2VIDA

Serine protease splb from staphylococcus aureus at 1.8a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
199
Chain Sequence
ENNVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVDNRNAYGVYFTPEIKKFIAENIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SERINE PROTEASE SPLB
publication title Enzymatic Activity of the Staphylococcus Aureus Splb Serine Protease is Induced by Substrates Containing the Sequence Trp-Glu-Leu-Gln.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 56
structure length 199
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vidA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vidA02
2Z9KA 1C5ZB 2SGEE 1HRTH 4DVAU 5EW2H 3HGPA 3E90B 1O3KA 2VWNA 3M3SA 2BD5A 1IHSH 5A09A 2XC0A 2VGCB 1EZQA 1Y3XA 1TGCA 1SGIB 1C2FA 2VB0A 2QXIA 3RXTA 1DWCH 6GCHF 2BDCA 4NZLA 4NWLA 4MNVA 2VWOA 1GMHG 2UUJB 4AG2A 1O2QA 1CQQA 3ZZ5A 1FY3A 2G8TA 1MZAA 1A3EH 1Y3VA 4MPUA 2NU1E 3E8LA 2A32A 3QGNB 1C1NA 3UIRA 2QV1A 2BYAX 2G51A 1O0DH 2UWPA 1ESTA 4B2CA 1A5HA 1XXFA 3P17H 3RU4T 1SMFE 1XUFA 3GYMA 4NA9H 2ESTE 1TPAE 5FPYA 3KQCA 3P70B 1KTSB 4AN7A 1O2LA 4GHQA 3SNEA 4H6TA 3DD2H 1P3CA 2HRVA 3V3MA 1ZPZA 1G36A 3JZ2B 1ZHPA 4DG4A 1E0FD 1O5EH 1GCDA 4B76A 1XUKA 1XUJA 2ULLA 1YM0A 1CHOF 4YLQH 5EODA 2C8ZB 4VGCC 4DY7B 5C2ZA 2QA9E 1DY9A 1DWBH 1RRKA 3UNQA 1V2NT 4FU7A 1C1SA 5AFYH 1BHXF 3BTFE 1FV9A 1PQAA 4YOGA 1FNIA 1O35A 3ZZ4A 1GBEA 2Z9JA 1P01A 1AKSA 1W11U 4RKOB 1LKBA 4O3UA 2P94A 2C8XB 2ASUB 1N6YA 2O8TA 3LIWA 1GHYH 2JH5D 3KIDU 2AFQB 1O5FH 3MNXA 2P3UB 3ODFA 1V2QT 1GMDF 1PQ7A 3M7TA 1GL1A 2G5VA 1BOQA 4K8YA 3A7YA 1GI3A 2ANKH 1DOJA 5EPNA 1EJAA 1AO5A 2R9PA 3CS7A 3GCHB 2H5DA 2J92A 1U6QA 3PROA 1J9CH 3TLOA 1JXPA 2BM2A 1BTYA 2HOBA 2RG3A 1O36A 4A92A 2FX4A 1FAXA 3BF6H 2RDLA 2FOBA 1DWDH 3SJ9A 3QWCH 3CENA 3QK1A 4ZHAA 3IITA 4GUXA 1SOZA 4ABBA 5EQQA 2C8WB 3GY5A 2VGCC 5DP9A 4RSPA 3RMMH 1DS2E 1FZZA 4AYYB 1MTNB 3LGUA 2V0BA 3SU3A 1XVOA 1PPZA 4D8NA 3TJOA 2OC0A 1PPBH 2V3OH 3A80A 2VIQA 1GBTA 3E91A 1O2OA 1UTKA 1AZ8A 2ZFPH 4Q7ZA 1BBRK 3AAVA 1VJ9U 8LPRA 2C4FH 2XRCA 3RDZA 2PKSC 1LMWB 5E2OA 3LOXA 1ZSJA 1DM4B 1Q2WA 5A0CA 5FX6A 4GCHG 2PFEA 3ZVFA 3SV2H 4CR9A 1F5LA 3UPEA 4D7GA 1QBOA 3GDSA 3PMJA 3RUOA 1V2JT 3EA8A 3RLYH 1EB1H 1NN6A 1V2UT 2P16A 1Z8IB 2A5KA 3SQHE 3GDUA 2ZQ2A 3AW1A 1GMCG 1TNLA 2FS9A 1G9IE 1O2ZA 3RXIA 2UUFB 4FUFA 3KCGH 1ANBA 3S9AA 5C5NA 1GPZA 2GCHG 5AF9H 3UNRA 1TB6H 1D3QB 3GY4A 4CREA 1UTMA 3SU6A 3C27B 3A82A 3RU4E 4GSOA 1GHZA 4X6OA 3SGAE 3GDVA 3K2UA 2VIVA 1RS0A 2A2XH 1INCA 2G00A 1UVOA 3P8GA 4WH6A 1GI6A 2P95A 3M3TA 3EGKH 1L0ZA 3D65E 1DLEA 1O3MA 5CE1A 3P8FA 1GJDB 2BLQA 4Y8XA 2TRMA 5DP3A 4Y10E 2F91A 3TGIE 2BD3A 4INKA 2EI8A 1ZRKA 1QRWA 5ESTE 3TNTA 4TY6A 1HB0B 2FTMA 3EQ0H 1GHBF 3ZVEA 3BEFB 1UVPA 3SJOA 1SHHB 2O8LA 1PYTC 3BG4C 2ODQA 1MTVA 2FOEA 1BUIA 6LPRA 3UR9A 1MQ6A 1NT1A 4ABEA 5HGGA 4ZKOU 2G81E 1EXFA 2BDIA 1TGBA 8KME2 4E05H 3RXEA 1L1JA 3H5CB 4FVDA 4INLA 1EAUA 1NU7B 2Z3EA 1GHWH 1AD8H 1TRNA 2P8OB 1MUEB 1PPEE 1DWEH 3U9AH 1AE5A 1AI8H 1EZUC 1GJ7B 4Y7AA 5FBEA 1XXDA 1NC6A 1O5AB 4KTSA 3OY6U 1IQGA 1YPHE 1EPTB 2F9BH 2FWWA 1E37B 1YPJH 1CE5A 2VIOA 3GY2A 4AB8A 3U8RH 1A46H 1P06A 3MU8A 1W12U 3U8OH 1HCGA 2SGQE 2V3HH 3ATKA 4LXBH 2FOFA 4TWWA 1BDAA 1PJPA 3K6ZA 1H1BA 3SU1A 4OS7A 1O2KA 5ETXA 3BV9B 2C90B 2ZHFH 3SU2A 1QR3E 3OSYA 3ZVBA 1H9LB 4X8UH 3UWIA 1GBFA 4THNH 2PHBA 3ITIA 3LH3A 4MPVA 2BZAA 1AMHA 5C1YA 4ABIA 1YP9A 1NTPA 3PMBB 1ZRBA 4JZ1A 2CGAA 3LH1A 2R3UA 1TNKA 4AX9H 4YO9A 3M36A 4FUGA 3MU1A 4KTCA 4WVPE 4IBLH 1EZXC 3STJA 3W95A 1VITF 1EB2A 4ZHLU 1QRXA 2ZCLP 1DLKB 2ZFSA 1F0TA 1F5KU 4YZUA 2WPIS 1O38A 3RXHA 5GJ4B 1HXEH 1MBMA 4UDWH 4WMDA 5C67A 1C1TA 2ZU3A 2OXSA 4ZKSU 1GVLA 1FUJA 1T32A 1LVOA 4CH2B 2GZ8A 3ZZBA 1SG8B 2QXGA 3BEUA 1P8VC 1HXFH 1K1LA 1Y59T 4X8SH 3RXQA 2A7HA 3GOVB 1WOFA 2SGAA 2SGFE 4I7YH 2BQ6B 2ZDAH 1QA0A 2Z9GA 2W5EA 1FY8E 3R0FA 1LPZB 2OINA 2B9LA 2ZFRH 1SGRE 2ZZUH 1FN6A 4X1RU 1V2TT 1V2VT 2PUQH 1BT7A 3MH6A 4JYVH 2F9UA 2BLVA 3ZZ8A 3LGTA 1BZXE 5B6OA 2GCTB 1THSH 3SU4A 1ELGA 2NWNA 4U2WA 1YPGH 1S6FA 5CMXH 3RXLA 2C3SA 4LZ4B 1DY8A 3TK9A 1K1NA 4X6PA 3QUMP 1C2LA 1DX5M 4LOYH 4UD9H 1RIWC 3BTDE 1B0EA 2F9NA 1TOCB 1ANEA 2OC8A 3AW0A 4MQAA 2JETB 4NIYA 2D1JA 1WUNH 3RU4D 3VB4A 3V12A 1O5DH 2XTTB 1QB9A 3RXVA 1TBRH 3CP7A 1O39A 3A7VA 1BBRH 2PGQB 2NU2E 3QTVH 1P11E 1BITA 2WPLS 2QAAA 2ZF0H 1SGFG 1BMAA 7GCHF 4XDEA 1IHTH 1CHGA 1G32B 3PTNA 3U8TH 2XBYA 2Z7FE 3RXAA 2ZHEH 2QYIA 2ZGBH 3SV7A 1HDTH 3PWCA 5L30H 1CA0B 4ZXYH 3MTYA 1K9OE 1GHAG 2EI7A 5FPSA 2ZFQH 1RJXB 2ZIQH 5LGOA 1VCWA 1O2TA 7LPRA 2A5AA 2BB4A 1EUFA 2O8WA 2ZO3H 5EXMA 1WYKA 1TRYA 1TNHA 2ZPSA 3ATLA 4F4OC 1TPPA 4AFSA 2XWBI 2PR3A 1A0JA 4BXWA 5JB9S 1JMOH 3SUGA 1AVGH 1TX6A 4IW4E 1MCVA 1O31A 2AYWA 2F9OA 1V2ST 4ABDA 1O3CA 1C1OA 1LQEA 4BNRA 4Y6DA 1EP6A 3BN9A 3UUZA 4NIXA 1QFKH 1CU1A 2GVFA 3MWIU 4CHAC 2AGEX 8ESTE 2QXHA 1BA8B 1ZMLA 4IMQA 1MTSA 1PPCE 1C4V2 3KF2A 1NROH 3SGBE 1KXEA 3PO1B 2Y81A 4HGCA 1O2MA 4F49A 2Q6DA 3JZ1B 4X8VH 1KDQB 3A8BA 3F9FA 1FDPA 2J95A 2ZGHA 5GPIB 3MYWA 3V7TA 1F7ZA 1TMBH 1XVMA 2BDGA 3F9EA 3GCTG 1O2SA 2VH6A 2VNTA 3K9XB 3NK8A 1UHBB 4NG9H 2GP9B 4FUBA 2CMYA 5E0HA 4Y79A 