA 1EQ9A 2FXRA 3N7DA 1GI8B 5FBEA 3RXKA 1SI5H 5HGGA 5E0GA 1GVZA 1K1PA 3UNQA 1C5ZB 2ZCLP 1GDNA 2Z3DA 3SNAA 3HATH 3TITA 1O34A 1LMWB 1TBRH 5ESBA 2IJOB 2ALPA 4GCHG 4AFQA 4E7NA 4INKA 3UAIC 1LTOA 4UEHH 1OWEA 2QA9E 3TJNA 1S6LA 2ZFQH 2BLOA 5EODA 1GJ5H 4FUFA 1PPHE 1TMUH 5A09A 5JDUB 1W10U 3RXUA 4BAQB 3SYJA 3SU5A 2ZHQH 1TIOA 4ISLA 1TAWA 1B0FA 1YPLH 2HNTF 2W26A 9LPRA 2RFKC 5JPMH 4I8GA 2G8TA 3LKWA 1CU1A 4Y0YE 1C1OA 3UOPA 3PRBA 1GI2A 1TBQH 4Q7ZA 1PPBH 1FIZA 4UDWH 1P11E 2EI7A 2UWOA 3MU1A 2ALVA 3QWCH 1C1RA 1N8OC 3FP8E 3GYLB 2EEKA 1HIAB 1O2HA 2VIWA 4B76A 1TQ0B 4CRBA 3E0NB 1SB1H 3OE7D 1H1BA 1XVMA 1W14U 3SUGA 1SLWB 3SGBE 1YPJH 4NGAH 5FL7D 1YLDA 2XOKD 1BTHH 4BXWA 1EZSC 3EA7A 2XXLA 2FOFA 2ZGHA 2VIQA 3GY6A 4XSKU 4IGDA 1BMFD 2QE7D 4F55A 1GBTA 3GCNA 3NK8A 4M9FA 2ZG0H 3BN9A 1HYLA 1ZSKA 4WVPE 4XBDA 3FP6E 3EE0B 4OS6A 2KCYA 3F6UH 1A0LA 2AGIX 5EQQA 1JRTA 3S69A 3S7HB 4NFEA 1MKWH 5FCRA 2VIDA 1C2HA 1LHFH 4D7FA 3BEUA 1LKAA 3BTEE 2QY0B 5HIYA 4JK6A 1V2UT 4THNH 3P95A 1IQLA 2FYQA 2H2ZA 2OCVB 3TH2H 1HFDA 5K7RA 3A80A 2GZ8A 1O2KA 2VIPA 4KTCA 1AFQC 1GJDB 3MH6A 1M9UA 1IQNA 1QQ4A 3C27B 2LP6A 1RJXB 3MH5A 1DVAH 1FV9A 1ZPBA 3WWFA 1VITF 5EW2H 3UR9A 3FFGA 2UUYA 1ZTLA 3GY5A 1YM0A 3QLPH 1EPTA 3B9FH 1A46H 3VB7A 3RXMA 5L2YH 3TIUA 1GVLA 3VEQB 3BG4C 2ZF0H 2M2AA 4I31A 4Q7XA 1SGPE 2R2MB 3ATWA 5EPNA 3MH4A 1P9SA 3RXPA 4TYDA 1F7ZA 1P12E 3TNSA 3IITA 1BZXE 5CMXH 2G52A 3SNDA 3LDXH 1GJCB 2P59A 1EUFA 4MG3A 1OOKB 1C5UA 1DWCH 3RU4D 2AMQA 2BDIA 1LHDH 2XNIA 1D3TB 5TJXA 1CT0E 1CA0B 1ESTA 1OKXA 1GDQA 3ZVAA 1TRMA 2O9QA 5HM9A 1O3EA 4YOJA 1SGFA 5PTPA 1V2KT 1AMHA 2TGTA 1GMDG 2ZDAH 2BX3A 3F9HA 4FU7A 1B5GH 1FLEE 1NFYA 2ZC9H 3STJA 1EAUA 3GCTG 3TNTA 1E35B 1EFRD 1F0UA 1DXWA 1HGTH 1B0EA 1SOZA 2CF9H 4ZHMU 2BY8X 3VB4A 1KDQB 2Z9JA 2P8OC 1RFNA 2FI5E 1BTXA 1G30B 4MDSA 4B2AA 2Y6TA 1T8MA 4AN7A 1A5HA 3U1JB 