2VIDA

Serine protease splb from staphylococcus aureus at 1.8a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
199
Chain Sequence
ENNVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVDNRNAYGVYFTPEIKKFIAENIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymatic Activity of the Staphylococcus Aureus Splb Serine Protease is Induced by Substrates Containing the Sequence Trp-Glu-Leu-Gln.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords SERINE PROTEASE SPLB
total genus 56
structure length 199
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vidA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vidA02
1O3CA 1A2CH 3FAOA 2QY0B 1O35A 1Y59T 1SGYE 1OXGA 1O33A 1DWBH 2A0QB 2GTBA 1PFXC 1CGIE 4JZEH 1N8OB 1XUGA 1QBVH 1C1TA 2WPLS 4IC6A 4XSKU 4BNRA 4D8NA 1BMMH 1ANEA 2A5AA 3ZZAA 5ABWA 1AZ8A 3LH3A 1O3IA 3O8DA 2ZNKH 3WY8A 3UTUH 3EAJA 3EYDA 4WH6A 4BTTB 1V2LT 3URDA 1Z8GA 4NA8A 1SI5H 3BF6H 3D49H 1K28D 1AQ7A 3RXVA 2BLQA 4U01A 1CGJE 1YM0A 1O2IA 1SPJA 1TNLA 2Z6BD 2G4UA 4DGJA 2PWXA 3MH5A 3S7KB 2A32A 2TBSA 3OU0A 4K69A 2WUCA 3MI4A 4X0WU 3RMOH 1TGTA 1O5GH 4UFEH 2OP9A 4IC5A 3MU8A 5EGMA 2R3UA 2FOEA 2FTLE 5EPNA 5K0HA 2BB4A 5A8ZA 1T8OA 3OX7U 2HLCA 1LPKB 1SLUB 2ZP0H 4Y71A 4OS1A 1TA6A 4X6PA 2AMQA 1AIXH 1TBRH 1Z8RA 2TPIZ 1VITH 1C1PA 4IS5A 1ZRKA 2SGFE 1CQQA 4MDSA 3KN2A 2QF0A 5A2MH 1DS2E 1GI3A 1MBQA 1RXPA 2V0BA 3STJA 1W13U 1LO6A 5LPRA 2WINI 5EOKA 3DT0H 8GCHG 4KTUA 4ASHA 2ALVA 3OSYA 2AMDA 1O37A 1G2LA 3M7TA 4B2BA 3O8RA 1P05A 4DG4A 2XC4A 3T5FH 3SUGA 1THPB 2ZO3H 3TJVA 1O38A 4CRCA 1IQFA 5F8TA 3RXLA 1O2PA 2XWAA 2ZWLH 1ZOMA 3LIWA 5FX6A 4X2WA 1ELCA 4M7GA 4MNXA 1U6QA 2GGVB 1NY22 5FBIA 1TA2A 1J16A 1BDAA 3M5LA 4JK6A 1ETRH 2ZU3A 3PM3A 4UEHH 2ANWA 2GCHG 3GCHC 4X6NA 1EJMA 1W3CA 4IN1A 2FS9A 3FZDA 1A4WH 5E2PA 3T28A 2FI3E 1ZJKA 2NWNA 1NU9A 3OTJE 1H4WA 2BD8A 4ZROA 1E37B 5EW1H 1TABE 1UK3A 2IN2A 1HLTH 4LZ1H 4DJZB 1AFEH 1HAPH 1ZJDA 3RUOA 2BD4A 3SORA 3S9CA 2GV6A 2HNTC 1THSH 2HALA 5IYTA 4ZHAA 5LGOA 1HUTH 3ODDA 5T6GA 2HOBA 4MLFB 1UHBA 5GIBA 3GCNA 3GY8A 2XBXA 2WPIS 3SV9A 2UUJB 2F9PA 4K1SA 4MPXA 3A7ZA 1Z8JB 5DP9A 4A92A 2ZHWH 6GCHF 1HFDA 1NRRH 1SGQE 2NU4E 1TE0A 4Y76A 1UTKA 1BB0B 3RXUA 3Q00A 2ZZUH 3SU0A 3ZVEA 2O9QA 4CH8B 5ETXA 1YPJH 2JH5D 2TGTA 4WH8A 1SLVB 1KIGH 3KIDU 2F3CE 2SGEE 3ZZ5A 2P3TB 3UR6A 2BQ7B 5JB8S 1EAXA 1TONA 4TWWA 1MTNB 1L2EA 2ODYB 2BLOA 3W95A 2BTCE 1A46H 1GJDB 3ZVCA 1IHSH 1KTTB 4NFFA 1C1WH 3JZ2B 4NFEA 1D6RA 2M5TA 1HAHH 2VVVA 1UCYK 2UWLA 1KXEA 3TGIE 2ZPRA 1PPEE 3ZVAA 3TH3H 1QTFA 2J4IA 4E7RG 1NZQH 5I46H 1CHOF 3CENA 3D62A 5IDKA 3RXKA 2AH4X 3MTYA 3TGJE 3UOUA 1O2NA 5T3HA 4MNVA 1P09A 1GBEA 1O3KA 1Z8IB 2BY5X 2FOAA 2VINA 3U1IB 1WBGB 1HYLA 4ZUHA 1V2QT 1MTSA 3HKJB 2IJOB 1BMNH 2ZFRH 1ACBE 1S6FA 3LGYA 2UUFB 2H2ZA 1J15A 3RXQA 7LPRA 1AE8H 1N6YA 1OX1A 3UWJH 5CMXH 1UJ1A 4MG3A 3UIRA 2DUCA 5L6NH 1ZSKA 1P2QA 4GAWA 2GVFA 2GZ7A 1PYTD 1EZSC 1K2I1 3S0NA 3QGNB 1KXFA 3DFLA 2C8YB 1P2KA 2VWOA 4RKOB 1WCZA 3M35A 1ZZZA 4TWYA 2R2WU 3IWMA 1L0ZA 1TRMA 4Y8ZA 2TGAA 5EQSA 1ARCA 1Y5BT 3QX5H 1O3OA 3TPIZ 3PLPA 3RU4T 3LGVA 1FXYA 1G3CA 3RLYH 1BTZA 5TCCA 1P01A 1GBTA 1AB9C 2ZKSA 3M5MA 5EG4A 1EP6A 2PKSC 1VZQH 2PTNA 3SUFA 1QBNA 1SR5C 3RXPA 3RXRA 1QJ1B 1UO6A 2EEKA 3V7TA 1O2OA 5T6FA 4CR5A 3GCHB 4D7GA 3A8DA 1SGFG 4KGAA 1D3QB 1GJ5H 1T32A 3A7WA 1AD8H 1JRSA 1S5SA 2HRVA 1EZUC 2FX6A 2PGQB 1C5YB 3B8JA 1BMLA 1P2JA 1HAOH 2BX3A 5GPIB 4YT7H 3SGBE 3HK6B 5CHAB 5FPSA 4NWLA 2OINA 2UUYA 1EPTB 3QZQA 1EKBB 1NRNH 4AFZA 3RU4D 4NIWA 1TGNA 1AZZA 2XNIA 5F6MA 1QJ6B 2WPJS 1GMCG 1QFKH 4NSYA 7GCHF 1ZHMA 1ELTA 3NPSA 3KEEA 1C1NA 1CHOG 3BTME 4ZKRU 5L2ZH 3Q77A 2XC5A 3GY2A 1W7XH 1GBJA 1A7SA 2FI4E 3QLPH 1CHGA 1H9IE 2YOLA 5LH8A 2ANMH 3AW1A 1Q31A 1J17T 2BX4A 2WPKS 1NT1A 1TPAE 2R0LA 2AGIX 1ETSH 4KELA 1WYKA 1ESTA 1MTNC 3VEQB 3VB7A 3RXDA 2AS9A 2J92A 2IOTA 1Q2WA 5FX5A 3TIUA 3SU3A 4AX9H 2BD5A 1B0EA 1BRBE 3K6YA 1SOTA 4Y0YE 5HMAA 1ZYOA 3BTQE 1TMTH 1MKWH 1W8BH 5CHAC 1LHEH 2QGRA 4VGCC 3BIVH 2EA3A 2BZ6H 2CV3A 1ID5H 3NWUA 2QCYA 1V2PT 1TB6H 1GHVH 1T8LA 3SUDA 1DFPA 2CGAA 1VJ9U 4BANB 3PMJA 1LKAA 2ZU4A 1C5TA 4AN7A 1QB6A 3QDZB 1P8VC 2Z3DA 3ZVFA 3O8BA 1NPMA 5C1UA 1UMAH 1DUEA 1C2IA 1ELAA 5I25A 1AWFH 3SV2H 1HIAA 1CSOE 3MO3A 4RKJB 1UVPA 1FONA 1WAYB 3MHWU 4ABHA 3LDXH 2IPHA 3VXEH 1S0QA 4CH2B 1UTPA 1A5HA 3GDVA 2UWPA 3SJIA 2HNTE 2A7CA 3GCOA 1TYNA 4K8BA 2OTVA 3P8OA 1BRUP 4GSOA 2P16A 4CRDA 4BTIB 5DP6A 2C3SA 5FBEA 4WXVA 2AERH 1Y3UA 2FMJA 4AGKA 6LPRA 1UTMA 1FV9A 4JYTA 4WF8A 4YTAA 2NU1E 2FYQA 1SFQB 3PTBA 2ZDKA 1GHAG 1TRNA 1OWIA 4OS5A 4GHQA 4CR9A 1C2FA 1OS8A 2A2QH 1ANDA 5FCKA 1YF4A 5HM9A 3BV9B 1V2UT 1MQ5A 4WJG2 2PUXB 1AMHA 4AYVB 2ANKH 1ELVA 1W12U 1KLIH 1K9OE 1HJ9A 1TGSZ 1MCVA 4X1NU 1EZXC 5DGJA 2H5DA 1BMAA 1QB9A 4Q2KA 1HCGA 1AUTC 1RFNA 3HK3B 3UUZA 3BEFB 1RIWB 2STAE 1JOUB 4XE4A 1V2MT 5A0CA 1S0RA 4WY3A 5E0GA 2SNVA 3PV4A 3ATIA 4WXIA 1QJ7B 3SNCA 1EPTC 2BLWA 2VWMA 4B2CA 4B74A 1K22H 2VVCA 1CT4E 1O3JA 2P59A 1IQJA 1NFXA 4ABDA 4DIHH 1Z71A 1KDQA 3BG4C 2XXLA 3LOXA 2Y7ZA 3BG4B 4MTBA 5HM2A 1H1BA 1TAWA 2STBE 1TPPA 2ULLA 1BTUA 3TK5A 1GL0E 4X6MA 1BTWA 1DT2A 4D7FA 1SLXB 5A09A 4Q7YA 2FLBH 3A8BA 