4LK4A 1N8OB 1A2CH 2O8MA 1BTXA 5JBTA 2CHAB 3E16B 5F8ZA 1Y8TA 2AEIH 2Z9IA 1F0UA 1GJ4H 2ZDLA 3MU5A 1JIRA 1QHRB 7KMEH 1C5XB 1GVKB 4XE4A 5T6FA 4X6NA 4NSYA 1L4DA 1P12E 5I25A 4E06H 1IQNA 1LO6A 1A3BH 1PPHE 4ZROA 2OLGA 3A85A 3M5OA 4Y0ZE 2JETC 2ZHQH 5DP7A 3TJUA 1AQ7A 2ANYA 2JH0D 2AIPA 3A7ZA 2W7SA 1CGIE 1G3CA 2B5TB 4YLUA 5EPYA 2SNVA 1OOKB 3F9GA 5HXFA 1TGTA 1W10U 1GHXH 2FLBH 1GDUA 2PKAA 1JRSA 2G4TA 4UE7H 1AIXH 3DA9B 2AERH 4H4FA 3E3TA 2IPHA 4B2AA 4B75A 1SB1H 1C2JA 3L33A 1C5TA 3MH4A 1O2HA 4OS6A 1JRTA 1BMLA 1QQUA 1P0SH 1BMNH 1CA0C 1MKWH 1TX8A 4Q80A 1EATA 4Q7XA 1HNEE 2A7CA 1C2MA 3DHKH 2BD4A 1T8NA 1OX1A 2GT7A 5AFZH 3A88A 2BY6X 1LVMA 1SLXB 1ESAA 1Z1JA 1O3LA 4MTBA 1KTTB 4A7IB 4Y7BA 1XX9A 1GMHF 3TGKE 2Y80A 2OBQA 1UK3A 4K2YA 1XKBC 1HAIH 2UUKB 1FPCH 1KLTA 1DPOA 5DP6A 5IYTA 3P95A 4ZUHA 1QBVH 1YCPM 1EX3A 1UTOA 4B1TA 1FY1A 2Z3CA 1ELCA 1K1MA 1PQ5A 1WTGH 1C5MD 4O3TA 1E34B 1G2LA 2ZI2H 4YM9A 4HZHA 2QF3A 4HTCH 2ZA5A 4AFZA 1C5QA 2ZDKA 1O3AA 4AGKA 5T6DA 3Q00A 1V6DA 3MHWU 2ZCHP 1C5WB 3I77A 1O2PA 4MPXA 2IN2A 2J9NA 1KYNA 1ZSLA 1FN8A 5IDKA 5DO4H 1TNJA 4HFPB 3BTKE 6CHAB 4DIHH 1IQMA 1TNGA 4MPWA 1O3JA 1ZPCA 3MH7A 1S84A 2WPMS 2FS8A 2HWLB 1QTFA 1YPMH 2TPIZ 1GCTC 3HKIB 3UY9A 1ELEE 2FDAA 2BOKA 3RMLH 1O32A 2FM2A 4D7FA 2OQ5A 1K28D 2ZWLH 1GBHA 1O3FA 1ELDE 4KGAA 3TVJB 5F03A 1LHCH 1GG6C 1GJ6A 2WUBA 2TIOA 2XNIA 4UFDH 3TNSA 1WSSH 1EZSC 4Q2KA 1TONA 4KTUA 2EA3A 2WINI 1UCYK 4BOHA 4J2YB 2WPJS 1AHTH 1OWKA 1OWEA 1HAPH 1YPEH 2BOHB 3PV4A 1W7GH 2ZP0H 2Z94A 1P2OA 1KSNA 2FOGA 1O2WA 3MFJA 2HVXA 1AWFH 3S7KB 1G3EA 1HJAB 2ZFFH 1VGCB 2WYGA 4MG3A 3MNSA 1J17T 1TGSZ 4XBBA 4FVBA 2BDBA 2H9HA 6ESTA 2GMTB 1E36B 1QA7A 3BSQA 2P59A 3LJOA 2NU4E 3KNXA 1EASA 1ZGIA 3E0PB 1O3IA 4Y71A 1D6WA 2K1QA 1AKSB 1SLWB 1CHOG 1DICA 4MVNA 2BX3A 4XBDA 2FEQH 4MNYA 4HI3A 2AGIX 3RXUA 2QIQA 4A1VA 4YESB 1FIWA 2AMDA 1GBCA 3BTHE 2R0KA 4B2BA 4NWKA 1OWJA 4AFUA 1GVZA 2ODYB 3BG8A 1TYNA 1TMUH 1UTNA 1RGQA 3ATIA 1P57B 2GX4A 1CGHA 4GCHF 4IC6A 1XKAC 4ZMAH 5LPEA 1GJ5H 1V2MT 3SBKA 3VB7A 3VPKA 1TRMA 3AAUA 3IG6B 1L2EA 2CV3A 1AUJA 2ZQ1A 3SUEA 3WY8A 1K21H 1LQDB 4UFEH 3RM0H 2SGPE 2YNBA 3M3VA 1YCPH 2H2ZA 4BAMB 2F83A 1GMCF 1GI2A 4TPYA 5GWZA 1O30A 2STBE 5C20A 6CHAC 1C5SA 4RN6A 4O03A 1PYTD 3HK3B 1GGDB 1MBQA 3BIUH 4NA8A 4NIVA 3LGIA 2ZU4A 3S0NA 5DPAA 1UMAH 1FIZA 2ZHWH 1HJ9A 1MAXA 1KXCA 1T8MA 4IN2A 1DUAA 3VB6A 4PROA 2ZTXA 1IQLA 3SORA 1C1MA 3FAOA 2Y5GA 4BAOB 4I8GA 1KIGH 5F8XA 4E7NA 4X1NU 2PWXA 3A7WA 4JYUH 3TU7H 1W8BH 5JYIA 2NU0E 1TFXA 4FUDA 1W0YH 5K7RA 1SGPE 2R0LA 1G2MA 3ATWA 2EC9H 4NIWA 1RFNA 2IJOB 1T4UH 3GY6A 1IOEA 1WBGB 3B9FH 3IWMA 3RXRA 1LDTT 1SGEE 2XBVA 2ILNA 2ZU1A 3ESTA 1D9IA 1QJ6B 9ESTA 1XUHA 3GY8A 2BD2A 2FIRH 3Q3XA 4I33A 4ISIH 2VIDA 1J14A 1NRSH 2J38A 4GHTA 1NPMA 3SV8A 2A4OA 3TH3H 1NFWA 1QBNA 1ZSKA 1O3DA 1C1WH 3M7UA 2R3YA 1ZTLA 1MH0A 3ZVDA 2O9QA 1HAOH 4K3JA 2J4IA 1OYQA 1QL7A 1V3XA 1TIOA 3QTOH 4R0IA 3GCHC 2AMQA 2XWAA 4ASHA 2ANWA 2BQWB 3ZVAA 4Z6AH 8GCHF 1T8OA 3DUXH 1O2JA 4X1PU 1V2RT 1E38B 3ZVCA 4FUIA 1O3HA 1B7XB 2ZG0H 1CGJE 5G4BA 1K1IA 2BY8X 4D9QA 1O2YA 3RXGA 1W13U 3M35A 5ABWA 5A8ZA 1BRCE 3S69A 2G52A 1Y5UT 4O97A 4OS1A 1AB9B 1OXGA 5EOKA 1ANCA 1HAZB 1P3EA 4TY7A 5EG4A 1KLIH 1O3EA 4JK6A 5EXLA 3RXCA 1C5UA 3M5LA 1MTNC 1SQAA 5FXLA 1K1OA 3EAJA 1BQYA 4BTTB 2HLCA 2HPQH 3ZZ7A 1A0LA 4WMEA 1GDNA 3A8CA 1O3PB 1OPHB 1YPLH 1O34A 1EOJA 1RTFB 4XBCA 2LNCA 4X2VA 3UOPA 1TOMH 1P2JA 1DXWA 2CJIA 1VCQA 2GTBA 3LGWA 2DE9A 1MKWK 2FTLE 3ZZCA 2Y5HA 1O3NA 3BTQE 1O3BA 1A4WH 1NY22 3T29A 3TIUA 2VINA 1ETSH 1ELBA 4DT7B 1BCUH 2XW9A 4A1TA 1Z7KA 2F9VA 1ZOMA 5GIBA 2VWLA 4X1QU 4OGYA 1UCYH 4CR5A 5F8TA 1SGTA 2BLWA 1EP5A 1NFYA 1UTJA 2VVUA 1SSXA 1GBDA 2ZCKP 1SI5H 1RTLA 1J15A 4FU9A 1GJ8B 2SGDE 1TQ7B 3BTGE 3EE0B 1C2IA 2BMGB 2IOTA 3P8NA 1LVBA 3RXDA 1LHEH 1QJ1B 1YLDA 2FX6A 2OP9A 1P9SA 2THFB 3GCNA 1UVUH 2VJ1A 3QGJA 4UFGH 3GICB 2FOAA 1SVPA 1ZYOA 1NS3A 2B8OH 3PM3A 7ESTE 1NFXA 1O5CB 4X2WA 3U98H 1O33A 4FU8A 5L2YH 4TWYA 1DSUA 3G01A 3GISB 5JBBS 1IQEA 3D62A 1C1VH 2HPPH 3LC3A 5EQSA 1AFQB 2TGAA 3HGNA 2H9TH 4INHA 3LPRA 4BAQB 3A8DA 1GHVH 1D3DB 2C8YB 2OUAA 4JZEH 1ELFA 2B0FA 2FXRA 3QDZB 5FX5A 1ETTH 4TPIZ 3FZZA 4OS2A 1HUTH 4K60A 3TJNA 4FUEA 3T27A 1GI9B 1T8LA 1C1QA 2KAIA 2WPKS 1P09A 4AG1A 5TCCA 1C2EA 2YOLA 1IQKA 2ODPA 3SNCA 1BBRE 2DUCA 1GHAF 2ZNKH 1HAVA 3M37A 5C1XA 3V13A 2P8OC 1GDQA 3FP6E 4Y8ZA 1K2I1 3GYLB 4XOJA 2GDDA 3MH5A 1TA6A 2FO9A 1EPTC 4IC5A 2ALVA 2GD4B 2A2QH 2VU8E 1EQ9A 4NSVA 4B73A 1AUTC 5AVDA 2BVSH 3BIVH 1G37A 2ZECA 2G4UA 5DP4A 1DDJA 2A31A 1DUEA 1TMTH 1K1JA 1Y5BT 2TGDA 3A83A 4NCYA 5C1UA 1ARCA 3LGVA 1W7XH 2BD7A 5GCHF 3H7OA 4DIIH 4I8HA 2VIWA 1Y3WA 1TAWA 1IQIA 2D8WA 3QLPH 1Y5AT 4YT7H 1O5GH 3A84A 3RMOH 2PTCE 4R8TB 3ZZ6A 1QRZA 4CRDA 3BEIB 3FP8E 1C5YB 3GCTF 1NESE 1HAGE 3RM2H 3D23A 3CS0A 1SGDE 2OTVA 3TITA 4CRFA 4AZ2B 3M7QA 3U1JB 3F1SB 3Q3KA 1GBBA 1ZMJA 4K1EA 1MTWA 1ARBA 2LPRA 2AH4X 4NA7A 5HYOA 1AFEH 1C2GA 2OD3B 2ZDVH 1UTQA 1FJSA 2FI3E 4B74A 1AU8A 1S81A 3NZIA 4U32A 1GI8B 4ZH8A 1YCPK 1LHFH 3QX5H 1HIAA 1QIXB 3MO3A 4FUJA 1YPKH 2ZDMA 1LVYA 3A89A 5SGAE 1IQHA 1SGQE 1OP8A 3F6UH 1ESBA 3QZQA 3NCLA 1DT2A 2AMPA 3UOUA 1C5PA 3SI3H 4WMFA 1AFQC 