2VIDA

Serine protease splb from staphylococcus aureus at 1.8a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
199
Chain Sequence
ENNVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVDNRNAYGVYFTPEIKKFIAENIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEASE SPLB
publication title Enzymatic Activity of the Staphylococcus Aureus Splb Serine Protease is Induced by Substrates Containing the Sequence Trp-Glu-Leu-Gln.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 56
structure length 199
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vidA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vidA02
1KXBA 1V2WT 3V3MA 3PROA 2VNTA 1QNJA 4DIHH 4GHTA 1ESTA 1UTNA 1NFXA 3FVFB 4CRCA 4LK4A 1O30A 2RG3A 2XYAA 4Y8ZA 5DP3A 1NZQH 3MO3A 5C1UA 1TBRH 1CGIE 1KYNA 1L1GA 4MNYA 3OY6U 1GJ7B 3BEIB 2H1UA 5EQRA 3VB5A 1ZPBA 3VXFH 3MFJA 1AVWA 2G5NA 4R8TB 2EC9H 1OP8A 1MMJN 4ZROA 4OS7A 1PQ7A 1QHRB 1NRQH 2WPKS 2Q6DA 1BJVA 1V3XA 3A86A 1FMGA 4KGAA 1AZZA 1LDTT 2FOCA 1EZXC 1C5MD 2ZNKH 5CHAB 3GCHB 2GD4B 5EW2H 2EI8A 1NRNH 3AW1A 1GI1A 9LPRA 1HAPH 2P93A 1Z1IA 1HAVB 1LMWB 4X2VA 1GGDB 1GJ5H 1XM1A 3BSQA 2J92A 3SOSA 1BITA 2FLRH 4B74A 2WV5A 4IC6A 1MKXK 1DM4B 2GCHG 2WYJA 2FDAA 3SHCH 1EPTA 3RXHA 1SGEE 3ATMA 4CREA 1O3DA 2F9OA 4X1SU 3UOUA 1RTLA 1S84A 1MCTA 1K2I1 5ESTE 4GPGA 3SBKA 4JYVH 1QGFA 2DE9A 2WV4A 3F9FA 1D3DB 4Y8YA 3BG8A 3EDXB 2XWBI 1SGIB 1L0ZA 4INHA 4I7YH 3T29A 2VGCB 1XKAC 4BANB 1QIXB 3VPKA 1CO7E 1C1NA 2YOLA 5AHGH 1T7CA 1P8VC 2BXUH 5E0JA 1DSTA 2BD9A 3KN2A 2JH6D 2V0BA 5E0GA 3BTQE 5JBTA 1HFDA 5C2ZA 1O5FH 1O3NA 2Z9JA 4YOGA 1ELVA 1YLCA 3BG4B 3GYMA 1GI2A 3SO3A 1LHCH 5DP4A 2GV7A 2TBSA 1O3FA 2V3OH 5DPAA 4ZXYH 4D7FA 2FMJA 3GICB 4AORA 2C8XB 2ZPRA 5PTPA 3A80A 1P11E 3H5CB 3TJUA 3LGWA 2AFQB 1O2QA 4J2YB 1LPKB 3P8NA 2AH4X 2ZFRH 3RXFA 4IGDA 2CN0H 1IHSH 2GDDA 3MU0A 1XUFA 1MTWA 2AIPA 2TPIZ 1TE0A 1THPB 5FPTA 3P95A 2XBXA 1TGBA 1VITF 2F9VA 4ZKOU 5HM9A 2ULLA 3BTFE 1XMNB 2XRCA 4NIXA 1WQSA 2KAIA 3SNEA 5TCCA 3E8LA 4AFSA 1OX1A 4J1YA 5T6FA 3MU8A 5J4QA 2ASUB 1QJ1B 2A5KA 3SORA 5DG6A 2ALPA 1D3PB 2FOFA 5EG4A 1VCWA 3R0FA 1M9UA 4Q7ZA 1GVZA 6GCHF 1DUAA 3L33A 4GCHF 1N8OB 4ISNA 2UUFB 3PTBA 2BHGA 7GCHG 1UJ1A 2XNIA 1G3BA 3QK1A 2A5AA 3CP7A 1IQKA 1MQ5A 4A7IB 3JZ1B 2BDIA 2BQ7B 2G4TA 3ZZAA 5HXFA 8GCHF 1D3TB 4INKA 1O2HA 3SUFA 3D65E 2ODPA 1P06A 2ZQ1A 1DICA 1O2SA 1OWEA 1TB6H 1VGCB 4KTSA 5ABWA 2J34A 1P2JA 1A0JA 3EA9A 1SHYA 4ZKSU 1MTNC 3UOPA 4XBBA 2ZHDA 2QA9E 2LNCA 1TQ7B 1E34B 1SR5C 2BX4A 5ESBA 1ABJH 2THFB 1MD7A 3PYHA 1QURH 1TYNA 2QF0A 2OD3B 3IITA 4B2BA 1OWDA 1GBDA 4DW2U 1CA8B 1BTZA 2PFEA 2ZDAH 2BD5A 1GHWH 2HLCA 2PHBA 1BRBE 1NU7B 1NRRH 2BD2A 2ANWA 4OS1A 1SGFA 4ABFA 5ETXA 5C1XA 2RA0A 1GI4A 1FPHH 1W13U 4ABHA 1MZAA 3ZV8A 1PPZA 1IQNA 2FIRH 3HKJB 4K2YA 1GMDF 1J16A 2D8WA 1BTYA 2QGRA 1GBBA 1GG6C 1GI7B 4IN1A 4O03A 2FTMA 5AFZH 5EU8A 3QZRA 4HGCA 3LC3A 4ABJA 4ABIA 1HCGA 1TGSZ 2ZHFH 3UY9A 1ZSLA 4E05H 7ESTE 1UVSH 2WPJS 5A8ZA 3P92A 3MWIU 4QT8C 1KLJH 2QC2A 2ZU5A 1CA0B 1O2RA 1H1BA 2CV3A 4DIIH 4IW4E 1QFKH 3QGNB 1O32A 1VJAU 4GSOA 1TGCA 1O2NA 4AG2A 4FU8A 4MNWA 1VZQH 3M35A 4NFEA 4BAOB 2H9EH 2NU0E 2XCFA 1SGTA 1O31A 3GOVB 5FCRA 1C2GA 1NRPH 4DT7B 3QDZB 4UONA 4X6OA 2FM2A 1SI5H 4FU9A 3UWIA 3KEEA 2ZECA 5F6MA 1Y3VA 1O3KA 1DWDH 3F9HA 1GBIA 4JYUH 1SQTA 2ZG0H 1AKSA 1HAHH 1LCYA 1Q3XA 4AYYB 4ZHLU 2Q6FA 3BF6H 3QUMP 3N7OA 1GL0E 3GY8A 2FODA 1FNIA 1KIGH 1GHVH 4Q7XA 3GDSA 3NKKA 4GCHG 3U8RH 1CU1A 3BV9B 4NA8A 1SOZA 2FOHA 3P8FA 1V2NT 3KQBA 1C4Y2 2ILNA 1PYTC 4ZAEA 1DDJA 1BTUA 4FUDA 1BTPA 1DOJA 4X6MA 3HK3B 2GT7A 2O8WA 1SGFG 2FOBA 3LH1A 4NWKA 3UUZA 3M36A 4CH2B 1ID5H 1EAUA 3TK6A 1LQDB 1J15A 1J14A 3BTGE 3P70B 5DKMA 2SGFE 2Y81A 2D1JA 1SFIA 4ZUHA 1YP9A 1YPMH 1ETRH 4TWYA 3TITA 4D76A 3T28A 2A7JA 1GCDA 2FI3E 5JBCS 3O8CA 3QLPH 1WCZA 1EATA 1P3CA 1CQQA 1TPOA 5FBIA 4F4OC 1C5PA 4NG9H 1PYTD 1TX7A 1F0SA 2ZC9H 1AO5A 5HYOA 5L2ZH 5C5OA 4RN6A 1SGYE 3LGUA 3A89A 3TH4H 3RXLA 4Y6DA 1ORFA 1UTPA 2FOMB 4MG3A 1BMMH 5E2OA 2WUCA 1HUTH 3KQDA 3S7KB 2HPQH 3L3TA 2B9LA 3FZZA 1P04A 1BTHH 1Y5AT 1DUEA 3RXKA 2FYRA 4AFZA 1GI6A 5L6NH 3T25A 1MKWH 1C4V2 2SNWA 3PMJA 1OWKA 2OUAA 5EQQA 1O2JA 1C5YB 2A2XH 3RU4D 1SLWB 1XVOA 3E0PB 3KCGH 2SGAA 2BDYA 2OLGA 1IQIA 1LHEH 1KTTB 6CHAB 3RXSA 2B7DH 1TA6A 2JETC 1C5VA 1K1IA 3RC5A 1SGRE 2AGGX 2Y7XA 3TK9A 3O8DA 3Q3KA 4X6NA 5HMAA 2AERH 1C2EA 3NXPA 4MVNA 2OC8A 1IQEA 2A45B 3ZZDA 5E8EH 2ZO3H 4GAWA 2H9TH 4XOJA 1ELFA 3SGBE 1JXPA 1RIWB 3S9AA 2O8MA 3W94A 5LH8A 2XBVA 3GCHC 2EA3A 3IWMA 5L2YH 5DO4H 1J17T 1IQGA 1ARBA 3EQ0H 3T27A 1RXPA 2A4QA 4XFQA 2ZWLH 1UO6A 5EGMA 1F5KU 3A7TA 1O2TA 3UQOA 1W10U 2YNAA 2FOEA 1D6WA 5DJ7A 2OINA 4CRFA 2QV1A 2SNVA 1GG6B 3SNBA 3E91A 1T8NA 3F6UH 4ZXXH 1GBAA 1OP2A 4IMQA 5DP9A 1C1PA 1IQMA 2R3YA 1H9IE 1YYY1 2GTBA 2W7UA 4IS5A 5F8ZA 3TIUA 3SNDA 2AEIH 8KME2 2ZFTA 4HFPB 3ZZ3A 1YM0A 1GHYH 1HPGA 1PPGE 2PW8H 9ESTA 1TMBH 1GBEA 1CHGA 1OXGA 2C8ZB 2GGVB 3LDXH 3Q3YA 1TNHA 3LGYA 1NFUA 1O2KA 1NS3A 2FS9A 2NU1E 1JIMA 1K22H 1O2VA 5A8YA 1JMOH 4MPVA 2GT8A 2QN5T 3M61U 4WH6A 1SQAA 3ZZ9A 1LVOA 1KXAA 4LZ4B 2PGBB 3ELAH 3MOCA 1BRCE 1O2ZA 1V2VT 3HGPA 1ZTJA 1JRSA 3VB6A 2ZGBH 