1FNIA 2EA3A 1CHGA 1NFWA 1WTHD 3MYWA 1K28D 1PFXC 2P93A 1J16A 5FX5A 3KQBA 1QL8A 1W2KH 3DSPA 1XX9A 3LGUA 3GICB 5DKMA 3S9CA 5LGOA 3Q00A 4YLQH 4K5ZA 1XUKA 2GCHG 2H9HA 1AKSB 2G51A 3RXBA 1IHSH 2GTBA 3QUMP 1TMBH 1EAWA 1EJNA 2KX4A 4X1RU 1LCYA 1D3DB 3F2FA 3VB6A 3GCHB 3ZZ4A 1C4V2 2G4UA 1UVSH 1MMJN 5EXNA 4MLFB 2A5AA 1IQEA 1BQYA 1EXFA 2P95A 1C5RA 1TA6A 2BY6X 3N7OA 3PWCA 2Y7XA 2TIOA 2Z9IA 5CE1A 3U8OH 1TQ7B 3T2NA 1YPHC 1EASA 1T8NA 1VJ9U 3UUZA 4LZ1H 2GD4B 4YO9A 4SGAE 4YM9A 2H9TH 1Q2WA 1ZPZA 4XE4A 3K9XB 2FODA 3GY2A 3DA9B 1C1NA 3A7TA 2PKAB 3P8FA 2WZQA 1GJBB 4ABHA 1MBMA 2RA3A 2BDBA 2OXSA 1P02A 3EA9A 2FZZA 5LPEA 1WUNH 1TOMH 1TONA 2ZQ1A 4U30A 5FX6A 1FPCH 2BDCA 3Q3YA 3ZZ9A 4JCNA 1A1RA 1E1RD 1WQVH 4WMDA 2GV7A 1W7XH 3A81A 4BTIB 3MNBA 2J9NA 3LC3A 4ABGA 1G3CA 1D6WA 1E0FD 1C5QA 1NO9H 3A8DA 4JZDH 1QRZA 2F91A 3WY8A 1GBAA 1HJAB 1O2ZA 1P05A 4XFQA 3MI4A 5DPAA 1MH0A 2O8WA 1KXAA 1CT2E 4K1TA 4FUHA 5KEDA 1GHBF 1VKYA 3U1IB 2RDEA 2VJ1A 1P57B 1AI8H 4KTUA 3LU9B 4ISIH 1O3NA 1NU9A 4UD9H 1P01A 4FUJA 1MTNB 1ELFA 3OEED 3T29A 2G5VA 3LJJA 3GISB 1EATA 2FM2A 4A6LA 2K1QA 3CNRA 3SV8A 1WBGB 3BTKE 2BZAA 1C5OH 3A8BA 1DS2E 3ZVDA 3QTVH 4IN1A 4OS1A 2XWAA 3U28C 1YY3A 5C3NA 2YMSD 1C1SA 4X6PA 5A8XA 1OP8A 1FY8E 1KY9A 2Q6FA 3KQCA 3P8NA 3SQHE 1W8BH 1GGDB 1AFEH 2FOEA 1HAVA 5GPIB 1J14A 5ETXA 2PLXA 2WV9A 3S9AA 1TRNA 1YPKH 1L2EA 1ZMJA 3A89A 3BEFB 4JYVH 5GCHG 3A84A 1EP5A 2PKSB 1AE5A 4OS4A 2IJD1 1ZYOA 1L1GA 3GDSA 1C2GA 3AAUA 4B75A 1AVGH 3UPEA 6CHAB 3SU3A 1TB6H 1ESAA 1AVXA 1VGCB 2G00A 1AB9C 4O03A 2WPIS 3AK5A 4NSVA 1QNJA 2FIRH 2P3UB 1C5SA 2ZECA 2ZGBH 1Y3VA 4NA9H 1SL3A 1SFIA 4X6OA 3Q76A 2V35A 2ZGXH 4P02A 3NUMA 4K8YA 4NA7A 4RN6A 4JZIA 1DWBH 2W3IA 4P00A 3L6PA 1A3BH 4JK5A 1BBRH 2NU2E 2OQ5A 1WQSA 2W6ID 4MNXA 3SV6A 1P2NA 4ZHLU 4FU9A 4GCHF 2PUQH 3RU4T 4K8BA 2XBYA 2YNBA 1DWEH 1HBTH 3S7KB 1C2MA 4Y6DA 