1P04A 4NZQA 3QO6A 1LHDH 3KEEA 3BTTE 1UK2A 2GCTC 4X1SU 1ABJH 1FAKH 3PB1E 2GKVE 4NFFA 1CA8B 2NU3E 2Y7XA 1ZJKA 1TABE 2WV4A 1GI4A 1DXPA 3MMGA 3MNCA 1KY9A 2RCEA 3VB5A 5L6NH 1WQSA 2RA0A 4I8KA 4GPGA 1P2KA 4QT8C 4Y0YE 1ABIH 1C5VA 1XMNB 3DFLA 1XUIA 4X2YA 3A7TA 4UEHH 5BRRE 1O3GA 2BX4A 1HBTH 5EXNA 2FODA 1WCZA 3NXPA 4WF8A 1H9IE 1NRQH 1GBIA 1M9UA 2Z6BD 1S82A 1W2KH 4DGJA 1LPKB 1QY6A 1CT0E 3MO6A 1YGCH 3UQOA 4X6MA 5C5OA 5H4IB 4YOJA 3KN2A 1O2RA 4VGCB 4CRBA 1W14U 1ZTKA 4Z0KA 3UNSA 3T26A 1VJAU 2I6QA 2M5TA 4WXVA 2ZHDA 1P03A 4X8TH 3HK6B 3URDA 2HALA 1MCTA 4A1XA 3VXFH 4CBNA 2P3FH 3PLPA 1TQ0B 1C4U2 1A61H 1BTZA 3VB3A 3U69H 1FQ3A 1P2NA 2PKAB 2BXUH 3MO9A 1D3TB 5A8XA 3U1IB 1GBLA 1TWXB 3BTWE 1MAYA 5J4QA 1C1PA 4A6LA 1GWAA 1PQ8A 3RC5A 2Y7ZA 3SUDA 1QGFA 3UFAA 2GV7A 2JH6D 2I6SA 2FPZA 1F0SA 3R3GB 1BTWA 1TPOA 2BVXH 2ZEBA 5JB8S 3T2NA 1NM6A 4D76A 3AVZA 1L1NA 5A2MH 1LCYA 3V0XA 4ABJA 3K65B 4CRAA 3DT0H 1O5BB 3W94A 5K0HA 3LJJA 4K8BA 4KELA 3HPTB 3T28A 3PO1C 2G5NA 1HGTH 1LHGH 3E0NB 1AWHB 1SBWA 2H6MA 3OYPA 3SZNA 4IMZA 4CBOA 1DANH 2XCFA 5DGJA 1TX7A 1KXFA 2QCYA 2Z9LA 1ZJDA 3KQDA 1GI0A 3SHAH 2R2WU 4BAKB 1N8OC 2ZKSA 3FP7E 4BTUB 2CHAC 3ZZAA 3H7TA 1O2XA 1GI1A 1FY4A 1C2KA 3ZYEA 1XUGA 1UJ1A 4MLFB 1QQ4A 1NFUA 1Z6JH 3LONA 2PKSB 1BTPA 1UK4A 3STIA 3VEQB 4Y76A 4K1SA 5DG6A 5A0BA 2PGBB 4JZFH 2W26A 6GCHG 1B0FA 2FMJA 5PTPA 1HPGA 1THRH 4YT6H 5A8YA 1GL0E 2BLOA 3VFEA 1ZTJA 3VXEH 3SO3A 1C5OH 1H8DH 4AYVB 1V2OT 2ZPQA 4DURA 1F92A 3TK6A 1BHXB 1O2NA 3SN8A 1TLDA 2BXTH 4X0WU 3OX7U 2F9PA 3P6ZB 4U30A 1EAIA 1GJCB 1SL3A 4B71A 1AE8H 1QB6A 4I8LA 2QY0B 4NFEA 3KL6A 4ZXXH 1C5NH 3DFJA 5GDSH 4JZDH 1T31A 2ZGJA 2BDHA 1WTHD 3SV6A 1K1PA 3SOSA 3UWJH 2BTCE 5DK1A 2FESH 1ZPBA 1V2KT 3SNAA 1SOTA 3EA9A 1IQFA 1RD3B 5LPFA 2WPHS 5E8EH 3SW2B 2OC1A 3LKWA 3M61U 2CXVA 4OS4A 3SV9A 1BIOA 4AGJA 1BRUP 1DITH 3NKKA 1TPSA 1C9PA 1RTKA 1ZR0A 2QGRA 1PFXC 1S6HA 5ESBA 3UTUH 4OGXA 3UQVA 3RXMA 3RXSA 1PPGE 1ELTA 1W3CA 1P2QA 1YKTA 3PMHB 5JPMH 4IS5A 4OS5A 3VGCB 1ZMNA 2ZDNA 1O2GH 1GBMA 2GZ9A 2QF0A 3MU0A 3UR6A 3BG4B 5F6MA 1HAXB 1ZZZA 4H6SB 1NRNH 2OC7A 4SGBE 2GZ7A 3KQEA 2Q1JA 3OTJE 1EJNA 2B7DH 1W0ZU 1FLEE 1P9UA 3RC6A 1GMDG 1D3PB 3ZZ9A 1QURH 4SGAE 1L4ZA 2HNTF 4Y8YA 2BZ6H 3RP2A 1G3DA 2BHGA 5BPEA 2AGGX 2PTNA 4AB9A 1QJ7B 5GXPA 3D49H 2GCHF 4MNWA 1C1UH 3P8OA 1BJVA 3EYDA 1SLUB 3T25A 1D6RA 1SQOA 5HMAA 1ETRH 1KLJH 2BDYA 1MTUA 2GDEH 1JOUB 2QC2A 4I32A 1VITH 3C1KA 4RKJB 3QZRA 4JCNA 3S7HB 1LPGB 1O3OA 1XM1A 3PTBA 1ZLRA 2BQ7B 2BD8A 4WH8A 1MMJN 1G3BA 3SU0A 3TH2H 1OWHA 1UO6A 2QXJA 3LDXH 5FHTA 2C93B 2OQUA 3KGPA 3RXBA 4YTAA 4JYTA 4AORA 2Y82A 1QL8A 4ABGA 1HYLA 4FUCA 1HJAC 1SGCA 3M5NA 4D9RA 4DCDA 1S85A 5JDUB 3S9BA 1VGCC 1SFIA 3RC4A 1N6XA 4ABAA 3SGQE 4BAHB 1NZQH 3NUMA 2FOMB 1IQJA 3A8AA 5J4SA 1T7CA 3LGYA 3SI4H 2GMTC 1S0QA 4ZKNU 1AY6H 2YNAA 3RXFA 1AGJA 1THPB 3S9CA 1MU8B 4AFQA 1DVAH 1MZDA 2SNWA 5LPRA 4H42U 1FMGA 1GBJA 2D2DA 2P93A 4UFFH 1DSTA 4X2XA 3MNBA 1YBWA 1J8AA 1C4Y2 1SPJA 2W3IA 5T6GA 1YYY1 1A0HB 3O8DA 3ELAH 2R2MB 3I78A 3SU5A 1MKXH 1C1RA 1ANDA 1RXPA 3T5FH 4BANB 3VGCC 2PSXA 2UWOA 1Z8GA 2J2UA 3HKJB 5FBIA 1SFQB 3NWUA 2HNTC 1V2PT 3AASA 3LT3A 3Q3YA 3Q77A 3RXPA 1SGYE 3SNDA 3URCA 1EPTA 1Z8JB 1PPFE 3K6YA 3SUFA 1RIWB 3GCOA 3BTEE 3Q76A 4ISOA 5I46H 1GJBB 4ISHH 3A7XA 2V6NA 3T62A 2BY5X 1ORFA 1GHBG 3A87A 1GGDC 1IAUA 1O2IA 2FOCA 4IGDA 1ID5H 2H5CA 1FXYA 1ZGVA 1T4VH 8GCHG 1LTOA 1OKXA 2P3TB 4DJZB 2EEKA 2XBWA 4DOQA 5EU8A 5E0JA 4ISLA 1GI7B 4YOIA 3P92A 3ZV9A 2CF8H 1QB1A 1O2VA 1UCYE 2AIQA 1MQ5A 2FOHA 4UONA 2H9EH 2CN0H 1CVWH 2TGPZ 1P02A 1EJMA 5LH8A 3GY7A 5FPTA 1GI5A 2PLXA 3F68H 3ZVGA 4CRGA 2XYAA 1YC0A 1GBAA 1GJAB 3PMAB 1DE7H 1AZZA 2BDAA 4JK5A 1KXAA 4AOQA 2BVRH 1MD8A 1WV7H 2ZPRA 1P2IA 2PV9B 1SLVB 2BY9X 1NO9H 2VVCA 4I8JA 1H4WA 1FI8A 3EA7A 2FI4E 1OSSA 2AS9A 5C3NA 5JBCS 4CHAB 1P05A 3LU9B 2GT8A 1AN1E 3OY5U 1HFDA 4NGAH 1MD7A 1C2DA 1SGFA 1V2WT 4IN1A 4J1YA 1AVWA 1SGNE 3ZZ3A 3O8RA 1A5GH 4CH8B 3E1XB 2CF9H 1HJ8A 1TBZH 1S0RA 2SFAA 4WJG2 4O9VA 2FYRA 1VITG 5E2PA 1HV7A 2D26C 2PW8H 3TGJE 2A4GA 1S83A 3TPIZ 4CRCA 2XBXA 1S5SA 2XC4A 1BRBE 1CBWB 1Y3YA 4Q7YA 1HLTH 1QL9A 4FXGH 3ENSB 1BTHH 2WV5A 5CHAB 3SHCH 3BTME 2UUYA 2ZU5A 1ZHRA 1CSOE 3M5MA 1YLCA 1AB9C 1OP0A 4MDSA 1N1LA 1ELAA 3GY3A 4ABHA 3SJIA 1Y3UA 1D4PB 1K22H 2A0QB 3RXOA 4ABFA 2VH0A 2XC5A 2ZTYA 2WYJA 1KXBA 4XFQA 1WAYB 4XSKU 1Z6EA 5DJ7A 2KAIB 1VR1H 3B8JA 1F2SE 3ODDA 5HM9A 1C5LH 1LKAA 1HAVB 3FFGA 3RLWH 1JBUH 2GGVB 3A81A 2Z3DA 1F5RA 4BTIB 1P2MA 2GV6A 2XXLA 3A86A 1ACBE 3FVFB 3ZV8A 3SNBA 1CO7E 1ELVA 2F3CE 3L3TA 3I29A 1YF4A 5TCAA 2ZGCA 1WQVH 1AVXA 1BTUA 4K1TA 2ALPA 2XCNA 1BJUA 1DFPA 3EDXB 3NPSA 1CT4E 1OYTH 2Y5FA 2PUXB 4WY3A 4JMYA 5DP8A 2FZZA 5DKMA 1QCPA 3ZYDA 2TBSA 5FAHA 2STAE 4ISNA 3LC5A 2O8UA 1GBKA 1C9TA 1FPHH 3TJVA 2FYQA 1H8IH 1O2UA 5HM2A 4ZKRU 3FANA 7GCHG 1KDQA 2WUCA 3OU0A 1OP2A 2Q6GA 5JBAS 2W3KA 4JZIA 5E0GA 4KP0A 3QN7A 1OS8A 1X7AC 2VVVA 2A1DB 1UHBA 2ZC9H 1JIMA 2RA3A 1E35B 1O37A 3MOCA 4ZHMU 2OBOA 1H9HE 5GCHG 1NRPH 3ATMA 2ANMH 3PLKA 1VZQH 5EW1H 2PSYA 1V2LT 2J94A 2A4QA 2DE8A 1UTPA 1BRAA 1TA2A 2W7UA 4ESTE 2ZU2A 1P10A 1TBQH 1GJ9B 4GVUA 2EI6A 1UTLM 2JKHA 1FONA 1Z71A 1Z8RA 3RXJA 