3GDUA 3M5OA 2BD3A 2QXGA 2OXSA 3RM2H 3MO6A 4FXGH 4ESTE 5JPMH 1O5BB 3E1XB 2YNBA 3ZZCA 4WMFA 5AFYH 2V6NA 1P2NA 3EA8A 1TGTA 3LH3A 1UHBA 3LONA 1G3EA 4BAKB 4ABEA 3GDVA 4K8YA 2GCHF 3K2UA 3ZZ4A 2VB0A 3R3GB 4X2WA 2O8LA 1JOUB 1EOLA 1ANDA 1O33A 3M7QA 1ZMJA 1TBZH 3TVJB 3TH2H 1LVBA 1GHBG 1O35A 1T4VH 3SU4A 4INLA 2ZPQA 5AF9H 4AYVB 2NU2E 1AFEH 4WH8A 1P0SH 5GXPA 1NY22 4TY7A 1BMNH 1JBUH 1DY8A 2FS8A 3L6PA 2H9HA 4A92A 1GBCA 2CHAC 4F49A 1L2EA 2GZ8A 4CRDA 4DVAU 2ANMH 3QZQA 3C27B 1K1LA 1YPLH 4YOIA 2J4IA 3RXVA 2C90B 1GBHA 1FAKH 2F3CE 2RCEA 3ZVDA 2ZPSA 3BTDE 3U69H 1H9HE 1B5GH 4LOYH 5GWZA 4FVDA 1N8OC 3S7HB 2G55A 3FANA 1QY6A 1W12U 2ANKH 1WV7H 2PLXA 2GP9B 1P2IA 3TNTA 5F8TA 4WMDA 5BRRE 2IN2A 2JH0D 1MUEB 4Y7AA 2ZDMA 1HGTH 2Z3DA 1O2LA 2BQ6B 2BB4A 2C3SA 2O8UA 3RC6A 1IHTH 1DFPA 1SBWA 3CENA 4JZFH 2ZA5A 2GZ9A 2C4FH 1BRUP 1AVXA 3P8GA 2BYAX 1QJ7B 2BVSH 2ZQ2A 2UWPA 4VGCC 1O3JA 1UK4A 1O36A 1ARCA 3DFJA 1BMAA 1P2MA 3SNAA 1Z8IB 4K60A 1C1MA 1P2OA 2J2UA 1P3EA 2W7SA 3SJ9A 5FPYA 3UWJH 1RTFB 1O2OA 2JETB 3RMLH 3QWCH 4K1SA 1C5NH 2P8OC 1PPFE 3GCTG 1UCYE 1ZZZA 1C5QA 2VH6A 2XC4A 3MU4A 3VB4A 1GI9B 1G3DA 3MNCA 2VWMA 4Y0ZE 3RMNH 3F1SB 3A7XA 3LKWA 1QRZA 4YZUA 3FFGA 4K8BA 2FOGA 2CXVA 3EE0B 1BJUA 3U8TH 2AYWA 1PPBH 2ZU2A 1UCYH 1C2MA 2G4UA 4ZKNU 3RU4T 3SU1A 4X8TH 4Y11E 3A88A 1CA0C 2ZGHA 1S83A 7GCHF 2HRVA 4IC5A 1GBLA 1P09A 4MNVA 5DP5A 1ESBA 2VH0A 1C2HA 1Y5UT 4JK5A 1V2KT 1TONA 3RXCA 3RXRA 4YM9A 3UPEA 5DP6A 1PQAA 3HK6B 4AGJA 4ISIH 1GVKB 4MTBA 2XBYA 4HI3A 2RA3A 1UTOA 3Q3XA 3Q76A 4MDSA 7KMEH 1QCPA 1QQUA 1MCVA 1EP5A 1G2LA 4E7NA 1GJ6A 1CT4E 5HGGA 3MNXA 1O5AB 2GMTC 3EAJA 1ZRKA 4FUHA 3DD2H 4KTUA 4OS6A 1O2IA 3RXUA 2Y5FA 4DOQA 1DSUA 3KQEA 1MZDA 4HZHA 1NESE 2ZDNA 1YPGH 1E35B 1P9UA 1S82A 3F9EA 2PKAB 3SGAE 2ODQA 2Z94A 2AMPA 2PGQB 1F0UA 3M5NA 3FP8E 2OQUA 1S85A 1DT2A 2HNTC 4RKJB 1PPEE 1WU1A 2H5CA 3DHKH 4BTUB 1O2XA 3GY5A 4H42U 3SV2H 1Q31A 3ATLA 2PR3A 3MH5A 1C1UH 1P2KA 4I8GA 1ELGA 4H6TA 2W3KA 3RXPA 3VXEH 2XXLA 2FI5E 1EAXA 2DUCA 2VIOA 4BAQB 2TIOA 2G52A 4ZHAA 4FUGA 4I32A 3STIA 1PPCE 1CT2E 1FY5A 4Y0YE 2GX4A 4LZ1H 1SGCA 1LKAA 4FU7A 1A0LA 1C9TA 4A1XA 2G51A 3BIVH 1K9OE 2ZDVH 2ZHWH 2ZTYA 5H4IB 1V2JT 2JH5D 2PKSC 4SGBE 4FUEA 1BA8B 1SGPE 1RS0A 2OTVA 2Q1JA 1O3CA 2CHAB 1D9IA 3Q00A 4TYDA 2TGAA 3LOXA 4NGAH 2J95A 3SGQE 1SMFE 2BMGB 2HALA 4NZQA 4Z0KA 1KDQA 2VIDA 2XC5A 1X7AC 1DLKB 2F9BH 1O2PA 4FUBA 1V2ST 1SB1H 2BOHB 2QAAA 4DY7B 1TGNA 1BBRE 2Z9LA 1GBFA 4AX9H 2Z9GA 1B0EA 3ZVAA 1RD3B 1BUIA 3VGCC 1VJ9U 1S81A 3E6PH 1V2LT 1B7XB 2V3HH 2BDAA 4KP0A 3T2NA 2FYQA 1A2CH 6CHAC 4OGXA 4BXSA 1G32B 3SW2B 2R2WU 1OYQA 1BBRH 2ZFQH 3M7UA 2A2QH 1KY9A 1YCPM 1FN8A 2ZFFH 4YLQH 3PLKA 2QF3A 3SQHE 4K69A 1A46H 2GKVE 3P17H 4UDWH 1RIWC 2UUJB 3MI4A 4VGCB 1K1OA 3ITIA 3TH3H 1Y3YA 2VWLA 1QA7A 3NUMA 1DWEH 1GI8B 4B75A 1GMHG 3BTWE 3RU4E 1EQ9A 1AE5A 3TGJE 5EOKA 1QL9A 1LTOA 4XBDA 1FN6A 4ISHH 3ATKA 5K0HA 1C4U2 1MKWK 1CT0E 2OBOA 1AB9C 1H4WA 1XUJA 2P8OB 2P94A 1HAVA 1CGJE 1P05A 3OU0A 1OP0A 1TWXB 2QCYA 4TPYA 1Y3WA 2OC7A 2ZU1A 1O2WA 2LPRA 3PMAB 1YLDA 3GY3A 1LPGB 4NA7A 2A4OA 2AIQA 4R0IA 1F0RA 4DCDA 1WBGB 2WYGA 2BD4A 3PM3A 1ZOMA 4X8UH 3ZZ8A 1V2UT 1P57B 3PWCA 3RXIA 4KTCA 3SQEE 1WTHD 5F03A 3ZZ6A 3ZZ7A 1ZTLA 1DXPA 1P12E 3K6YA 3KNXA 2FOAA 5LPFA 1L4DA 1GI5A 1FONA 1CHOG 1XUHA 3RXEA 1GBMA 3RXMA 1ZJKA 2J9NA 1TNJA 2VWNA 3PTNA 3T5FH 1OOKB 1P02A 2BY5X 5E2PA 3SV6A 1EPTC 1O3EA 1TNKA 1W7XH 4NIWA 4NZLA 2I6SA 4OS5A 1G3CA 1C2DA 1Z6JH 3AASA 1BQYA 1VITH 3RMMH 3RUOA 4Y76A 3SU3A 2ZU4A 2QYIA 2QXHA 1CGHA 1C2IA 1TNGA 2ZCHP 3ZVBA 2GMTB 1K28D 1O3LA 2BLOA 2BVRH 1KXDA 5GPIB 3D23A 1HYLA 3B23B 2CMYA 1AU8A 2BDCA 2UUYA 5EW1H 2ZCKP 1BHXB 4I8LA 2SGEE 1S6FA 1PQ8A 1TAWA 1F0TA 3RP2A 4FUJA 5CE1A 1SHHB 3K9XB 3RXOA 1AVGH 2A5IA 4YOJA 1ZRBA 3HGNA 1HAGE 1TMTH 1QQ4A 1FIWA 3TGIE 1NPMA 1ZMLA 5GDSH 4IBLH 1TLDA 2XWAA 4ASHA 3BEUA 3ZVFA 3CS7A 2PTNA 1NFWA 1ANBA 3LGTA 4X8VH 1HBTH 2AMQA 1OWJA 4ABAA 1O0DH 2ZGJA 1GL1A 2BDBA 1N1LA 1GJBB 4NIVA 2A7HA 1H8DH 4JZDH 4Y8XA 5JBBS 4AG1A 2AS9A 2ANYA 1VR1H 3PLBA 3OTJE 2FWWA 5C5NA 2DE8A 2A32A 2WPMS 1MTVA 2WINI 1Y5BT 2GVFA 1AHTH 1BZXE 1T32A 2PKSB 2Y7ZA 3K6ZA 2XW9A 2C93B 4GHQA 3SJ8A 1XUIA 3H7TA 2P3UB 2SGPE 4Y79A 2Y5HA 2BY7X 2A1DB 3ZYEA 4I33A 3UR6A 2VU8E 1ZR0A 5EPNA 2XCNA 2VIPA 4KELA 2SGDE 3S69A 1ANCA 3MNBA 1OS8A 3GY4A 1EX3A 1IQHA 3TGKE 1HIAB 1K1NA 2GDEH 1YBWA 3V7TA 3QN7A 3KHVA 5FCKA 2ZHEH 3VGCB 1T8LA 4NA9H 3AW0A 4BTIB 4DGJA 2P59A 4AN7A 1KXCA 3PMBB 1GHBF 1V2MT 2CGAA 4JZEH 1QL7A 1C9PA 4A1TA 4NSVA 4AB8A 1QA0A 3DUXH 2GCTC 4ZKRU 1DWBH 1OSSA 1V2QT 1O2UA 1TPPA 1UVPA 1ZPCA 1EAWA 4Q80A 1DX5M 1IQLA 1O5CB 1DE7H 1V2OT 1ZJDA 2HGTH 5FAHA 3S9CA 2UWOA 4YT7H 3UNRA 2ZTXA 3M3TA 1TFXA 1QBVH 1SLXB 4YO9A 2I6QA 3ESTA 5T6DA 4BTTB 3F9GA 1BDAA 1ANEA 1MU8B 1XUGA 1BIOA 5SGAE 4U32A 1C2KA 1GPZA 1GBJA 2SGQE 1SQOA 1FZZA 1K21H 4K3JA 1E37B 5T3HA 2EI7A 2OC1A 2VIWA 1AB9B 4WJG2 1GHXH 2BX3A 2P3FH 1ELDE 3WY8A 3SJIA 5CMXH 1DY9A 2HWLB 1BT7A 3M3VA 4LXBH 1HDTH 2TGTA 2STAE 4NCYA 5LGOA 4CRBA 3UQVA 3TNSA 1CE5A 3UTUH 2R0LA 3UNQA 3OY5U 4GVUA 3D62A 3BTHE 2Z7FE 4MPWA 1TA2A 1TRNA 1O34A 1TQ0B 2Z9IA 2TRMA 1EKBB 3TJVA 1XVMA 1V2PT 1F92A 3DA9B 3MTYA 2IJOB 