3TNTA 1S85A 5C1XA 1T4VH 3TH2H 4JZ1A 2FM2A 2XCFA 1MQ6A 3KNXA 4X2YA 3T29A 1AVXA 2QAAA 2ZTXA 2G52A 4FVDA 3ATKA 4D76A 1S83A 4WVPE 3MU5A 4Y7AA 1DANH 1QB1A 2ZDNA 4SGBE 2R2MB 1NN6A 2VU8E 3QUMP 2G8TA 3A7TA 1IAUA 5FXLA 1EXFA 1C1MA 1P03A 2NU0E 1KXCA 1J9CH 2FI5E 4TPIZ 1CBWC 1VITF 5C1YA 2VIPA 5DJ7A 5C20A 2VIDA 3VB6A 1O2VA 2HNTF 3L33A 2RA3A 3LPRA 1O2WA 1YPHC 1UCYE 1GMHF 3KQDA 2HVXA 3DHKH 1TBQH 3SUEA 1K1JA 3BSQA 1QRXA 1TNIA 3U8RH 4X6OA 4CHAC 2CHAB 1P9UA 2J9NA 3GY3A 1BIOA 4B71A 1VJAU 1SGNE 2FEQH 2Y7XA 1C5XB 4R0IA 1C1SA 3ZYDA 4R8TB 1C4Y2 4TY6A 3ZZDA 1C5SA 1YP9A 1QY6A 1S6HA 1SGEE 4THNH 4UFGH 3LU9B 4ISNA 4JZFH 3ENSB 1ZGVA 1F0SA 2XCNA 3M7UA 1WQVH 3PWCA 5EXNA 1HAGE 1O2QA 1OPHB 1SQAA 1V2ST 2V3OH 1SB1H 3M5NA 1MKWK 1SG8B 1HJAB 1PQ7A 2VVUA 1XX9A 1K1OA 1SGRE 1O2HA 1OYTH 1HJAC 1ZMLA 1Y3XA 3SU1A 1F0TA 1ESBA 5JBTA 3SGQE 1OWHA 2Z9JA 2B8OH 2AGEX 1GJ6A 3FFGA 1LPZB 2SGAA 3QTVH 3SU5A 1P3CA 1RTLA 1OP0A 1V2OT 2O8LA 4HGCA 4O9VA 1CO7E 2B9LA 3A89A 1Y5UT 1GJ9B 1QA0A 1EB2A 4A1TA 1VCPA 1SGDE 1CE5A 4Z0KA 2FIRH 1C2LA 1MMJN 1H8DH 2JKHA 1UVSH 1N1LA 1Q3XA 4AB8A 1RGQA 2R3YA 3A82A 2R0KA 2OCVB 3P8FA 2EI8A 2ZHFH 3SW2B 1AGJA 1WQSA 2GD4B 4AYYB 4ISOA 5K7RA 3Q3XA 4ESTE 1UK4A 8LPRA 4A5TS 1D6WA 9ESTA 1IQGA 3RM2H 1XUFA 2WUBA 4YZUA 3TH4H 2FOMB 1YCPK 3QK1A 1DLKB 3QGJA 1AKSA 3U69H 1PPHE 3DFJA 2SNWA 3L3TA 1GDQA 2PV9B 5FCRA 3EA9A 1YYY1 3PMHB 2P3FH 7ESTE 3SV6A 4XBDA 1XVOA 1W2KH 1GCTC 2H5CA 5BPEA 3I78A 1P57B 3ZV8A 3TU7H 4DCDA 1XVMA 4FUFA 2TGPZ 3UR9A 1GBIA 4FU9A 1LHCH 3TJNA 1GJ7B 2V35A 1G36A 1UK2A 2ZECA 1VR1H 2PKAA 1Y5AT 1EAUA 1B7XB 1O2KA 3GCTG 3KQCA 2GDDA 1V2TT 2BDBA 3OY6U 3SJ8A 3I29A 1YPMH 2WV4A 1C9TA 3V12A 1EJAA 2A5IA 1XKAC 1FY3A 5A8YA 1QQUA 1SGIB 3SBKA 4LXBH 3EGKH 2FWWA 5EPYA 1SGFA 1QURH 1D4PB 2AYWA 3L6PA 5EQRA 1W11U 1GBKA 3URCA 3MYWA 4I8KA 1NU7B 2VWLA 1KLTA 3UNQA 1FIWA 1SVPA 4GUXA 3D23A 3UNSA 4E7NA 1IQNA 4X8UH 1C5QA 1LHGH 1O2GH 1WTGH 4X1SU 4GPGA 2XW9A 3LGWA 2A4RA 3DA9B 3U9AH 2AFQB 3FVFB 1GI4A 1BHXF 3D65E 5G4BA 3TGKE 2Y5FA 3B9FH 1B5GH 3ZVDA 3F9FA 2H1UA 5HXFA 3A85A 1O3PB 4ISIH 4TPYA 3RMLH 4CREA 1C5LH 2VIVA 4AORA 1Y3VA 1TNJA 2QC2A 4X8VH 1MD8A 1DVAH 2GKVE 4HFPB 4J1YA 1GMDF 3RXBA 3A87A 1UCYH 2TIOA 1C1UH 5C3NA 4OGYA 1IQEA 1HV7A 3MO9A 3A8AA 4TY7A 2VWNA 3ZZ8A 3TJOA 1DWEH 1K1NA 3V0XA 2ZGBH 3RXEA 2ZDVH 4FUHA 6CHAB 1LVOA 2I6SA 1GI2A 8KME2 1TQ0B 1C2HA 2G55A 1QA7A 2OBQA 2OBOA 3U98H 3E16B 2AIPA 3E0PB 1OKXA 4IMQA 2QXHA 1GBHA 1HDTH 3SNBA 1GBBA 1FY1A 1GHAF 4DW2U 1QL7A 1OP2A 1O31A 5DO4H 1K1PA 1HAVB 2OQ5A 3NK8A 5DKMA 4AFSA 1TBZH 4HZHA 1KYNA 1VCQA 3QO6A 3IITA 4BXSA 4Y0ZE 4YM9A 4YO9A 1ABIH 2ZI2H 3U8OH 1HIAB 1J8AA 5E0HA 1GGDC 1ANBA 3CS0A 3FANA 1C5MD 5A0AE 2ZCKP 1SGTA 1HBTH 4AG1A 1GJBB 1QRZA 1GHWH 3OY5U 2RDLA 4JZDH 4X1RU 2Z3EA 3M36A 1GI7B 1O34A 2AGGX 2BM2A 2FPZA 3MU1A 1MU8B 1DY8A 3VB3A 3GDUA 1DICA 1X7AC 3AVZA 3NXPA 1S82A 4QT8C 1DWCH 1KSNA 1WTHD 1TMUH 1O3BA 3U1JB 1MBMA 1PJPA 3A80A 4Q7ZA 2P95A 2P3UB 1O2YA 3FP7E 3GY4A 3EE0B 2UWOA 1PPGE 3T27A 5ESBA 2P93A 1W7GH 4ZAEA 3OYPA 1K1LA 1KXBA 5AHGH 1THRH 3NZIA 4JYVH 2Z94A 4UE7H 3PMBB 1YC0A 1QIXB 1BZXE 4JCNA 2FS8A 4CBNA 1PPFE 1GHZA 1ZTLA 1CA0C 1GVLA 1O30A 2Q1JA 3EA8A 1JWTA 2FX4A 1WOFA 3R0FA 4UD9H 4NZQA 1IQIA 1P3EA 1BTYA 2NU2E 3CS7A 4AG2A 1EOLA 3UQOA 2CMYA 2ZGCA 3KGPA 3SNAA 3BEIB 3RXAA 3ZZCA 2A4OA 3BN9A 4RN6A 4X8SH 1CBWB 2BOKA 1XMNB 1GHYH 1A0JA 2A45B 1V2WT 3SQEE 4AB9A 5GDSH 1MTWA 1UTQA 1BUIA 4FVBA 5GCHG 1BQYA 1PPBH 5AVDA 8GCHF 1L1GA 4I32A 5H4IB 3GYMA 1O5AB 6GCHG 1AFQC 4OGXA 1XUHA 3MH7A 1Y3YA 1GGDB 2A4QA 2ZTYA 2A4GA 1HPGA 1CA0B 1KLJH 1E38B 5HYOA 5AF9H 3VB4A 4U32A 1AE5A 5E8EH 2WYGA 1PQAA 1E34B 1MAYA 1TX8A 1GBMA 2HPPH 3S7HB 2Z9GA 4HTCH 4ISLA 3NKKA 3E3TA 6CHAC 4JK5A 1UHBB 1GI1A 1OYQA 2Z3CA 1HAIH 2PGBB 3MH4A 2ZQ2A 1BBRH 2CN0H 3PYHA 2CF9H 2C8ZB 1G3BA 2ZG0H 4ABFA 2O8TA 5JPMH 2BMGB 2QYIA 4IN2A 5SGAE 3MNBA 1DSUA 1GVKB 2FO9A 1W0ZU 2F9UA 4CBOA 3MH6A 1ZHRA 1JRTA 2XYAA 4K60A 3MO6A 1GG6B 1ZHPA 1O3GA 1AY6H 1C4U2 2OC0A 2OD3B 2ZTZA 2BHGA 2Z9LA 2GCTB 1EQ9A 3LONA 4H4FA 1D3PB 1S84A 3BEUA 1O2TA 3H5CB 3UQVA 1C5ZB 4BAKB 1ZTKA 2ESTE 3LGTA 1MZAA 3MMGA 1L1NA 2BDYA 1OP8A 1FQ3A 3UOPA 1SC8U 3E91A 3TK6A 4OS7A 1YKTA 1GMHG 2D1JA 4I8JA 4OS2A 3SGAE 1DSTA 3JZ1B 4NGAH 1O2JA 1T7CA 1O5CB 4BAQB 5F03A 1P10A 1F5KU 1MTVA 3ZZ6A 3IG6B 1INCA 1KY9A 5JBCS 4Y8YA 1XXFA 3E0NB 1O2SA 1OWJA 1UVUH 2CF8H 5GXPA 1V6DA 2PLXA 2ZEBA 2ZF0H 2Y80A 5EQQA 2ANYA 3NCLA 1AFQB 3M5OA 1C1RA 3HKIB 4B76A 1O2RA 1VCWA 2TGDA 3CP7A 4MNYA 5FAHA 2B5TB 2V3HH 3EQ0H 4YLUA 3M37A 1FMGA 1JMOH 2Z9IA 3BG8A 4NSVA 4E05H 5FPTA 2F9VA 4K3JA 1EASA 4ZXXH 3RC5A 1LCYA 4YOJA 3AASA 3A86A 1CT0E 2ZC9H 1V3XA 1UTOA 2ZU1A 1AWHB 1ZR0A 2BQ6B 4E06H 2YNAA 5L2YH 3BTHE 1BBRK 1G30B 1PPZA 2A5KA 1LVYA 1H8IH 1ZSJA 1TLDA 1LHDH 4Q80A 3E6PH 3V3MA 4YOGA 4IMZA 2JETC 1BJVA 1BHXB 1TX7A 1ELBA 1VGCC 2J38A 4WMEA 3RXHA 1DOJA 4GCHG 1PQ5A 1OSSA 1GBDA 1ELDE 2ZA5A 5ESTE 2Y5HA 1LPGB 1QHRB 1SLWB 2A7HA 4H6TA 1N8OC 4F4OC 4K2YA 2C93B 1CA8B 3ZZ9A 4FU8A 1XUJA 2V6NA 1O3DA 4Y8XA 1P9SA 3VB5A 2QA9E 4CRFA 1NC6A 3ATWA 3F9HA 4D9RA 4XOJA 4DOQA 5E0JA 1O0DH 1GBAA 3MWIU 3UWIA 1TGCA 1FNIA 3AAUA 1DXWA 3ATMA 2C90B 2NU3E 1PYTC 2VJ1A 1HGTH 