4KKDA 4E7RG 1UVTH 2Q6FA 4A5TS 1CBWC 1EOLA 2G55A 1HIAB 1TALA 2BD9A 2ZGXH 5AHGH 1GCTB 3PYHA 2BY7X 5CHAC 3SJKA 1EKBB 2J34A 5TJXA 1TNIA 4ZAEA 3FZDA 4Y11E 1BB0B 2TGTA 5FCKA 3O8CA 2Y6TA 1HAYB 2OCVB 3E6PH 1NU9A 4WXIA 1Q3XA 1TGNA 4FUHA 4WWYA 1JWTA 3RXKA 1G30B 2H1UA 1HAHH 1OWDA 1L1GA 1GG6B 2V35A 3PLBA 4K5ZA 3O8BA 2FP7B 2A7JA 5EQRA 1SHYA 5DP5A 1SR5C 9LPRA 5T3HA 3SJ8A 3TK5A 4M7GA 1CT2E 3UREA 3ZZDA 4DW2U 1SC8U 3SQEE 5FCRA 1VCPA 2HGTH 1Q31A 3B23B 3KQBA 1B5GH 1FY5A 3L6PA 1J16A 2FI5E 4U01A 1A1RA 1F0RA 1QNJA 4GAWA 1ZHMA 4K69A 1MU6B 4TYDA 1TE0A 3KHVA 3MI4A 1C5RA 1YPHC 2A4RA 2A5IA 1EAXA 2VIPA 5A0AE 2UWLA 3PWBA 3HATH 5EGMA 3TH4H 1Z1IA 2HNTE 1A5IA 2VWMA 2ZTZA 1EAWA 3N7OA 4I31A 1OWIA 2ZFTA 4BXSA 1MKXK 5L2ZH 1NRRH 1BMMH 3F9HA 4GLYA 1UVSH 1WU1A 4MNXA 1KXDA 1C2HA 3MU4A 2FLRH 2A45B 1A7SA 4LZ1H 3RMNH 2QN5T 1SQTA
chains in the Genus database with same CATH superfamily
2Z9KA 1C5ZB 2SGEE 1HRTH 4DVAU 5EW2H 3HGPA 3E90B 1O3KA 2VWNA 3M3SA 2BD5A 1IHSH 5A09A 2PP6A 2XC0A 2VGCB 1EZQA 1Y3XA 1TGCA 1SGIB 1C2FA 2VB0A 2QXIA 3RXTA 1DWCH 2WSSD 6GCHF 2BDCA 4NZLA 4NWLA 4MNVA 2VWOA 1GMHG 2UUJB 4AG2A 1O2QA 1CQQA 3ZZ5A 1FY3A 1YLNA 2G8TA 1MZAA 1A3EH 1Y3VA 4MPUA 2NU1E 3E8LA 2A32A 3QGNB 1C1NA 3UIRA 2QV1A 2BYAX 2G51A 1O0DH 2UWPA 1ESTA 4B2CA 1A5HA 1XXFA 3P17H 3RU4T 1SMFE 1XUFA 3GYMA 4NA9H 2ESTE 5DSFA 1TPAE 5FPYA 4ASUD 3KQCA 3P70B 1KTSB 4AN7A 1O2LA 4GHQA 3SNEA 4H6TA 3DD2H 3KYGA 1P3CA 2HRVA 3V3MA 1ZPZA 5FL7D 1G36A 2VBCA 3JZ2B 1ZHPA 4DG4A 1E0FD 1O5EH 2LP6A 1GCDA 4B76A 1XUKA 1XUJA 2ULLA 1YM0A 5HKKD 1CHOF 4YLQH 5EODA 2C8ZB 4VGCC 4DY7B 5C2ZA 2QA9E 1DY9A 1DWBH 1RRKA 3UNQA 1V2NT 4FU7A 1C1SA 2WPDD 5AFYH 1BHXF 3BTFE 1FV9A 1PQAA 1SKYE 4YOGA 1FNIA 1O35A 3ZZ4A 1GBEA 2Z9JA 1P01A 1AKSA 1W11U 4RKOB 1LKBA 4O3UA 2KX4A 2P94A 2C8XB 2ASUB 1N6YA 2O8TA 3F2HA 3LIWA 1GHYH 3WW7A 2JH5D 3KIDU 2AFQB 1O5FH 3MNXA 2P3UB 3ODFA 1V2QT 1GMDF 1PQ7A 3M7TA 1GL1A 5HIYA 2G5VA 1UW7A 1BOQA 4K8YA 3A7YA 1GI3A 2ANKH 1DOJA 5EPNA 1EJAA 1AO5A 2R9PA 3CS7A 3GCHB 2H5DA 2J92A 1U6QA 3PROA 1J9CH 3TLOA 1JXPA 2BM2A 1BTYA 3UB0A 2HOBA 2RG3A 1O36A 4A92A 2FX4A 1FAXA 3BF6H 2RDLA 2FOBA 1DWDH 3SJ9A 3QWCH 3CENA 3QK1A 4ZHAA 3IITA 4GUXA 1SOZA 4ABBA 5EQQA 2C8WB 3GY5A 2VGCC 5DP9A 4RSPA 3RMMH 1DS2E 1FZZA 4AYYB 1MTNB 3LGUA 3VG8A 2V0BA 3SU3A 1XVOA 1PPZA 2KFWA 4D8NA 3TJOA 2OC0A 1PPBH 2V3OH 3A80A 2VIQA 1GBTA 3E91A 5C0TA 1O2OA 1UTKA 1AZ8A 2ZFPH 4Q7ZA 1BBRK 3AAVA 1VJ9U 8LPRA 2C4FH 2XRCA 3RDZA 2PKSC 1LMWB 1K0HA 5E2OA 3LOXA 1ZSJA 1DM4B 2WV9A 1Q2WA 5A0CA 5FX6A 4GCHG 2PFEA 3ZVFA 3SV2H 4CR9A 1F5LA 3UPEA 4D7GA 1QBOA 3GDSA 3PMJA 3RUOA 1V2JT 3EA8A 3RLYH 1EB1H 1NN6A 1V2UT 2P16A 1Z8IB 2A5KA 2L6OA 3SQHE 3GDUA 1COWD 2ZQ2A 3AW1A 1GMCG 1TNLA 2FS9A 1G9IE 1O2ZA 3MQKC 5HIZA 3RXIA 2UUFB 4FUFA 3KCGH 1ANBA 3S9AA 5C5NA 1GPZA 2GCHG 5AF9H 3UNRA 1TB6H 1D3QB 3GY4A 4CREA 1UTMA 3SU6A 3C27B 3A82A 3RU4E 4GSOA 1GHZA 4X6OA 3SGAE 3GDVA 3K2UA 2VIVA 1RS0A 2A2XH 1INCA 2G00A 1UVOA 3P8GA 4WH6A 1GI6A 2P95A 3M3TA 3EGKH 1L0ZA 3D65E 1DLEA 1O3MA 5CE1A 3P8FA 1GJDB 2M2AA 2BLQA 4Y8XA 2TRMA 5DP3A 4Y10E 2F91A 3TGIE 2BD3A 3F2GA 4INKA 2EI8A 1ZRKA 1QRWA 5ESTE 3TNTA 4TY6A 1HB0B 2FTMA 3EQ0H 1GHBF 3ZVEA 3BEFB 1UVPA 3SJOA 1SHHB 2O8LA 1PYTC 3BG4C 2ODQA 1MTVA 2J98B 2FOEA 2RDEA 1BUIA 6LPRA 3UR9A 1MQ6A 1NT1A 4ABEA 5HGGA 4ZKOU 2G81E 1EXFA 2BDIA 1TGBA 8KME2 4E05H 3RXEA 1L1JA 3H5CB 4B6EA 4FVDA 4INLA 1EAUA 1NU7B 2Z3EA 1GHWH 1AD8H 1TRNA 2P8OB 1MUEB 1PPEE 1DWEH 3U9AH 1AE5A 1AI8H 1EZUC 1GJ7B 2K0QA 4Y7AA 1XXDA 5FBEA 1NC6A 1O5AB 4KTSA 3OY6U 1IQGA 1YPHE 1EPTB 2F9BH 2FWWA 1E37B 1YPJH 1CE5A 2VIOA 2YMSB 3GY2A 4AB8A 3U8RH 1A46H 1P06A 3MU8A 1W12U 3U8OH 1HCGA 2SGQE 2V3HH 3ATKA 4LXBH 2FOFA 4TWWA 1BDAA 1PJPA 3K6ZA 1H1BA 3SU1A 4OS7A 1O2KA 5ETXA 3BV9B 2C90B 2ZHFH 3SU2A 1QR3E 3OSYA 3ZVBA 1H9LB 4X8UH 3UWIA 1GBFA 4THNH 2PHBA 3ITIA 3LH3A 4MPVA 2BZAA 1AMHA 5C1YA 4ABIA 1YP9A 1NTPA 3PMBB 1ZRBA 4JZ1A 2CGAA 3LH1A 2R3UA 1TNKA 4AX9H 4YO9A 3M36A 4FUGA 3MU1A 4KTCA 4WVPE 4IBLH 1EZXC 3STJA 3W95A 1VITF 1EB2A 4ZHLU 1QRXA 2ZCLP 1DLKB 2ZFSA 1F0TA 1F5KU 4YZUA 2WPIS 1O38A 3RXHA 5GJ4B 2J5UA 1HXEH 1MBMA 4UDWH 4WMDA 5C67A 1C1TA 2ZU3A 3F2FA 3N7DA 2OXSA 2EY4C 4ZKSU 1GVLA 1FUJA 1T32A 1LVOA 4CH2B 2GZ8A 3ZZBA 1SG8B 2QXGA 3BEUA 1P8VC 1HXFH 1K1LA 1Y59T 4X8SH 3RXQA 2A7HA 3GOVB 1WOFA 2F4LA 2SGAA 2SGFE 4I7YH 2BQ6B 2ZDAH 1QA0A 2Z9GA 2W5EA 1FY8E 2J97A 1LPZB 2OINA 2B9LA 3R0FA 2ZFRH 1SGRE 2ZZUH 1FN6A 4X1RU 1V2TT 1V2VT 2PUQH 1BT7A 3MH6A 4JYVH 2F9UA 2BLVA 3ZZ8A 3LGTA 1BZXE 5B6OA 2GCTB 1THSH 3SU4A 1ELGA 2NWNA 2WHXA 4U2WA 1YPGH 1S6FA 5CMXH 4RI0A 2C3SA 3RXLA 4LZ4B 1DY8A 3TK9A 1K1NA 4X6PA 3QUMP 1C2LA 1DX5M 4LOYH 4UD9H 1RIWC 3BTDE 1B0EA 2F9NA 1TOCB 1ANEA 2OC8A 3AW0A 4MQAA 2JETB 4NIYA 2D1JA 1WUNH 3RU4D 3VB4A 3V12A 1O5DH 2XTTB 1QB9A 3RXVA 1TBRH 3CP7A 1O39A 3A7VA 1BBRH 2PGQB 2NU2E 3QTVH 1P11E 1BITA 2WPLS 2QAAA 2ZF0H 1SGFG 1BMAA 7GCHF 4XDEA 1IHTH 1CHGA 1G32B 3PTNA 3U8TH 2W6ID 2XBYA 2Z7FE 3RXAA 2ZHEH 2QYIA 2ZGBH 3SV7A 1HDTH 3OEED 3PWCA 5L30H 1CA0B 4ZXYH 3MTYA 1K9OE 1H8HD 1GHAG 2EI7A 5FPSA 2ZFQH 1FX0B 1RJXB 2ZIQH 5LGOA 1VCWA 1O2TA 3GS9A 7LPRA 2A5AA 2BB4A 1EUFA 2O8WA 2ZO3H 5EXMA 1WYKA 1TRYA 1TNHA 