4YOGA

Hku4-3clpro bound to non-covalent inhibitor 3b
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
molecule tags Hydrolase/hydrolase inhibitor
total genus 91
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yogA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yogA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yogA02
1C1VH 5DJ7A 2ZU2A 1NRQH 1ESTA 4IN2A 4GHTA 3SU5A 1Q3XA 4AOQA 3LT3A 1DLEA 1O3GA 4NCYA 3UPEA 4WVPE 1MUEB 3ATKA 5A0CA 4CREA 1P2NA 5LPRA 4YOIA 1EX3A 2FI3E 4AFUA 4ZKOU 3T27A 4AGKA 2AS9A 3SJ9A 1AVGH 2A32A 1SOTA 2NU2E 3UTUH 1O2RA 5DO4H 3SNAA 2PW8H 3EA7A 2Z6BD 1HAVA 1EUFA 1DXWA 2YNAA 5FCRA 3RXMA 3U8OH 3S0NA 3C27B 3T5FH 2BD2A 3M61U 1TNJA 1YPLH 2SGEE 4CRGA 1YPGH 1OWHA 1G30B 3ZVGA 1RIWB 4MQAA 3ENSB 2G55A 3KQCA 1ZSJA 5CE1A 2IJOB 2XC4A 2F9VA 3F68H 1GMHG 2K1QA 1N6YA 3RXGA 4AG1A 1XXFA 2ZEBA 4R0IA 3MNBA 1HJ9A 1H1BA 1O5FH 1SGFA 1S82A 1KLIH 4IBLH 1O5EH 1LHFH 1GHWH 1A5IA 2OXSA 1N8OB 1ZPZA 1CU1A 4GAWA 4B73A 1ZTJA 3V13A 1Y59T 1YPJH 2PUQH 2CGAA 4AGJA 1TGNA 4KKDA 4D7FA 3UR6A 2JH5D 5EG4A 2P3TB 1QTFA 4LOYH 3TU7H 4I33A 1MQ6A 5E8EH 2ZHEH 1QBVH 1O2LA 4YTAA 5F03A 3RM2H 1HAZB 2DE9A 1XUKA 1T7CA 1P2QA 4FUBA 1S83A 4MDSA 2GZ9A 3FAOA 3VXEH 1EOJA 1TB6H 4NIWA 1XUIA 2FMJA 3ZYEA 1GGDB 1K1IA 1QGFA 3RU4T 1QJ7B 1HXEH 3SJIA 1IHTH 1LHGH 3Q00A 5EQRA 1O3NA 1SFIA 1VJAU 3KQBA 5EW2H 1AKSA 4H42U 4FUEA 3CS7A 2VJ1A 2ALPA 1MD7A 3RMOH 2F3CE 4A1XA 2JKHA 3KQDA 1TMUH 2V6NA 1T4UH 1UTOA 3QZRA 3MH4A 4TY6A 3AW0A 1GVKB 1EJMA 1Y3YA 1DWBH 4UEHH 2GD4B 1O3BA 5T6FA 2Y5GA 2ZFFH 2STAE 1C9TA 4GUXA 1ELAA 4XFQA 2B0FA 2H1UA 2TGPZ 4WH6A 1TMTH 1Z6EA 4RKJB 1KLTA 2FS9A 1TA2A 2XRCA 1P05A 2J95A 3TVJB 2HGTH 1H8IH 4MPUA 2UWPA 2M5TA 3SU1A 3PLBA 2KAIB 2HNTF 1P12E 5EU8A 1B0FA 2G4UA 3Q76A 1RXPA 1AY6H 1HAGE 2VIPA 3M3SA 3SJKA 3SNBA 2J2UA 2GMTC 3QGJA 1FPCH 2RA3A 4WXVA 1CGIE 1AFEH 1C4Y2 2ZTYA 1NESE 1DPOA 4Q2KA 1SGCA 5DG6A 1P3EA 3S9BA 3EA9A 4ABIA 2CF8H 5C3NA 3URCA 1JMOH 1CA0C 4IMQA 4Y79A 1PFXC 1NT1A 3E16B 1KDQA 2BHGA 3PWBA 2EI7A 2QF3A 1F5LA 5HGGA 2TGTA 6GCHG 2VVVA 1SGPE 1SPJA 1TRMA 1IQHA 2FESH 3OTJE 3NPSA 3TJVA 1OX1A 2H5DA 3UFAA 3O8BA 3QGNB 1G3CA 1KYNA 1RRKA 4MNWA 3TLOA 1HNEE 2Z9IA 5AFYH 2NU3E 1ID5H 2AGGX 3RXKA 1ZLRA 4YLUA 4RSPA 2PGQB 3PMJA 1RJXB 1GJ6A 1BTUA 4X1RU 2QGRA 5FX5A 3U69H 3BG4B 1M9UA 3P8GA 3GDVA 1UCYK 3ZZ3A 5A8ZA 2BD7A 1YLDA 3SV9A 1AD8H 4ZHLU 3RMLH 2FOGA 1O2OA 1WUNH 4KTUA 5FPTA 1MKXH 1O2MA 1DLKB 1ESAA 2PTCE 4K8YA 3E0PB 1BMAA 1PPGE 1DSTA 1O5BB 1DWEH 2GCHF 2PKAA 3A7ZA 4X0WU 7GCHG 1O2JA 2BZ6H 2GT8A 5FCKA 