3H7TA 1IQMA 2GV7A 4FUGA 1A3BH 2XTTB 5FHTA 5JBAS 3VGCC 4BXWA 1SHHB 4ABAA 2OQUA 1G3EA 4CRAA 4WWYA 1FAXA 3A84A 1GBLA 5EODA 2FODA 2TRMA 5FPYA 4X2VA 1D3DB 1O36A 3BTKE 2PFEA 2ZPSA 3PMAB 1EZQA 1JXPA 4A7IB 2VIWA 3RXCA 1LQDB 4INHA 2BXTH 4ZKSU 1UTLM 1Z7KA 3LC5A 1F5LA 2BVSH 1JIMA 1FUJA 4DY7B 2SGQE 1V2RT 3ZZ3A 4IGDA 1H9HE 2CHAC 3RC4A 3U8TH 4NIYA 3H7OA 2DE8A 1BOQA 1ZPZA 1MZDA 5L30H 1TFXA 5F8ZA 1DITH 1GI6A 5JB9S 1MH0A 5BRRE 4UONA 1FPCH 4B73A 4Z6AH 5DP4A 2C4FH 1EB1H 4K1EA 1NESE 1SBWA 2QN5T 3ATLA 2W7UA 3SQHE 2FDAA 3FP8E 2G81E 1GCDA 2SGPE 4GCHF 3RMMH 1EP5A 1UTNA 5F8XA 1RJXB 1DY9A 3P17H 3P8GA 1SGPE 3K65B 3PLBA 2ZGXH 4NWKA 2BD7A 1SOZA 3SHCH 5AFZH 4BTUB 1RS0A 4K5ZA 3SU2A 3P95A 2VGCC 1LQEA 1FLEE 1O32A 4IBLH 3LH1A 4DT7B 1W10U 3S9BA 1AB9B 1GHBF 4ZHMU 1DWDH 1M9UA 3QN7A 1ZMNA 4ABGA 1EOJA 3SJ9A 2ZU5A 1O3HA 4RSPA 1AHTH 2Y81A 3GYLB 1DM4B 2BYAX 1KXAA 3QZRA 3GOVB 1KXDA 1FY8E 1BCUH 1Z6EA 2ZHEH 3ZVGA 3SZNA 3A88A 2BVRH 2PSXA 1MCTA 3SNDA 3B23B 2PKAB 2ZFPH 1XXDA 1GJCB 5EXLA 3PB1E 4MNWA 5DP8A 1VITG 1ORFA 3LC3A 1L4DA 4INLA 1NFYA 1TNKA 2F83A 1L1JA 1A3EH 3QWCH 2ZCHP 2ILNA 4TYDA 1P12E 1DE7H 2GMTC 4DVAU 2BY9X 2G5VA 5C5NA 1FPHH 1O2LA 5TCAA 2BDAA 1FDPA 3RXGA 3TJUA 4B2AA 1ESAA 3STIA 4JZIA 2RCEA 2EI6A 3SU4A 4H6SB 1XM1A 1C1OA 1LHFH 1UVOA 1FY4A 3SV8A 2VGCB 1JBUH 2ASUB 4FUBA 1C5OH 1FJSA 2P94A 5C2ZA 1YCPM 2Z7FE 1ZPBA 1EX3A 1WUNH 1Z1JA 3PO1B 4A6LA 4NIVA 3KQBA 4X2XA 1BTPA 2QIQA 5C67A 2EI7A 1AI8H 4NG9H 1SHYA 3BIUH 3E8LA 3K9XB 4AGJA 1KTSB 3UY9A 1PQ8A 1QQ4A 1C2DA 2BDGA 2BOHB 1TPSA 2ZU2A 3V13A 1FN6A 2BZAA 2G5NA 3SI3H 2OC1A 1OOKB 1O3FA 3PROA 4BOHA 4AFUA 2OC7A 4D9QA 1FN8A 4FU7A 3M3SA 4FUDA 2BY7X 4BAHB 2EC9H 2XBVA 3UNRA 4Y7BA 1CU1A 4GHTA 2ODPA 2RA0A 3ZZBA 2ZIQH 4LK4A 1V2VT 4NZLA 4MVNA 3T26A 1XUKA 3RP2A 4K1TA 3K2UA 2W3IA 1GDNA 1TPOA 2QF3A 2VIOA 1GVZA 3KL6A 3ZV9A 5DP5A 4KTCA 4CHAB 1O2XA 1ETTH 3A81A 4A1XA 3F9GA 1P2IA 2FOFA 4YLQH 5EXMA 3RXIA 4ZKNU 1YLDA 2QXGA 1GMCF 4ABIA 4MPVA 1C2EA 2Q6FA 1G9IE 4JYUH 2H9EH 4FXGH 3SU6A 2PW8H 1E35B 2F91A 1T8NA 1E0FD 1FIZA 7GCHG 2LPRA 1MAXA 2WPHS 1BJUA 1XUIA 4WMDA 1D3TB 3PWBA 3Q3YA 2THFB 1P11E 4X8TH 1S81A 2HGTH 3SI4H 4ZKOU 3BTEE 1C1QA 1HAZB 3TLOA 2XBWA 3P92A 5A0BA 2XRCA 5B6OA 1C5WB 3KF2A 1F7ZA 2C8XB 1CVWH 3A7YA 4U30A 7KMEH 4XBBA 3MU4A 1OWDA 1SQTA 5J4SA 4Y6DA 1JIRA 4NA9H 3MNCA 2RG3A 2ZGHA 1TOCB 3M3TA 1DDJA 2KAIA 1RIWC 1AVGH 3M61U 3LJOA 3VFEA 3SN8A 2K1QA 1LVMA 1NRPH 3A8CA 4WMFA 3M3VA 1GI9B 3UFAA 1LMWB 2B7DH 2Y82A 1T31A 2JH6D 4SGAE 1UTJA 1IHTH 1A0LA 2ODQA 3W94A 3F1SB 1ZLRA 2A31A 4F49A 4I33A 4O3TA 4OS6A 1NM6A 1F0RA 1GWAA 1Y3WA 5DG6A 2Z9KA 1SL3A 2FTMA 1SGCA 1O2UA 1MKXK 2PUQH 5HGGA 3SJOA 1L4ZA 1ELFA 2BD2A 2W3KA 3A7XA 1EUFA 3RXOA 4XFQA 1DPOA 1EATA 1P06A 1TMBH 3NUMA 5LPEA 1MTUA 3PLKA 1G3DA 2F9OA 1A1RA 1BTHH 1YGCH 1GBCA 3BTGE 2GP9B 3TK9A 6ESTA 1HJ8A 1FY5A 5PTPA 2A1DB 3LGIA 1O3LA 1YPEH 3AAVA 4ABJA 2QXIA 2H9HA 4I8HA 3RDZA 4INKA 5EU8A 2FOCA 3VGCB 3C27B 1TALA 1GJ4H 2OXSA 2ZHDA 2CJIA 3ZZ7A 1SSXA 2W7SA 1IQKA 1K1IA 1RTKA 1HXFH 2AIQA 2OC8A 5DPAA 1P0SH 1O3MA 1BRCE 2UUKB 2H6MA 2PTCE 2Y5GA 4BAMB 1ZPCA 2KAIB 4YESB 2J95A 1NRQH 1ZMJA 1QGFA 1YPGH 1CT2E 1WU1A 2LNCA 2SGDE 4KP0A 2Q6GA 1TOMH 4JMYA 3KCGH 1BRAA 3HGPA 3BTWE 1O5BB 3GCTF 1P04A 4XDEA 3RXJA 1CGHA 9LPRA 4Y79A 1HAXB 1OWEA 2BY8X 2ZPQA 2GT8A 1GL1A 1NROH 1P2MA 3K6ZA 2O8WA 2F9BH 1Y8TA 1GG6C 1A5IA 1H9LB 1C2MA 3LGUA 4B75A 1C1VH 2P8OC 3ODFA 4K8YA 1HAYB 1BBRE 1P02A 2P8OB 1EJNA 4DIIH 2ZDMA 1AUJA 3SNEA 2YNBA 3QTOH 5JDUB 1NTPA 1TNHA 1V2NT 3SO3A 1ELEE 1SQOA 1TQ7B 2BLVA 1GI5A 5AFYH 2W5EA 3ZZ4A 2OLGA 3VXFH 1UVTH 1O5EH 2A2XH 1GHXH 2GZ8A 5CE1A 2GCHF 5DP3A 3LT3A 1TIOA 1QNJA 1ANCA 2Q6DA 1BTXA 1YPLH 4PROA 3AW0A 1DLEA 1C2GA 2QXJA 2BXUH 2F9NA 2HWLB 2SFAA 2J2UA 3DUXH 4LOYH 3HPTB 1O3NA 2FP7B 1GCTB 2BD9A 3ESTA 2AMPA 1LKBA 3ZVBA 4FUJA 4O03A 4FUCA 1YBWA 1Z1IA 3EA7A 4IW4E 5A8XA 3RMNH 1YPHE 1HXEH 1HB0B 1HAVA 1G32B 1QR3E 2I6QA 5GJ4B 3C1KA 3M7QA 3VPKA 1TGBA 1C2JA 3RXTA 3LKWA 2W26A 4Q7XA 3E90B 3ELAH 1DUAA 2BD3A 1FAKH 3UREA 3SHAH 5DP7A 4X1PU 2GCTC 4X1QU 3MNXA 2XWBI 3LJJA 1IOEA 1ARBA 1V2JT 1P2NA 1W14U 2GMTB 2ZDAH 1MUEB 3N7OA 1FI8A 1QBOA 1O2MA 2ZCLP 4AOQA 4UFFH 2GZ9A 4BAOB 4ZMAH 2C8WB 4GVUA 2G00A 3P70B 3P6ZB 3GISB 3T25A 1TNGA 5GCHF 1QCPA 3MNSA 4CRBA 1GBFA 1NS3A 4U2WA 1NO9H 2JETB 2ZHQH 2ZFFH 1IQLA 3HGNA 2ZQ1A 1EPTA 2GDEH 4ABEA 4MPWA 3SOSA 2ZGJA 5T6DA 3RLWH 3MOCA 3RXFA 2FLRH 3Q3KA 1F92A 1EAWA 1FZZA 2R9PA 4I8LA 4A1VA 2XC0A 4GLYA 4B1TA 1J14A 1HNEE 3BTFE 4J2YB 3GICB 1D9IA 4FUIA 2D2DA 3FZZA 3PO1C 2FZZA 1YPKH 1HRTH 2VB0A 4ABBA 1YCPH 3EDXB 3DD2H 1RD3B 2ZFQH 1G2MA 1C5RA 2VNTA 1BITA 4NA7A 4Y11E 5E2OA 4ZXYH 1W0YH 1V2KT 1GI8B 4ZH8A 3RXMA 1F0UA 1SMFE 1G37A 5J4QA 1O5FH 3F68H 1E36B 3ZYEA 2BDIA 1AU8A 4KTSA 4I8GA 5LPFA 4OS4A 4VGCB 2FESH 1O5DH 4YT6H 1GHBG 3T62A 2BQWB 3MU0A 2QV1A 3O8CA 5JYIA 4MPUA 1IQHA 2WYJA 1VGCB 1NRSH 1K1MA 3BTTE 2PR3A 1OWKA 3I77A 2BVXH 2BDCA 3TNSA 2FOGA 1A5GH 1C5UA 1K21H 1F2SE 4I7YH 1O39A 1GJAB 1QRWA 3G01A 1GI0A 4ZHLU 1A61H 2BDHA 1AN1E 1O2ZA 3ITIA 1DX5M 2OUAA 2O8UA 4UDWH 8ESTE 2VIQA 2GT7A 3TITA 1NFUA 3TVJB 1C5VA 3R3GB 4KKDA 1B0FA 3KHVA 5EW2H 1WSSH 1SFIA 3A83A 1RTFB 2ZFTA 