2ZPSA 3ATLA 4F4OC 1TPPA 4AFSA 2XWBI 2PR3A 3SZEA 1A0JA 4BXWA 5JB9S 1JMOH 3SUGA 4Z1MD 1AVGH 1TX6A 4IW4E 1MCVA 1O31A 2AYWA 2F9OA 1V2ST 4ABDA 1O3CA 1C1OA 1LQEA 4BNRA 4Y6DA 1EP6A 3BN9A 3UUZA 4NIXA 1QFKH 1CU1A 2GVFA 3MWIU 4CHAC 2AGEX 8ESTE 2QXHA 1BA8B 1ZMLA 4IMQA 1MTSA 1VKYA 1PPCE 1C4V2 3KF2A 1NROH 5CHBA 3SGBE 1KXEA 3PO1B 2Y81A 4HGCA 1O2MA 4F49A 2Q6DA 3JZ1B 4X8VH 1KDQB 3A8BA 3F9FA 1FDPA 2J95A 2ZGHA 5GPIB 3MYWA 3V7TA 1F7ZA 1TMBH 1XVMA 2BDGA 3F9EA 3GCTG 1O2SA 2VH6A 2VNTA 3K9XB 3NK8A 1UHBB 4NG9H 2GP9B 4FUBA 2CMYA 5E0HA 4Y79A 4LK4A 1N8OB 1A2CH 2HVYB 2O8MA 1BTXA 5JBTA 2CHAB 3E16B 5F8ZA 1Y8TA 2AEIH 2Z9IA 1F0UA 1GJ4H 2ZDLA 3MU5A 1JIRA 1QHRB 7KMEH 1C5XB 1GVKB 4P00A 4XE4A 5T6FA 4X6NA 4NSYA 1L4DA 2LELA 1P12E 5KEDA 5I25A 4E06H 1IQNA 3N7EA 1LO6A 1A3BH 3PV5A 1PPHE 4ZROA 2OLGA 3A85A 3M5OA 4Y0ZE 2JETC 2ZHQH 5DP7A 3TJUA 1AQ7A 2ANYA 2JH0D 2AIPA 3A7ZA 2W7SA 1CGIE 1G3CA 2B5TB 4YLUA 5EPYA 2SNVA 1OOKB 3F9GA 5HXFA 1TGTA 1W10U 1GHXH 2FLBH 1GDUA 2PKAA 1JRSA 2G4TA 4UE7H 1AIXH 3DA9B 2AERH 4H4FA 3E3TA 2IPHA 4B2AA 4B75A 1SB1H 1C2JA 3L33A 1C5TA 3MH4A 1O2HA 4OS6A 1JRTA 1BMLA 1QQUA 1P0SH 1BMNH 1CA0C 1MKWH 1TX8A 4Q80A 1EATA 4Q7XA 1HNEE 2A7CA 1C2MA 3DHKH 2BD4A 1T8NA 1OX1A 2GT7A 5AFZH 3A88A 2BY6X 1LVMA 1SLXB 1ESAA 1Z1JA 1O3LA 4MTBA 1KTTB 4A7IB 4Y7BA 1XX9A 2EQNA 1GMHF 3TGKE 2Y80A 2OBQA 1UK3A 4K2YA 1XKBC 1HAIH 2UUKB 1FPCH 1KLTA 1DPOA 5DP6A 5IYTA 3P95A 4ZUHA 1QBVH 1YCPM 1EX3A 1UTOA 4B1TA 1FY1A 2Z3CA 1ELCA 1K1MA 1PQ5A 1WTGH 1C5MD 4O3TA 1E34B 1QZ8A 1G2LA 2ZI2H 4YM9A 4HZHA 2QF3A 4HTCH 2ZA5A 4AFZA 3NRLA 1C5QA 2ZDKA 1O3AA 4AGKA 5T6DA 3Q00A 1V6DA 3MHWU 2ZCHP 2L74A 1C5WB 3I77A 1O2PA 4MPXA 2IN2A 2J9NA 3DSPA 1KYNA 1ZSLA 1FN8A 5IDKA 5DO4H 1TNJA 4HFPB 3BTKE 6CHAB 4DIHH 1IQMA 1WDIA 1TNGA 4MPWA 1O3JA 1ZPCA 3MH7A 1S84A 2WPMS 2FS8A 2HWLB 1QTFA 4F55A 1YPMH 4M9FA 2TPIZ 1GCTC 3HKIB 3UY9A 1ELEE 2FDAA 2BOKA 3RMLH 1O32A 2FM2A 4D7FA 2OQ5A 1K28D 2ZWLH 1GBHA 1O3FA 1ELDE 4KGAA 3TVJB 5F03A 1LHCH 1GG6C 1GJ6A 2WUBA 2TIOA 2XNIA 4UFDH 3TNSA 1WSSH 3DCLA 1EZSC 4Q2KA 1TONA 4KTUA 2EA3A 2WINI 1UCYK 4BOHA 4J2YB 2WPJS 1AHTH 1OWKA 1OWEA 1HAPH 1YPEH 2BOHB 3PV4A 1W7GH 2ZP0H 2Z94A 1P2OA 1KSNA 2FOGA 1O2WA 3MFJA 2HVXA 1AWFH 3S7KB 1G3EA 1HJAB 2ZFFH 2XOKD 1VGCB 2WYGA 4MG3A 3MNSA 1J17T 1TGSZ 4XRNA 4DT4A 4XBBA 4FVBA 2BDBA 2H9HA 6ESTA 2GMTB 1E36B 1QA7A 3BSQA 2P59A 3LJOA 2NU4E 3KNXA 1EASA 1ZGIA 3E0PB 1O3IA 4Y71A 1D6WA 3KYFA 2K1QA 1AKSB 1SLWB 1CHOG 1DICA 4MVNA 2BX3A 4XBDA 2FEQH 4MNYA 4HI3A 2AGIX 3RXUA 2QIQA 4A1VA 4HG6A 4YESB 1FIWA 2AMDA 1GBCA 2KCYA 3BTHE 2R0KA 4B2BA 4NWKA 1OWJA 4AFUA 1GVZA 2ODYB 3BG8A 1TYNA 1TMUH 1UTNA 1RGQA 3ATIA 1P57B 2GX4A 1CGHA 4GCHF 4IC6A 1XKAC 4ZMAH 5LPEA 1GJ5H 1V2MT 3SBKA 3VB7A 3VPKA 1TRMA 3AAUA 3IG6B 1L2EA 2CV3A 1AUJA 2ZQ1A 3SUEA 3WY8A 4P02A 1K21H 1LQDB 4UFEH 3RM0H 2SGPE 2YNBA 3M3VA 1YCPH 2H2ZA 4BAMB 2F83A 1GMCF 1GI2A 4TPYA 5GWZA 1O30A 2STBE 5C20A 6CHAC 1C5SA 4RN6A 3WWFA 4O03A 1PYTD 3HK3B 1GGDB 1MBQA 3BIUH 4NA8A 4NIVA 3LGIA 2ZU4A 3S0NA 5DPAA 1UMAH 1FIZA 2ZHWH 1HJ9A 1MAXA 1KXCA 1T8MA 4IN2A 1DUAA 1EFRD 3VB6A 5C17A 4PROA 2ZTXA 1IQLA 3SORA 1C1MA 3FAOA 2Y5GA 4BAOB 4I8GA 1KIGH 5F8XA 4E7NA 4X1NU 2PWXA 3A7WA 4JYUH 3TU7H 1W8BH 5JYIA 2NU0E 1TFXA 4FUDA 1W0YH 5K7RA 1SGPE 2R0LA 1G2MA 3ATWA 2EC9H 4NIWA 1RFNA 2IJOB 1T4UH 3GY6A 1IOEA 1WBGB 3B9FH 3IWMA 3RXRA 1LDTT 1SGEE 2XBVA 2ILNA 2ZU1A 3ESTA 1D9IA 1QJ6B 9ESTA 1XUHA 3GY8A 2BD2A 2FIRH 3Q3XA 4I33A 4ISIH 2VIDA 3OFND 1J14A 1NRSH 2J38A 4Q63A 4GHTA 1NPMA 3SV8A 2A4OA 3TH3H 1NFWA 1QBNA 1ZSKA 1O3DA 1C1WH 3M7UA 2R3YA 1ZTLA 1MH0A 3ZVDA 2O9QA 1HAOH 4K3JA 2J4IA 1OYQA 1QL7A 1V3XA 1TIOA 3QTOH 4R0IA 3GCHC 2AMQA 2XWAA 4ASHA 2ANWA 2BQWB 3ZVAA 4Z6AH 8GCHF 1T8OA 3DUXH 1O2JA 4X1PU 1V2RT 1W0JD 1E38B 3FN8A 3ZVCA 4FUIA 1O3HA 1B7XB 1NBME 2ZG0H 1CGJE 5G4BA 1K1IA 2BY8X 4D9QA 1O2YA 3RXGA 1W13U 3M35A 5ABWA 5A8ZA 1BRCE 3S69A 2G52A 1Y5UT 4O97A 4OS1A 1AB9B 1OXGA 5EOKA 1ANCA 1HAZB 1P3EA 4TY7A 5EG4A 1WXRA 1KLIH 1O3EA 4JK6A 5EXLA 3RXCA 1C5UA 3M5LA 1MTNC 1SQAA 5FXLA 2KR7A 1K1OA 3EAJA 1BQYA 4BTTB 2HLCA 2HPQH 3ZZ7A 1A0LA 4WMEA 1GDNA 3A8CA 1O3PB 1OPHB 1YPLH 1O34A 1EOJA 1RTFB 4XBCA 2LNCA 4X2VA 3UOPA 1TOMH 1P2JA 1DXWA 2CJIA 1VCQA 2GTBA 3LGWA 2DE9A 1MKWK 2FTLE 3ZZCA 2Y5HA 3FKSD 1O3NA 3BTQE 1O3BA 1A4WH 2KCPA 1NY22 3T29A 3TIUA 2VINA 2WZQA 1ETSH 1ELBA 4DT7B 1BCUH 2XW9A 4A1TA 1Z7KA 2F9VA 1ZOMA 5GIBA 3W1EA 2VWLA 4X1QU 4OGYA 1UCYH 4CR5A 5F8TA 1SGTA 2BLWA 1EP5A 1NFYA 1UTJA 2VVUA 1SSXA 1GBDA 2ZCKP 1SI5H 1RTLA 1J15A 4FU9A 1GJ8B 2SGDE 1TQ7B 3BTGE 3F3BA 3EE0B 1C2IA 2BMGB 2IOTA 3P8NA 1LVBA 3RXDA 1LHEH 1QJ1B 1YLDA 2FX6A 2OP9A 1P9SA 2THFB 3GCNA 1UVUH 2VJ1A 3QGJA 4UFGH 3GICB 3N99A 2FOAA 1SVPA 1ZYOA 1NS3A 2B8OH 3PM3A 7ESTE 1NFXA 1O5CB 3DSGA 4X2WA 3U98H 1O33A 4FU8A 5L2YH 4TWYA 1DSUA 1SQRA 3G01A 3GISB 5JBBS 1IQEA 4ZCNA 3D62A 1C1VH 2HPPH 3LC3A 5EQSA 1AFQB 2TGAA 3HGNA 2H9TH 4INHA 3LPRA 4BAQB 3A8DA 1GHVH 1D3DB 2C8YB 2OUAA 4JZEH 1ELFA 2B0FA 2FXRA 3PRDA 3QDZB 5FX5A 1ETTH 4TPIZ 3FZZA 4OS2A 1HUTH 4K60A 3TJNA 4FUEA 3T27A 1GI9B 1T8LA 1C1QA 2KAIA 2WPKS 1P09A 4AG1A 5TCCA 1C2EA 2YOLA 1IQKA 2ODPA 3SNCA 1BBRE 2DUCA 1GHAF 2ZNKH 1HAVA 3M37A 3OE7D 5C1XA 