4F4OC 4I8HA 4JZDH 5FBEA 3RXAA 4ZXXH 3QX5H 1QB9A 2BMGB 3P8FA 2HOBA 1TPPA 2GGVB 3GISB 4UONA 3A86A 1TPOA 1C2GA 1J8AA 1QRZA 1XVOA 2P94A 4JK6A 4A7IB 2QA9E 4O3UA 5ABWA 3BTEE 2J34A 1MTVA 2BVRH 1T8MA 3GDSA 1O3DA 1W7XH 1NFUA 4B2BA 3QLPH 1ZRBA 1GBEA 5A2MH 1AIXH 1GJAB 2XCFA 4B1TA 2NU0E 3KCGH 1UJ1A 1UHBB 1CE5A 3PWCA 4NGAH 5E0JA 5EPYA 5TCCA 3SORA 3I78A 4I7YH 1JRSA 2RCEA 3CENA 3NKKA 1LHCH 2V3HH 4AG2A 1YM0A 1LKBA 1SLUB 1BT7A 1IAUA 2FZZA 3P8NA 1AWHB 3U1JB 4AB8A 4UDWH 3PLKA 5BPEA 1UTPA 4X8TH 2HVXA 3GY5A 4AYVB 1W11U 1O2ZA 2BLQA 2FYRA 2J94A 1GI3A 2Z3DA 1C2IA 1LO6A 2FS8A 1EPTA 3MU5A 3P92A 4Q7XA 1QB1A 1B0EA 1C5NH 4X1NU 3SU0A 2P3UB 1C1WH 3RLWH 1HIAB 1TPSA 3BSQA 1EAXA 1GHBG 2GDEH 3TNSA 2ANWA 5GXPA 1DUEA 5TCAA 4SGBE 1FZZA 1GBTA 2PKSB 4MTBA 2BXUH 2SFAA 1GBFA 1THPB 2CF9H 5E0GA 1AFQB 3NXPA 1D3QB 3FP6E 1RS0A 2ZGHA 1GVZA 2QN5T 2BDGA 5L30H 8GCHG 4Q80A 3SQHE 4NA9H 1ARCA 4BXWA 5JYIA 2OD3B 2F9PA 4IC5A 3LC3A 1CGHA 1KSNA 1MH0A 2OP9A 2WPIS 1A5HA 1C5TA 4NZLA 1UTKA 4Y0ZE 1F0UA 2Q6FA 1GDUA 1MZAA 4X2YA 4KP0A 4D8NA 2ZP0H 3ODDA 3PB1E 1EAIA 4ZXYH 1Y3UA 3K65B 4AFZA 1Y5UT 2D2DA 1O2UA 2SGFE 1TPAE 1TX7A 2GZ8A 2P8OC 1XVMA 1THSH 1IQJA 3PO1C 3TJNA 3M3TA 2NWNA 2ZWLH 1S81A 1L1NA 2BDHA 3GCHB 1TRNA 4INLA 2BVXH 1GJ5H 1O38A 1UVOA 1DY8A 5T6GA 3VXFH 1TWXB 2Q6GA 1NFWA 1W13U 2WPKS 4NG9H 4WMEA 2R2MB 1GMDF 1DOJA 3F9FA 1QA7A 4K1SA 1CVWH 4CBOA 1QQ4A 2R2WU 2FOAA 1BDAA 3EAJA 1NU7B 2ZQ2A 1BJUA 1SBWA 1OKXA 1SQTA 2JETC 2R3UA 1LHDH 3E6PH 1SLVB 3RXIA 5LH8A 1ZR0A 3HGNA 4E05H 1NPMA 3RC4A 2QC2A 1ELTA 1LPZB 4FU8A 6CHAB 5JBAS 1K1LA 4ABEA 3OU0A 1AWFH 1FY3A 2PHBA 3RMMH 1XM1A 3GCTF 2ZCLP 1PQ5A 1BRAA 2P3FH 1QL9A 1Z1IA 1ORFA 1BTPA 1BMMH 3ZZ7A 4DT7B 1MTSA 1WAYB 1XX9A 1SHHB 1NY22 1EATA 1GL0E 1TBRH 2W3KA 3MNSA 3MU1A 1F92A 3M7QA 4O97A 1C5PA 1NO9H 1GWAA 3DD2H 1FLEE 3FVFB 5GDSH 1SGTA 3SI3H 1MKWH 1C5WB 2ODQA 1D6WA 4OS1A 2HNTE 1F5KU 3D65E 1ARBA 3L3TA 5HXFA 2BDAA 1Y5BT 2UUKB 1BRUP 3M36A 3LKWA 2TBSA 1O2WA 4GCHG 1AB9B 1C2MA 1P9SA 4TPIZ 1KTTB 3GCOA 4X6PA 1FY8E 3S9AA 1W14U 3TK9A 1P3CA 1HUTH 1ANDA 1EJNA 2C8YB 3ZZCA 3LIWA 5C2ZA 4KTCA 1UTLM 3RXRA 5J4SA 3SJ8A 1ZMLA 1A0JA 1HLTH 7KMEH 5E2OA 1T32A 3M35A 2AMDA 1UTJA 3BG8A 2A5KA 1TFXA 2FOCA 2B5TB 4DIIH 3RXSA 1ZMNA 1SR5C 5ETXA 2ZI2H 1LDTT 2WPHS 1P03A 2SNWA 1TABE 1AVXA 5EXLA 1C2DA 2BX3A 1OWJA 2A31A 2XW9A 2BLVA 2BDCA 2C4FH 1WU1A 1OP8A 1L2EA 4NWLA 1YKTA 2GV6A 3BTDE 5L2YH 2B7DH 1G37A 3BV9B 1K9OE 5GCHF 4HFPB 3A85A 2UUYA 1DICA 4WF8A 2P59A 4B2CA 4BTTB 2RA0A 3VEQB 5LPFA 2H9EH 3MHWU 1MTUA 3RC6A 1V3XA 3VGCB 2VWNA 1PQ7A 4OS2A 