1KDQB 3MFJA 1GPZA 1A0HB 1ZRBA 1C5PA 1AVWA 1F5RA 4I31A 2BY6X 1TWXB 1GDUA 3GY7A 3S9AA 1PPCE 1TRYA 2XBYA 1C5NH 3BTDE 4XBCA 3F9EA 4DURA 1N6XA 3UPEA 1AO5A 1GMDG 1ABJH 1MD7A 2ZFSA 1ZTJA 2B0FA 4O97A 2GX4A 3P8NA 2PSYA 1Z6JH 1YLCA 3SV7A 2FYRA 2G4TA 1WV7H 1T4UH 2JH0D 2J34A 2A7JA 3KQEA 2PKSB 4O3UA 4FUEA 5DK1A 4NIXA 2AEIH 1LTOA 4NCYA 5C5OA 1ELGA 1GJ8B 2D8WA 3HATH 4CRGA 1O3EA 2HPQH 1C2KA 1QL8A 2O8MA 2D26C 1P2OA 1O3AA 4AFQA 5TJXA 4LZ4B 3E1XB 2FOHA 3RXSA 4ISHH 1BA8B 3T2NA 2WPMS 5JBBS 1C4V2 4UFDH 3RM0H 1C9PA 4HI3A 3S69A 2FOBA 2H9TH 1QL9A 1MU6B 1LDTT 1ZSLA 4H42U 1EAIA 5GWZA 2WV5A 2VH6A 4MQAA 1LVBA 1MKXH 3FP6E 2J94A 2VH0A 1ZGIA 3RC6A 2PHBA 3Q76A 2ALPA 3GDSA 3GY5A 1NFWA 2G51A 3RU4E 3F6UH 2DE9A 3GY6A 1BT7A 2Y6TA 1TX6A 1AKSB 1RRKA 4AZ2B 1XKBC 3SJKA 4Y10E 2FXRA 2CXVA 3PTNA 1DXPA 4YOIA 2ZDLA 1T8MA 3A7VA
chains in the Genus database with same CATH superfamily
1O3CA 1A2CH 3FAOA 2QY0B 1O35A 1Y59T 1SGYE 5KEDA 1OXGA 4YXWD 1O33A 1DWBH 2A0QB 2GTBA 1PFXC 2VBCA 1CGIE 4JZEH 1N8OB 1XUGA 1QBVH 1C1TA 2WPLS 4IC6A 4XSKU 4BNRA 4D8NA 1BMMH 1E1RD 1ANEA 2A5AA 3ZZAA 5ABWA 1AZ8A 3LH3A 1O3IA 3O8DA 3W1EA 2ZNKH 3WY8A 3UTUH 3EAJA 3EYDA 4WH6A 4BTTB 1V2LT 3URDA 1Z8GA 4NA8A 1SI5H 3BF6H 3D49H 1K28D 1AQ7A 3RXVA 2BLQA 4U01A 1CGJE 1YM0A 1E1QD 1O2IA 1SPJA 1TNLA 2Z6BD 2G4UA 4DGJA 2PWXA 3MH5A 3S7KB 2A32A 2TBSA 3OU0A 4K69A 2WUCA 3MI4A 4X0WU 3RMOH 1TGTA 1O5GH 4UFEH 2OP9A 4IC5A 3MU8A 5EGMA 2R3UA 2FOEA 2J98A 2FTLE 5EPNA 5K0HA 2BB4A 5CHBA 5A8ZA 1T8OA 3OX7U 2HLCA 1LPKB 1SLUB 2ZP0H 4Y71A 4OS1A 3PRBA 1TA6A 4X6PA 2AMQA 4RT0A 1AIXH 1TBRH 1Z8RA 2TPIZ 1VITH 1C1PA 4IS5A 1ZRKA 2EY4C 2SGFE 2M2AA 1CQQA 4MDSA 3KN2A 2QF0A 5A2MH 1DS2E 1GI3A 1MBQA 1RXPA 2V0BA 3STJA 1W13U 1LO6A 3SYJA 5LPRA 2WINI 5EOKA 3DT0H 3F2HA 8GCHG 4KTUA 4ASHA 2ALVA 3OSYA 2AMDA 1O37A 1G2LA 4P02A 3M7TA 4B2BA 3O8RA 1P05A 2KM0A 4DG4A 2XC4A 3T5FH 3SUGA 1THPB 2ZO3H 3TJVA 1O38A 4CRCA 1IQFA 5F8TA 3RXLA 2J98B 1O2PA 2XWAA 2ZWLH 1ZOMA 3LIWA 5FX6A 4X2WA 1ELCA 4M7GA 4MNXA 1U6QA 2GGVB 1NY22 5FBIA 1TA2A 1J16A 1BDAA 3M5LA 4JK6A 1ETRH 2ZU3A 3PM3A 4UEHH 2ANWA 2GCHG 3GCHC 4X6NA 1EJMA 1W3CA 4IN1A 2FS9A 3FZDA 1A4WH 5E2PA 3T28A 2FI3E 1ZJKA 2NWNA 1NU9A 3OTJE 1H4WA 2BD8A 4ZROA 1E37B 5EW1H 3F3BA 1TABE 1UK3A 2IN2A 1HLTH 4LZ1H 4DJZB 1AFEH 1HAPH 1ZJDA 3RUOA 2BD4A 3SORA 3S9CA 2GV6A 2HNTC 1THSH 2HALA 5IYTA 4ZHAA 5LGOA 1HUTH 3ODDA 5T6GA 2HOBA 2WPDD 4MLFB 1UHBA 5GIBA 3GCNA 3GY8A 5C0UA 2XBXA 2WPIS 3SV9A 2UUJB 2F9PA 4K1SA 4MPXA 3A7ZA 1Z8JB 3F0PA 5DP9A 4A92A 2ZHWH 6GCHF 1HFDA 5HKKD 1NRRH 1SGQE 1UW7A 2NU4E 1TE0A 4Y76A 1UTKA 1BB0B 3RXUA 2WSSD 3Q00A 2ZZUH 3SU0A 3ZVEA 2O9QA 4CH8B 5ETXA 1YPJH 2JH5D 2RDEA 2TGTA 3EE7A 4WH8A 1SLVB 1KIGH 3KIDU 2F3CE 2SGEE 3ZZ5A 2P3TB 3UR6A 2BQ7B 5JB8S 1EAXA 1TONA 1H8HD 4TWWA 1MTNB 1L2EA 2ODYB 2BLOA 3W95A 2BTCE 1A46H 1GJDB 3ZVCA 1IHSH 1KTTB 4NFFA 1C1WH 3JZ2B 2CK3D 4NFEA 2M5TA 1D6RA 1HAHH 2VVVA 1UCYK 2UWLA 1KXEA 3TGIE 2ZPRA 1PPEE 3ZVAA 3TH3H 1QTFA 2J4IA 4E7RG 1NZQH 5B6LA 5I46H 1CHOF 3CENA 3D62A 5IDKA 2WHXA 2AH4X 3RXKA 3MTYA 3TGJE 3UOUA 1O2NA 5T3HA 4MNVA 1P09A 1GBEA 1O3KA 1Z8IB 2BY5X 2FOAA 2VINA 3U1IB 1WBGB 1HYLA 4ZUHA 1V2QT 4AC9A 1MTSA 3HKJB 2IJOB 1K0HA 1BMNH 2ZFRH 1ACBE 1S6FA 3LGYA 2UUFB 2H2ZA 5FL7D 1J15A 3RXQA 4XRNA 7LPRA 1AE8H 1N6YA 1OX1A 3UWJH 5CMXH 1UJ1A 4MG3A 3UIRA 2DUCA 5L6NH 1ZSKA 1P2QA 4GAWA 2GVFA 2GZ7A 1PYTD 1EZSC 1K2I1 3S0NA 3QGNB 1KXFA 3DFLA 2C8YB 1P2KA 2VWOA 4RKOB 1WCZA 3M35A 1ZZZA 4TWYA 2R2WU 3IWMA 1L0ZA 1TRMA 4Y8ZA 2TGAA 5EQSA 1ARCA 1Y5BT 3QX5H 1O3OA 3TPIZ 3PLPA 3RU4T 3LGVA 1FXYA 1G3CA 3RLYH 1BTZA 5TCCA 1P01A 1GBTA 1AB9C 2ZKSA 3M5MA 5EG4A 1EP6A 2PKSC 1VZQH 2PTNA 3SUFA 1QBNA 1SR5C 3RXPA 3RXRA 1QJ1B 1UO6A 1S6LA 2EEKA 3V7TA 1O2OA 5T6FA 4CR5A 3GCHB 4D7GA 3A8DA 1SGFG 4KGAA 1D3QB 1GJ5H 1T32A 3A7WA 1AD8H 1JRSA 1S5SA 2HRVA 1EZUC 2FX6A 2PGQB 2QF4A 1C5YB 3B8JA 1BMLA 1P2JA 1HAOH 4RI0A 2BX3A 5GPIB 4YT7H 3SGBE 3HK6B 5CHAB 5FPSA 4NWLA 3DCLA 2OINA 2UUYA 1EPTB 3QZQA 1EKBB 1NRNH 4AFZA 3RU4D 4NIWA 1TGNA 1AZZA 2XNIA 5F6MA 1QJ6B 2WPJS 1GMCG 1QFKH 4NSYA 7GCHF 1ZHMA 1ELTA 3NPSA 3KEEA 1C1NA 1CHOG 3BTME 4ZKRU 5L2ZH 3Q77A 2XC5A 3GY2A 1W7XH 1GBJA 1A7SA 2FI4E 3QLPH 1CHGA 1SQRA 1H9IE 2YOLA 5LH8A 2ANMH 3AW1A 1Q31A 1J17T 2BX4A 1NT1A 2WPKS 1TPAE 2AGIX 2R0LA 1ETSH 4KELA 1WYKA 5C0TA 2JDID 1ESTA 1MTNC 3VEQB 3VB7A 3RXDA 2AS9A 2J92A 2IOTA 1Q2WA 5FX5A 3TIUA 3SU3A 4AX9H 2BD5A 1B0EA 1BRBE 3K6YA 1SOTA 4Y0YE 5HMAA 1ZYOA 3BTQE 1TMTH 1MKWH 1W8BH 5CHAC 1LHEH 2QGRA 4VGCC 3BIVH 2EA3A 2BZ6H 2CV3A 1ID5H 3NWUA 2YMSC 2QCYA 1V2PT 1TB6H 1GHVH 1T8LA 3SUDA 1DFPA 2CGAA 1VJ9U 4BANB 3PMJA 1LKAA 2ZU4A 1C5TA 4AN7A 1QB6A 3OAAD 3QDZB 1P8VC 2L6OA 2Z3DA 3ZVFA 3O8BA 1NPMA 5C1UA 1UMAH 1DUEA 1C2IA 1ELAA 5I25A 1AWFH 3SV2H 1HIAA 1CSOE 3MO3A 4RKJB 5GNDA 1UVPA 1FONA 1WAYB 3MHWU 4ABHA 3LDXH 2IPHA 3VXEH 1S0QA 4CH2B 1UTPA 1A5HA 3GDVA 3MQKC 2UWPA 3SJIA 2HNTE 2A7CA 3GCOA 1TYNA 4K8BA 2OTVA 3P8OA 1BRUP 4GSOA 2P16A 4CRDA 4BTIB 5DP6A 2C3SA 5FBEA 4WXVA 2AERH 1Y3UA 2FMJA 4AGKA 6LPRA 1UTMA 5KGOA 1FV9A 4JYTA 4WF8A 4YTAA 2NU1E 2FYQA 1SFQB 3PTBA 2ZDKA 1GHAG 1TRNA 1OWIA 4OS5A 4GHQA 4CR9A 1C2FA 1OS8A 2A2QH 1ANDA 5FCKA 1YF4A 5HM9A 