5KECA 3V13A 2V7QD 2P8OC 1GDQA 3FP6E 4Y8ZA 1K2I1 3GYLB 1KMHB 4XOJA 2GDDA 5C94A 3MH5A 1TA6A 2FO9A 1EPTC 4IC5A 2ALVA 2YMSC 2GD4B 2A2QH 2VU8E 1EQ9A 4NSVA 4B73A 1AUTC 5AVDA 2BVSH 3BIVH 1G37A 2ZECA 5DN6D 2G4UA 5DP4A 1DDJA 2A31A 1DUEA 1TMTH 1K1JA 1Y5BT 2TGDA 3A83A 4NCYA 5C1UA 1ARCA 3LGVA 1W7XH 2BD7A 5GCHF 3H7OA 4DIIH 4I8HA 2VIWA 1Y3WA 1TAWA 1IQIA 2D8WA 3QLPH 1Y5AT 4YT7H 1O5GH 3A84A 3RMOH 2PTCE 4R8TB 1NBMD 3ZZ6A 1QRZA 4CRDA 3BEIB 3FP8E 1C5YB 3GCTF 1NESE 1HAGE 3RM2H 3D23A 5EIYA 3CS0A 1SGDE 2OTVA 3TITA 1YWUA 4CRFA 4AZ2B 3M7QA 3U1JB 3F1SB 1W0KD 3Q3KA 1GBBA 1ZMJA 4K1EA 1MTWA 1ARBA 2LPRA 2AH4X 4NA7A 5HYOA 1AFEH 1C2GA 2OD3B 2ZDVH 1UTQA 1FJSA 2FI3E 4B74A 1AU8A 1S81A 3NZIA 4U32A 1GI8B 4ZH8A 1YCPK 1LHFH 3QX5H 1HIAA 4YXWD 1QIXB 3MO3A 4FUJA 1YPKH 2ZDMA 1LVYA 3A89A 5SGAE 1IQHA 1SGQE 1OP8A 3F6UH 1ESBA 3QZQA 3NCLA 1DT2A 2AMPA 3UOUA 1C5PA 3SI3H 4WMFA 1AFQC 1P04A 4NZQA 3QO6A 1LHDH 3KEEA 3BTTE 1UK2A 2GCTC 4X1SU 1ABJH 1FAKH 3DSOA 3PB1E 2GKVE 4NFFA 1CA8B 2NU3E 2Y7XA 1ZJKA 1TABE 2WV4A 1GI4A 1DXPA 2XNDD 3MMGA 3MNCA 1KY9A 2RCEA 3VB5A 5L6NH 1WQSA 2RA0A 4I8KA 4GPGA 1P2KA 4QT8C 4Y0YE 1ABIH 1C5VA 1XMNB 3DFLA 1XUIA 4X2YA 5GNDA 3A7TA 4UEHH 5BRRE 1O3GA 2BX4A 1HBTH 5EXNA 2FODA 1WCZA 3NXPA 4WF8A 4I86A 1H9IE 1NRQH 1GBIA 1M9UA 2Z6BD 1S82A 1W2KH 4DGJA 1LPKB 1QY6A 1CT0E 3MO6A 1YGCH 3UQOA 4X6MA 5C5OA 2JIZD 5H4IB 4YOJA 3KN2A 1O2RA 4VGCB 4CRBA 1W14U 1ZTKA 4Z0KA 3UNSA 3T26A 1VJAU 2I6QA 2M5TA 4WXVA 2ZHDA 1P03A 4X8TH 3HK6B 3URDA 2HALA 5IK2D 1MCTA 4A1XA 3VXFH 4CBNA 2P3FH 3PLPA 1TQ0B 1C4U2 1A61H 1BTZA 3VB3A 3U69H 1FQ3A 1P2NA 2PKAB 2BXUH 3MO9A 1D3TB 5A8XA 3U1IB 1GBLA 1TWXB 3BTWE 3PRBA 1MAYA 5J4QA 1C1PA 4A6LA 1GWAA 1PQ8A 3RC5A 2Y7ZA 3KQ5A 3SUDA 1QGFA 3UFAA 2AHME 2GV7A 2JH6D 2I6SA 2FPZA 1F0SA 3R3GB 1BTWA 1TPOA 2BVXH 2ZEBA 5JB8S 3T2NA 1NM6A 4D76A 3AVZA 2CK3D 1L1NA 3OEHD 5A2MH 1LCYA 3V0XA 3EE7A 4ABJA 3K65B 4CRAA 3DT0H 1O5BB 3W94A 5K0HA 3LJJA 4K8BA 4KELA 3HPTB 3T28A 3PO1C 2G5NA 1HGTH 1LHGH 3E0NB 1AWHB 2JJ1D 1SBWA 2H6MA 3OYPA 3SZNA 4IMZA 4CBOA 1DANH 2XCFA 5DGJA 1TX7A 2V3MA 1KXFA 5EJZA 2QCYA 2Z9LA 5CDFE 1ZJDA 3KQDA 1GI0A 3SHAH 2R2WU 4BAKB 1N8OC 2ZKSA 3FP7E 4BTUB 2CHAC 3ZZAA 3H7TA 1O2XA 1GI1A 1FY4A 1C2KA 3ZYEA 1XUGA 1UJ1A 4MLFB 1QQ4A 1NFUA 1Z6JH 3LONA 2PKSB 5EJ1A 1BTPA 1UK4A 3STIA 3VEQB 4Y76A 4K1SA 5DG6A 5A0BA 3OAAD 2PGBB 4JZFH 2W26A 6GCHG 1B0FA 2FMJA 5PTPA 1HPGA 1THRH 4YT6H 5A8YA 1GL0E 2BLOA 2F43B 3VFEA 1ZTJA 3VXEH 3SO3A 1C5OH 1H8DH 4AYVB 1V2OT 2QE7D 2ZPQA 1F92A 4DURA 3TK6A 1BHXB 1O2NA 3SN8A 1TLDA 2BXTH 4X0WU 3OX7U 2F9PA 2IPQX 3P6ZB 4U30A 1EAIA 1GJCB 1SL3A 2KCOA 3PV2A 4B71A 1AE8H 1QB6A 4I8LA 2QY0B 4NFEA 3KL6A 4ZXXH 1C5NH 3DFJA 5GDSH 4JZDH 1T31A 3FO8D 2ZGJA 2BDHA 1WTHD 3SV6A 1K1PA 2KCAA 3SOSA 3UWJH 2BTCE 5DK1A 2FESH 1ZPBA 1V2KT 3SNAA 1SOTA 3EA9A 1IQFA 1RD3B 4TSFD 5LPFA 2WPHS 5E8EH 3SW2B 2OC1A 3LKWA 3M61U 2CXVA 4OS4A 3SV9A 1BIOA 4AGJA 1BMFD 1BRUP 1DITH 3NKKA 1TPSA 1C9PA 1RTKA 1ZR0A 2QGRA 1PFXC 1S6HA 5ESBA 3UTUH 4OGXA 3UQVA 3RXMA 3RXSA 1PPGE 1ELTA 1W3CA 1P2QA 1YKTA 3PMHB 5JPMH 4IS5A 4OS5A 3VGCB 1ZMNA 2ZDNA 1O2GH 1GBMA 2GZ9A 2QF0A 3MU0A 3UR6A 3BG4B 5F6MA 1HAXB 1ZZZA 4H6SB 1NRNH 2OC7A 4SGBE 2GZ7A 3KQEA 2Q1JA 3OTJE 5EJLA 1EJNA 2B7DH 1W0ZU 1H8ED 2RFKC 1FLEE 1P9UA 3RC6A 1GMDG 1D3PB 3ZZ9A 1QURH 4SGAE 1L4ZA 2HNTF 4Y8YA 2BZ6H 3RP2A 1G3DA 2BHGA 5BPEA 2AGGX 2PTNA 4AB9A 1QJ7B 2JDID 5GXPA 3D49H 2GCHF 4MNWA 1C1UH 1S6LA 3P8OA 4AC9A 1BJVA 3EYDA 1SLUB 4B6FA 3T25A 1D6RA 1SQOA 5HMAA 1ETRH 1E1QD 1KLJH 2BDYA 1MTUA 2GDEH 1JOUB 2QC2A 4I32A 1VITH 3C1KA 4RKJB 3QZRA 4JCNA 3S7HB 1LPGB 1O3OA 1XM1A 4TT3D 3PTBA 1ZLRA 2BQ7B 2BD8A 4WH8A 1MMJN 1G3BA 3SU0A 3TH2H 1OWHA 1UO6A 2QXJA 3LDXH 5FHTA 2C93B 2OQUA 3KGPA 3RXBA 4YTAA 4JYTA 4AORA 2Y82A 3U28C 1QL8A 4ABGA 1HYLA 4FUCA 1HJAC 1SGCA 3M5NA 4D9RA 4DCDA 1S85A 5JDUB 3S9BA 1VGCC 2IJD1 2KZ4A 1SFIA 3RC4A 1N6XA 4ABAA 3SGQE 4BAHB 1NZQH 3NUMA 2FOMB 1IQJA 3A8AA 5J4SA 1T7CA 3LGYA 3SI4H 2GMTC 1S0QA 4ZKNU 1AY6H 2YNAA 3RXFA 1AGJA 1THPB 3S9CA 1MU8B 4AFQA 1DVAH 1MZDA 2SNWA 5LPRA 2J98A 4H42U 1FMGA 1GBJA 2D2DA 2P93A 4UFFH 1DSTA 4X2XA 3MNBA 1YBWA 1J8AA 1C4Y2 1SPJA 2W3IA 5T6GA 1YYY1 1A0HB 3O8DA 3ELAH 2R2MB 3I78A 3SU5A 1MKXH 1C1RA 1ANDA 1RXPA 3T5FH 4BANB 3VGCC 2PSXA 2UWOA 1Z8GA 2J2UA 3HKJB 5FBIA 1SFQB 3NWUA 2HNTC 1V2PT 3AASA 3LT3A 3Q3YA 3Q77A 3RXPA 1SGYE 3SNDA 3URCA 1EPTA 1Z8JB 1PPFE 3K6YA 3SUFA 1RIWB 3GCOA 3BTEE 3Q76A 4ISOA 5I46H 1GJBB 4ISHH 3A7XA 2V6NA 3T62A 3ZIAD 2BY5X 1ORFA 3F0OA 3UAIC 1GHBG 2K8IA 3A87A 1GGDC 4FOUC 1IAUA 1O2IA 2FOCA 4IGDA 1ID5H 2H5CA 1FXYA 1ZGVA 1T4VH 8GCHG 1LTOA 1OKXA 2P3TB 4DJZB 2EEKA 2XBWA 4DOQA 5EU8A 5E0JA 1E1RD 4ISLA 1GI7B 4YOIA 3P92A 3ZV9A 2CF8H 1QB1A 1O2VA 1UCYE 2AIQA 1MQ5A 2FOHA 4UONA 2H9EH 2CN0H 1CVWH 3AK5A 2TGPZ 1P02A 1EJMA 5LH8A 3GY7A 5FPTA 1GI5A 2PLXA 3F68H 3ZVGA 4CRGA 2XYAA 1YC0A 2YMSD 1GBAA 1GJAB 3PMAB 1DE7H 1AZZA 2BDAA 4JK5A 1KXAA 4AOQA 2BVRH 1MD8A 1WV7H 2ZPRA 1P2IA 2PV9B 1SLVB 2BY9X 1NO9H 4ACAA 2VVCA 4I8JA 1H4WA 1FI8A 3EA7A 2FI4E 1OSSA 2AS9A 5C3NA 5JBCS 4CHAB 1P05A 3LU9B 4FETA 2GT8A 1AN1E 3OY5U 1HFDA 4NGAH 1MD7A 1C2DA 1SGFA 1V2WT 3H09A 4IN1A 1AVWA 1SGNE 4J1YA 3ZZ3A 3O8RA 