3SU2A 2C90B 3LGYA 4NA8A 1O3EA 1IQGA 1Y3XA 5EGMA 5CHAB 1TGSZ 2HALA 1FUJA 4LXBH 5C67A 1ZTKA 2YNBA 1LHEH 1KXEA 1H8DH 2EC9H 1S6FA 4GLYA 4FXGH 2ZPSA 2A4OA 1VCPA 4WH8A 1G3EA 4X6NA 2A7JA 2Y81A 3I29A 1BJVA 2PUXB 2Y5HA 4JZIA 1SGQE 1EASA 1E0FD 2Z3CA 1C5VA 1RIWC 1W2KH 2R0LA 3ZYDA 2TIOA 4GPGA 3F9GA 3GDUA 4I8KA 2THFB 3TPIZ 4JZ1A 1C1TA 3BEFB 1Z8RA 3K6ZA 1AE8H 1BBRH 1C5XB 3OY6U 3MNXA 3E8LA 3TH3H 4E7RG 2VH0A 1W0ZU 4TWWA 3QK1A 3RXLA 1O2HA 2A1DB 1JIMA 2IPHA 1GG6B 5K0HA 3RP2A 2F83A 4LK4A 1SQOA 2WUCA 3TK5A 1SL3A 1SGYE 3UWIA 2GVFA 1QNJA 1BHXF 3BEIB 4J1YA 1O3PB 1LKAA 1BCUH 1GBJA 2VIWA 1TGTA 1GHZA 4DOQA 2AIQA 4M7GA 5DP6A 4NA7A 1V2OT 2GCTB 2ZFRH 7LPRA 2WV5A 1WOFA 2PWXA 1BQYA 1DVAH 1GBBA 1GGDC 3A7TA 3GYMA 3LGWA 5A8YA 6ESTA 4DJZB 1SGFG 8ESTE 4ABJA 3P70B 1GMHF 1TLDA 1N1LA 1YP9A 5FBIA 1D3DB 2FM2A 1O3AA 1CSOE 3IWMA 2FOBA 1O39A 1GJCB 3M37A 4MNVA 2AERH 1P2IA 3RXOA 4CRBA 1PPFE 2BM2A 3A7WA 3UNQA 2Y5FA 1FI8A 3T28A 1BIOA 1GHAF 5I25A 3QZQA 1GI5A 4X8UH 4BAHB 4B74A 4D76A 1Z1JA 1GHYH 2ZNKH 4K5ZA 4XBBA 5DP4A 3DA9B 2HWLB 3A8BA 3BTQE 4Y8XA 1QBOA 4K8BA 4QT8C 1ANCA 3UOUA 1WSSH 1O36A 1SGIB 5DKMA 2ZHQH 3H7TA 3LOXA 2IN2A 3U8TH 1UVUH 1KIGH 5E0HA 2FP7B 1WQSA 1QFKH 1LVMA 2OC1A 3BTKE 3S9CA 1VCWA 3UNSA 2AMPA 1BTHH 1ZGVA 1V2LT 2O8TA 2CXVA 3U1IB 4MG3A 2ZDLA 2GKVE 2BVSH 1O2IA 1A61H 2FI5E 2OTVA 3SBKA 1J14A 1O5CB 1K1MA 1MCTA 2SGPE 3RU4D 1HAVB 1GCTB 1YPEH 2BD5A 1GHXH 2PSYA 4KELA 1ETSH 1BHXB 1Z8GA 2OQUA 3TH2H 2A7HA 1AMHA 1GBDA 3SJOA 2VWLA 4BTIB 4THNH 4YLQH 3ZVCA 2QIQA 3UIRA 2WUBA 2ZGJA 4KGAA 1ACBE 2XTTB 3MU0A 1ETRH 3A7XA 3A84A 3SW2B 1DANH 3WY8A 2CHAC 1IQFA 2V35A 3DFJA 5H4IB 2GP9B 2AFQB 3LDXH 3A8DA 3P17H 1ETTH 3TJUA 3A8CA 1ABIH 1HAXB 4XSKU 2ZPQA 2CJIA 4INHA 4NZQA 2WYJA 1ZGIA 2VU8E 1MU6B 3BG4C 4DW2U 1OXGA 4VGCB 1CBWB 3RC5A 2QF0A 1AHTH 1ANEA 1MZDA 3LH3A 3TK6A 3HPTB 1HAPH 2OBOA 1G3BA 1FY5A 1YCPH 5IDKA 1RTFB 1ABJH 3JZ2B 1HAYB 5JBTA 1W10U 1GBLA 4ASHA 3V12A 1Z71A 3BN9A 1C4V2 3VFEA 6GCHF 3RUOA 1C1SA 3U98H 1BMLA 1K22H 1MBQA 5EODA 1K1PA 1SC8U 3QN7A 1AZZA 3OYPA 3M7TA 2HNTC 1TONA 4CRFA 3BTGE 1AKSB 2JH0D 1SMFE 4XDEA 1GBHA 3S69A 2P93A 3A87A 1OYQA 3F9EA 2AMQA 1EP5A 9LPRA 4TWYA 2FLBH 3ODFA 5FPYA 3RXBA 1P06A 3QUMP 1PPBH 1FN8A 5C5OA 3SZNA 1E36B 4H6SB 3M3VA 1UK2A 1P2KA 1HFDA 3AAVA 2WV4A 1P04A 2O8LA 4MPVA 1SG8B 2ZU5A 1DWDH 1O0DH 5LPEA 1P2MA 3MMGA 1V2KT 3LJOA 1W8BH 2PTNA 3UOPA 2ZECA 1Y3WA 4WJG2 1RGQA 2ZIQH 2WINI 5AFZH 2R3YA 4ZHAA 4MNYA 1SVPA 1V2ST 2O8UA 1GI6A 8LPRA 1O35A 2BLOA 1O2QA 2GV7A 2Y7XA 5A0AE 1GBMA 4U01A 2FOEA 2WPLS 3MTYA 2TGAA 