2WV9A 3BV9B 1V2UT 1MQ5A 4M9FA 4WJG2 2PUXB 1AMHA 4AYVB 2ANKH 1ELVA 1W12U 1KLIH 1K9OE 1HJ9A 1TGSZ 1MCVA 4X1NU 1EZXC 5DGJA 2H5DA 1BMAA 1QB9A 4Q2KA 1HCGA 1AUTC 1RFNA 3HK3B 3UUZA 3BEFB 1RIWB 2STAE 1JOUB 4XE4A 1V2MT 5A0CA 1S0RA 4WY3A 3WWFA 3FOAA 5E0GA 2SNVA 3PV4A 3ATIA 4WXIA 1QJ7B 3PRDA 3SNCA 1EPTC 2BLWA 2VWMA 4B2CA 4B74A 1K22H 2VVCA 1OHHD 1CT4E 1O3JA 2P59A 1IQJA 1NFXA 4ABDA 4DIHH 1Z71A 1KDQA 3BG4C 2XXLA 3LOXA 2Y7ZA 3BG4B 4MTBA 5HM2A 2KFWA 1H1BA 1TAWA 2STBE 1TPPA 2ULLA 1BTUA 3TK5A 1GL0E 4X6MA 1BTWA 1DT2A 4D7FA 1SLXB 5A09A 4Q7YA 2FLBH 3A8BA 5EJZA 3TNTA 1S85A 5C1XA 1T4VH 3TH2H 4JZ1A 2FM2A 2XCFA 1MQ6A 3KNXA 4X2YA 3T29A 1AVXA 2QAAA 2ZTXA 2G52A 4FVDA 3ATKA 4D76A 1S83A 4WVPE 3MU5A 4Y7AA 1DANH 1QB1A 2ZDNA 4SGBE 2R2MB 1NN6A 2VU8E 3QUMP 2G8TA 3A7TA 1IAUA 5FXLA 1EXFA 1C1MA 1P03A 2NU0E 1KXCA 1J9CH 2FI5E 3NRLA 4TPIZ 1CBWC 1VITF 5C1YA 2VIPA 5DJ7A 5C20A 2VIDA 3VB6A 3F2FA 1O2VA 2HNTF 3L33A 2RA3A 3LPRA 1O2WA 1YPHC 1UCYE 1GMHF 3KQDA 2HVXA 3DHKH 1TBQH 3SUEA 1K1JA 3BSQA 1QRXA 1TNIA 3U8RH 4X6OA 4CHAC 2CHAB 1P9UA 2J9NA 3GY3A 1BIOA 4B71A 1VJAU 1SGNE 2FEQH 2Y7XA 1C5XB 4R0IA 1C1SA 3ZYDA 4R8TB 1C4Y2 4TY6A 3ZZDA 1C5SA 1YP9A 1QY6A 1S6HA 1SGEE 4THNH 4UFGH 3LU9B 4ISNA 4JZFH 3ENSB 1ZGVA 1F0SA 3OEHD 2XCNA 3M7UA 2XNDD 1WQVH 3PWCA 5EXNA 1HAGE 1O2QA 1OPHB 1SQAA 1V2ST 2V3OH 1SB1H 3M5NA 1MKWK 1SG8B 1HJAB 1PQ7A 1XX9A 2VVUA 1K1OA 1SGRE 1O2HA 1OYTH 1HJAC 1ZMLA 1Y3XA 3SU1A 1F0TA 1W0JD 1ESBA 5JBTA 3SGQE 1OWHA 2Z9JA 2B8OH 1WDIA 2AGEX 1GJ6A 3FFGA 1LPZB 2SGAA 3QTVH 3SU5A 1P3CA 1RTLA 1OP0A 1V2OT 2O8LA 4HGCA 4O9VA 1CO7E 2B9LA 3A89A 1Y5UT 1GJ9B 1QA0A 1EB2A 4A1TA 1VCPA 1SGDE 1CE5A 4Z0KA 5C94A 2FIRH 1C2LA 1MMJN 1H8DH 2JKHA 1UVSH 1N1LA 2QF5A 1Q3XA 4AB8A 2W6ID 1RGQA 2R3YA 2HLDD 2R0KA 3A82A 2OCVB 3P8FA 2EI8A 2ZHFH 3SW2B 1AGJA 1WQSA 2GD4B 4AYYB 4ISOA 5K7RA 3Q3XA 4ESTE 1UK4A 2KZ4A 8LPRA 3OTPA 4A5TS 1D6WA 9ESTA 1IQGA 3RM2H 1XUFA 2WUBA 4YZUA 3TH4H 2FOMB 1YCPK 3QK1A 1DLKB 3QGJA 1AKSA 3U69H 1PPHE 3DFJA 2SNWA 3L3TA 1GDQA 2PV9B 5FCRA 3EA9A 1YYY1 3PMHB 2P3FH 7ESTE 3F0OA 3SV6A 4XBDA 2KCYA 4I86A 2V7QD 1XVOA 1W2KH 1GCTC 1WXRA 2H5CA 5BPEA 3I78A 1P57B 3ZV8A 3TU7H 4DCDA 1XVMA 4FUFA 2TGPZ 3UR9A 1GBIA 4FU9A 1H8ED 1LHCH 2J97A 3TJNA 1GJ7B 2V35A 5HIYA 1G36A 1UK2A 2ZECA 3PV5A 1VR1H 2PKAA 1MABB 1Y5AT 1EAUA 1B7XB 1O2KA 3GCTG 3KQCA 2GDDA 1V2TT 2BDBA 3OY6U 3SJ8A 3I29A 1YPMH 2WV4A 1C9TA 3V12A 5CDFE 1EJAA 2A5IA 1XKAC 1FY3A 5A8YA 1QQUA 1SGIB 3SBKA 4LXBH 3EGKH 2FWWA 5EPYA 1SGFA 1QURH 1D4PB 2AYWA 3L6PA 5EQRA 1W11U 1GBKA 3URCA 3MYWA 4I8KA 1NU7B 2VWLA 4TSFD 1KLTA 3UNQA 1FIWA 1SVPA 4GUXA 3D23A 3UNSA 4E7NA 1IQNA 4X8UH 1C5QA 1LHGH 1O2GH 1WTGH 4X1SU 4GPGA 2XW9A 3LGWA 2A4RA 3DA9B 3U9AH 2AFQB 3FVFB 1GI4A 1BHXF 3D65E 5G4BA 3TGKE 2Y5FA 3B9FH 1B5GH 3ZVDA 2KCPA 3F9FA 2H1UA 5HXFA 3A85A 1O3PB 4ISIH 4TPYA 3RMLH 4CREA 1C5LH 2VIVA 4AORA 1Y3VA 1TNJA 2QC2A 4X8VH 1MD8A 1DVAH 2GKVE 4HFPB 4J1YA 1GMDF 3RXBA 3A87A 1UCYH 2TIOA 1C1UH 5C3NA 4OGYA 1IQEA 1HV7A 3MO9A 3A8AA 4TY7A 2VWNA 3ZZ8A 3TJOA 1DWEH 1K1NA 3V0XA 2ZGBH 3RXEA 2ZDVH 4FUHA 6CHAB 5F53A 1LVOA 2I6SA 1GI2A 8KME2 1TQ0B 1C2HA 2G55A 1QA7A 2OBQA 2OBOA 3U98H 3E16B 2AIPA 3E0PB 1OKXA 4IMQA 2QXHA 1GBHA 1HDTH 1SKYE 3SNBA 1GBBA 1FY1A 1GHAF 4DW2U 1QL7A 1OP2A 1O31A 5DO4H 1K1PA 1HAVB 2OQ5A 3NK8A 5DKMA 4AFSA 1TBZH 4HZHA 1KYNA 1VCQA 3QO6A 3IITA 4BXSA 2LELA 4Y0ZE 4YM9A 4YO9A 2KR7A 1ABIH 2ZI2H 3U8OH 1HIAB 1J8AA 5E0HA 1GGDC 1ANBA 3CS0A 3FANA 1C5MD 5A0AE 2ZCKP 1SGTA 1HBTH 4AG1A 1GJBB 1QRZA 1GHWH 3OY5U 2RDLA 4JZDH 4X1RU 2Z3EA 3M36A 1GI7B 1O34A 2AGGX 2BM2A 2FPZA 3MU1A 1MU8B 1DY8A 3VB3A 3GDUA 1DICA 1X7AC 3AVZA 3NXPA 1S82A 4QT8C 1DWCH 1KSNA 1WTHD 1TMUH 1O3BA 3U1JB 1MBMA 1PJPA 3A80A 4Q7ZA 2P95A 2P3UB 2JJ1D 1O2YA 3FP7E 3GY4A 5T1VA 3EE0B 2YMSD 2UWOA 1PPGE 3T27A 5ESBA 2P93A 1W7GH 4ZAEA 3OYPA 1K1LA 1KXBA 5AHGH 1THRH 3NZIA 4JYVH 2Z94A 4UE7H 3PMBB 1YC0A 1QIXB 1BZXE 4JCNA 2FS8A 4CBNA 1PPFE 1GHZA 1ZTLA 1CA0C 1GVLA 1O30A 2Q1JA 3EA8A 1JWTA 2FX4A 1WOFA 3R0FA 4UD9H 4NZQA 1IQIA 1P3EA 1BTYA 2NU2E 3CS7A 4AG2A 1EOLA 3UQOA 2CMYA 2ZGCA 3KGPA 3SNAA 3BEIB 3RXAA 3ZZCA 2A4OA 3BN9A 4RN6A 4X8SH 1CBWB 2BOKA 1XMNB 1GHYH 4ACAA 1A0JA 4XD7D 2A45B 1V2WT 3SQEE 4AB9A 5GDSH 1MTWA 1UTQA 1BUIA 5DSFA 4FVBA 5GCHG 1BQYA 2OK5A 1PPBH 5AVDA 8GCHF 1L1GA 4I32A 5H4IB 4Q63A 3GYMA 1O5AB 6GCHG 1AFQC 4OGXA 1XUHA 3MH7A 1Y3YA 1GGDB 2A4QA 2ZTYA 2A4GA 1HPGA 1CA0B 1KLJH 1E38B 5HYOA 5AF9H 3VB4A 4U32A 1YWUA 1AE5A 5E8EH 2WYGA 1PQAA 1E34B 1MAYA 4DT4A 3WWBA 1TX8A 1GBMA 2HPPH 3S7HB 2Z9GA 4HTCH 4ISLA 3NKKA 3E3TA 6CHAC 4JK5A 1UHBB 1GI1A 1OYQA 2Z3CA 1HAIH 2PGBB 3MH4A 2ZQ2A 1BBRH 2CN0H 3PYHA 2CF9H 2C8ZB 1G3BA 4OM9A 2ZG0H 5EJ1A 4ABFA 2O8TA 5JPMH 2BMGB 2QYIA 4IN2A 5SGAE 3MNBA 3SZEA 1DSUA 1GVKB 2FO9A 3ZIAD 1W0ZU 2F9UA 4CBOA 3MH6A 3U28C 1ZHRA 1JRTA 2XYAA 4K60A 3MO6A 1GG6B 1ZHPA 1O3GA 1AY6H 1C4U2 2OC0A 2OD3B 2ZTZA 2BHGA 1YLNA 2Z9LA 2GCTB 1EQ9A 3LONA 4H4FA 1D3PB 1S84A 3BEUA 1O2TA 3H5CB 3UQVA 1C5ZB 4BAKB 1ZTKA 2ESTE 3LGTA 1MZAA 3MMGA 1L1NA 2BDYA 1OP8A 1FQ3A 3UB0A 2JJ2D 1SC8U 3UOPA 2XOKD 3E91A 3TK6A 2KCOA 4OS7A 1YKTA 1GMHG 2D1JA 4I8JA 4OS2A 3SGAE 1DSTA 3JZ1B 4ZCNA 4NGAH 1O2JA 1T7CA 1O5CB 