1O5EH 1UTKA 2ZGCA 1OWHA 1PPHE 4MLFB 2AMDA 1KXEA 1F5RA 2BLQA 1UCYK 2QY0B 3Q77A 3A8CA 1TABE 2FXRA 3NWUA 5DK1A 1IQFA 2OP9A 1KTSB 2J94A 3GCTF 1EPTB 3GY7A 3ATWA 1QR3E 1ELEE 1LHFH 2PTCE 1BRAA 1GHAG 1UVOA 1ELAA 4RKOB 1BTXA 1O3OA 2P95A 2W3IA 3QTVH 4OS2A 1GJ9B 2OBQA 4AB9A 1PFXC 4PROA 4WXVA 2BOKA 3A7YA 3E3TA 4B2CA 2ZHQH 1K1PA 1O2YA 3PV4A 3BTEE 4B2AA 1H9LB 1XXDA 2Z9KA 1QL8A 1NM6A 1C5XB 1UVUH 1C1TA 1FDPA 3SV8A 1WYKA 1UK2A 4Q7YA 4U01A 1THSH 2BZ6H 2A31A 5FBEA 1OYTH 1DXWA 1QBNA 1TNIA 2FP7B 3I78A 3M5MA 1W3CA 1UK3A 3RLWH 4MNXA 3T62A 1AD8H 3U8OH 4X1QU 1G2MA 4BAHB 4X1NU 1Z7KA 1ZSJA 1NROH 2P16A 4O9VA 1YPJH 3K65B 4Y7BA 4ISOA 4NWLA 1W14U 3ZVEA 1QBOA 3URCA 1V2RT 4TPIZ 3CS0A 5B6OA 3QX5H 3HKIB 2NU3E 2TGPZ 1AI8H 3RXQA 4AGKA 5I25A 4UFFH 1RFNA 4O3UA 2QIQA 3C1KA 1UTJA 5DP7A 4D9QA 1Z1JA 3PLPA 3U9AH 2VJ1A 1Z8GA 1GI3A 3KQCA 3ZZBA 2HNTE 2XTTB 1EB2A 4CHAC 4IMZA 2ZTZA 1W8BH 1W0ZU 2BD8A 1SC8U 3MHWU 1TPSA 2KAIB 1A7SA 3V13A 4ZH8A 2ZDKA 2ZF0H 5DGJA 3TPIZ 1O3IA 1EB1H 3LGIA 5EPYA 5BPEA 5C67A 4CBOA 1C1QA 7LPRA 1YPEH 2C8WB 4YTAA 1UTMA 2WPIS 4B76A 4JZ1A 4BAMB 1F7ZA 3FP6E 2AGIX 5J4SA 4UFDH 3NCLA 5C1YA 2VIQA 4ZMAH 1C2FA 2GCTB 5FHTA 1FI8A 1W0YH 1FY3A 5AVDA 5EODA 1LPZB 4YESB 1HAYB 3B9FH 2QXIA 1RJXB 3SNCA 1LKBA 1D3QB 2FX4A 4NIYA 1V2TT 1ZHPA 2VINA 3RLYH 5A09A 2BY6X 2A0QB 2Z3CA 1BBRK 1C2LA 1Q2WA 2CJIA 2Y80A 3KIDU 4TWWA 4D7GA 1HNEE 2VVCA 5JDUB 1TOCB 1AWHB 4Y71A 1K1MA 4D9RA 1UTQA 3PMHB 1JIRA 3I77A 3QTOH 2ZP0H 5A0BA 4MPXA 3UFAA 3RDZA 4CRGA 3RXTA 3FZDA 2FESH 1YPHE 5C3NA 1CBWC 3LJJA 4D8NA 1C1VH 1HAXB 2ZU3A 1HJ9A 2IPHA 4BOHA 3U1JB 1ELBA 1E36B 4CRAA 4DURA 2BTCE 1C1OA 3NK8A 2FX6A 2PUXB 5GCHG 4U30A 4CR9A 1ZGIA 5GIBA 1HLTH 1C1WH 3RC4A 1A0HB 2A7CA 3IG6B 4JMYA 3H7OA 4HTCH 2FTLE 3TLOA 3UIRA 1FY1A 2W5EA 1YPKH 3MU5A 1L4ZA 1YC0A 2OQ5A 1EZQA 1GMHF 5JB8S 1DWCH 3BTTE 1C5LH 1GMCG 2A4RA 3D49H 1AGJA 2ZFPH 4H6SB 3SI3H 3A7ZA 1MH0A 1J9CH 3RXDA 4BNRA 3LT3A 4U2WA 3RXAA 1W7GH 1MTSA 4WMEA 3W95A 1TMUH 1MU6B 3VB3A 2R3UA 3M3SA 1ACBE 4WWYA 3TU7H 1NFYA 2W26A 1INCA 4UE7H 1S0RA 2FEQH 3FP7E 2Y5GA 1GVLA 3GY6A 3O8BA 3SZNA 1AKSB 4CBNA 3MH6A 1HXEH 1Y8TA 3TJOA 1NC6A 2ALVA 4ISLA 1EASA 3A81A 1CHOF 3RXGA 2XBWA 3MH7A 4FVBA 2H2ZA 1YCPH 3ENSB 1MD8A 1A3BH 1FAXA 1SL3A 4B71A 2G81E 1O5GH 2BY9X 1QTFA 2K1QA 2ZEBA 5HM2A 1ABIH 2BLWA 2RDLA 3UR9A 2PSYA 2H5DA 1GBKA 1VCPA 1LVMA 4GLYA 1GJCB 3HATH 1BOQA 2B0FA 1S0QA 1T31A 4WF8A 1O3PB 5K7RA 3A82A 2F83A 5A2MH 1O5DH 3LJOA 1EOJA 1P01A 1JRTA 1RGQA 3A8AA 3O8RA 4X2YA 1GDUA 4X1RU 4WY3A 2BDHA 1F2SE 1O2GH 1OWIA 3G01A 5EQSA 4CHAB 2WUBA 3NZIA 3JZ2B 3P8OA 1HV7A 1YPHC 1A5GH 3A8BA 1AQ7A 1ZGVA 2F9UA 1PJPA 1D4PB 4M7GA 2PWXA 1THRH 1EZUC 4CR5A 3U98H 4I8HA 1A3EH 2F91A 4FUCA 3BN9A 1C2JA 2FPZA 5JYIA 3EYDA 1NU9A 1G37A 2Y6TA 1O2MA 3ZZ5A 2G8TA 3SU2A 1AFQB 1OKXA 5A0CA 1XX9A 1NO9H 3SU6A 1TRMA 3KL6A 1GJDB 1WTGH 1WAYB 3RXJA 2A4GA 1EJAA 1ZYOA 4DJZB 1O39A 1MKXH 1Z8JB 4B73A 3BEFB 4X8SH 1FXYA 3LU9B 1ELTA 1ZPZA 1ESAA 1RRKA 5GJ4B 5I46H 1FLEE 1SLVB 1HXFH 2OC0A 1QRXA 1KSNA 3NPSA 1Y3UA 1DPOA 1A4WH 1O3BA 2VIVA 1AUJA 1SG8B 1A5IA 1HAOH 1ZTKA 1LHGH 2JKHA 2PSXA 1UTLM 4WVPE 1MBQA 2VWOA 5DP8A 1A5HA 1N6XA 1F5LA 1ELCA 1HAZB 2ZI2H 1CBWB 2R9PA 1HB0B 1ZSKA 1SGDE 4GUXA 1V6DA 1EUFA 1LO6A 1EP6A 1FQ3A 1Y59T 1TPAE 1IAUA 1J8AA 3DT0H 4MPUA 1FV9A 1AMHA 2BVXH 4X6PA 1SFQB 2WPLS 1T8MA 1XKBC 3ZVCA 1RTKA 1AY6H 3M37A 4O3TA 2SFAA 5TJXA 4UD9H 3S9BA 3AAVA 2GV6A 5EXMA 1SPJA 2PKAA 3V12A 2NWNA 3PO1C 1AIXH 1VITG 4UFEH 4Z6AH 2WPHS 1C5TA 3E90B 5A8XA 3SV9A 4ABBA 2PUQH 5L30H 1GJ4H 1ZMNA 1C1RA 1CSOE 1QB9A 1GCTC 3DFLA 5FXLA 2ODYB 1YKTA 2NU4E 1H8IH 3PB1E 1L1JA 2D26C 1JWTA 1T4UH 1YGCH 5EXLA 4AFUA 4K1TA 3ODDA 5IDKA 5JB9S 3MMGA 2STBE 1W11U 2HOBA 3MO9A 3PWBA 6GCHG 1GDNA 1TNLA 3QO6A 4ZHMU 3UREA 1HJ8A 1AZ8A 4AZ2B 3LC5A 1E38B 1DLEA 2BDGA 1TRYA 2IOTA 3MU1A 1NT1A 3SI4H 1BMLA 8GCHG 2BQWB 3EGKH 1MAXA 1UHBB 1UMAH 2B5TB 1WQVH 1NTPA 1U6QA 1G30B 3T26A 3SUDA 3S0NA 3LGVA 1T8OA 1ETTH 3FAOA 3SU5A 4XDEA 1GHAF 3GYLB 1VCQA 1SOTA 1Z71A 1DITH 2OCVB 4X1PU 4NFFA 2CF9H 1A61H 2Y82A 4IN2A 3TK5A 2VVUA 3UNSA 1HJAC 2BZAA 3HPTB 1TBQH 4TY6A 1GBTA 1P10A 3URDA 5FX6A 1SLUB 1C1SA 3BTME 4AOQA 1AWFH 1GMDG 3ODFA 3MNSA 1K1JA 4I31A 1YF4A 3VEQB 2O8TA 1G36A 4Q2KA 1ZLRA 5E0HA 3LPRA 3RM0H 2R0KA 1O3AA 2O9QA 1EJNA 3VB7A 2G00A 3ZV9A 4XBCA 4XSKU 2ZZUH 4RSPA 3RMOH 1DVAH 1Y3XA 1C5UA 6ESTA 4AFQA 4FUFA 1FIZA 5LPRA 4A1VA 1FY4A 2V35A 5F8XA 4MQAA 2F9PA 1FPCH 1C5SA 3A85A 1OPHB 3OSYA 4K5ZA 1QB1A 5T6GA 5G4BA 3GCNA 3ZYDA 2ZCLP 1FJSA 4ABGA 1GJ8B 1NRSH 2ZKSA 1SVPA 1HRTH 2ZDLA 3SJKA 3OX7U 1EJMA 3B8JA 3V0XA 1O3HA 2VVVA 3E0NB 2QXJA 1MTNB 4Y10E 3GCOA 4SGAE 1GI0A 2HVXA 1S6HA 2PV9B 3A87A 3AAUA 1FY8E 1S5SA 1SGQE 4ABDA 3A7WA 5CHAC 4O97A 3KF2A 1DS2E 1A1RA 1O37A 2FI4E 1C5RA 1BB0B 2UUKB 4THNH 4KKDA 4X2XA 1GGDC 1C5ZB 1BTWA 1TX8A 3A7VA 3GY2A 2CF8H 1BHXF 1WOFA 1P2QA 4JZIA 1P9SA 1SSXA 5C20A 8ESTE 2AGEX 3SUGA 4E06H 1TX6A 5TCAA 5A0AE 1LQEA 1ZHMA 1SGNE 1KLTA 1LHDH 4OGYA 2HNTF 1AUTC 2G5VA 3M5LA 3LIWA 1IQJA 3STJA 1DANH 5JBAS 4A5TS 2M5TA 3SUEA 2EI6A 1MQ6A 2VGCC 2BXTH 1NN6A 1GJAB 1O38A 1ZHRA 1KXFA 3ZVGA 1Z8RA 1O3MA 3E16B 4BXWA 2J38A 4JCNA 1IOEA 3AVZA 3KGPA 1MBMA 