3MH5A 3NCLA 1MAYA 1DDJA 1LMWB 4Y76A 3MO6A 4K60A 1ZHRA 1O5AB 1ZYOA 2H2ZA 1YLCA 1GJ4H 1PQ8A 2ZHWH 3HATH 3KNXA 1ZSKA 1BTYA 3HK3B 1QB6A 2OBQA 1KDQB 4Z6AH 1TGCA 4ZUHA 2BOHB 3UQVA 2XC0A 2J38A 1DX5M 2UUJB 2XC5A 2FEQH 2PKSC 1OPHB 1HAOH 2BY6X 2GDDA 5JBCS 3UNRA 3SNDA 4B76A 1KTSB 2QAAA 4IC6A 2QCYA 1GDNA 1P10A 2RDLA 3F9HA 3ZZ4A 1LCYA 3VB3A 4I8LA 4XBCA 4ABDA 2ZTXA 4CRDA 1DT2A 1G2MA 1O3LA 2UWOA 1BBRE 1TNIA 4JMYA 1Z8JB 1EZSC 2H6MA 3KHVA 3LPRA 2BY5X 1KXBA 4X6OA 5TJXA 1YF4A 1TE0A 4X6MA 2QV1A 3RDZA 3FP8E 3BEUA 1S85A 1GJDB 3Q77A 1HV7A 1C5QA 4UFFH 4B75A 1GHBF 2A0QB 4D9RA 3E1XB 1HB0B 5DGJA 1HRTH 3F6UH 4GSOA 2LNCA 1FY4A 1TIOA 1NFYA 3GCHC 2PKAB 3VB4A 3A88A 5DP9A 3OX7U 2FIRH 2TRMA 4AFSA 2YOLA 1PYTC 1AN1E 1W12U 2ZDNA 2AEIH 4YM9A 1RTKA 1Y8TA 3T26A 1A7SA 1SOZA 3O8RA 1DM4B 3QO6A 4J2YB 5EW1H 2G5VA 1SGDE 1ELGA 2OC8A 4MPXA 1O30A 5T6DA 1C2HA 1LVYA 1PPHE 1FONA 3AASA 2BLWA 1UTNA 4CHAB 1JBUH 2C8XB 1TRYA 1F2SE 1KXFA 1DSUA 1NRSH 5DP7A 5GIBA 4I8JA 2BD4A 2Z3EA 1FAXA 4GVUA 1TNLA 6CHAC 1AE5A 5C1XA 1NZQH 1HCGA 1AGJA 2BB4A 2XWBI 1S0QA 3KEEA 1GMCF 1FPHH 1BITA 1AQ7A 3T2NA 3L33A 3EA8A 2J4IA 1ELDE 3DUXH 1O3JA 2BYAX 4BOHA 1HJAB 1TGBA 1A0LA 5HYOA 1FIZA 3AVZA 3FFGA 2ZKSA 2GZ7A 4XBDA 3ATIA 5HM2A 1WQVH 1XKBC 2VVUA 1HJ8A 1TX6A 1L4DA 1MD8A 1P11E 3JZ1B 1A1RA 4YESB 3O8CA 1QCPA 1C2LA 1DXPA 4LZ4B 1S6HA 1IQMA 3UWJH 1EZUC 1C5ZB 1TOCB 1EPTB 3RXDA 1A2CH 2OLGA 3GCNA 5FHTA 3FANA 1AB9C 3A80A 1AU8A 2V3OH 1CT0E 1GI7B 4JZEH 2W26A 1VITF 5C1UA 1S84A 1GMDG 1LQDB 4ZKSU 3SUDA 4ABGA 3SV6A 1H9IE 4U30A 1VITH 4FVBA 1GJ8B 1NC6A 3N7OA 1E37B 2CN0H 2ULLA 2ZGCA 2ZFPH 3ATWA 1CHOG 3ZZAA 1SGNE 2H5CA 3ZZ9A 1OP0A 1QL8A 3MI4A 3W95A 3QTOH 4ZHMU 1X7AC 1BTXA 1EXFA 3ZZ5A 5SGAE 2G8TA 1Z8IB 3LC5A 3ZV9A 2FX6A 2QXGA 1LVBA 4ISLA 1D4PB 1G36A 3A83A 2QYIA 2Q1JA 2ZG0H 4HZHA 4ABAA 3NWUA 3TITA 3SI4H 1ELCA 1UTQA 5JPMH 1GI1A 2TGDA 3A7VA 5A0BA 1K1NA 4OS5A 2EI6A 4BXSA 1P02A 1PQAA 4CRCA 4Y10E 1F5RA 1FV9A 4GHQA 2FO9A 1TA6A 1C1RA 1TQ7B 2FODA 1NRNH 3KIDU 2C93B 4Q7YA 4YOJA 1UCYH 1UTMA 1VGCB 2W7SA 3NUMA 1ELVA 3VGCC 1EJAA 1V2MT 1DUAA 1T4VH 2ESTE 3M5OA 4NSVA 1CO7E 1CGJE 1H9HE 1TMBH 5CHAC 1UVSH 1MTNB 2ZPRA 2XBYA 2J92A 5EQQA 2DE8A 3GY4A 3ITIA 2Z9KA 4X2WA 1LQEA 1K2I1 1ZMJA 3V7TA 1RFNA 3GY2A 5L6NH 1NRPH 4I32A 2BQWB 4X8SH 3VB7A 3TIUA 1CQQA 1OSSA 2VIVA 3ZZDA 3GYLB 3MO3A 3PMBB 1V2VT 4ESTE 2QXHA 4CRAA 3SHAH 3A81A 4YO9A 4KTSA 1PPZA 2FPZA 2R0KA 8KME2 2ZGBH 4CR5A 1SB1H 2OINA 1NRRH 2ZU3A 2EA3A 2XBXA 3D23A 1GG6C 1FNIA 3DHKH 4FUFA 3OSYA 4NFFA 4Y7BA 2AYWA 1P2JA 3VB6A 4ISIH 2HPPH 2OQ5A 