4BAQB 5F03A 1P10A 1F5KU 1MTVA 3ZZ6A 3IG6B 1INCA 1KY9A 5JBCS 4Y8YA 1XXFA 3E0NB 1O2SA 1OWJA 1UVUH 2CF8H 5GXPA 1V6DA 2PLXA 2ZEBA 2ZF0H 4B6EA 4Z1MD 2IJD1 2Y80A 5EQQA 2ANYA 3NCLA 1AFQB 3M5OA 1C1RA 3HKIB 3FO8D 4B76A 1O2RA 1VCWA 2TGDA 3CP7A 4MNYA 5FAHA 2B5TB 2V3HH 3EQ0H 4YLUA 3M37A 1FMGA 1JMOH 2Z9IA 3BG8A 4NSVA 4E05H 1QZ8A 5FPTA 2F9VA 4K3JA 1EASA 4ZXXH 3RC5A 1LCYA 4YOJA 3AASA 3A86A 1CT0E 2ZC9H 1V3XA 1UTOA 2ZU1A 1AWHB 1ZR0A 2BQ6B 4E06H 2YNAA 2WZQA 5L2YH 3BTHE 1BBRK 1G30B 1PPZA 2A5KA 1LVYA 1H8IH 1ZSJA 1TLDA 2L74A 1LHDH 4Q80A 3E6PH 3V3MA 4YOGA 4IMZA 2JETC 1BJVA 1BHXB 1TX7A 1ELBA 1VGCC 2J38A 4WMEA 3RXHA 1DOJA 4GCHG 1PQ5A 1OSSA 1GBDA 1ELDE 2ZA5A 3N7EA 3DSOA 2Y5HA 5ESTE 1LPGB 1QHRB 1SLWB 2A7HA 4H6TA 3AK5A 1N8OC 4F4OC 4K2YA 2C93B 1CA8B 3ZZ9A 4FU8A 1XUJA 2V6NA 1O3DA 3GS9A 3WW7A 4Y8XA 5HIZA 1NBMD 1P9SA 3VB5A 2QA9E 4CRFA 1NC6A 3ATWA 3F9HA 4D9RA 4XOJA 4DOQA 5E0JA 1O0DH 1GBAA 3MWIU 3F2GA 3UWIA 1TGCA 1FNIA 3AAUA 3FKSD 1DXWA 1E79D 3ATMA 2C90B 2NU3E 5EJLA 1PYTC 2VJ1A 1HGTH 3H7TA 1IQMA 2GV7A 4FUGA 1A3BH 2XTTB 5FHTA 5JBAS 3VGCC 4BXWA 1SHHB 4ABAA 2OQUA 1G3EA 4CRAA 4WWYA 1FAXA 3A84A 1GBLA 5EODA 2FODA 2TRMA 5FPYA 4X2VA 1D3DB 1O36A 3BTKE 2PFEA 2ZPSA 3PMAB 1EZQA 1JXPA 1VKYA 4A7IB 2VIWA 3RXCA 1LQDB 4INHA 2BXTH 4ZKSU 1UTLM 1Z7KA 3LC5A 1F5LA 2BVSH 1JIMA 1FUJA 4DY7B 2SGQE 3KQ5A 1V2RT 3ZZ3A 4IGDA 1H9HE 2CHAC 2V3MA 3RC4A 3U8TH 4NIYA 3H7OA 2DE8A 1BOQA 1ZPZA 1MZDA 5L30H 1TFXA 5F8ZA 1DITH 1GI6A 5JB9S 2F43B 1MH0A 5BRRE 4UONA 1FPCH 4B73A 4Z6AH 1KMHB 5DP4A 2C4FH 1EB1H 4K1EA 1NESE 1SBWA 2QN5T 2PP6A 3ATLA 2W7UA 3SQHE 2FDAA 3FP8E 2G81E 1GCDA 2SGPE 4GCHF 3RMMH 1EP5A 1UTNA 5F8XA 1RJXB 1DY9A 3P17H 3P8GA 1SGPE 3K65B 3PLBA 2ZGXH 4NWKA 2BD7A 1SOZA 3SHCH 5AFZH 4BTUB 1RS0A 4K5ZA 3SU2A 3P95A 2VGCC 1LQEA 1FLEE 1O32A 4IBLH 3LH1A 4DT7B 1W10U 3S9BA 1FX0B 1AB9B 1GHBF 2LP6A 4ZHMU 1DWDH 1M9UA 3QN7A 1ZMNA 4ABGA 1EOJA 3SJ9A 2ZU5A 1O3HA 4RSPA 1AHTH 2Y81A 3GYLB 2K8IA 1DM4B 2BYAX 1KXAA 3QZRA 3GOVB 1KXDA 1FY8E 1BCUH 1Z6EA 2ZHEH 3ZVGA 3SZNA 3A88A 2BVRH 2PSXA 1MCTA 3SNDA 3B23B 2PKAB 2ZFPH 1XXDA 3CNRA 1GJCB 5EXLA 3PB1E 4MNWA 5DP8A 1VITG 1ORFA 3LC3A 1L4DA 4INLA 1NFYA 1TNKA 2F83A 1L1JA 1A3EH 3QWCH 2ZCHP 2ILNA 4TYDA 1P12E 1DE7H 2GMTC 4DVAU 2BY9X 2G5VA 5C5NA 1FPHH 1O2LA 5TCAA 2BDAA 1FDPA 3RXGA 3TJUA 4B2AA 1ESAA 3STIA 4JZIA 2RCEA 2EI6A 3SU4A 4H6SB 1XM1A 1C1OA 1LHFH 1UVOA 1FY4A 3SV8A 2VGCB 1JBUH 2ASUB 4FUBA 1C5OH 1FJSA 2P94A 5C2ZA 4HG6A 4ASUD 1YCPM 2Z7FE 1ZPBA 1EX3A 1WUNH 1Z1JA 3PO1B 4A6LA 4NIVA 3KQBA 4X2XA 1BTPA 2QIQA 5C67A 2EI7A 1AI8H 4NG9H 1SHYA 3BIUH 3E8LA 3K9XB 4FETA 4AGJA 1KTSB 2HVYB 3UY9A 1PQ8A 1QQ4A 1C2DA 2BDGA 2BOHB 1TPSA 2ZU2A 3V13A 1FN6A 2BZAA 2G5NA 3SI3H 2OC1A 1OOKB 1O3FA 3PROA 4BOHA 4AFUA 2OC7A 4D9QA 1FN8A 4FU7A 3M3SA 4FUDA 2BY7X 4BAHB 2YMSB 2EC9H 2XBVA 3UNRA 4Y7BA 1CU1A 4GHTA 4FOUC 2ODPA 2RA0A 3UAIC 3ZZBA 2ZIQH 4LK4A 1V2VT 4NZLA 4MVNA 4TT3D 1XUKA 3T26A 3RP2A 4K1TA 3K2UA 2W3IA 1GDNA 1TPOA 2QF3A 2VIOA 1GVZA 3KL6A 3ZV9A 5DP5A 4KTCA 4CHAB 3OEED 3DSPA 1O2XA 1ETTH 3DSGA 3A81A 4RT1A 4A1XA 3F9GA 1P2IA 2FOFA 4YLQH 5EXMA 3RXIA 4ZKNU 1YLDA 2QXGA 1GMCF 4ABIA 4MPVA 1C2EA 2K0QA 2Q6FA 1G9IE 4JYUH 2H9EH 4FXGH 3SU6A 2PW8H 1E35B 2F91A 1T8NA 1E0FD 1FIZA 7GCHG 2LPRA 1MAXA 2WPHS 1BJUA 1XUIA 4WMDA 2QE7D 1D3TB 3PWBA 3Q3YA 2THFB 1P11E 4X8TH 1S81A 2HGTH 3SI4H 4ZKOU 3BTEE 1C1QA 1HAZB 3TLOA 2XBWA 3P92A 5A0BA 2XRCA 5B6OA 4P00A 1C5WB 3KF2A 1F7ZA 2C8XB 1CVWH 3A7YA 4U30A 7KMEH 4XBBA 3MU4A 1OWDA 1SQTA 5J4SA 4Y6DA 1JIRA 4NA9H 3MNCA 2RG3A 2ZGHA 1TOCB 3M3TA 1DDJA 2KAIA 1RIWC 1AVGH 3M61U 3LJOA 3VFEA 3SN8A 2K1QA 1LVMA 1NRPH 3A8CA 4WMFA 3OE7D 3M3VA 1GI9B 3UFAA 1LMWB 2B7DH 2Y82A 1T31A 2JH6D 4SGAE 1UTJA 1IHTH 1A0LA 2ODQA 3W94A 3F1SB 1ZLRA 2A31A 4F49A 4I33A 4O3TA 4OS6A 1NM6A 1F0RA 1GWAA 1Y3WA 5DG6A 2Z9KA 1SL3A 2FTMA 1SGCA 5KECA 1O2UA 1MKXK 2PUQH 5HGGA 3SJOA 1L4ZA 1ELFA 2BD2A 2W3KA 3A7XA 1EUFA 3RXOA 4XFQA 1DPOA 1EATA 1P06A 2RFKC 1TMBH 3NUMA 5LPEA 1MTUA 3PLKA 1G3DA 2F9OA 1A1RA 1BTHH 1YGCH 1W0KD 1GBCA 3BTGE 2GP9B 3TK9A 6ESTA 1HJ8A 1FY5A 5PTPA 2A1DB 3LGIA 1O3LA 1YPEH 3AAVA 4ABJA 2QXIA 2H9HA 4I8HA 3RDZA 4INKA 5EU8A 2FOCA 3VGCB 3C27B 1TALA 1GJ4H 2OXSA 2ZHDA 2CJIA 3ZZ7A 1SSXA 2W7SA 1IQKA 1K1IA 1RTKA 1HXFH 2AIQA 2OC8A 5DPAA 1EFRD 1P0SH 1O3MA 1BRCE 2UUKB 2H6MA 2PTCE 2Y5GA 4BAMB 1ZPCA 2KAIB 4YESB 2J95A 1NRQH 1ZMJA 1QGFA 3H09A 1YPGH 1CT2E 3KYGA 1WU1A 2LNCA 2SGDE 4KP0A 2Q6GA 1TOMH 4JMYA 3KCGH 1BRAA 3HGPA 3BTWE 1O5BB 3GCTF 1P04A 4XDEA 3RXJA 1CGHA 9LPRA 4Y79A 1HAXB 3KYFA 1OWEA 2BY8X 2ZPQA 2GT8A 1GL1A 1NROH 1P2MA 3K6ZA 2O8WA 2F9BH 1Y8TA 1GG6C 1A5IA 1H9LB 1C2MA 3LGUA 4B75A 1C1VH 2P8OC 3ODFA 1BMFD 4K8YA 1HAYB 1BBRE 1P02A 2P8OB 1EJNA 4DIIH 2ZDMA 1AUJA 3SNEA 2YNBA 3QTOH 5JDUB 1NTPA 1TNHA 1V2NT 3SO3A 1ELEE 1SQOA 2JIZD 1TQ7B 2BLVA 4F48B 1GI5A 5AFYH 2W5EA 3ZZ4A 2OLGA 3VXFH 1UVTH 1O5EH 2A2XH 1GHXH 2GZ8A 5CE1A 2GCHF 5DP3A 3LT3A 1TIOA 1QNJA 1ANCA 2Q6DA 1BTXA 1YPLH 2EQNA 4PROA 3AW0A 1NBME 1DLEA 1C2GA 2QXJA 2BXUH 2F9NA 2HWLB 2SFAA 2J2UA 3DUXH 4LOYH 3HPTB 1O3NA 2FP7B 1GCTB 2BD9A 3ESTA 4ACBA 2AMPA 1LKBA 3ZVBA 4FUJA 4O03A 4FUCA 1YBWA 1Z1IA 3EA7A 4IW4E 5A8XA 3RMNH 1YPHE 1HXEH 