2D2DA 3PO1B 5FPSA 6LPRA 8LPRA 1CVWH 1AE8H 4CH8B 2BM2A 2ZFSA 4I8JA 4FUIA 1D6RA 2ZIQH 3BG4C 1GCTB 4K1EA 1QB6A 2P3TB 1QJ6B 1GHZA 2TGDA 2Z3EA 2BLVA 1WSSH 4UFGH 3EA7A 2FLBH 3VFEA 1E0FD 2EEKA 1PQ5A 4WXIA 4E7RG 1HAIH 2Q6GA 1C5OH 3SN8A 1EAIA 2H6MA 2HPPH 5GCHF 1WUNH 2FO9A 2FZZA 3QGJA 2F9NA 1XUKA 1GWAA 3BIUH 4H4FA 4A6LA 1P03A 3M7TA 4UEHH 1L1NA 4OS4A 3U1IB 3P6ZB 4X0WU 1C5WB 4YT6H 1GMCF 3A84A 1N6YA 4DG4A 1B0FA 3TJNA 2BD7A 5FX5A 3SV7A 3SHAH 2B8OH 1TALA 1HIAA 2XC0A 1UVTH 3A8DA 4JYTA 2BY8X 5EXNA 3RXBA 2C8YB 5IYTA 4XE4A 4I8KA 3MH4A 1MAYA 2Z6BD 2UWLA 2ESTE 3A83A 1O3GA 3SU0A 1KLIH 1YCPK 2R2MB 2ZGXH 1EZSC 1HJAB 1GDQA 3MYWA 1TIOA 1LVYA 1FUJA 1Z6EA 1XXFA 1KDQB 1EXFA 1TOMH 3I29A 3SJOA 4NSYA 4JK6A 1AN1E 4YLUA 4B1TA 1ETSH 3F68H 5LPEA 1MTUA 1G9IE 1AFQC 3ATIA 1QRWA 2GZ7A 1VGCC 1BCUH 3OYPA 1W2KH 3BTKE 3GISB
chains in the Genus database with same CATH superfamily
1KXBA 1V2WT 3PRBA 3V3MA 3PROA 2VNTA 1QNJA 4DIHH 4GHTA 1ESTA 1UTNA 1NFXA 3FVFB 3DSPA 4Q4LA 4CRCA 4LK4A 1O30A 2RG3A 2XYAA 4Y8ZA 3PV5A 1NZQH 5DP3A 3MO3A 5C1UA 2RDEA 1TBRH 1CGIE 1KYNA 1L1GA 4MNYA 3OY6U 1GJ7B 3BEIB 2H1UA 5EQRA 3VB5A 1ZPBA 3VXFH 3MFJA 1AVWA 2G5NA 4R8TB 2EC9H 1OP8A 5HKKD 1MMJN 4ZROA 2JDID 1S6LA 4OS7A 1PQ7A 1QHRB 1NRQH 2WPKS 2Q6DA 1BJVA 1V3XA 3A86A 1FMGA 4KGAA 1AZZA 1LDTT 2FOCA 1EZXC 1C5MD 2ZNKH 5CHAB 3GCHB 2GD4B 5EW2H 2EI8A 1NRNH 3AW1A 1GI1A 9LPRA 1HAPH 2P93A 1Z1IA 1HAVB 1LMWB 4X2VA 1GGDB 1GJ5H 1XM1A 3BSQA 2J92A 3SOSA 1BITA 2FLRH 4B6EA 4B74A 1KMHB 2WV5A 4IC6A 1MKXK 1DM4B 2GCHG 2WYJA 2FDAA 3SHCH 1EPTA 3RXHA 2JJ2D 1SGEE 3ATMA 4CREA 1O3DA 2F9OA 4X1SU 3UOUA 1RTLA 1S84A 1MCTA 1K2I1 5ESTE 4GPGA 3SBKA 4JYVH 1QGFA 2DE9A 2WV4A 3F9FA 1D3DB 4Y8YA 3BG8A 3EDXB 2XWBI 1SGIB 1L0ZA 4INHA 4I7YH 3T29A 2VGCB 1XKAC 4BANB 1QIXB 3VPKA 1CO7E 1C1NA 2YOLA 2M2AA 3OEHD 5AHGH 1T7CA 1P8VC 2BXUH 5E0JA 1DSTA 2BD9A 3KN2A 2JH6D 2V0BA 5E0GA 3BTQE 5JBTA 1HFDA 5C2ZA 1O5FH 1O3NA 2Z9JA 4YOGA 1ELVA 1YLCA 3BG4B 3GYMA 1GI2A 3SO3A 1LHCH 5DP4A 2GV7A 2TBSA 1O3FA 2V3OH 5DPAA 4ZXYH 4D7FA 2FMJA 3GICB 4AORA 2C8XB 2ZPRA 5PTPA 3A80A 1NBME 1P11E 3H5CB 3TJUA 3LGWA 2AFQB 1OHHD 2WHXA 1O2QA 4J2YB 1LPKB 3P8NA 2AH4X 2ZFRH 3RXFA 4IGDA 2CN0H 1IHSH 2GDDA 3MU0A 1XUFA 1MTWA 2AIPA 2TPIZ 1TE0A 1THPB 5FPTA 3P95A 2XBXA 1TGBA 1VITF 2F9VA 4ZKOU 5HM9A 2ULLA 3BTFE 1XMNB 2XRCA 4NIXA 1WQSA 2KAIA 3UAIC 2L6OA 3SNEA 5TCCA 3E8LA 4AFSA 1OX1A 4J1YA 5T6FA 3MU8A 5J4QA 2ASUB 1QJ1B 5CHBA 2A5KA 3SORA 2JIZD 5DG6A 2ALPA 1D3PB 2FOFA 5EG4A 1VCWA 3R0FA 1M9UA 4Q7ZA 1GVZA 6GCHF 1DUAA 2KCYA 3L33A 1N8OB 4GCHF 2UUFB 3PTBA 2BHGA 4ISNA 7GCHG 1UJ1A 2XNIA 3OTPA 1G3BA 3QK1A 3FKSD 2A5AA 3CP7A 1IQKA 1MQ5A 4A7IB 3JZ1B 2BDIA 3WW7A 2BQ7B 1WDIA 2G4TA 3ZZAA 5HXFA 8GCHF 1D3TB 4INKA 1O2HA 3SUFA 3D65E 2ODPA 1P06A 2ZQ1A 1DICA 1O2SA 1OWEA 1TB6H 1VGCB 2WV9A 4KTSA 2J34A 1P2JA 1A0JA 3EA9A 5ABWA 1SHYA 4ZKSU 1MTNC 3UOPA 4XBBA 2ZHDA 2QA9E 2LNCA 1TQ7B 1E34B 1SR5C 2BX4A 5ESBA 1ABJH 2THFB 1MD7A 3PYHA 1QURH 1TYNA 2QF0A 2OD3B 3IITA 4B2BA 1OWDA 5EJLA 1GBDA 4DW2U 1CA8B 1BTZA 2PFEA 2ZDAH 2BD5A 1GHWH 2HLCA 2PHBA 1BRBE 1NU7B 1NRRH 2BD2A 2ANWA 4OS1A 1SGFA 4ABFA 5ETXA 5C1XA 2RA0A 1GI4A 1FPHH 1W13U 4ABHA 1MZAA 3ZV8A 1PPZA 1IQNA 2FIRH 3HKJB 4K2YA 1GMDF 1J16A 2D8WA 1BTYA 2QGRA 1GBBA 1GG6C 1GI7B 4RT1A 4IN1A 4O03A 2FTMA 5AFZH 5EU8A 3QZRA 4HGCA 3LC3A 4ABJA 4ABIA 1HCGA 1TGSZ 2ZHFH 3UY9A 1ZSLA 4E05H 7ESTE 1UVSH 2WPJS 5A8ZA 3P92A 3OE7D 3MWIU 4QT8C 1KLJH 2QC2A 2ZU5A 1CA0B 3KYGA 1O2RA 1H1BA 2CV3A 4DIIH 4IW4E 1QFKH 3QGNB 1O32A 1VJAU 4GSOA 1TGCA 1O2NA 4AG2A 4FU8A 4MNWA 1VZQH 3M35A 4NFEA 4BAOB 2H9EH 2NU0E 2XCFA 1SGTA 1O31A 3GOVB 5FCRA 1C2GA 1NRPH 4DT7B 3QDZB 4UONA 4X6OA 2FM2A 4RT0A 1SI5H 4FU9A 3UWIA 3KEEA 2ZECA 5F6MA 1Y3VA 1O3KA 1DWDH 3F9HA 1GBIA 4JYUH 1SQTA 2ZG0H 1AKSA 1HAHH 1LCYA 1Q3XA 4AYYB 4ZHLU 2Q6FA 3BF6H 3QUMP 3N7OA 1GL0E 3GY8A 2FODA 1FNIA 1KIGH 1GHVH 4Q7XA 3GDSA 3SYJA 3NKKA 4GCHG 3U8RH 1CU1A 3BV9B 4NA8A 1SOZA 2FOHA 3P8FA 1V2NT 4B6FA 3KQBA 1C4Y2 2ILNA 1PYTC 4ZAEA 1DDJA 1BTUA 4FUDA 1BTPA 1DOJA 4X6MA 3HK3B 2GT7A 2O8WA 1SGFG 2FOBA 3LH1A 4NWKA 3UUZA 2K0QA 3M36A 4CH2B 1ID5H 1EAUA 3TK6A 1LQDB 1J15A 1J14A 3BTGE 3P70B 5DKMA 4Z1MD 2SGFE 2Y81A 2D1JA 1SFIA 4ZUHA 1YP9A 1YPMH 1ETRH 4TWYA 3TITA 4D76A 3AK5A 3T28A 2A7JA 1GCDA 2FI3E 5JBCS 3O8CA 3QLPH 1WCZA 1EATA 1P3CA 1CQQA 1TPOA 5FBIA 4F4OC 1C5PA 4NG9H 1PYTD 1TX7A 1F0SA 2ZC9H 1AO5A 3KQ5A 5HYOA 5L2ZH 5C5OA 4RN6A 1SGYE 3LGUA 3A89A 4DT4A 3TH4H 3RXLA 4Y6DA 1ORFA 1UTPA 2FOMB 4MG3A 1BMMH 2WPDD 5E2OA 2WUCA 1HUTH 3KQDA 3S7KB 2HPQH 3L3TA 2B9LA 3FZZA 1P04A 2F4LA 1BTHH 1Y5AT 1DUEA 3RXKA 2FYRA 4AFZA 1GI6A 5L6NH 3T25A 3UB0A 1MKWH 1C4V2 2SNWA 3PMJA 5KECA 3PRDA 1OWKA 2OUAA 5EQQA 1O2JA 1C5YB 2A2XH 3RU4D 1SLWB 1XVOA 3E0PB 3KCGH 2SGAA 2BDYA 2XOKD 2OLGA 1IQIA 1LHEH 1KTTB 6CHAB 3RXSA 2B7DH 1TA6A 2JETC 1C5VA 1K1IA 3RC5A 1SGRE 2AGGX 2Y7XA 3TK9A 3O8DA 3Q3KA 4X6NA 5HMAA 2AERH 1C2EA 3NXPA 4MVNA 2OC8A 1IQEA 2A45B 3ZZDA 5E8EH 2ZO3H 4GAWA 2H9TH 4XOJA 1ELFA 3SGBE 2V7QD 2WSSD 1JXPA 1RIWB 3S9AA 2O8MA 3W94A 5LH8A 2XBVA 3GCHC 2EA3A 3IWMA 5L2YH 5DO4H 1J17T 1IQGA 1ARBA 3EQ0H 3T27A 1RXPA 2A4QA 4XFQA 2ZWLH 1UO6A 5EGMA 1F5KU 3A7TA 2KR7A 