5GCHG 4I8GA 4NIVA 5J4QA 3ZVFA 1D9IA 1XUHA 4JYUH 2VB0A 4O9VA 4Y6DA 4Y8YA 4DGJA 1ELBA 1SQAA 3U9AH 3ZVEA 2O8MA 2GCTC 2VGCB 2XYAA 2FTMA 1EP6A 3SN8A 4DCDA 1QL7A 2ODYB 3TJOA 1WV7H 4X1QU 1C5LH 1A0HB 1ZHMA 2STBE 4TPYA 3MH7A 3EBNA 5DP8A 4TY7A 5EOKA 3LGUA 3TGKE 2DUCA 4FUCA 2ANYA 1XUFA 1YPMH 1T8LA 1O3IA 1P2OA 5JBBS 1WCZA 1XKAC 1H9LB 5AF9H 1EAUA 1D6RA 2C8ZB 1FY1A 3ZZ6A 1D3PB 1N8OC 2B9LA 2BZAA 1O2PA 2A4QA 3RMNH 2UUFB 1JRTA 3GY8A 2BY8X 5JDUB 1VZQH 3Q3XA 1TNKA 4X2VA 1BRCE 5EXMA 2NU1E 1A3EH 4DY7B 3QTVH 1V2UT 1LPGB 3E90B 1FN6A 1N6XA 2BDYA 2BDBA 1XUJA 2AGEX 3BF6H 4H6TA 3SUGA 2A5IA 1T8NA 1P9UA 1E38B 2FOMB 1HGTH 1TX8A 2XNIA 4A1VA 4YT7H 2GTBA 2ZZUH 2Y6TA 4ZKNU 3RXQA 3B8JA 3ESTA 3KGPA 3GY3A 1GL1A 2IOTA 4AN7A 1QA0A 1GI9B 1NROH 4BNRA 1KLJH 2BY9X 1HBTH 5CMXH 1V2TT 4OGXA 3RXCA 2W7UA 2PV9B 2A2XH 4BANB 3T29A 3PLPA 4NFEA 1GCTC 2ODPA 2ZO3H 1GCDA 2C8WB 1V2RT 5F8ZA 1V2NT 1W0YH 2KAIA 3ZV8A 1K28D 2VNTA 1QBNA 5AHGH 1OP2A 1Y3VA 5ESBA 1VR1H 4X2XA 2O9QA 2AH4X 1C9PA 3BIVH 5FAHA 1JIRA 1BTZA 4ABFA 3VPKA 1UK3A 1O34A 1D3TB 1MBMA 1WTHD 3M7UA 1GI8B 2VWMA 1GHAG 2PFEA 2OC7A 2G5NA 3PTNA 3NK8A 4B71A 3H7OA 2ZTZA 1GJBB 2ZDVH 1UK4A 1O3FA 1OOKB 1C1NA 2ZDMA 1TOMH 5GWZA 2A45B 1W7GH 3KN2A 1AI8H 1LPKB 1VJ9U 3SV7A 1SGEE 4VGCC 3ZZ8A 1CBWC 3K6YA 1YBWA 1ANBA 3SGAE 3SNCA 1EZXC 1ZPCA 1HXFH 1NU9A 3F1SB 1CT4E 4K2YA 1C1QA 2H9HA 5C20A 1AO5A 4LZ1H 4DVAU 1DY9A 4Y11E 1V6DA 4A5TS 3RXEA 1RTLA 2OCVB 2SGAA 1FXYA 1IQIA 2FI4E 7ESTE 3UR9A 1GHVH 1IQNA 1DWCH 1V2QT 2D26C 4UFEH 3O8DA 4DURA 2ASUB 1AZ8A 1C5YB 1IQKA 5F6MA 5JB8S 1O3CA 1L1GA 1C2FA 2HPQH 1GBIA 3HGPA 3RLYH 3KF2A 1FDPA 5PTPA 1SLWB 3MO9A 4TYDA 4MVNA 3MH6A 1C1MA 4F49A 3A8AA 2BX4A 5DP3A 2BDIA 1O2YA 1BMNH 3SGQE 3A7YA 4UFDH 4NIXA 1QY6A 4BAMB 1VCQA 3FZDA 1QJ6B 2Y82A 3HK6B 2SGQE 2ZC9H 4FVDA 1W3CA 1GJ7B 5L2ZH 3Q3YA 5EPNA 3RXJA 2BQ7B 2R9PA 4B2AA 1K1JA 1ZOMA 3PTBA 1K1OA 1YPHE 2K7XA 1RD3B 1C1OA 1IQEA 2CMYA 4K3JA 4AB9A 2EI8A 3UY9A 1ZHPA 3M5LA 3I77A 1PYTD 1NS3A 1AUTC 3SU6A 1JOUB 2ZFSA 3BTTE 2SNVA 5G4BA 1O32A 3A82A 1L4ZA 1FAKH 4D9QA 1J16A 1GBKA 1MKWK 1QRWA 1UMAH 1UHBA 2Y7ZA 5FX6A 1OWIA 1O3HA 2XBWA 2HLCA 3U8RH 1UCYE 1YGCH 1EQ9A 3E0NB 3AAUA 3MFJA 4O03A 1SFQB 1EB1H 1ELEE 3SOSA 1HYLA 2HRVA 2CHAB 3MYWA 3SGBE 1OYTH 2ZF0H 1P01A 1PPEE 1FMGA 1THRH 1KXDA 4UFGH 1XMNB 3TH4H 4UD9H 2GMTB 4XE4A 2VWOA 7GCHF 3SNEA 4Y8ZA 1AVWA 2ZFTA 5E2PA 5GPIB 2BXTH 4Q7ZA 1G32B 2A2QH 4R8TB 1JXPA 3LONA 4CR9A 3SUFA 3PROA 1V2PT 4O3TA 1GPZA 3DT0H 1HIAA 1YYY1 2ZU4A 1CA0B 1MMJN 2PR3A 3Q3KA 1S0RA 1AUJA 1BZXE 3RXVA 4WWYA 2Z9LA 3BTWE 2GCHG 