1HB0B 1HAVA 1G32B 1QR3E 2I6QA 3VG8A 5GJ4B 3C1KA 3M7QA 3VPKA 1TGBA 1C2JA 3RXTA 3LKWA 2W26A 4Q7XA 3E90B 1YY3A 3ELAH 1DUAA 2BD3A 1FAKH 3UREA 3SHAH 5DP7A 4X1PU 2GCTC 4X1QU 3MNXA 2XWBI 3LJJA 1IOEA 1ARBA 1V2JT 1P2NA 1W14U 2GMTB 2ZDAH 1MUEB 3N7OA 1FI8A 1QBOA 1O2MA 2ZCLP 4AOQA 4UFFH 2GZ9A 4BAOB 4ZMAH 2C8WB 4GVUA 2G00A 3P70B 3P6ZB 3GISB 3T25A 1TNGA 5GCHF 1QCPA 2KX4A 3MNSA 4CRBA 1GBFA 1NS3A 4U2WA 1NO9H 5EIYA 2JETB 2ZHQH 4F55A 2ZFFH 1IQLA 3HGNA 2ZQ1A 1EPTA 2GDEH 4ABEA 4MPWA 3SOSA 2ZGJA 5T6DA 3RLWH 3MOCA 3RXFA 2FLRH 3Q3KA 1F92A 1EAWA 1FZZA 2R9PA 4I8LA 4A1VA 2XC0A 4GLYA 4B1TA 1J14A 1HNEE 3BTFE 4J2YB 3GICB 1D9IA 4FUIA 2D2DA 3FZZA 3PO1C 2FZZA 1YPKH 1HRTH 2VB0A 5DN6D 4ABBA 1YCPH 3EDXB 3DD2H 1RD3B 2ZFQH 1G2MA 2W6JD 3N7DA 4B6FA 1C5RA 2VNTA 1BITA 4NA7A 4Y11E 5E2OA 4ZXYH 1W0YH 1V2KT 1GI8B 4ZH8A 3RXMA 1F0UA 1SMFE 3FN8A 1G37A 5J4QA 1O5FH 3F68H 1E36B 3ZYEA 2BDIA 1AU8A 4KTSA 4I8GA 5LPFA 4OS4A 4VGCB 2FESH 1O5DH 4YT6H 1GHBG 3T62A 2BQWB 3MU0A 2QV1A 3O8CA 5JYIA 4MPUA 1IQHA 2WYJA 1VGCB 1NRSH 1K1MA 5C17A 3BTTE 2PR3A 1OWKA 3I77A 2BVXH 2BDCA 3TNSA 2FOGA 1A5GH 1C5UA 1K21H 1F2SE 3N99A 4I7YH 1O39A 1GJAB 1QRWA 3G01A 1GI0A 1COWD 4ZHLU 1A61H 2BDHA 1AN1E 1O2ZA 3ITIA 1DX5M 2OUAA 2O8UA 4UDWH 8ESTE 2VIQA 2GT7A 3TITA 1NFUA 3TVJB 1C5VA 3R3GB 4KKDA 1B0FA 3KHVA 5EW2H 1WSSH 1SFIA 3A83A 1RTFB 2ZFTA 1KDQB 3MFJA 1GPZA 2IPQX 1A0HB 3OFND 1ZRBA 1C5PA 1AVWA 1F5RA 4I31A 2BY6X 1TWXB 3PV2A 1GDUA 3GY7A 3S9AA 1PPCE 1TRYA 2XBYA 1C5NH 3BTDE 4XBCA 3F9EA 4DURA 1N6XA 3UPEA 1AO5A 1GMDG 1ABJH 1MD7A 2ZFSA 1ZTJA 2B0FA 4O97A 2GX4A 3P8NA 2PSYA 1Z6JH 1YLCA 3SV7A 2FYRA 2G4TA 1WV7H 1T4UH 2JH0D 2J34A 2A7JA 3KQEA 2PKSB 4O3UA 2F4LA 4FUEA 2GJGA 5DK1A 4NIXA 2AEIH 1LTOA 4NCYA 5C5OA 1ELGA 1GJ8B 2D8WA 3HATH 4CRGA 1O3EA 2HPQH 1C2KA 1QL8A 2O8MA 2D26C 1P2OA 1O3AA 4AFQA 5TJXA 4LZ4B 3E1XB 2FOHA 3RXSA 4ISHH 1BA8B 2AHME 2WPMS 5JBBS 3T2NA 1C4V2 4UFDH 3RM0H 1C9PA 4HI3A 3S69A 2FOBA 2H9TH 1QL9A 1MU6B 1LDTT 1ZSLA 4H42U 1EAIA 5GWZA 2WV5A 2VH6A 4MQAA 1LVBA 1MKXH 3FP6E 2J94A 2VH0A 1ZGIA 3RC6A 2PHBA 3Q76A 2ALPA 4Q4LA 3GDSA 3GY5A 1NFWA 2G51A 3RU4E 2KCAA 3F6UH 2DE9A 3GY6A 1BT7A 2Y6TA 1TX6A 1AKSB 1RRKA 4AZ2B 1XKBC 3SJKA 4Y10E 5IK2D 2FXRA 2CXVA 3PTNA 1DXPA 4YOIA 2J5UA 2ZDLA 1T8MA 3A7VA
chains in the Genus database with same CATH topology
1O3CA 1A2CH 3FAOA 2QY0B 1O35A 1Y59T 1SGYE 1OXGA 1O33A 1DWBH 2A0QB 2GTBA 1PFXC 1CGIE 4JZEH 1N8OB 1XUGA 1QBVH 1C1TA 2WPLS 4IC6A 4XSKU 4BNRA 4D8NA 1BMMH 1ANEA 2A5AA 3ZZAA 5ABWA 1AZ8A 3LH3A 1O3IA 3O8DA 2ZNKH 3WY8A 3UTUH 3EAJA 3EYDA 4WH6A 4BTTB 1V2LT 3URDA 1Z8GA 4NA8A 1SI5H 3BF6H 3D49H 1K28D 1AQ7A 3RXVA 2BLQA 4U01A 1CGJE 1YM0A 1O2IA 1SPJA 1TNLA 2Z6BD 2G4UA 4DGJA 2PWXA 3MH5A 3S7KB 2A32A 2TBSA 3OU0A 4K69A 2WUCA 3MI4A 4X0WU 3RMOH 1TGTA 1O5GH 4UFEH 2OP9A 4IC5A 3MU8A 5EGMA 2R3UA 2FOEA 2FTLE 5EPNA 5K0HA 2BB4A 5A8ZA 1T8OA 3OX7U 2HLCA 1LPKB 1SLUB 2ZP0H 4Y71A 4OS1A 1TA6A 4X6PA 2AMQA 1AIXH 1TBRH 1Z8RA 2TPIZ 1VITH 1C1PA 4IS5A 1ZRKA 2SGFE 1CQQA 4MDSA 3KN2A 2QF0A 5A2MH 1DS2E 1GI3A 1MBQA 1RXPA 2V0BA 3STJA 1W13U 1LO6A 5LPRA 2WINI 5EOKA 3DT0H 8GCHG 4KTUA 4ASHA 2ALVA 3OSYA 2AMDA 1O37A 1G2LA 3M7TA 4B2BA 3O8RA 1P05A 4DG4A 2XC4A 3T5FH 3SUGA 1THPB 2ZO3H 3TJVA 1O38A 4CRCA 1IQFA 5F8TA 3RXLA 1O2PA 2XWAA 2ZWLH 1ZOMA 3LIWA 5FX6A 4X2WA 1ELCA 4M7GA 4MNXA 1U6QA 2GGVB 1NY22 5FBIA 1TA2A 1J16A 1BDAA 3M5LA 4JK6A 1ETRH 2ZU3A 3PM3A 4UEHH 2ANWA 2GCHG 3GCHC 4X6NA 1EJMA 1W3CA 4IN1A 2FS9A 3FZDA 1A4WH 5E2PA 3T28A 2FI3E 1ZJKA 2NWNA 1NU9A 3OTJE 1H4WA 2BD8A 4ZROA 1E37B 5EW1H 1TABE 1UK3A 2IN2A 1HLTH 4LZ1H 4DJZB 1AFEH 1HAPH 1ZJDA 3RUOA 2BD4A 3SORA 3S9CA 2GV6A 2HNTC 1THSH 2HALA 5IYTA 4ZHAA 5LGOA 1HUTH 3ODDA 5T6GA 2HOBA 4MLFB 1UHBA 5GIBA 3GCNA 3GY8A 2XBXA 2WPIS 3SV9A 2UUJB 2F9PA 4K1SA 4MPXA 3A7ZA 1Z8JB 5DP9A 4A92A 2ZHWH 6GCHF 1HFDA 1NRRH 1SGQE 2NU4E 1TE0A 4Y76A 1UTKA 1BB0B 3RXUA 3Q00A 2ZZUH 3SU0A 3ZVEA 2O9QA 4CH8B 5ETXA 1YPJH 2JH5D 2TGTA 4WH8A 1SLVB 1KIGH 3KIDU 2F3CE 2SGEE 3ZZ5A 2P3TB 3UR6A 2BQ7B 5JB8S 1EAXA 1TONA 4TWWA 1MTNB 1L2EA 2ODYB 2BLOA 3W95A 2BTCE 1A46H 1GJDB 3ZVCA 1IHSH 1KTTB 4NFFA 1C1WH 3JZ2B 4NFEA 1D6RA 2M5TA 1HAHH 2VVVA 1UCYK 2UWLA 1KXEA 3TGIE 2ZPRA 1PPEE 3ZVAA 3TH3H 1QTFA 2J4IA 4E7RG 1NZQH 5I46H 1CHOF 3CENA 3D62A 5IDKA 3RXKA 2AH4X 3MTYA 3TGJE 3UOUA 1O2NA 5T3HA 4MNVA 1P09A 1GBEA 1O3KA 1Z8IB 2BY5X 2FOAA 2VINA 3U1IB 1WBGB 1HYLA 4ZUHA 1V2QT 1MTSA 3HKJB 2IJOB 1BMNH 2ZFRH 1ACBE 1S6FA 3LGYA 2UUFB 2H2ZA 1J15A 3RXQA 7LPRA 1AE8H 1N6YA 1OX1A 3UWJH 5CMXH 1UJ1A 4MG3A 3UIRA 2DUCA 5L6NH 1ZSKA 1P2QA 4GAWA 2GVFA 2GZ7A 1PYTD 1EZSC 1K2I1 3S0NA 3QGNB 1KXFA 3DFLA 2C8YB 1P2KA 2VWOA 4RKOB 1WCZA 3M35A 1ZZZA 4TWYA 2R2WU 3IWMA 1L0ZA 1TRMA 4Y8ZA 2TGAA 5EQSA 1ARCA 1Y5BT 3QX5H 1O3OA 3TPIZ 3PLPA 3RU4T 3LGVA 1FXYA 1G3CA 3RLYH 1BTZA 5TCCA 1P01A 1GBTA 1AB9C 2ZKSA 3M5MA 5EG4A 1EP6A 2PKSC 1VZQH 2PTNA 3SUFA 1QBNA 1SR5C 3RXPA 3RXRA 1QJ1B 1UO6A 2EEKA 3V7TA 1O2OA 5T6FA 4CR5A 3GCHB 4D7GA 3A8DA 1SGFG 4KGAA 1D3QB 1GJ5H 1T32A 3A7WA 1AD8H 1JRSA 1S5SA 2HRVA 1EZUC 2FX6A 2PGQB 1C5YB 3B8JA 1BMLA 1P2JA 1HAOH 2BX3A 5GPIB 4YT7H 3SGBE 3HK6B 5CHAB 5FPSA 4NWLA 2OINA 2UUYA 1EPTB 3QZQA 1EKBB 1NRNH 