4ZCNA 1O2TA 3UQOA 1W10U 5EIYA 2YNAA 2FOEA 1D6WA 5DJ7A 2OINA 4CRFA 2QV1A 2SNVA 1GG6B 3SNBA 3E91A 1T8NA 3F6UH 4ZXXH 1GBAA 1OP2A 4IMQA 5DP9A 1C1PA 1IQMA 2R3YA 4Q63A 1H9IE 1YYY1 2GTBA 2W7UA 3FOAA 4IS5A 5F8ZA 3TIUA 5KGOA 3SNDA 2AEIH 8KME2 2ZFTA 4HFPB 3ZZ3A 1YM0A 1GHYH 1HPGA 1PPGE 2PW8H 9ESTA 1TMBH 1GBEA 1CHGA 1OXGA 2C8ZB 2GGVB 3LDXH 4ASUD 3Q3YA 1TNHA 3LGYA 1NFUA 1O2KA 1NS3A 2FS9A 2NU1E 1JIMA 1K22H 1O2VA 5A8YA 1JMOH 4MPVA 2GT8A 2QN5T 3M61U 4WH6A 1SQAA 3ZZ9A 1LVOA 1KXAA 4LZ4B 2PGBB 3ELAH 3MOCA 1BRCE 1O2ZA 1V2VT 3HGPA 1ZTJA 1JRSA 3VB6A 2ZGBH 2HVYB 3GDUA 3M5OA 2BD3A 2QXGA 2OXSA 3RM2H 3MO6A 4FXGH 4ESTE 5JPMH 1O5BB 3E1XB 2YNBA 3ZZCA 4WMFA 5AFYH 2V6NA 1P2NA 3EA8A 1TGTA 3LH3A 1UHBA 3LONA 1G3EA 4BAKB 4ABEA 3GDVA 4K8YA 2GCHF 3K2UA 3ZZ4A 5T1VA 2VB0A 3R3GB 4X2WA 2O8LA 1JOUB 1EOLA 1ANDA 2KCOA 5F53A 1O33A 3M7QA 1ZMJA 1TBZH 3TVJB 3TH2H 1LVBA 1GHBG 1O35A 1T4VH 3SU4A 4INLA 5GNDA 2ZPQA 5AF9H 4AYVB 2NU2E 1AFEH 4WH8A 1P0SH 5GXPA 1NY22 4TY7A 1BMNH 1JBUH 1DY8A 2FS8A 3L6PA 2H9HA 4A92A 1GBCA 2CHAC 2KZ4A 4F49A 1L2EA 2GZ8A 4CRDA 4DVAU 2ANMH 3QZQA 3C27B 3DCLA 1K1LA 1YPLH 4YOIA 2J4IA 3RXVA 2C90B 1GBHA 1FAKH 2F3CE 2RCEA 3ZVDA 2ZPSA 3BTDE 3U69H 1H9HE 1B5GH 4LOYH 5GWZA 4FVDA 1N8OC 3S7HB 2G55A 3FANA 1QY6A 1W12U 2ANKH 1WV7H 2PLXA 2GP9B 1P2IA 3TNTA 5F8TA 4WMDA 5BRRE 2IN2A 2JH0D 1MUEB 4Y7AA 2ZDMA 4TSFD 1HGTH 4P02A 2Z3DA 1O2LA 2BQ6B 2BB4A 2C3SA 2O8UA 3RC6A 1IHTH 1DFPA 1SBWA 3CENA 4JZFH 2ZA5A 2GZ9A 2C4FH 1BRUP 1AVXA 3P8GA 2BYAX 1QJ7B 2BVSH 2ZQ2A 2UWPA 4VGCC 1O3JA 1UK4A 1O36A 1ARCA 3DFJA 1BMAA 3U28C 1P2MA 2KCPA 3SNAA 1Z8IB 4K60A 1C1MA 1P2OA 2J2UA 1P3EA 2W7SA 3SJ9A 5FPYA 3UWJH 1RTFB 2CK3D 1O2OA 2JETB 3RMLH 3QWCH 4K1SA 1C5NH 2P8OC 1PPFE 2J98A 3GCTG 1UCYE 1ZZZA 1C5QA 2VH6A 2XC4A 3MU4A 3VB4A 1GI9B 1G3DA 3MNCA 2VWMA 4Y0ZE 3RMNH 3F1SB 3A7XA 3LKWA 1QRZA 4YZUA 1E79D 3FFGA 4K8BA 2FOGA 2CXVA 3EE0B 1BJUA 3U8TH 2AYWA 1PPBH 2ZU2A 1UCYH 1C2MA 2G4UA 4ZKNU 3RU4T 3SU1A 4X8TH 4Y11E 3A88A 1CA0C 2ZGHA 1S83A 7GCHF 2HRVA 4IC5A 1GBLA 1P09A 4MNVA 5DP5A 3H09A 1ESBA 2VH0A 1C2HA 2EQNA 1Y5UT 4JK5A 1V2KT 1TONA 3RXCA 3N7DA 3RXRA 4YM9A 2EY4C 3UPEA 5DP6A 1PQAA 3HK6B 4AGJA 4ISIH 1GVKB 4MTBA 2XBYA 4HI3A 2RA3A 1UTOA 3Q3XA 3Q76A 4MDSA 7KMEH 1QCPA 1QQUA 1MCVA 1EP5A 3N7EA 1G2LA 4E7NA 1GJ6A 1CT4E 5HGGA 3MNXA 1O5AB 2GMTC 3EAJA 1ZRKA 4FUHA 3DD2H 4KTUA 2L74A 2AHME 4OS6A 1O2IA 3RXUA 2Y5FA 4DOQA 2IJD1 1DSUA 3KQEA 1MZDA 4HZHA 1NESE 2ZDNA 1YPGH 1E35B 1P9UA 1S82A 3F9EA 2PKAB 3SGAE 2ODQA 2Z94A 2AMPA 2PGQB 5EJZA 1F0UA 3M5NA 3FP8E 2OQUA 1S85A 1DT2A 2HNTC 4RKJB 1PPEE 1WU1A 2H5CA 3DHKH 4BTUB 1O2XA 3GY5A 4H42U 3SV2H 1Q31A 3ATLA 2PR3A 3MH5A 1C1UH 1P2KA 4I8GA 1SQRA 1ELGA 4H6TA 2W3KA 3RXPA 3VXEH 2XXLA 2FI5E 1EAXA 2DUCA 4ACAA 1W0JD 2VIOA 4BAQB 2TIOA 2G52A 4ZHAA 4FUGA 4I32A 3STIA 1PPCE 1CT2E 1FY5A 4Y0YE 2GX4A 4LZ1H 1SGCA 1LKAA 4FU7A 1A0LA 1C9TA 4A1XA 2G51A 3BIVH 1K9OE 2ZDVH 2ZHWH 2ZTYA 5H4IB 1V2JT 2JH5D 2PKSC 4SGBE 4FUEA 1BA8B 1SGPE 1RS0A 2OTVA 2Q1JA 1O3CA 2CHAB 1D9IA 3Q00A 4TYDA 2TGAA 3LOXA 4NGAH 2J95A 3SGQE 1SMFE 2BMGB 2HALA 4NZQA 4Z0KA 1KDQA 2VIDA 2XC5A 1X7AC 1DLKB 2F9BH 1O2PA 2K8IA 4FUBA 1V2ST 1SB1H 2BOHB 2QAAA 4DY7B 1TGNA 1BBRE 2Z9LA 1GBFA 4AX9H 2Z9GA 1B0EA 3ZVAA 1RD3B 1BUIA 3VGCC 1VJ9U 1S81A 3E6PH 5KEDA 1V2LT 1B7XB 2V3HH 2BDAA 4KP0A 3T2NA 2FYQA 1A2CH 6CHAC 4OGXA 4BXSA 1G32B 3SW2B 2R2WU 1OYQA 1BBRH 2ZFQH 3M7UA 1BMFD 2A2QH 1KY9A 1YCPM 1FN8A 2ZFFH 4YLQH 2V3MA 3PLKA 2QF3A 3SQHE 4K69A 1A46H 3F2FA 2GKVE 3P17H 2XNDD 4UDWH 1RIWC 2UUJB 3MI4A 4VGCB 1K1OA 3ITIA 3TH3H 1Y3YA 2VWLA 1QA7A 3NUMA 1DWEH 1GI8B 4B75A 1GMHG 3BTWE 3RU4E 1EQ9A 1AE5A 3TGJE 5EOKA 1QL9A 1LTOA 4XBDA 1FN6A 4ISHH 3ATKA 5K0HA 1C4U2 1MKWK 1CT0E 2OBOA 1AB9C 1H4WA 1XUJA 2P8OB 2P94A 1HAVA 1CGJE 1P05A 3OU0A 1OP0A 1TWXB 2QCYA 4TPYA 1Y3WA 2OC7A 2ZU1A 1O2WA 2LPRA 3PMAB 1YLDA 1K0HA 3GY3A 1LPGB 4NA7A 2A4OA 2AIQA 4R0IA 1F0RA 4I86A 4DCDA 1WBGB 2WYGA 2BD4A 3PM3A 1ZOMA 4X8UH 1H8ED 3ZZ8A 1V2UT 1P57B 3PWCA 3RXIA 4KTCA 3SQEE 3OAAD 3VG8A 1WTHD 5F03A 3ZZ6A 3ZZ7A 1ZTLA 1DXPA 1P12E 3K6YA 3KNXA 2FOAA 5LPFA 1L4DA 1GI5A 1FONA 1CHOG 1XUHA 3RXEA 1GBMA 3RXMA 1ZJKA 2J9NA 1TNJA 2VWNA 3PTNA 3T5FH 1OOKB 1P02A 2BY5X 5E2PA 3SV6A 1EPTC 4XRNA 1O3EA 1TNKA 1W7XH 4NIWA 4NZLA 2I6SA 4OS5A 1G3CA 1C2DA 1Z6JH 3AASA 1BQYA 1VITH 3RMMH 3SZEA 3RUOA 5B6LA 4Y76A 3SU3A 2ZU4A 2QYIA 2QXHA 1CGHA 3EE7A 1C2IA 1TNGA 2ZCHP 3ZVBA 2GMTB 2VBCA 1K28D 1O3LA 2BLOA 2BVRH 1KXDA 5GPIB 3D23A 1HYLA 3B23B 2CMYA 1AU8A 2BDCA 2UUYA 5EW1H 2ZCKP 1BHXB 4I8LA 2SGEE 1S6FA 1PQ8A 1YWUA 1TAWA 1F0TA 3RP2A 4FUJA 5CE1A 1SHHB 3K9XB 3RXOA 1AVGH 2A5IA 4YOJA 1ZRBA 2KFWA 3HGNA 1HAGE 1TMTH 1QQ4A 1FIWA 3TGIE 1NPMA 1ZMLA 5GDSH 4IBLH 1TLDA 2XWAA 4TT3D 4ASHA 3BEUA 3ZVFA 3CS7A 2PTNA 1NFWA 1ANBA 5IK2D 3LGTA 4X8VH 1HBTH 2AMQA 1OWJA 4ABAA 1O0DH 2ZGJA 1GL1A 2BDBA 1N1LA 1GJBB 4NIVA 2A7HA 1H8DH 4JZDH 4Y8XA 5JBBS 4AG1A 2AS9A 2ANYA 1VR1H 3PLBA 3OTJE 2FWWA 5C5NA 2DE8A 2A32A 2WPMS 1MTVA 2WINI 1Y5BT 2GVFA 1AHTH 1BZXE 1T32A 2PKSB 2Y7ZA 3K6ZA 2XW9A 2C93B 4GHQA 3SJ8A 1XUIA 3H7TA 2P3UB 2QE7D 2SGPE 4Y79A 2Y5HA 2BY7X 2A1DB 3ZYEA 4I33A 3UR6A 2VU8E 1ZR0A 5EPNA 2XCNA 2VIPA 4KELA 2SGDE 3S69A 