1TBQH 3C1KA 4JYVH 3UREA 3RM0H 1C2KA 1MAXA 3PMHB 2ZCHP 2Q6DA 3M5NA 4NWKA 2B8OH 1P57B 1PJPA 2W5EA 2XXLA 2Z7FE 3ZVBA 5A8XA 1MCVA 4IGDA 1O3OA 2ZU1A 3CS0A 1CHGA 4ABHA 4OS7A 2PSXA 2C3SA 3LGIA 3BTHE 3E3TA 2EEKA 1C1UH 3ZVAA 5EQSA 2ZQ1A 4SGAE 1AFQC 3HKIB 2A5AA 3IITA 6LPRA 5FPSA 4X8VH 2LIZA 1TYNA 3LGVA 4WXIA 4I31A 2BD3A 2BOKA 4CH8B 4ISOA 3NZIA 1J9CH 1EAWA 1QHRB 3W94A 3B9FH 3LH1A 5IYTA 1OS8A 1C2JA 4BAQB 4CHAC 3PYHA 4NIYA 5C5NA 4PROA 4OS6A 1HDTH 2A4RA 2V0BA 3QDZB 3ELAH 4JK5A 3UUZA 4D7GA 1SI5H 3OY5U 4K1TA 3MOCA 3GY7A 1J17T 1ZSLA 2BTCE 3ZZBA 2VINA 1B5GH 2QXJA 1NN6A 2NU4E 3SU4A 4YT6H 2J9NA 1DFPA 2I6SA 1O2XA 2PLXA 3EE0B 3VB5A 1GJ9B 3TNTA 4X1SU 3RXUA 1HJAC 1BBRK 2Z9GA 1O2NA 3L6PA 5K7RA 1GDQA 1HAIH 1UO6A 1V2WT 1FJSA 4IMZA 4IN1A 1EKBB 3LU9B 3S7HB 2D1JA 1O2GH 1ELFA 4XOJA 1IQLA 1O2TA 3MWIU 2UWLA 2PGBB 3URDA 8GCHF 3TGIE 2F9BH 1G3DA 4ISHH 2I6QA 3PV4A 4JYTA 4Y71A 1Z7KA 1ZJKA 3HKJB 2ZHFH 2D8WA 2XBVA 1EB2A 1EPTC 3STIA 1J15A 4WMDA 1GI2A 4WMFA 1O5DH 4NSYA 1FQ3A 3GICB 3EQ0H 2BD9A 4A1TA 3SV8A 3EGKH 5DP5A 4HI3A 4AZ2B 4AYYB 2VIDA 4DIHH 1O37A 1TNGA 1O3MA 2ALVA 2AIPA 2AGIX 3KL6A 4OS4A 4ZROA 2ZDAH 1QJ1B 2P95A 4K1EA 4JCNA 3T25A 1C5SA 3EDXB 1QIXB 1BUIA 1KXAA 1NTPA 2LPRA 3CP7A 1YCPM 1TNHA 2Y80A 3RXTA 1YC0A 3D62A 3KQEA 4UE7H 3RXFA 1E34B 1MTWA 1BA8B 1F7ZA 5LGOA 1P0SH 4U2WA 1OWEA 1Y5AT 1GMCG 1T8OA 1ESBA 2GX4A 4Y0YE 2QY0B 4IW4E 4BAOB 1WBGB 2BD8A 1TQ0B 1F0SA 3FZZA 4MPWA 1IHSH 2WYGA 1QR3E 1G2LA 4YOGA 3GY6A 1ZJDA 3P95A 4FUIA 1P09A 4E7NA 3BTFE 3ZVDA 2G51A 5T3HA 3B23B 2JH6D 1C5OH 2ANMH 2VIOA 4RN6A 1NFXA 1SGRE 2G81E 5DK1A 1Q31A 3RXHA 1S5SA 1BOQA 2CV3A 3P8OA 3ATMA 1O3KA 1O2KA 1O5GH 2FTLE 4FUDA 2VH6A 2FWWA 4ISNA 1C1PA 3TGJE 1CHOF 3RXPA 2FXRA 3QWCH 3UQOA 1VGCC 4FUHA 1OWKA 1G9IE 4ZAEA 4H4FA 2WPJS 1VITG 5GJ4B 4AX9H 2ZHDA 5B6OA 4ZKRU 1B7XB 1QURH 3R3GB 1HPGA 1GBAA 1A4WH 2FLRH 2P8OB 3LJJA 1Z6JH 3GOVB 3PO1B 1MTNC 3GCTG 4DG4A 4BAKB 2F91A 1QRXA 4FUJA 2OUAA 2BQ6B 1F0TA 3M5MA 1BTWA 1PPCE 2ILNA 1QQUA 5FXLA 4GCHF 1GI0A 2G52A 2ZGXH 3BTME 2ANKH 2XWAA 3IG6B 2W3IA 1WYKA 2ZCKP 4WY3A 3AW1A 1INCA 1Q2WA 1U6QA 2XCNA 3PM3A 1GI4A 3V0XA 1O33A 4IS5A 1UVTH 3SUEA 4YZUA 4E06H 2F9NA 3G01A 2A4GA 3LGTA 1DS2E 1O2SA 2JETB 1SLXB 1FIWA 3S7KB 1CA8B 2FOFA 1C5UA 2TPIZ 2BY7X 1UVPA 1GVLA 3D49H 1H4WA 3SU3A 3K2UA 5HM9A 4RKOB 4ZH8A 1EZQA 5JB9S 1EOLA 2G4TA 2A7CA 2OC0A 1T31A 2G00A 2FYQA 4CH2B 4Z0KA 1YCPK 3T62A 1YPHC 1GBCA 1ZTLA 3SQEE 4ZMAH 1WTGH 2VGCC 5F8TA 3MNCA 5HMAA 5I46H 1C5RA 3PMAB 3EYDA 2ZFQH 4U32A 1OWDA 4BTUB 2FDAA 2FOHA 9ESTA 3A89A 3FP7E 4A6LA 