5C67A 1AZZA 2SGFE 5DP6A 5E0HA 1GCTC 1O5GH 4U01A 2HLDD 4LOYH 2FX6A 1P10A 1GG6B 1UHBB 1SBWA 2AMDA 2J5UA 3GS9A 4NG9H 1Y5AT 5DGJA 1SGQE 1TNIA 5GDSH 4ZXYH 2ZPRA 4R8TB 2F83A 1UCYE 5C17A 1T32A 1O5EH 4B6FA 3BIVH 1QFKH 5KGOA 1N1LA 5CHAC 2V3MA 3RXOA 3K6YA 4AOQA 4DW2U 1L1NA 1O2XA 1PPZA 3ZV9A 2FPZA 1BTPA 1V6DA 5C20A 2XNDD 5IK2D 1O2OA 3PM3A 1UTJA 2PSXA 3I29A 5A0CA 3G01A 2K8IA 1FMGA 1DLKB 1ZSJA 3LIWA 1BHXB 1YC0A 4RT0A 1TWXB 2JETB 4F48B 3SU0A 7GCHG 4YXWD 2ZDLA 3E0PB 2R9PA 1TALA 1QTFA 1BRCE 3MWIU 5E0JA 2ZTXA 1QY6A 1GBFA 5AVDA 1KXFA 1QURH 5L2ZH 1WV7H 3BSQA 1FY4A 2B7DH 2JIZD 2A2XH 5GNDA 2PGBB 1LQDB 3GDUA 1GMCF 1TNGA 1UTMA 3QK1A 4NWLA 4TY7A 1ZHRA 2YMSB 3KQ5A 1CVWH 1W0YH 1YCPK 4ESTE 1GL0E 2WPLS 2ZFTA 1LPGB 2BX4A 4O9VA 1S84A 1G36A 1QR3E 1BTYA 1KXBA 3RLYH 3NCLA 1EKBB 1GJ4H 1NRNH 1O2IA 1P03A 2BDAA 1Z1IA 5C0TA 2QXGA 5E2OA 1V2JT 1SSXA 2J97A 3IWMA 3L3TA 3O8DA 1C5TA 2A0QB 2ZFPH 5DP8A 4KGAA 1NPMA 1GBKA 1WU1A 5I46H 3OFND 3L33A 4HG6A 1FAXA 4X2XA 3M3SA 2AS9A 4WMEA 1YP9A 1T31A 3ZZCA 3UNRA 1TX7A 3VXFH 5EG4A 2GT8A 1BUIA 2L74A 1P06A 2Q1JA 3P8OA 5EQSA 1GHBG 1O5CB 3A83A 4B74A 1SQOA 1K21H 4DT4A 3K2UA 1T7CA 1K1MA 2C8YB 4X2YA 1C2FA 2BOKA 1QA0A 8KME2 3SBKA 3AW0A 3M5NA 1A3EH 5F8ZA 2WV5A 4FOUC 1GJAB 1UCYK 1HUTH 3UNSA 5LPRA 4MPUA 5CDFE 1MD8A 1O2JA 4YT6H 1Z8IB 3TK9A 2VVVA 3M61U 1QJ6B 3RXVA 5EPYA 3GY4A 3K6ZA 5EW1H 2QYIA 2FS8A 1KXDA 4ISOA 1JIRA 2IOTA 2WHXA 4NZLA 1ZHPA 3GCTF 1HXEH 1S82A
chains in the Genus database with same CATH topology
1Y3XA 3MTYA 1ANEA 2ZPSA 2QC2A 4BANB 2JETC 4CREA 4RKJB 1GBCA 2RCEA 4K2YA 1SGYE 4DG4A 2PW8H 4X6NA 1E36B 4I33A 3RXQA 3LT3A 3AW1A 1YPHE 1Q31A 4GUXA 1P3CA 1HAHH 1GHVH 1ZLRA 2ZKSA 2XYAA 1F0TA 2CHAC 4AFSA 4FUGA 2TGDA 1G3BA 4JZEH 3F0PA 4FUDA 4GVUA 1VZQH 2OBOA 1HAPH 4OS5A 4BTUB 1JMOH 1Y5BT 1MQ5A 1QHRB 3GCOA 3VB3A 5JBTA 1ABIH 3ZZ3A 1EPTB 3BTTE 