1ANCA 3MNBA 5DSFA 1OS8A 3GY4A 1EX3A 1IQHA 3TGKE 1HIAB 1K1NA 2GDEH 1YBWA 3V7TA 3QN7A 3KHVA 5FCKA 2ZHEH 3VGCB 1T8LA 4NA9H 3AW0A 4BTIB 4DGJA 2P59A 4AN7A 1KXCA 3PMBB 4RI0A 1GHBF 1V2MT 2CGAA 4JZEH 1QL7A 1C9PA 4A1TA 4NSVA 4AB8A 1QA0A 3DUXH 2GCTC 4ZKRU 1DWBH 1OSSA 1V2QT 1O2UA 1TPPA 1UVPA 1ZPCA 1EAWA 4Q80A 1DX5M 3ZIAD 1IQLA 1O5CB 1DE7H 1V2OT 1ZJDA 2HGTH 5FAHA 3S9CA 2UWOA 4FETA 4YT7H 3UNRA 2ZTXA 3M3TA 1TFXA 1QBVH 1SLXB 4YO9A 2I6QA 3ESTA 5T6DA 4BTTB 2WZQA 3F9GA 3F3BA 1BDAA 1ANEA 1MU8B 1XUGA 1BIOA 5SGAE 4U32A 1C2KA 1GPZA 1GBJA 2SGQE 1SQOA 1FZZA 1K21H 4K3JA 1E37B 5T3HA 2EI7A 2OC1A 2VIWA 1AB9B 2YMSC 1EFRD 4WJG2 1GHXH 2BX3A 2P3FH 1ELDE 3WY8A 3SJIA 5CMXH 1DY9A 2HWLB 1BT7A 3M3VA 4LXBH 2HLDD 1HDTH 2TGTA 2STAE 4NCYA 5LGOA 4CRBA 3UQVA 3TNSA 1CE5A 3UTUH 2R0LA 3UNQA 3OY5U 4GVUA 3D62A 3BTHE 3F2HA 2Z7FE 4MPWA 1TA2A 1TRNA 1O34A 3F0PA 1TQ0B 2Z9IA 2TRMA 1EKBB 3TJVA 1XVMA 1V2PT 1F92A 3DA9B 2YMSD 3MTYA 2IJOB 1O5EH 1UTKA 2ZGCA 1OWHA 1PPHE 4MLFB 2AMDA 1KXEA 1F5RA 2BLQA 1UCYK 2QY0B 3FN8A 3Q77A 3A8CA 1TABE 2FXRA 3NWUA 5DK1A 1IQFA 2OP9A 1KTSB 2J94A 3GCTF 1EPTB 3GY7A 3ATWA 1QR3E 1ELEE 1LHFH 2PTCE 4F55A 1BRAA 1GHAG 1UVOA 1ELAA 4RKOB 5CDFE 1BTXA 1O3OA 2P95A 2W3IA 3QTVH 4OS2A 1GJ9B 2OBQA 4AB9A 1PFXC 4PROA 4WXVA 2BOKA 3A7YA 3E3TA 4B2CA 1YY3A 2ZHQH 1K1PA 1O2YA 3PV4A 3BTEE 4B2AA 1H9LB 1XXDA 2Z9KA 1QL8A 1NM6A 1C5XB 1UVUH 1C1TA 1FDPA 3SV8A 1WYKA 1UK2A 4Q7YA 4U01A 1THSH 2BZ6H 2A31A 5FBEA 1OYTH 1DXWA 1QBNA 1TNIA 3OEED 5DN6D 2FP7B 3I78A 3M5MA 1W3CA 1UK3A 3RLWH 4MNXA 3T62A 1AD8H 3U8OH 4X1QU 1G2MA 4BAHB 4X1NU 1Z7KA 1ZSJA 1NROH 2P16A 4O9VA 1YPJH 3K65B 4Y7BA 4ISOA 4NWLA 1W14U 3ZVEA 1VKYA 1QBOA 3URCA 1V2RT 4M9FA 4TPIZ 3CS0A 5B6OA 3QX5H 4ACBA 3HKIB 2NU3E 2TGPZ 1AI8H 3RXQA 3FO8D 4AGKA 5I25A 4UFFH 1UW7A 1RFNA 4O3UA 2QIQA 3C1KA 1UTJA 4HG6A 5DP7A 4D9QA 1Z1JA 3PLPA 3U9AH 2VJ1A 1SKYE 1Z8GA 3DSGA 1GI3A 3KQCA 3ZZBA 2HNTE 2XTTB 1EB2A 4CHAC 4IMZA 2ZTZA 1W8BH 1W0ZU 2J97A 1E1RD 4AC9A 2BD8A 2W6JD 1SC8U 3MHWU 1TPSA 2KAIB 1A7SA 3V13A 4ZH8A 2ZDKA 3DSOA 2ZF0H 5DGJA 3TPIZ 1O3IA 1EB1H 3LGIA 5EPYA 5BPEA 5C67A 4CBOA 1C1QA 7LPRA 1YPEH 2C8WB 4YTAA 5FL7D 1UTMA 2WPIS 4B76A 4JZ1A 4BAMB 1F7ZA 3FP6E 2AGIX 5J4SA 4UFDH 3NCLA 5C1YA 2VIQA 4ZMAH 1C2FA 3KYFA 2GCTB 5FHTA 1FI8A 1W0YH 1FY3A 5AVDA 5EODA 1LPZB 4YESB 1HAYB 3B9FH 2QXIA 1RJXB 3SNCA 1LKBA 1D3QB 2FX4A 4NIYA 1V2TT 1ZHPA 2VINA 3RLYH 5A09A 2BY6X 2A0QB 2Z3CA 1BBRK 1C2LA 1Q2WA 2CJIA 2Y80A 3KIDU 4F48B 4TWWA 4D7GA 1HNEE 2VVCA 5JDUB 1TOCB 1AWHB 2J5UA 4Y71A 1K1MA 4D9RA 1UTQA 3PMHB 1JIRA 3I77A 2YMSB 3QTOH 2ZP0H 5A0BA 4MPXA 3UFAA 2KCAA 3RDZA 4CRGA 3RXTA 3FZDA 2FESH 1YPHE 5C3NA 1CBWC 3LJJA 4D8NA 1C1VH 1HAXB 2ZU3A 1HJ9A 2IPHA 4BOHA 3U1JB 1ELBA 1E36B 4CRAA 4DURA 2BTCE 1C1OA 3NK8A 2FX6A 2PUXB 5GCHG 4U30A 4CR9A 1ZGIA 5GIBA 1HLTH 1C1WH 3RC4A 1A0HB 2A7CA 3IG6B 4JMYA 3H7OA 4HTCH 2FTLE 3TLOA 3UIRA 1FY1A 2W5EA 3CNRA 1YPKH 2GJGA 3MU5A 1L4ZA 1YC0A 2OQ5A 1EZQA 1GMHF 1QZ8A 5JB8S 1DWCH 3BTTE 1C5LH 1GMCG 2A4RA 3D49H 1AGJA 2ZFPH 4H6SB 3SI3H 3A7ZA 1MH0A 1J9CH 3RXDA 4BNRA 3LT3A 4U2WA 3RXAA 1W7GH 1MTSA 4WMEA 3W95A 1TMUH 1MU6B 3VB3A 2R3UA 3M3SA 1ACBE 4WWYA 3TU7H 1NFYA 2W26A 1INCA 4UE7H 4OM9A 1S0RA 2FEQH 3FP7E 2Y5GA 1GVLA 3GY6A 3O8BA 3SZNA 1AKSB 4CBNA 3MH6A 1HXEH 1Y8TA 3TJOA 1NC6A 2ALVA 4ISLA 2QF4A 1EASA 3A81A 1FX0B 1CHOF 3RXGA 2XBWA 3MH7A 2LP6A 4FVBA 2H2ZA 1YCPH 3ENSB 1MD8A 1YLNA 1A3BH 1FAXA 1SL3A 4B71A 2G81E 1O5GH 2BY9X 1QTFA 2K1QA 2ZEBA 4XD7D 2OK5A 5HM2A 1ABIH 2BLWA 2RDLA 3UR9A 2PSYA 2H5DA 1GBKA 1VCPA 1LVMA 4GLYA 2JJ1D 1GJCB 3HATH 1BOQA 3MQKC 2B0FA 1S0QA 1T31A 4WF8A 1O3PB 5K7RA 3A82A 1WXRA 2F83A 5A2MH 1O5DH 3LJOA 1EOJA 1P01A 1JRTA 1RGQA 3A8AA 3O8RA 4X2YA 1GDUA 3F2GA 4X1RU 3W1EA 4WY3A 2BDHA 1F2SE 1O2GH 1OWIA 3G01A 5EQSA 4CHAB 2WUBA 3NZIA 5EJ1A 3JZ2B 3P8OA 1HV7A 1YPHC 1A5GH 3A8BA 1AQ7A 1ZGVA 5HIZA 2F9UA 1PJPA 1D4PB 4M7GA 2PWXA 4YXWD 1THRH 1EZUC 4CR5A 3U98H 4I8HA 1A3EH 2F91A 4FUCA 3BN9A 1C2JA 2FPZA 5JYIA 3EYDA 1NU9A 1G37A 1MABB 2Y6TA 1O2MA 3ZZ5A 5C0TA 2G8TA 3SU2A 1AFQB 1OKXA 5A0CA 1XX9A 1NO9H 3SU6A 1TRMA 3KL6A 1GJDB 1WTGH 1WAYB 3RXJA 2A4GA 1EJAA 1ZYOA 4DJZB 1O39A 1MKXH 1Z8JB 4B73A 3BEFB 4X8SH 1FXYA 3LU9B 1ELTA 1ZPZA 1ESAA 1RRKA 5GJ4B 5I46H 1FLEE 1SLVB 1HXFH 2OC0A 1QRXA 1KSNA 3NPSA 1Y3UA 1DPOA 1A4WH 1O3BA 2VIVA 1AUJA 1SG8B 1A5IA 1HAOH 1ZTKA 1LHGH 2JKHA 2PSXA 1UTLM 4WVPE 1MBQA 2VWOA 5DP8A 1A5HA 1N6XA 1F5LA 1ELCA 1HAZB 2ZI2H 1CBWB 2R9PA 1HB0B 1ZSKA 1SGDE 4GUXA 1V6DA 1EUFA 1LO6A 1EP6A 1FQ3A 1Y59T 1TPAE 1IAUA 1J8AA 3DT0H 4MPUA 1FV9A 1AMHA 2BVXH 4X6PA 1SFQB 2WPLS 1T8MA 1XKBC 3ZVCA 1RTKA 1AY6H 3M37A 4O3TA 2SFAA 5TJXA 4UD9H 3S9BA 3AAVA 2GV6A 5EXMA 1SPJA 2PKAA 3V12A 2NWNA 3PO1C 1AIXH 1VITG 4UFEH 3WWBA 4Z6AH 2WPHS 1C5TA 3E90B 5A8XA 3SV9A 4ABBA 2PUQH 5L30H 1GJ4H 1ZMNA 1C1RA 1CSOE 1QB9A 1GCTC 3DFLA 5FXLA 2ODYB 1YKTA 2NU4E 1H8IH 3PB1E 1L1JA 2D26C 1JWTA 1T4UH 1YGCH 5EXLA 4AFUA 1NBMD 3ODDA 4K1TA 5IDKA 5JB9S 3MMGA 2STBE 1W11U 2HOBA 3MO9A 3PWBA 6GCHG 1GDNA 1TNLA 3QO6A 4ZHMU 3UREA 1HJ8A 1AZ8A 4AZ2B 3LC5A 1E38B 1DLEA 2BDGA 1TRYA 2IOTA 3MU1A 1NT1A 3SI4H 1BMLA 8GCHG 2LELA 2BQWB 3EGKH 1MAXA 1UHBB 1UMAH 2B5TB 1WQVH 1NTPA 