3OTPA 1A5GH 4CH8B 3E1XB 2CF9H 1HJ8A 1TBZH 1S0RA 2SFAA 4WJG2 4O9VA 2FYRA 1VITG 5E2PA 1HV7A 2D26C 2PW8H 3TGJE 2A4GA 1S83A 3TPIZ 4CRCA 2XBXA 1S5SA 2XC4A 1BRBE 1CBWB 1Y3YA 4Q7YA 1HLTH 2QF4A 1QL9A 4FXGH 3ENSB 1BTHH 2WV5A 5CHAB 3SHCH 3BTME 2W6JD 2UUYA 2ZU5A 1ZHRA 1CSOE 3M5MA 1YLCA 1AB9C 1OP0A 4MDSA 2KM0A 1N1LA 1ELAA 3GY3A 4ABHA 3SJIA 1Y3UA 1D4PB 1K22H 2A0QB 3RXOA 4ABFA 2VH0A 1YY3A 2XC5A 2ZTYA 2WYJA 1KXBA 4XFQA 1WAYB 4XSKU 1Z6EA 5DJ7A 4RT0A 2KAIB 1VR1H 3B8JA 1F2SE 3ODDA 5HM9A 1C5LH 4OM9A 1LKAA 1HAVB 3FFGA 3RLWH 1JBUH 2GGVB 3A81A 2Z3DA 1F5RA 4BTIB 1P2MA 3CNRA 2GV6A 2XXLA 3FOAA 3A86A 1ACBE 3FVFB 3ZV8A 3SNBA 1CO7E 2F3CE 1ELVA 3L3TA 4RT1A 3I29A 1YF4A 5TCAA 2ZGCA 1WQVH 1AVXA 2OK5A 1BTUA 4K1TA 5T1VA 2ALPA 2XCNA 1BJUA 1DFPA 3EDXB 3NPSA 4XD7D 1CT4E 1OYTH 2Y5FA 2PUXB 4WY3A 4JMYA 5DP8A 2FZZA 5DKMA 1QCPA 3ZYDA 2TBSA 5FAHA 2STAE 4ISNA 3LC5A 2O8UA 1GBKA 1C9TA 1FPHH 3TJVA 2FYQA 1H8IH 1O2UA 5HM2A 4ZKRU 3FANA 4Q4LA 7GCHG 1KDQA 2WUCA 3OU0A 1OP2A 2Q6GA 5JBAS 2W3KA 3SYJA 4JZIA 5E0GA 2QF5A 4KP0A 2HLDD 3QN7A 1OS8A 1X7AC 2VVVA 2A1DB 1UHBA 2ZC9H 1JIMA 2RA3A 1E35B 1O37A 3MOCA 4ZHMU 2OBOA 1H9HE 5GCHG 1NRPH 3ATMA 2ANMH 2GJGA 3PLKA 1VZQH 5EW1H 2PSYA 1V2LT 2J94A 2A4QA 2DE8A 1UTPA 1BRAA 1E79D 1TA2A 2W7UA 4ESTE 3F0PA 2ZU2A 1P10A 1TBQH 1GJ9B 4GVUA 2EI6A 1UTLM 2JKHA 1FONA 1Z71A 1Z8RA 3RXJA 4KKDA 4E7RG 1UVTH 2Q6FA 4A5TS 1CBWC 1EOLA 2G55A 1HIAB 1TALA 2BD9A 2ZGXH 2JJ2D 5AHGH 1GCTB 3PYHA 2BY7X 5CHAC 3SJKA 1EKBB 2J34A 5TJXA 3WWBA 4F48B 1TNIA 4ZAEA 3FZDA 4Y11E 1BB0B 2TGTA 5FCKA 3O8CA 5C0UA 2Y6TA 1HAYB 2OCVB 3E6PH 1NU9A 5B6LA 4WXIA 1Q3XA 1TGNA 4FUHA 4WWYA 1JWTA 3RXKA 1G30B 2H1UA 1HAHH 1OWDA 1L1GA 1GG6B 2V35A 3PLBA 4K5ZA 3O8BA 2FP7B 2A7JA 5EQRA 1SHYA 5DP5A 1SR5C 9LPRA 5T3HA 3SJ8A 3TK5A 4M7GA 1CT2E 3UREA 3ZZDA 4DW2U 1SC8U 3SQEE 5FCRA 1VCPA 2HGTH 1Q31A 3B23B 3KQBA 1B5GH 1FY5A 3L6PA 1J16A 2FI5E 4U01A 1A1RA 1F0RA 1QNJA 4GAWA 1ZHMA 4K69A 1MU6B 4TYDA 1TE0A 3KHVA 3MI4A 1C5RA 1YPHC 2A4RA 2A5IA 1EAXA 2VIPA 5A0AE 2UWLA 3PWBA 3HATH 5EGMA 1MABB 3TH4H 1Z1IA 2HNTE 1A5IA 2VWMA 5KGOA 2ZTZA 1EAWA 3N7OA 4ACBA 4I31A 1OWIA 2ZFTA 4BXSA 1MKXK 5L2ZH 1NRRH 1BMMH 3F9HA 4GLYA 1UVSH 1WU1A 4MNXA 5F53A 1KXDA 1OHHD 1C2HA 3MU4A 2FLRH 2A45B 1A7SA 4LZ1H 3RMNH 2QN5T 1SQTA
chains in the Genus database with same CATH topology
2Z9KA 1C5ZB 2SGEE 1HRTH 4DVAU 5EW2H 3HGPA 3E90B 1O3KA 2VWNA 3M3SA 2BD5A 1IHSH 5A09A 2XC0A 2VGCB 1EZQA 1Y3XA 1TGCA 1SGIB 1C2FA 2VB0A 2QXIA 3RXTA 1DWCH 6GCHF 2BDCA 4NZLA 4NWLA 4MNVA 2VWOA 1GMHG 2UUJB 4AG2A 1O2QA 1CQQA 3ZZ5A 1FY3A 2G8TA 1MZAA 1A3EH 1Y3VA 4MPUA 2NU1E 3E8LA 2A32A 3QGNB 1C1NA 3UIRA 2QV1A 2BYAX 2G51A 1O0DH 2UWPA 1ESTA 4B2CA 1A5HA 1XXFA 3P17H 3RU4T 1SMFE 1XUFA 3GYMA 4NA9H 2ESTE 1TPAE 5FPYA 3KQCA 3P70B 1KTSB 4AN7A 1O2LA 4GHQA 3SNEA 4H6TA 3DD2H 1P3CA 2HRVA 3V3MA 1ZPZA 1G36A 3JZ2B 1ZHPA 4DG4A 1E0FD 1O5EH 1GCDA 4B76A 1XUKA 1XUJA 2ULLA 1YM0A 1CHOF 4YLQH 5EODA 2C8ZB 4VGCC 4DY7B 5C2ZA 2QA9E 1DY9A 1DWBH 1RRKA 3UNQA 1V2NT 4FU7A 1C1SA 5AFYH 1BHXF 3BTFE 1FV9A 1PQAA 4YOGA 1FNIA 1O35A 3ZZ4A 1GBEA 2Z9JA 1P01A 1AKSA 1W11U 4RKOB 1LKBA 4O3UA 2P94A 2C8XB 2ASUB 1N6YA 2O8TA 3LIWA 1GHYH 2JH5D 3KIDU 2AFQB 1O5FH 3MNXA 2P3UB 3ODFA 1V2QT 1GMDF 1PQ7A 3M7TA 1GL1A 2G5VA 1BOQA 4K8YA 3A7YA 1GI3A 2ANKH 1DOJA 5EPNA 1EJAA 1AO5A 2R9PA 3CS7A 3GCHB 2H5DA 2J92A 1U6QA 3PROA 1J9CH 3TLOA 1JXPA 2BM2A 1BTYA 2HOBA 2RG3A 1O36A 4A92A 2FX4A 1FAXA 3BF6H 2RDLA 2FOBA 1DWDH 3SJ9A 3QWCH 3CENA 3QK1A 4ZHAA 3IITA 4GUXA 1SOZA 4ABBA 5EQQA 2C8WB 3GY5A 2VGCC 5DP9A 4RSPA 3RMMH 1DS2E 1FZZA 4AYYB 1MTNB 3LGUA 2V0BA 3SU3A 1XVOA 1PPZA 4D8NA 3TJOA 2OC0A 1PPBH 2V3OH 3A80A 2VIQA 1GBTA 3E91A 1O2OA 1UTKA 1AZ8A 2ZFPH 4Q7ZA 1BBRK 3AAVA 1VJ9U 8LPRA 2C4FH 2XRCA 3RDZA 2PKSC 1LMWB 5E2OA 3LOXA 1ZSJA 1DM4B 1Q2WA 5A0CA 5FX6A 4GCHG 2PFEA 3ZVFA 3SV2H 4CR9A 1F5LA 3UPEA 4D7GA 1QBOA 3GDSA 3PMJA 3RUOA 1V2JT 3EA8A 3RLYH 1EB1H 1NN6A 1V2UT 2P16A 1Z8IB 2A5KA 3SQHE 3GDUA 2ZQ2A 3AW1A 1GMCG 1TNLA 2FS9A 1G9IE 1O2ZA 3RXIA 2UUFB 4FUFA 3KCGH 1ANBA 3S9AA 5C5NA 1GPZA 2GCHG 5AF9H 3UNRA 1TB6H 1D3QB 3GY4A 4CREA 1UTMA 3SU6A 3C27B 3A82A 3RU4E 4GSOA 1GHZA 4X6OA 3SGAE 3GDVA 3K2UA 2VIVA 1RS0A 2A2XH 1INCA 2G00A 1UVOA 3P8GA 4WH6A 1GI6A 2P95A 3M3TA 3EGKH 1L0ZA 3D65E 1DLEA 1O3MA 5CE1A 3P8FA 1GJDB 2BLQA 4Y8XA 2TRMA 5DP3A 4Y10E 2F91A 3TGIE 2BD3A 4INKA 2EI8A 1ZRKA 1QRWA 5ESTE 3TNTA 4TY6A 1HB0B 2FTMA 3EQ0H 1GHBF 3ZVEA 3BEFB 1UVPA 3SJOA 1SHHB 2O8LA 1PYTC 3BG4C 2ODQA 1MTVA 2FOEA 1BUIA 6LPRA 3UR9A 1MQ6A 1NT1A 4ABEA 5HGGA 4ZKOU 2G81E 1EXFA 2BDIA 1TGBA 8KME2 4E05H 3RXEA 1L1JA 3H5CB 4FVDA 4INLA 1EAUA 1NU7B 2Z3EA 1GHWH 1AD8H 1TRNA 2P8OB 1MUEB 1PPEE 1DWEH 3U9AH 1AE5A 1AI8H 1EZUC 1GJ7B 4Y7AA 5FBEA 1XXDA 1NC6A 1O5AB 4KTSA 3OY6U 1IQGA 1YPHE 1EPTB 2F9BH 2FWWA 1E37B 1YPJH 1CE5A 2VIOA 3GY2A 4AB8A 3U8RH 1A46H 1P06A 3MU8A 1W12U 3U8OH 1HCGA 2SGQE 2V3HH 3ATKA 4LXBH 2FOFA 4TWWA 1BDAA 1PJPA 3K6ZA 1H1BA 3SU1A 4OS7A 1O2KA 5ETXA 3BV9B 2C90B 2ZHFH 3SU2A 1QR3E 3OSYA 3ZVBA 1H9LB 4X8UH 3UWIA 1GBFA 4THNH 2PHBA 3ITIA 3LH3A 4MPVA 2BZAA 1AMHA 5C1YA 4ABIA 1YP9A 1NTPA 3PMBB 1ZRBA 4JZ1A 2CGAA 3LH1A 2R3UA 1TNKA 4AX9H 4YO9A 3M36A 4FUGA 