3O8RA 2QF3A 2XCFA 4IW4E 1QJ7B 4DIHH 1HAOH 1F5KU 1BIOA 2GV6A 1S6HA 1V2QT 3FP7E 3LGYA 4B71A 1NBMD 1O3GA 3H5CB 3BEIB 2G5NA 2TGAA 1TNJA 1MTSA 3RXEA 4MTBA 2BQ7B 2ZU2A 1CBWB 2ZFRH 3ZVFA 4CHAB 1YYY1 1VCQA 1W3CA 4JZ1A 5DP5A 2QN5T 1MU8B 2H1UA 1XKAC 1GVKB 3ITIA 5E2PA 2XBWA 1LPKB 1NRSH 1OWDA 1BJUA 1UJ1A 5DP3A 4K69A 4H6SB 4SGBE 4Q63A 2WPKS 2ZQ2A 3PTBA 2F4LA 1TPPA 2GMTB 4UE7H 2ZHEH 1TLDA 1EB2A 3PMHB 1QRWA 1YPMH 2PTNA 4UFDH 3TPIZ 4YTAA 4Y8XA 1SQAA 2UUKB 1H9HE 3VFEA 4YT7H 3MNCA 2V3OH 2A7JA 3ZZ5A 1GI4A 1A61H 4NIWA 1ACBE 4D76A 1V2PT 5TCCA 1O35A 4X8VH 3VB5A 4AG1A 1O3MA 4AFZA 3FKSD 2KAIA 2ZHDA 3H7TA 4BAKB 1GJ9B 9ESTA 2PUXB 1H8IH 1UTOA 3T26A 1GBJA 3HK3B 4NIYA 1FUJA 1Z6EA 2STAE 1C5LH 3ZZDA 4AYYB 3WWBA 2Y81A 1O2RA 2BXUH 2RG3A 1D4PB 1QB6A 1C1UH 2W6JD 1O5BB 1GMCG 2G81E 1O2NA 4FU8A 1G3EA 2PV9B 2BD8A 1KTTB 4HZHA 2GZ7A 5C2ZA 4H42U 1V2MT 2VGCB 2DE8A 1A0JA 1LHGH 3RXTA 1GI9B 1SQTA 1GI7B 2V7QD 1FIWA 3N99A 4B1TA 1FY1A 5DP7A 1C5NH 3D23A 2V0BA 1ZZZA 2A5KA 2VIVA 1CO7E 3A87A 1ELCA 3MO3A 1EPTC 5E8EH 1AO5A 1ELBA 2BD2A 3QO6A 5JB8S 3RXLA 1CA8B 3TK5A 2V6NA 5T6DA 5DP9A 2ZA5A 2KCAA 2YNAA 2ZGJA 1BTZA 4FUCA 1SGIB 1OX1A 4MNYA 4Y79A 4Z0KA 5GCHF 3UIRA 4XBCA 1KXEA 1CBWC 1MTWA 3OYPA 5FPTA 4NZQA 4UFGH 1L1JA 1C1QA 3PV4A 2Y82A 1XUJA 2OUAA 4CRDA 4I32A 1G3DA 4CRAA 1LVOA 3VGCB 1QBVH 1J8AA 1S0QA 2ODYB 1QB9A 2R0KA 1O3AA 3SNBA 1N6YA 2XTTB 1TRYA 3F0OA 1O5FH 3GY7A 1A0HB 1MCVA 1IQHA 3QZRA 5HMAA 1F5LA 2NU1E 1Y59T 1PYTC 1Y3UA 1MQ6A 3SUFA 4CH2B 1GPZA 1YBWA 3UB0A 2C8WB 1QB1A 1GHYH 1GBBA 3R3GB 2OTVA 2J4IA 1CE5A 1UVTH 2A4RA 1Q3XA 1O2SA 1OP0A 4A92A 1O0DH 1F2SE 1NROH 1O39A 1RXPA 5C1UA 1O3JA 2GCTB 2WUCA 3V7TA 2C3SA 2A4GA 1OWHA 3I78A 1NRQH 2SGDE 2ZHFH 5K0HA 2IN2A 1QL9A 1S81A 1C2IA 2SGEE 3F9FA 3MU0A 1DLEA 4WXIA 5ESTE 1O2TA 1XM1A 2RDLA 1FXYA 3QZQA 5EU8A 1SMFE 3UY9A 2K0QA 3BTWE 4IN2A 1EAXA 1C1TA 