1U6QA 1G30B 3T26A 3SUDA 3S0NA 1W0KD 3LGVA 1T8OA 1ETTH 3FAOA 3SU5A 4XDEA 2KM0A 1GHAF 3GYLB 5C0UA 1VCQA 1SOTA 1Z71A 1DITH 2OCVB 4X1PU 4NFFA 2CF9H 1A61H 2Y82A 4IN2A 3TK5A 2VVUA 3UNSA 1HJAC 2BZAA 4FOUC 3HPTB 1TBQH 4TY6A 1GBTA 1P10A 2QF5A 3URDA 5FX6A 1SLUB 1C1SA 3BTME 4AOQA 1AWFH 1GMDG 3ODFA 3MNSA 1K1JA 4I31A 1H8HD 1YF4A 3VEQB 2O8TA 1G36A 4Q2KA 1ZLRA 5E0HA 3LPRA 3RM0H 2R0KA 1O3AA 2O9QA 1EJNA 3VB7A 2G00A 3ZV9A 4XBCA 4XSKU 2ZZUH 4RSPA 3RMOH 1DVAH 1Y3XA 1C5UA 6ESTA 4AFQA 4FUFA 1FIZA 5LPRA 4A1VA 1FY4A 2V35A 5F8XA 4MQAA 2F9PA 1FPCH 1C5SA 3A85A 1OPHB 3OSYA 4K5ZA 1QB1A 5T6GA 5G4BA 3GCNA 3ZYDA 2ZCLP 1FJSA 4ABGA 1GJ8B 1NRSH 2ZKSA 1SVPA 1HRTH 2ZDLA 3SJKA 2W6ID 3OX7U 1EJMA 3B8JA 3V0XA 1O3HA 2VVVA 3E0NB 2IPQX 2QXJA 1MTNB 4Y10E 3GCOA 4SGAE 1GI0A 2HVXA 1S6HA 2PV9B 3A87A 3AAUA 1FY8E 1S5SA 1SGQE 4ABDA 3A7WA 3NRLA 5CHAC 4O97A 3KF2A 1DS2E 1A1RA 1O37A 2FI4E 1C5RA 1BB0B 2UUKB 4THNH 3OFND 2J98B 4KKDA 4X2XA 1GGDC 1C5ZB 1BTWA 1TX8A 3A7VA 3GY2A 2CF8H 1BHXF 1WOFA 1P2QA 4JZIA 1P9SA 1SSXA 5C20A 2PP6A 8ESTE 2AGEX 3SUGA 4E06H 1TX6A 5TCAA 1COWD 5A0AE 1LQEA 1ZHMA 1SGNE 1KLTA 1LHDH 4OGYA 2HNTF 1AUTC 2G5VA 3M5LA 3LIWA 1IQJA 3STJA 1DANH 3N99A 5JBAS 4A5TS 2M5TA 3SUEA 2EI6A 1MQ6A 2VGCC 2BXTH 1NN6A 1GJAB 1O38A 1ZHRA 1KXFA 3ZVGA 1Z8RA 1O3MA 3F0OA 2F43B 3E16B 4BXWA 2J38A 4JCNA 2KX4A 1IOEA 3AVZA 3KGPA 1MBMA 2D2DA 3PO1B 5FPSA 6LPRA 8LPRA 1CVWH 1AE8H 4CH8B 2BM2A 2ZFSA 5C94A 4I8JA 4FUIA 1D6RA 2ZIQH 3BG4C 1GCTB 4K1EA 1QB6A 2P3TB 1QJ6B 1GHZA 2TGDA 2Z3EA 2BLVA 1WSSH 4UFGH 3EA7A 2FLBH 3VFEA 1E0FD 2EEKA 1PQ5A 4WXIA 4E7RG 1HAIH 2Q6GA 1C5OH 3SN8A 1EAIA 2H6MA 2HPPH 5GCHF 1WUNH 2FO9A 2FZZA 3QGJA 2F9NA 1XUKA 3GS9A 5HIYA 1GWAA 3BIUH 4P00A 4H4FA 4A6LA 1P03A 3M7TA 4UEHH 1L1NA 4OS4A 3U1IB 3P6ZB 4X0WU 1C5WB 4YT6H 3PV2A 1GMCF 3A84A 1N6YA 4DG4A 2RFKC 1B0FA 3TJNA 2BD7A 5FX5A 3WWFA 3SV7A 3SHAH 1E1QD 2B8OH 1TALA 1HIAA 2XC0A 1UVTH 3A8DA 4JYTA 2BY8X 5EXNA 3RXBA 2C8YB 5IYTA 4XE4A 4I8KA 3MH4A 1MAYA 2Z6BD 2UWLA 2ESTE 3A83A 1O3GA 3SU0A 1KLIH 1YCPK 5C17A 2R2MB 2ZGXH 1EZSC 1HJAB 1GDQA 3MYWA 1TIOA 1LVYA 1FUJA 1Z6EA 1XXFA 1KDQB 1EXFA 1TOMH 3I29A 3SJOA 4NSYA 4JK6A 1AN1E 4YLUA 4B1TA 1ETSH 3F68H 5LPEA 1MTUA 1G9IE 1AFQC 3ATIA 1QRWA 2GZ7A 1VGCC 1BCUH 3OYPA 1W2KH 3BTKE 3GISB
chains in the Genus database with same CATH topology
1KXBA 1V2WT 3V3MA 3PROA 2VNTA 1QNJA 4DIHH 4GHTA 1ESTA 1UTNA 1NFXA 3FVFB 4CRCA 4LK4A 1O30A 2RG3A 2XYAA 4Y8ZA 5DP3A 1NZQH 3MO3A 5C1UA 1TBRH 1CGIE 1KYNA 1L1GA 4MNYA 3OY6U 1GJ7B 3BEIB 2H1UA 5EQRA 3VB5A 1ZPBA 3VXFH 3MFJA 1AVWA 2G5NA 4R8TB 2EC9H 1OP8A 1MMJN 4ZROA 4OS7A 1PQ7A 1QHRB 1NRQH 2WPKS 2Q6DA 1BJVA 1V3XA 3A86A 1FMGA 4KGAA 1AZZA 1LDTT 2FOCA 1EZXC 1C5MD 2ZNKH 5CHAB 3GCHB 2GD4B 5EW2H 2EI8A 1NRNH 3AW1A 1GI1A 9LPRA 1HAPH 2P93A 1Z1IA 1HAVB 1LMWB 4X2VA 1GGDB 1GJ5H 1XM1A 3BSQA 2J92A 3SOSA 1BITA 2FLRH 4B74A 2WV5A 4IC6A 1MKXK 1DM4B 2GCHG 2WYJA 2FDAA 3SHCH 1EPTA 3RXHA 1SGEE 3ATMA 4CREA 1O3DA 2F9OA 4X1SU 3UOUA 1RTLA 1S84A 1MCTA 1K2I1 5ESTE 4GPGA 3SBKA 4JYVH 1QGFA 2DE9A 2WV4A 3F9FA 1D3DB 4Y8YA 3BG8A 3EDXB 2XWBI 1SGIB 1L0ZA 4INHA 4I7YH 3T29A 2VGCB 1XKAC 4BANB 1QIXB 3VPKA 1CO7E 1C1NA 2YOLA 5AHGH 1T7CA 1P8VC 2BXUH 5E0JA 1DSTA 2BD9A 3KN2A 2JH6D 2V0BA 5E0GA 3BTQE 5JBTA 1HFDA 5C2ZA 1O5FH 1O3NA 2Z9JA 4YOGA 1ELVA 1YLCA 3BG4B 3GYMA 1GI2A 3SO3A 1LHCH 5DP4A 2GV7A 2TBSA 1O3FA 2V3OH 5DPAA 4ZXYH 4D7FA 2FMJA 3GICB 4AORA 2C8XB 2ZPRA 5PTPA 3A80A 1P11E 3H5CB 3TJUA 3LGWA 2AFQB 1O2QA 4J2YB 1LPKB 3P8NA 2AH4X 2ZFRH 3RXFA 4IGDA 2CN0H 1IHSH 2GDDA 3MU0A 1XUFA 1MTWA 2AIPA 2TPIZ 1TE0A 1THPB 5FPTA 3P95A 2XBXA 1TGBA 1VITF 2F9VA 4ZKOU 5HM9A 2ULLA 3BTFE 1XMNB 2XRCA 4NIXA 1WQSA 2KAIA 3SNEA 5TCCA 3E8LA 4AFSA 1OX1A 4J1YA 5T6FA 3MU8A 5J4QA 2ASUB 1QJ1B 2A5KA 3SORA 5DG6A 2ALPA 1D3PB 2FOFA 5EG4A 1VCWA 3R0FA 1M9UA 4Q7ZA 1GVZA 6GCHF 1DUAA 3L33A 4GCHF 1N8OB 4ISNA 2UUFB 3PTBA 2BHGA 7GCHG 1UJ1A 2XNIA 1G3BA 3QK1A 2A5AA 3CP7A 1IQKA 1MQ5A 4A7IB 3JZ1B 2BDIA 2BQ7B 2G4TA 3ZZAA 5HXFA 8GCHF 1D3TB 4INKA 1O2HA 3SUFA 3D65E 2ODPA 1P06A 2ZQ1A 1DICA 1O2SA 1OWEA 1TB6H 1VGCB 4KTSA 5ABWA 2J34A 1P2JA 1A0JA 3EA9A 1SHYA 4ZKSU 1MTNC 3UOPA 4XBBA 2ZHDA 2QA9E 2LNCA 1TQ7B 1E34B 1SR5C 2BX4A 5ESBA 1ABJH 2THFB 1MD7A 3PYHA 1QURH 1TYNA 2QF0A 2OD3B 3IITA 4B2BA 1OWDA 1GBDA 4DW2U 1CA8B 1BTZA 2PFEA 2ZDAH 2BD5A 1GHWH 2HLCA 2PHBA 1BRBE 1NU7B 1NRRH 2BD2A 2ANWA 4OS1A 1SGFA 4ABFA 5ETXA 5C1XA 2RA0A 1GI4A 1FPHH 1W13U 4ABHA 1MZAA 3ZV8A 1PPZA 1IQNA 2FIRH 3HKJB 4K2YA 1GMDF 1J16A 2D8WA 1BTYA 2QGRA 1GBBA 1GG6C 1GI7B 4IN1A 4O03A 2FTMA 5AFZH 5EU8A 3QZRA 4HGCA 3LC3A 4ABJA 4ABIA 1HCGA 1TGSZ 2ZHFH 3UY9A 1ZSLA 4E05H 7ESTE 1UVSH 2WPJS 5A8ZA 3P92A 3MWIU 4QT8C 1KLJH 2QC2A 2ZU5A 1CA0B 1O2RA 1H1BA 2CV3A 4DIIH 4IW4E 1QFKH 3QGNB 1O32A 1VJAU 4GSOA 1TGCA 1O2NA 4AG2A 4FU8A 4MNWA 1VZQH 3M35A 4NFEA 4BAOB 2H9EH 2NU0E 2XCFA 1SGTA 1O31A 3GOVB 5FCRA 1C2GA 1NRPH 4DT7B 3QDZB 4UONA 4X6OA 2FM2A 1SI5H 4FU9A 3UWIA 3KEEA 2ZECA 5F6MA 1Y3VA 1O3KA 1DWDH 3F9HA 1GBIA 4JYUH 1SQTA 2ZG0H 1AKSA 1HAHH 1LCYA 1Q3XA 4AYYB 4ZHLU 2Q6FA 3BF6H 3QUMP 3N7OA 1GL0E 3GY8A 2FODA 1FNIA 1KIGH 1GHVH 4Q7XA 3GDSA 3NKKA 4GCHG 3U8RH 1CU1A 3BV9B 4NA8A 1SOZA 2FOHA 