4AFZA 3RU4D 4NIWA 1TGNA 1AZZA 2XNIA 5F6MA 1QJ6B 2WPJS 1GMCG 1QFKH 4NSYA 7GCHF 1ZHMA 1ELTA 3NPSA 3KEEA 1C1NA 1CHOG 3BTME 4ZKRU 5L2ZH 3Q77A 2XC5A 3GY2A 1W7XH 1GBJA 1A7SA 2FI4E 3QLPH 1CHGA 1H9IE 2YOLA 5LH8A 2ANMH 3AW1A 1Q31A 1J17T 2BX4A 2WPKS 1NT1A 1TPAE 2R0LA 2AGIX 1ETSH 4KELA 1WYKA 1ESTA 1MTNC 3VEQB 3VB7A 3RXDA 2AS9A 2J92A 2IOTA 1Q2WA 5FX5A 3TIUA 3SU3A 4AX9H 2BD5A 1B0EA 1BRBE 3K6YA 1SOTA 4Y0YE 5HMAA 1ZYOA 3BTQE 1TMTH 1MKWH 1W8BH 5CHAC 1LHEH 2QGRA 4VGCC 3BIVH 2EA3A 2BZ6H 2CV3A 1ID5H 3NWUA 2QCYA 1V2PT 1TB6H 1GHVH 1T8LA 3SUDA 1DFPA 2CGAA 1VJ9U 4BANB 3PMJA 1LKAA 2ZU4A 1C5TA 4AN7A 1QB6A 3QDZB 1P8VC 2Z3DA 3ZVFA 3O8BA 1NPMA 5C1UA 1UMAH 1DUEA 1C2IA 1ELAA 5I25A 1AWFH 3SV2H 1HIAA 1CSOE 3MO3A 4RKJB 1UVPA 1FONA 1WAYB 3MHWU 4ABHA 3LDXH 2IPHA 3VXEH 1S0QA 4CH2B 1UTPA 1A5HA 3GDVA 2UWPA 3SJIA 2HNTE 2A7CA 3GCOA 1TYNA 4K8BA 2OTVA 3P8OA 1BRUP 4GSOA 2P16A 4CRDA 4BTIB 5DP6A 2C3SA 5FBEA 4WXVA 2AERH 1Y3UA 2FMJA 4AGKA 6LPRA 1UTMA 1FV9A 4JYTA 4WF8A 4YTAA 2NU1E 2FYQA 1SFQB 3PTBA 2ZDKA 1GHAG 1TRNA 1OWIA 4OS5A 4GHQA 4CR9A 1C2FA 1OS8A 2A2QH 1ANDA 5FCKA 1YF4A 5HM9A 3BV9B 1V2UT 1MQ5A 4WJG2 2PUXB 1AMHA 4AYVB 2ANKH 1ELVA 1W12U 1KLIH 1K9OE 1HJ9A 1TGSZ 1MCVA 4X1NU 1EZXC 5DGJA 2H5DA 1BMAA 1QB9A 4Q2KA 1HCGA 1AUTC 1RFNA 3HK3B 3UUZA 3BEFB 1RIWB 2STAE 1JOUB 4XE4A 1V2MT 5A0CA 1S0RA 4WY3A 5E0GA 2SNVA 3PV4A 3ATIA 4WXIA 1QJ7B 3SNCA 1EPTC 2BLWA 2VWMA 4B2CA 4B74A 1K22H 2VVCA 1CT4E 1O3JA 2P59A 1IQJA 1NFXA 4ABDA 4DIHH 1Z71A 1KDQA 3BG4C 2XXLA 3LOXA 2Y7ZA 3BG4B 4MTBA 5HM2A 1H1BA 1TAWA 2STBE 1TPPA 2ULLA 1BTUA 3TK5A 1GL0E 4X6MA 1BTWA 1DT2A 4D7FA 1SLXB 5A09A 4Q7YA 2FLBH 3A8BA 3TNTA 1S85A 5C1XA 1T4VH 3TH2H 4JZ1A 2FM2A 2XCFA 1MQ6A 3KNXA 4X2YA 3T29A 1AVXA 2QAAA 2ZTXA 2G52A 4FVDA 3ATKA 4D76A 1S83A 4WVPE 3MU5A 4Y7AA 1DANH 1QB1A 2ZDNA 4SGBE 2R2MB 1NN6A 2VU8E 3QUMP 2G8TA 3A7TA 1IAUA 5FXLA 1EXFA 1C1MA 1P03A 2NU0E 1KXCA 1J9CH 2FI5E 4TPIZ 1CBWC 1VITF 5C1YA 2VIPA 5DJ7A 5C20A 2VIDA 3VB6A 1O2VA 2HNTF 3L33A 2RA3A 3LPRA 1O2WA 1YPHC 1UCYE 1GMHF 3KQDA 2HVXA 3DHKH 1TBQH 3SUEA 1K1JA 3BSQA 1QRXA 1TNIA 3U8RH 4X6OA 4CHAC 2CHAB 1P9UA 2J9NA 3GY3A 1BIOA 4B71A 1VJAU 1SGNE 2FEQH 2Y7XA 1C5XB 4R0IA 1C1SA 3ZYDA 4R8TB 1C4Y2 4TY6A 3ZZDA 1C5SA 1YP9A 1QY6A 1S6HA 1SGEE 4THNH 4UFGH 3LU9B 4ISNA 4JZFH 3ENSB 1ZGVA 1F0SA 2XCNA 3M7UA 1WQVH 3PWCA 5EXNA 1HAGE 1O2QA 1OPHB 1SQAA 1V2ST 2V3OH 1SB1H 3M5NA 1MKWK 1SG8B 1HJAB 1PQ7A 2VVUA 1XX9A 1K1OA 1SGRE 1O2HA 1OYTH 1HJAC 1ZMLA 1Y3XA 3SU1A 1F0TA 1ESBA 5JBTA 3SGQE 1OWHA 2Z9JA 2B8OH 2AGEX 1GJ6A 3FFGA 1LPZB 2SGAA 3QTVH 3SU5A 1P3CA 1RTLA 1OP0A 1V2OT 2O8LA 4HGCA 4O9VA 1CO7E 2B9LA 3A89A 1Y5UT 1GJ9B 1QA0A 1EB2A 4A1TA 1VCPA 1SGDE 1CE5A 4Z0KA 2FIRH 1C2LA 1MMJN 1H8DH 2JKHA 1UVSH 1N1LA 1Q3XA 4AB8A 1RGQA 2R3YA 3A82A 2R0KA 2OCVB 3P8FA 2EI8A 2ZHFH 3SW2B 1AGJA 1WQSA 2GD4B 4AYYB 4ISOA 5K7RA 3Q3XA 4ESTE 1UK4A 8LPRA 4A5TS 1D6WA 9ESTA 1IQGA 3RM2H 1XUFA 2WUBA 4YZUA 3TH4H 2FOMB 1YCPK 3QK1A 1DLKB 3QGJA 1AKSA 3U69H 1PPHE 3DFJA 2SNWA 3L3TA 1GDQA 2PV9B 5FCRA 3EA9A 1YYY1 3PMHB 2P3FH 7ESTE 3SV6A 4XBDA 1XVOA 1W2KH 1GCTC 2H5CA 5BPEA 3I78A 1P57B 3ZV8A 3TU7H 4DCDA 1XVMA 4FUFA 2TGPZ 3UR9A 1GBIA 4FU9A 1LHCH 3TJNA 1GJ7B 2V35A 1G36A 1UK2A 2ZECA 1VR1H 2PKAA 1Y5AT 1EAUA 1B7XB 1O2KA 3GCTG 3KQCA 2GDDA 1V2TT 2BDBA 3OY6U 3SJ8A 3I29A 1YPMH 2WV4A 1C9TA 3V12A 1EJAA 2A5IA 1XKAC 1FY3A 5A8YA 1QQUA 1SGIB 3SBKA 4LXBH 3EGKH 2FWWA 5EPYA 1SGFA 1QURH 1D4PB 2AYWA 3L6PA 5EQRA 1W11U 1GBKA 3URCA 3MYWA 4I8KA 1NU7B 2VWLA 1KLTA 3UNQA 1FIWA 1SVPA 4GUXA 3D23A 3UNSA 4E7NA 1IQNA 4X8UH 1C5QA 1LHGH 1O2GH 1WTGH 4X1SU 4GPGA 2XW9A 3LGWA 2A4RA 3DA9B 3U9AH 2AFQB 3FVFB 1GI4A 1BHXF 3D65E 5G4BA 3TGKE 2Y5FA 3B9FH 1B5GH 3ZVDA 3F9FA 2H1UA 5HXFA 3A85A 1O3PB 4ISIH 4TPYA 3RMLH 4CREA 1C5LH 2VIVA 4AORA 1Y3VA 1TNJA 2QC2A 4X8VH 1MD8A 1DVAH 2GKVE 4HFPB 4J1YA 1GMDF 3RXBA 3A87A 1UCYH 2TIOA 1C1UH 5C3NA 4OGYA 1IQEA 1HV7A 3MO9A 3A8AA 4TY7A 2VWNA 3ZZ8A 3TJOA 1DWEH 1K1NA 3V0XA 2ZGBH 3RXEA 2ZDVH 4FUHA 6CHAB 1LVOA 2I6SA 1GI2A 8KME2 1TQ0B 1C2HA 2G55A 1QA7A 2OBQA 2OBOA 3U98H 3E16B 2AIPA 3E0PB 1OKXA 4IMQA 2QXHA 1GBHA 1HDTH 3SNBA 1GBBA 1FY1A 1GHAF 4DW2U 1QL7A 1OP2A 1O31A 5DO4H 1K1PA 1HAVB 2OQ5A 3NK8A 5DKMA 4AFSA 1TBZH 4HZHA 1KYNA 1VCQA 3QO6A 3IITA 4BXSA 4Y0ZE 4YM9A 4YO9A 1ABIH 2ZI2H 3U8OH 1HIAB 1J8AA 5E0HA 1GGDC 1ANBA 3CS0A 3FANA 1C5MD 5A0AE 2ZCKP 1SGTA 1HBTH 4AG1A 1GJBB 1QRZA 1GHWH 3OY5U 2RDLA 4JZDH 4X1RU 2Z3EA 3M36A 1GI7B 1O34A 2AGGX 2BM2A 2FPZA 3MU1A 1MU8B 1DY8A 3VB3A 3GDUA 1DICA 1X7AC 3AVZA 3NXPA 1S82A 4QT8C 1DWCH 1KSNA 1WTHD 1TMUH 1O3BA 3U1JB 1MBMA 1PJPA 3A80A 4Q7ZA 2P95A 2P3UB 1O2YA 3FP7E 3GY4A 3EE0B 2UWOA 1PPGE 3T27A 5ESBA 2P93A 1W7GH 4ZAEA 3OYPA 1K1LA 1KXBA 5AHGH 1THRH 3NZIA 4JYVH 2Z94A 4UE7H 3PMBB 1YC0A 1QIXB 1BZXE 4JCNA 2FS8A 4CBNA 1PPFE 1GHZA 1ZTLA 1CA0C 1GVLA 1O30A 2Q1JA 3EA8A 1JWTA 2FX4A 1WOFA 3R0FA 4UD9H 4NZQA 1IQIA 1P3EA 1BTYA 2NU2E 3CS7A 4AG2A 1EOLA 3UQOA 2CMYA 2ZGCA 3KGPA 3SNAA 3BEIB 3RXAA 3ZZCA 2A4OA 3BN9A 4RN6A 4X8SH 1CBWB 2BOKA 1XMNB 1GHYH 1A0JA 2A45B 1V2WT 3SQEE 4AB9A 5GDSH 1MTWA 1UTQA 1BUIA 4FVBA 5GCHG 1BQYA 1PPBH 5AVDA 8GCHF 1L1GA 4I32A 5H4IB 3GYMA 1O5AB 6GCHG 1AFQC 4OGXA