1HAVB 2PGQB 5FBIA 2GGVB 7KMEH 3E6PH 1RGQA 3R0FA 8LPRA 2GDEH 1ID5H 4Y7BA 4DVAU 7GCHF 3WW7A 1U6QA 5F53A 1C4Y2 4ZH8A 4UONA 4XBBA 4X1PU 2OD3B 1THPB 2JJ2D 2L6OA 2SGAA 4IC5A 2A31A 3SORA 2VWNA 1ZHMA 3PO1B 4J2YB 1D6RA 4GAWA 4KTSA 1G32B 1O3HA 2C4FH 3ODFA 3SUDA 3M5MA 3O8CA 3TJUA 1O2UA 4VGCB 5A2MH 4JMYA 2GDDA 5EOKA 1PPEE 1P09A 1ZGVA 2FOMB 1EZQA 3RXRA 4A1XA 4X2WA 2FI4E 4ZXXH 3M35A 1D3QB 1RS0A 1QBNA 2EI6A 1GJ7B 3ATIA 3SOSA 4KELA 2R3YA 1UMAH 2AIPA 5L6NH 1LQEA 3M7UA 1UTQA 1MCTA 3CS7A 1MAYA 3SO3A 2PWXA 3UTUH 1ARBA 1ELGA 4UFEH 2F43B 2UWLA 1O3LA 3TH3H 1UTKA 3A7YA 3A88A 3KGPA 1OHHD 5BPEA 4X6MA 3P92A 3FAOA 1UCYH 2BVXH 1BRUP 3B8JA 1CA0C 1EP6A 3SN8A 3URCA 3MU4A 1H8DH 3UQOA 3TVJB 3A8AA 4WY3A 2P3TB 1DANH 1YF4A 5FXLA 1ZPCA 3H7OA 1QGFA 5F8TA 2OBQA 1GWAA 1KXCA 2FTMA 3TLOA 3T5FH 2Z3CA 2FDAA 3BTHE 1HJ9A 4ABJA 2VB0A 4B2BA 2H5DA 2WV4A 3PRDA 1QIXB 1C2KA 1A4WH 2HPQH 1AY6H 1FN8A 3SQEE 2J2UA 5G4BA 4K1EA 4ABDA 1C5MD 2GCTC 1ANBA 3ESTA 2AHME 3UWJH 3TU7H 1F92A 4ZMAH 1X7AC 3UQVA 1EZXC 2CN0H 4MPWA 4Y7AA 1GBHA 2Y80A 1S0RA 2W5EA 6LPRA 4FVDA 4LK4A 1YLCA 4CRFA 1Z1JA 1KSNA 2JKHA 1Y3YA 1MKXK 2BOHB 4ABAA 3SU2A 1IQKA 2H9EH 4ABIA 1NRPH 1ZJDA 3SZNA 4I8KA 2C93B 5IDKA 4PROA 4ZCNA 1XVOA 2W7UA 3A7VA 3LOXA 1C5VA 3BTME 2CV3A 3NWUA 2THFB 2H5CA 4Y8ZA 3ZV8A 3HKIB 3SJ8A 2VU8E 1C2LA 3GCHC 1HLTH 1O3PB 1Z8RA 2BY9X 2ZFFH 3OTPA 1O3FA 1C5PA 1OP2A 3DSOA 1TNLA 1H4WA 1O2YA 5DP4A 4B6EA 1ZRKA 2ZCHP 4Y0ZE 1G37A 4CR9A 4DY7B 3OX7U 4VGCC 1O31A 1WYKA 1WOFA 1XUIA 2Z6BD 3RP2A 4I8HA 2FESH 2PSYA 2SGQE 1P8VC 2ZDVH 3SU6A 3SV7A 1OYTH 3D65E 2BD4A 2OC1A 2NU0E 1TA2A 1A7SA 4X1QU 4BAHB 2AH4X 4ZKNU 3STIA 3F68H 4O97A 1OWIA 1UVOA 3UWIA 1P04A 4MQAA 3RMMH 1ZR0A 1UTPA 1GCDA 2WUBA 1VJAU 1O37A 2BD5A 3KQDA 2TPIZ 4AYVB 2JJ1D 2J38A 3BIUH 2A2QH 3ODDA 3ZYEA 3KEEA 2ULLA 5AFZH 2D26C 4INLA 2F9UA 3ATKA 2P3FH 1PPFE 3RLWH 