3P8FA 1V2NT 3KQBA 1C4Y2 2ILNA 1PYTC 4ZAEA 1DDJA 1BTUA 4FUDA 1BTPA 1DOJA 4X6MA 3HK3B 2GT7A 2O8WA 1SGFG 2FOBA 3LH1A 4NWKA 3UUZA 3M36A 4CH2B 1ID5H 1EAUA 3TK6A 1LQDB 1J15A 1J14A 3BTGE 3P70B 5DKMA 2SGFE 2Y81A 2D1JA 1SFIA 4ZUHA 1YP9A 1YPMH 1ETRH 4TWYA 3TITA 4D76A 3T28A 2A7JA 1GCDA 2FI3E 5JBCS 3O8CA 3QLPH 1WCZA 1EATA 1P3CA 1CQQA 1TPOA 5FBIA 4F4OC 1C5PA 4NG9H 1PYTD 1TX7A 1F0SA 2ZC9H 1AO5A 5HYOA 5L2ZH 5C5OA 4RN6A 1SGYE 3LGUA 3A89A 3TH4H 3RXLA 4Y6DA 1ORFA 1UTPA 2FOMB 4MG3A 1BMMH 5E2OA 2WUCA 1HUTH 3KQDA 3S7KB 2HPQH 3L3TA 2B9LA 3FZZA 1P04A 1BTHH 1Y5AT 1DUEA 3RXKA 2FYRA 4AFZA 1GI6A 5L6NH 3T25A 1MKWH 1C4V2 2SNWA 3PMJA 1OWKA 2OUAA 5EQQA 1O2JA 1C5YB 2A2XH 3RU4D 1SLWB 1XVOA 3E0PB 3KCGH 2SGAA 2BDYA 2OLGA 1IQIA 1LHEH 1KTTB 6CHAB 3RXSA 2B7DH 1TA6A 2JETC 1C5VA 1K1IA 3RC5A 1SGRE 2AGGX 2Y7XA 3TK9A 3O8DA 3Q3KA 4X6NA 5HMAA 2AERH 1C2EA 3NXPA 4MVNA 2OC8A 1IQEA 2A45B 3ZZDA 5E8EH 2ZO3H 4GAWA 2H9TH 4XOJA 1ELFA 3SGBE 1JXPA 1RIWB 3S9AA 2O8MA 3W94A 5LH8A 2XBVA 3GCHC 2EA3A 3IWMA 5L2YH 5DO4H 1J17T 1IQGA 1ARBA 3EQ0H 3T27A 1RXPA 2A4QA 4XFQA 2ZWLH 1UO6A 5EGMA 1F5KU 3A7TA 1O2TA 3UQOA 1W10U 2YNAA 2FOEA 1D6WA 5DJ7A 2OINA 4CRFA 2QV1A 2SNVA 1GG6B 3SNBA 3E91A 1T8NA 3F6UH 4ZXXH 1GBAA 1OP2A 4IMQA 5DP9A 1C1PA 1IQMA 2R3YA 1H9IE 1YYY1 2GTBA 2W7UA 4IS5A 5F8ZA 3TIUA 3SNDA 2AEIH 8KME2 2ZFTA 4HFPB 3ZZ3A 1YM0A 1GHYH 1HPGA 1PPGE 2PW8H 9ESTA 1TMBH 1GBEA 1CHGA 1OXGA 2C8ZB 2GGVB 3LDXH 3Q3YA 1TNHA 3LGYA 1NFUA 1O2KA 1NS3A 2FS9A 2NU1E 1JIMA 1K22H 1O2VA 5A8YA 1JMOH 4MPVA 2GT8A 2QN5T 3M61U 4WH6A 1SQAA 3ZZ9A 1LVOA 1KXAA 4LZ4B 2PGBB 3ELAH 3MOCA 1BRCE 1O2ZA 1V2VT 3HGPA 1ZTJA 1JRSA 3VB6A 2ZGBH 3GDUA 3M5OA 2BD3A 2QXGA 2OXSA 3RM2H 3MO6A 4FXGH 4ESTE 5JPMH 1O5BB 3E1XB 2YNBA 3ZZCA 4WMFA 5AFYH 2V6NA 1P2NA 3EA8A 1TGTA 3LH3A 1UHBA 3LONA 1G3EA 4BAKB 4ABEA 3GDVA 4K8YA 2GCHF 3K2UA 3ZZ4A 2VB0A 3R3GB 4X2WA 2O8LA 1JOUB 1EOLA 1ANDA 1O33A 3M7QA 1ZMJA 1TBZH 3TVJB 3TH2H 1LVBA 1GHBG 1O35A 1T4VH 3SU4A 4INLA 2ZPQA 5AF9H 4AYVB 2NU2E 1AFEH 4WH8A 1P0SH 5GXPA 1NY22 4TY7A 1BMNH 1JBUH 1DY8A 2FS8A 3L6PA 2H9HA 4A92A 1GBCA 2CHAC 4F49A 1L2EA 2GZ8A 4CRDA 4DVAU 2ANMH 3QZQA 3C27B 1K1LA 1YPLH 4YOIA 2J4IA 3RXVA 2C90B 1GBHA 1FAKH 2F3CE 2RCEA 3ZVDA 2ZPSA 3BTDE 3U69H 1H9HE 1B5GH 4LOYH 5GWZA 4FVDA 1N8OC 3S7HB 2G55A 3FANA 1QY6A 1W12U 2ANKH 1WV7H 2PLXA 2GP9B 1P2IA 3TNTA 5F8TA 4WMDA 5BRRE 2IN2A 2JH0D 1MUEB 4Y7AA 2ZDMA 1HGTH 2Z3DA 1O2LA 2BQ6B 2BB4A 2C3SA 2O8UA 3RC6A 1IHTH 1DFPA 1SBWA 3CENA 4JZFH 2ZA5A 2GZ9A 2C4FH 1BRUP 1AVXA 3P8GA 2BYAX 1QJ7B 2BVSH 2ZQ2A 2UWPA 4VGCC 1O3JA 1UK4A 1O36A 1ARCA 3DFJA 1BMAA 1P2MA 3SNAA 1Z8IB 4K60A 1C1MA 1P2OA 2J2UA 1P3EA 2W7SA 3SJ9A 5FPYA 3UWJH 1RTFB 1O2OA 2JETB 3RMLH 3QWCH 4K1SA 1C5NH 2P8OC 1PPFE 3GCTG 1UCYE 1ZZZA 1C5QA 2VH6A 2XC4A 3MU4A 3VB4A 1GI9B 1G3DA 3MNCA 2VWMA 4Y0ZE 3RMNH 3F1SB 3A7XA 3LKWA 1QRZA 4YZUA 3FFGA 4K8BA 2FOGA 2CXVA 3EE0B 1BJUA 3U8TH 2AYWA 1PPBH 2ZU2A 1UCYH 1C2MA 2G4UA 4ZKNU 3RU4T 3SU1A 4X8TH 4Y11E 3A88A 1CA0C 2ZGHA 1S83A 7GCHF 2HRVA 4IC5A 1GBLA 1P09A 4MNVA 5DP5A 1ESBA 2VH0A 1C2HA 1Y5UT 4JK5A 1V2KT 1TONA 3RXCA 3RXRA 4YM9A 3UPEA 5DP6A 1PQAA 3HK6B 4AGJA 4ISIH 1GVKB 4MTBA 2XBYA 4HI3A 2RA3A 1UTOA 3Q3XA 3Q76A 4MDSA 7KMEH 1QCPA 1QQUA 1MCVA 1EP5A 1G2LA 4E7NA 1GJ6A 1CT4E 5HGGA 3MNXA 1O5AB 2GMTC 3EAJA 1ZRKA 4FUHA 3DD2H 4KTUA 4OS6A 1O2IA 3RXUA 2Y5FA 4DOQA 1DSUA 3KQEA 1MZDA 4HZHA 1NESE 2ZDNA 1YPGH 1E35B 1P9UA 1S82A 3F9EA 2PKAB 3SGAE 2ODQA 2Z94A 2AMPA 2PGQB 1F0UA 3M5NA 3FP8E 2OQUA 1S85A 1DT2A 2HNTC 4RKJB 1PPEE 1WU1A 2H5CA 3DHKH 4BTUB 1O2XA 3GY5A 4H42U 3SV2H 1Q31A 3ATLA 2PR3A 3MH5A 1C1UH 1P2KA 4I8GA 1ELGA 4H6TA 2W3KA 3RXPA 3VXEH 2XXLA 2FI5E 1EAXA 2DUCA 2VIOA 4BAQB 2TIOA 2G52A 4ZHAA 4FUGA 4I32A 3STIA 1PPCE 1CT2E 1FY5A 4Y0YE 2GX4A 4LZ1H 1SGCA 1LKAA 4FU7A 1A0LA 1C9TA 4A1XA 2G51A 3BIVH 1K9OE 2ZDVH 2ZHWH 2ZTYA 5H4IB 1V2JT 2JH5D 2PKSC 4SGBE 4FUEA 1BA8B 1SGPE 1RS0A 2OTVA 2Q1JA 1O3CA 2CHAB 1D9IA 3Q00A 4TYDA 2TGAA 3LOXA 4NGAH 2J95A 3SGQE 1SMFE 2BMGB 2HALA 4NZQA 4Z0KA 1KDQA 2VIDA 2XC5A 1X7AC 1DLKB 2F9BH 1O2PA 4FUBA 1V2ST 1SB1H 2BOHB 2QAAA 4DY7B 1TGNA 1BBRE 2Z9LA 1GBFA 4AX9H 2Z9GA 1B0EA 3ZVAA 1RD3B 1BUIA 3VGCC 1VJ9U 1S81A 3E6PH 1V2LT 1B7XB 2V3HH 2BDAA 4KP0A 3T2NA 2FYQA 1A2CH 6CHAC 4OGXA 4BXSA 1G32B 3SW2B 2R2WU 1OYQA 1BBRH 2ZFQH 3M7UA 2A2QH 1KY9A 1YCPM 1FN8A 2ZFFH 4YLQH 3PLKA 2QF3A 3SQHE 4K69A 1A46H 2GKVE 3P17H 4UDWH 1RIWC 2UUJB 3MI4A 4VGCB 1K1OA 3ITIA 3TH3H 1Y3YA 2VWLA 1QA7A 3NUMA 1DWEH 1GI8B 4B75A 1GMHG 3BTWE 3RU4E 1EQ9A 1AE5A 3TGJE 5EOKA 1QL9A 1LTOA 4XBDA 1FN6A 4ISHH 3ATKA 5K0HA 1C4U2 1MKWK 1CT0E 2OBOA 1AB9C 1H4WA 1XUJA 2P8OB 2P94A 1HAVA 1CGJE 1P05A 3OU0A 1OP0A 1TWXB 2QCYA 4TPYA 1Y3WA 2OC7A 2ZU1A 1O2WA 2LPRA 3PMAB 1YLDA 3GY3A 1LPGB 4NA7A 2A4OA 2AIQA 4R0IA 1F0RA 4DCDA 1WBGB 2WYGA 2BD4A 3PM3A 1ZOMA 4X8UH 3ZZ8A 1V2UT 1P57B 3PWCA 3RXIA 4KTCA 3SQEE 1WTHD 5F03A 3ZZ6A 3ZZ7A 1ZTLA 1DXPA 1P12E 3K6YA 3KNXA 2FOAA 5LPFA 1L4DA 1GI5A 1FONA 1CHOG 1XUHA 3RXEA 1GBMA 3RXMA 1ZJKA 2J9NA 1TNJA 2VWNA 3PTNA 3T5FH 1OOKB 1P02A 2BY5X 5E2PA 3SV6A 1EPTC 1O3EA 1TNKA 1W7XH 4NIWA 4NZLA 2I6SA 4OS5A 1G3CA 1C2DA 1Z6JH 3AASA 1BQYA 1VITH 3RMMH 3RUOA 4Y76A 3SU3A