2F9OA 4HGCA 5BRRE 5C1YA 4CBNA 5EXNA 1K21H 1NM6A 1ZPBA 3K9XB 2FX4A 3MU4A 4MNXA 1LVOA 1KY9A 1MU8B 1TAWA 1TALA 4HTCH 4MLFB 2ZDKA 1XXDA 2F9UA 1SSXA 3RU4E 1JWTA 1LTOA 1HAHH 2H9TH 4FU9A 1XUGA 1V2JT 1O2VA 4INKA 1E35B 3R0FA 4X1PU 4AORA 4OGYA 4ABBA 3MU8A 1L0ZA 1DITH 1ZZZA 2WPMS 1O31A 1C2EA 2P16A 1SHYA 3SV2H 4K69A 3P6ZB 1MKXK 1DE7H 2ZA5A 3V3MA 3STJA 2VVCA 1YPKH 1F0RA 2QXIA 1P8VC 2RG3A 5F8XA 4AFQA 1C4U2 3DFLA 1IOEA 3SHCH 1A5GH 2SGDE 1A46H 3ATLA 4JZFH 4A92A 4Y7AA 1KXCA 1L1JA 4FU7A 5AVDA 5ESTE 1CT2E 2GT7A 3SO3A 2O8WA 5DPAA 3BIUH 3E91A 5A09A 2Z94A 1ZRKA 2Z9JA 1BB0B 2VIQA 1BRBE 1TBZH 1A3BH 1MQ5A 1C5MD 3H5CB 4FUGA
chains in the Genus database with same CATH superfamily
1C1VH 5DJ7A 2ZU2A 1NRQH 1ESTA 4IN2A 4GHTA 3SU5A 1Q3XA 4AOQA 3LT3A 1DLEA 1O3GA 4NCYA 5C0UA 3UPEA 4WVPE 1MUEB 3ATKA 5A0CA 4CREA 1P2NA 5LPRA 4YOIA 1EX3A 2FI3E 4AFUA 4ZKOU 2M2AA 3T27A 4AGKA 2AS9A 3SJ9A 1AVGH 2A32A 1SOTA 2NU2E 3UTUH 1O2RA 5DO4H 3SNAA 2PW8H 3EA7A 2Z6BD 1HAVA 1EUFA 1DXWA 2YNAA 5FCRA 3RXMA 3U8OH 3S0NA 3C27B 3T5FH 2BD2A 3M61U 1TNJA 1YPLH 2SGEE 4CRGA 1YPGH 1OWHA 1G30B 2KFWA 3ZVGA 1RIWB 4MQAA 3ENSB 2G55A 3KQCA 1ZSJA 5CE1A 2IJOB 2XC4A 2F9VA 3F68H 1GMHG 2K1QA 1N6YA 3RXGA 4AG1A 1XXFA 2LELA 2ZEBA 4R0IA 3MNBA 1HJ9A 1H1BA 1O5FH 1SGFA 4Q4LA 1S82A 1KLIH 4IBLH 1O5EH 1LHFH 1GHWH 1A5IA 2OXSA 1N8OB 1ZPZA 1CU1A 4GAWA 4B73A 1ZTJA 3V13A 1Y59T 1YPJH 2PUQH 2CGAA 4AGJA 1TGNA 4KKDA 4D7FA 3UR6A 2JH5D 5EG4A 2P3TB 1QTFA 4LOYH 3TU7H 3OE7D 1YWUA 4I33A 1MQ6A 5E8EH 2ZHEH 1QBVH 1O2LA 4YTAA 5F03A 3RM2H 1HAZB 2DE9A 2IPQX 1XUKA 1T7CA 1P2QA 4FUBA 1S83A 4MDSA 2GZ9A 3FAOA 3VXEH 1EOJA 1TB6H 4NIWA 1XUIA 2FMJA 3ZYEA 1GGDB 1K1IA 1QGFA 3RU4T 1QJ7B 1HXEH 3SJIA 1IHTH 1LHGH 3Q00A 5EQRA 1O3NA 1SFIA 1VJAU 3KQBA 5EW2H 3FN8A 1AKSA 4H42U 4FUEA 3CS7A 2VJ1A 2ALPA 1MD7A 3RMOH 2F3CE 4A1XA 2JKHA 2F4LA 3KQDA 1TMUH 2V6NA 1T4UH 1UTOA 3QZRA 3MH4A 4TY6A 3AW0A 5HIZA 1GVKB 1EJMA 1Y3YA 1DWBH 4UEHH 2GD4B 1O3BA 5T6FA 2Y5GA 2ZFFH 2STAE 1C9TA 4GUXA 1ELAA 4XFQA 2B0FA 2H1UA 2WZQA 2TGPZ 4WH6A 1TMTH 1Z6EA 4RKJB 1KLTA 2FS9A 1TA2A 2XRCA 1P05A 2J95A 3TVJB 2HGTH 5B6LA 1H8IH 4MPUA 2UWPA 2M5TA 3SU1A 3PLBA 2KAIB 2HNTF 1P12E 5EU8A 1B0FA 2G4UA 3Q76A 1RXPA 2J98A 1AY6H 1HAGE 2VIPA 3M3SA 3SJKA 3SNBA 2J2UA 2GMTC 3QGJA 1FPCH 2RA3A 4WXVA 2RDEA 1CGIE 1AFEH 1C4Y2 2ZTYA 1NESE 1DPOA 4Q2KA 1SGCA 5DG6A 1P3EA 3S9BA 3EA9A 4ABIA 2CF8H 5C3NA 3URCA 1JMOH 1W0JD 1CA0C 4IMQA 4Y79A 1PFXC 1NT1A 3E16B 1KDQA 2BHGA 3PWBA 2EI7A 2QF3A 1F5LA 5HGGA 2TGTA 6GCHG 2VVVA 1SGPE 1E1QD 1SPJA 1TRMA 1IQHA 2FESH 3OTJE 