1HJAC 5SGAE 1H8HD 4WXVA 1TGCA 4YESB 4E06H 4FUIA 3URDA 2HALA 1HXFH 1O2QA 4GHQA 5T6FA 1HJ8A 1ZRBA 3QTOH 2BZ6H 1JOUB 2A4QA 4WH6A 1MTNC 1GBDA 3LC5A 1O2MA 5FPSA 4NCYA 3I77A 1GHXH 1RIWB 3UFAA 3SZEA 1BMAA 1EX3A 5HKKD 1JXPA 5C0UA 1VCWA 5J4SA 3EQ0H 5A8YA 1EJAA 1FY5A 1ZSLA 1MZDA 4U32A 2G55A 1RTLA 1TE0A 5T3HA 1C1PA 1E38B 3E91A 2HWLB 3ELAH 1SGNE 2J34A 1COWD 2QXIA 2ZTYA 1FN6A 1K1LA 1DM4B 1Y5UT 1UO6A 1NS3A 1O3IA 4ASUD 1FX0B 1DT2A 5AF9H 2EI8A 1GGDC 4MPXA 4AZ2B 2FP7B 4X1NU 3P70B 1A5GH 1NESE 2QXJA 1BRAA 1C5YB 1C1WH 3RXJA 3PMJA 2ZPQA 5IYTA 1O38A 2VH0A 2BD7A 4NSYA 1TNKA 2PKSC 1UTNA 1PQ7A 1TGBA 3PLBA 5I25A 2SNVA 2BHGA 6CHAC 3HGPA 5AFYH 1VGCC 4DGJA 5EXMA 3LONA 2WINI 2FI3E 1K1OA 2FTLE 2JH5D 1GBMA 4CRGA 2CGAA 2PFEA 1WXRA 2FOCA 3KL6A 1ZJKA 2P94A 4TY6A 4IBLH 2FOHA 2OINA 3FVFB 1GDUA 1WTGH 2WPMS 1ELAA 1FQ3A 3BV9B 1LO6A 2OLGA 1IQFA 2Z7FE 3A86A 4WF8A 2O8MA 1HCGA 2FYRA 1NN6A 1O36A 1XXDA 1LPZB 2F3CE 2Y5HA 1BITA 2KCOA 4A7IB 1OYQA 1E34B 3E1XB 3OY6U 1OPHB 1GG6C 1QL7A 3QN7A 5JBBS 4GPGA 1L4ZA 5GWZA 1YCPM 1AIXH 3ZVCA 3SI3H 3BTDE 1LVBA 4Y76A 1DSUA 3LGWA 5JB9S 4CBOA 2Z9GA 4KP0A 2KAIB 2BDYA 3U98H 3BG8A 3EA8A 1SHYA 3MO6A 1BMNH 3EGKH 3BTFE 3GYMA 3MHWU 2VINA 1HRTH 1JWTA 3SV9A 4U2WA 1BTUA 2GX4A 2A5IA 4DT7B 3SJ9A 2HLCA 1EZUC 1Y8TA 1ABJH 3LGTA 3ZVEA 1GL1A 1KIGH 1P2KA 4HFPB 1RIWC 4E7RG 1XKBC 2D1JA 2QV1A 2UUFB 1N8OB 1AGJA 1TMTH 2BM2A 1CQQA 3UR6A 3AVZA 2BVRH 1OS8A 1NFXA 3HK6B 3AASA 5H4IB 1BA8B 1FI8A 1KTSB 1B7XB 1K1JA 4FVBA 2HNTE 3RUOA 4ABFA 2Y5GA 1GJ8B 2F9NA 1DPOA 2FOGA 3T25A 1KLIH 1V2RT 4Q80A 1TX6A 4NIVA 2Z9KA 2WSSD 5C5OA 3RXHA 2YMSC 3RM0H 3QX5H 1G2LA 5T6GA 2BB4A 1K9OE 2ZNKH 4ZROA 2VWMA 2AGEX 1NZQH 1L0ZA 1DUAA 2ZDKA 4YLUA 1MD7A 1VCPA 1TPSA 1ESBA 3CENA 2AIQA 3ZIAD 3F2HA 1A2CH 2C90B 3JZ2B 4ISNA 1C2JA 2VVUA 2B8OH 3MU5A 1D3PB 5FAHA 2FEQH 4ZUHA 3P17H 5A8ZA 2HOBA 4TWYA 3HGNA 