3MU1A 4KTCA 4WVPE 4IBLH 1EZXC 3STJA 3W95A 1VITF 1EB2A 4ZHLU 1QRXA 2ZCLP 1DLKB 2ZFSA 1F0TA 1F5KU 4YZUA 2WPIS 1O38A 3RXHA 5GJ4B 1HXEH 1MBMA 4UDWH 4WMDA 5C67A 1C1TA 2ZU3A 2OXSA 4ZKSU 1GVLA 1FUJA 1T32A 1LVOA 4CH2B 2GZ8A 3ZZBA 1SG8B 2QXGA 3BEUA 1P8VC 1HXFH 1K1LA 1Y59T 4X8SH 3RXQA 2A7HA 3GOVB 1WOFA 2SGAA 2SGFE 4I7YH 2BQ6B 2ZDAH 1QA0A 2Z9GA 2W5EA 1FY8E 3R0FA 1LPZB 2OINA 2B9LA 2ZFRH 1SGRE 2ZZUH 1FN6A 4X1RU 1V2TT 1V2VT 2PUQH 1BT7A 3MH6A 4JYVH 2F9UA 2BLVA 3ZZ8A 3LGTA 1BZXE 5B6OA 2GCTB 1THSH 3SU4A 1ELGA 2NWNA 4U2WA 1YPGH 1S6FA 5CMXH 3RXLA 2C3SA 4LZ4B 1DY8A 3TK9A 1K1NA 4X6PA 3QUMP 1C2LA 1DX5M 4LOYH 4UD9H 1RIWC 3BTDE 1B0EA 2F9NA 1TOCB 1ANEA 2OC8A 3AW0A 4MQAA 2JETB 4NIYA 2D1JA 1WUNH 3RU4D 3VB4A 3V12A 1O5DH 2XTTB 1QB9A 3RXVA 1TBRH 3CP7A 1O39A 3A7VA 1BBRH 2PGQB 2NU2E 3QTVH 1P11E 1BITA 2WPLS 2QAAA 2ZF0H 1SGFG 1BMAA 7GCHF 4XDEA 1IHTH 1CHGA 1G32B 3PTNA 3U8TH 2XBYA 2Z7FE 3RXAA 2ZHEH 2QYIA 2ZGBH 3SV7A 1HDTH 3PWCA 5L30H 1CA0B 4ZXYH 3MTYA 1K9OE 1GHAG 2EI7A 5FPSA 2ZFQH 1RJXB 2ZIQH 5LGOA 1VCWA 1O2TA 7LPRA 2A5AA 2BB4A 1EUFA 2O8WA 2ZO3H 5EXMA 1WYKA 1TRYA 1TNHA 2ZPSA 3ATLA 4F4OC 1TPPA 4AFSA 2XWBI 2PR3A 1A0JA 4BXWA 5JB9S 1JMOH 3SUGA 1AVGH 1TX6A 4IW4E 1MCVA 1O31A 2AYWA 2F9OA 1V2ST 4ABDA 1O3CA 1C1OA 1LQEA 4BNRA 4Y6DA 1EP6A 3BN9A 3UUZA 4NIXA 1QFKH 1CU1A 2GVFA 3MWIU 4CHAC 2AGEX 8ESTE 2QXHA 1BA8B 1ZMLA 4IMQA 1MTSA 1PPCE 1C4V2 3KF2A 1NROH 3SGBE 1KXEA 3PO1B 2Y81A 4HGCA 1O2MA 4F49A 2Q6DA 3JZ1B 4X8VH 1KDQB 3A8BA 3F9FA 1FDPA 2J95A 2ZGHA 5GPIB 3MYWA 3V7TA 1F7ZA 1TMBH 1XVMA 2BDGA 3F9EA 3GCTG 1O2SA 2VH6A 2VNTA 3K9XB 3NK8A 1UHBB 4NG9H 2GP9B 4FUBA 2CMYA 5E0HA 4Y79A 4LK4A 1N8OB 1A2CH 2O8MA 1BTXA 5JBTA 2CHAB 3E16B 5F8ZA 1Y8TA 2AEIH 2Z9IA 1F0UA 1GJ4H 2ZDLA 3MU5A 1JIRA 1QHRB 7KMEH 1C5XB 1GVKB 4XE4A 5T6FA 4X6NA 4NSYA 1L4DA 1P12E 5I25A 4E06H 1IQNA 1LO6A 1A3BH 1PPHE 4ZROA 2OLGA 3A85A 3M5OA 4Y0ZE 2JETC 2ZHQH 5DP7A 3TJUA 1AQ7A 2ANYA 2JH0D 2AIPA 3A7ZA 2W7SA 1CGIE 1G3CA 2B5TB 4YLUA 5EPYA 2SNVA 1OOKB 3F9GA 5HXFA 1TGTA 1W10U 1GHXH 2FLBH 1GDUA 2PKAA 1JRSA 2G4TA 4UE7H 1AIXH 3DA9B 2AERH 4H4FA 3E3TA 2IPHA 4B2AA 4B75A 1SB1H 1C2JA 3L33A 1C5TA 3MH4A 1O2HA 4OS6A 1JRTA 1BMLA 1QQUA 1P0SH 1BMNH 1CA0C 1MKWH 1TX8A 4Q80A 1EATA 4Q7XA 1HNEE 2A7CA 1C2MA 3DHKH 2BD4A 1T8NA 1OX1A 2GT7A 5AFZH 3A88A 2BY6X 1LVMA 1SLXB 1ESAA 1Z1JA 1O3LA 4MTBA 1KTTB 4A7IB 4Y7BA 1XX9A 1GMHF 3TGKE 2Y80A 2OBQA 1UK3A 4K2YA 1XKBC 1HAIH 2UUKB 1FPCH 1KLTA 1DPOA 5DP6A 5IYTA 3P95A 4ZUHA 1QBVH 1YCPM 1EX3A 1UTOA 4B1TA 1FY1A 2Z3CA 1ELCA 1K1MA 1PQ5A 1WTGH 1C5MD 4O3TA 1E34B 1G2LA 2ZI2H 4YM9A 4HZHA 2QF3A 4HTCH 2ZA5A 4AFZA 1C5QA 2ZDKA 1O3AA 4AGKA 5T6DA 3Q00A 1V6DA 3MHWU 2ZCHP 1C5WB 3I77A 1O2PA 4MPXA 2IN2A 2J9NA 1KYNA 1ZSLA 1FN8A 5IDKA 5DO4H 1TNJA 4HFPB 3BTKE 6CHAB 4DIHH 1IQMA 1TNGA 4MPWA 1O3JA 1ZPCA 3MH7A 1S84A 2WPMS 2FS8A 2HWLB 1QTFA 1YPMH 2TPIZ 1GCTC 3HKIB 3UY9A 1ELEE 2FDAA 2BOKA 3RMLH 1O32A 2FM2A 4D7FA 2OQ5A 1K28D 2ZWLH 1GBHA 1O3FA 1ELDE 4KGAA 3TVJB 5F03A 1LHCH 1GG6C 1GJ6A 2WUBA 2TIOA 2XNIA 4UFDH 3TNSA 1WSSH 1EZSC 4Q2KA 1TONA 4KTUA 2EA3A 2WINI 1UCYK 4BOHA 4J2YB 2WPJS 1AHTH 1OWKA 1OWEA 1HAPH 1YPEH 2BOHB 3PV4A 1W7GH 2ZP0H 2Z94A 1P2OA 1KSNA 2FOGA 1O2WA 3MFJA 2HVXA 1AWFH 3S7KB 1G3EA 1HJAB 2ZFFH 1VGCB 2WYGA 4MG3A 3MNSA 1J17T 1TGSZ 4XBBA 4FVBA 2BDBA 2H9HA 6ESTA 2GMTB 1E36B 1QA7A 3BSQA 2P59A 3LJOA 2NU4E 3KNXA 1EASA 1ZGIA 3E0PB 1O3IA 4Y71A 1D6WA 2K1QA 1AKSB 1SLWB 1CHOG 1DICA 4MVNA 2BX3A 4XBDA 2FEQH 4MNYA 4HI3A 2AGIX 3RXUA 2QIQA 4A1VA 4YESB 1FIWA 2AMDA 1GBCA 3BTHE 2R0KA 4B2BA 4NWKA 1OWJA 4AFUA 1GVZA 2ODYB 3BG8A 1TYNA 1TMUH 1UTNA 1RGQA 3ATIA 1P57B 2GX4A 1CGHA 4GCHF 4IC6A 1XKAC 4ZMAH 5LPEA 1GJ5H 1V2MT 3SBKA 3VB7A 3VPKA 1TRMA 3AAUA 3IG6B 1L2EA 2CV3A 1AUJA 2ZQ1A 3SUEA 3WY8A 1K21H 1LQDB 4UFEH 3RM0H 2SGPE 2YNBA 3M3VA 1YCPH 2H2ZA 4BAMB 2F83A 1GMCF 1GI2A 4TPYA 5GWZA 1O30A 2STBE 5C20A 6CHAC 1C5SA 4RN6A 4O03A 1PYTD 3HK3B 1GGDB 1MBQA 3BIUH 4NA8A 4NIVA 3LGIA 2ZU4A 3S0NA 5DPAA 1UMAH 1FIZA 2ZHWH 1HJ9A 1MAXA 1KXCA 1T8MA 4IN2A 1DUAA 3VB6A 4PROA 2ZTXA 1IQLA 3SORA 1C1MA 3FAOA 2Y5GA 4BAOB 4I8GA 1KIGH 5F8XA 4E7NA 4X1NU 2PWXA 3A7WA 4JYUH 3TU7H 1W8BH 5JYIA 2NU0E 1TFXA 4FUDA 1W0YH 5K7RA 1SGPE 2R0LA 1G2MA 3ATWA 2EC9H 4NIWA 1RFNA 2IJOB 1T4UH 3GY6A 1IOEA 1WBGB 3B9FH 3IWMA 3RXRA 1LDTT 1SGEE 2XBVA 2ILNA 2ZU1A 3ESTA 1D9IA 1QJ6B 9ESTA 1XUHA 3GY8A 2BD2A 2FIRH 3Q3XA 4I33A 4ISIH 2VIDA 1J14A 1NRSH 2J38A 4GHTA 1NPMA 3SV8A 2A4OA 3TH3H 1NFWA 1QBNA 1ZSKA 1O3DA 1C1WH 3M7UA 2R3YA 1ZTLA 1MH0A 3ZVDA 2O9QA 1HAOH 4K3JA 2J4IA 1OYQA 1QL7A 1V3XA 1TIOA 3QTOH 4R0IA 3GCHC 2AMQA 2XWAA 4ASHA 2ANWA 2BQWB 3ZVAA 4Z6AH 8GCHF 1T8OA 3DUXH 1O2JA 4X1PU 1V2RT 1E38B 3ZVCA 4FUIA 1O3HA 1B7XB 2ZG0H 1CGJE 5G4BA 1K1IA 2BY8X 4D9QA 1O2YA 3RXGA 1W13U 3M35A 5ABWA 5A8ZA 1BRCE 3S69A 2G52A 1Y5UT 4O97A 4OS1A 1AB9B 1OXGA 5EOKA 1ANCA 1HAZB 1P3EA 4TY7A 5EG4A 1KLIH 1O3EA 4JK6A 5EXLA 3RXCA 1C5UA 3M5LA 1MTNC 1SQAA 5FXLA 1K1OA 3EAJA 1BQYA 4BTTB 2HLCA 2HPQH 3ZZ7A 1A0LA 4WMEA 1GDNA 3A8CA 1O3PB 1OPHB 1YPLH 1O34A 1EOJA 1RTFB 4XBCA 2LNCA 4X2VA 3UOPA 1TOMH 1P2JA 1DXWA 2CJIA 1VCQA 2GTBA 3LGWA 2DE9A 1MKWK 2FTLE 3ZZCA 2Y5HA 1O3NA 3BTQE 1O3BA 1A4WH 1NY22