4AGJA 1JBUH 5AHGH 1AFQB 3LGIA 4ASHA 4CH8B 3U69H 2FMJA 4Q2KA 1RD3B 4NA8A 1V2LT 2HRVA 1ETSH 3LH3A 3RXGA 2A1DB 4MPVA 2ODPA 4Y8YA 2F9OA 2ZTZA 2BDGA 1G9IE 2D8WA 3F3BA 1F0RA 2BLQA 2VVCA 2TGPZ 4ZKOU 1LVYA 3BG4B 3PWBA 3KHVA 4DCDA 3M37A 1CHOG 2QGRA 1HNEE 1QJ1B 4X0WU 2A7CA 1E79D 1OWJA 3MNSA 2LELA 3FZDA 1O5AB 1O2PA 2CMYA 1PQ8A 1ZTKA 4Q4LA 2O8TA 2R0LA 1AE8H 3PLKA 1ELDE 3U8TH 2VIOA 4ZKSU 4OS7A 3QGNB 2NWNA 3LPRA 2F9PA 2PR3A 1K22H 3A82A 1H9IE 6GCHG 1YPEH 1S5SA 1YPGH 3P8GA 5EXLA 1MKXH 2XBXA 1V2ST 1BBRK 1AHTH 1BDAA 1TBZH 2BYAX 3VG8A 1AN1E 4ZAEA 1T4UH 2W3KA 4X8SH 1BJVA 1C9PA 3RXSA 2WPDD 4INHA 2EC9H 1V2TT 4AG2A 1WCZA 4BOHA 2BLVA 4X8UH 4NWKA 3MH7A 3V0XA 1SLVB 4YOGA 2P8OB 1ETRH 1P2MA 1SG8B 1SLUB 2BTCE 4XOJA 1O2GH 5GIBA 1FZZA 3BTGE 1C5XB 3TGJE 5GXPA 4HI3A 2XBVA 1SFQB 2AGGX 2VNTA 4RI0A 4X1SU 1G2MA 1C1VH 3OU0A 3DCLA 1CGJE 3EYDA 1MABB 3CP7A 4D8NA 1SLXB 2A32A 3V12A 4A5TS 3KNXA 1CGHA 3DFLA 1TX8A 2PTCE 4TWWA 1LHEH 4I7YH 2VWLA 1C2DA 1Z6JH 2BMGB 5LPFA 4IS5A 3NKKA 2ANKH 4OGXA 3KN2A 3PMAB 4A1TA 3TH4H 3FZZA 2QF0A 1CGIE 2QXHA 4CHAC 2JDID 2SNWA 1DUEA 1ARCA 2OK5A 2BXTH 4YOIA 4OM9A 1O3CA 3RU4E 3MFJA 3LH1A 3TGKE 1DSTA 4O3TA 1HAYB 4OGYA 1HAZB 3ATMA 4OS2A 3SJIA 1P2JA 1HDTH 2STBE 2FLBH 2ZZUH 2G4TA 3MO9A 4BTTB 1ZGIA 2ODQA 4YZUA 2Q6GA 1SVPA 1UK4A 2GMTC 1VR1H 1NT1A 3PTNA 5JYIA 1SPJA 3A8CA 1SGRE 1O2WA 1SC8U 3E8LA 1S6FA 1UVPA 1GBEA 1P0SH 4MVNA 1OSSA 2BD9A 1Z8JB 2IPHA 2AFQB 1DITH 2FO9A 4KKDA 3GY8A 5C5NA 1O2LA 4UFFH 5EQRA 3SNCA 1AD8H 4ABBA 1DOJA 5ABWA 1KMHB 3M36A 1C4U2 4GLYA 1O3BA 3E3TA 3TK6A 2CJIA 1K1IA 3SHAH 2OC8A 5B6LA 2AEIH 1NTPA 3Q3XA 3SGAE 3E16B 1GHAG 1TGTA 3EDXB 5L30H 3SU4A 1EAIA 3C1KA 1SGTA 1FPHH 3K65B 1EOJA 2ESTE 3PROA 1GHWH 1SGFG 1KLJH 1MZAA 1A5IA 1HIAA 1LDTT 1XUHA 4K3JA 3UREA 2HPPH 3RMNH 2KR7A 2O8LA 4M7GA 3H09A 7LPRA 1PPGE 2TRMA 1YKTA 2QCYA 2VGCC 3FOAA 2H6MA