3NPSA 3TJVA 1OX1A 2H5DA 3UFAA 3O8BA 3QGNB 1G3CA 1KYNA 5EIYA 1RRKA 4MNWA 3TLOA 4RI0A 1HNEE 2Z9IA 5AFYH 2NU3E 1ID5H 2AGGX 3RXKA 1ZLRA 4YLUA 4RSPA 2PGQB 3PMJA 1RJXB 1GJ6A 1BTUA 4X1RU 2QGRA 5FX5A 3U69H 3BG4B 4P00A 3DSPA 1M9UA 3P8GA 3GDVA 1UCYK 3ZZ3A 5A8ZA 2BD7A 1YLDA 3SV9A 1AD8H 4ZHLU 3RMLH 2FOGA 1O2OA 1WUNH 4KTUA 5FPTA 1MKXH 1O2MA 1DLKB 1ESAA 2PTCE 4K8YA 3E0PB 1BMAA 1PPGE 1DSTA 4ASUD 1O5BB 1DWEH 2GCHF 2PKAA 3A7ZA 4X0WU 7GCHG 1O2JA 2BZ6H 2GT8A 5FCKA 4F4OC 4I8HA 4JZDH 5FBEA 3RXAA 4ZXXH 3QX5H 1QB9A 2BMGB 3P8FA 2HOBA 1TPPA 2GGVB 3GISB 4UONA 3A86A 1TPOA 1C2GA 1J8AA 1QRZA 1XVOA 2P94A 3PRBA 4JK6A 4A7IB 2QA9E 4O3UA 5ABWA 3BTEE 2J34A 1MTVA 2BVRH 1T8MA 3GDSA 1O3DA 1W7XH 1NFUA 4B2BA 3QLPH 4RT1A 1ZRBA 1GBEA 5A2MH 1AIXH 1GJAB 2XCFA 4B1TA 2NU0E 3KCGH 1UJ1A 1UHBB 1CE5A 4FOUC 3PWCA 4NGAH 3SYJA 5E0JA 5EPYA 5TCCA 3SORA 3I78A 4I7YH 1JRSA 2RCEA 3CENA 3NKKA 1LHCH 2V3HH 4AG2A 1WDIA 1YM0A 1LKBA 1SLUB 1BT7A 1IAUA 2FZZA 3P8NA 1AWHB 3U1JB 4AB8A 4M9FA 4UDWH 3PLKA 5BPEA 1UTPA 4X8TH 2HVXA 3GY5A 4AYVB 1W11U 1O2ZA 2BLQA 2KX4A 2FYRA 2J94A 1GI3A 2KR7A 2Z3DA 1C2IA 1LO6A 2FS8A 1EPTA 3MU5A 3P92A 4Q7XA 1QB1A 1B0EA 1C5NH 4X1NU 3SU0A 2P3UB 1C1WH 3RLWH 1HIAB 1TPSA 3BSQA 1EAXA 1GHBG 2GDEH 3TNSA 2ANWA 3SZEA 5GXPA 1SQRA 1DUEA 5TCAA 2EY4C 4SGBE 1FZZA 1GBTA 2PKSB 4MTBA 2BXUH 2SFAA 1GBFA 1THPB 2CF9H 5E0GA 1AFQB 3NXPA 1E79D 1D3QB 3FP6E 1RS0A 2ZGHA 1GVZA 2QN5T 2BDGA 5L30H 2LP6A 8GCHG 4Q80A 3SQHE 4NA9H 1ARCA 4BXWA 5JYIA 2OD3B 2F9PA 4IC5A 3LC3A 1CGHA 1KSNA 1MH0A 2OP9A 2WPIS 1A5HA 1C5TA 4NZLA 1UTKA 4Y0ZE 1F0UA 2Q6FA 1GDUA 1MZAA 3PV2A 4X2YA 4KP0A 4D8NA 2ZP0H 3ODDA 3PB1E 1EAIA 4ZXYH 1Y3UA 3K65B 4AFZA 2HVYB 1Y5UT 2D2DA 5T1VA 1O2UA 2SGFE 1TPAE 1TX7A 2GZ8A 3OEHD 2P8OC 1XVMA 1THSH 1IQJA 3PO1C 3TJNA 3M3TA 2NWNA 2ZWLH 1S81A 1L1NA 2BDHA 3GCHB 1TRNA 4INLA 2BVXH 1GJ5H 1O38A 1UVOA 1DY8A 5T6GA 5CHBA 3VXFH 2GJGA 1TWXB 2Q6GA 1NFWA 1W13U 2WPKS 4NG9H 5F53A 4WMEA 2R2MB 1GMDF 1DOJA 3F9FA 1QA7A 4K1SA 1CVWH 4CBOA 1QQ4A 5EJ1A 2R2WU 2FOAA 1BDAA 3EAJA 1NU7B 2ZQ2A 1BJUA 1SBWA 2HLDD 1OKXA 1SQTA 2JETC 2R3UA 1LHDH 3E6PH 1SLVB 3RXIA 5LH8A 3F0PA 1ZR0A 3HGNA 4E05H 1NPMA 2YMSC 3RC4A 2QC2A 1ELTA 1LPZB 4FU8A 6CHAB 5JBAS 1K1LA 4ABEA 3OU0A 1AWFH 1FY3A 2PHBA 3RMMH 1XM1A 3GCTF 2ZCLP 1PQ5A 1BRAA 2P3FH 1QL9A 1Z1IA 1ORFA 1BTPA 4I86A 1BMMH 3ZZ7A 4DT7B 1MTSA 1WAYB 1XX9A 1SHHB 1NY22 1EATA 1GL0E 1TBRH 2W3KA 3MNSA 3MU1A 1F92A 3M7QA 2JIZD 4O97A 1C5PA 1NO9H 1GWAA 3DD2H 1FLEE 4ZCNA 3FVFB 5GDSH 1SGTA 3SI3H 4ACBA 1MKWH 1C5WB 2ODQA 1D6WA 3PV5A 4OS1A 2HNTE 1F5KU 3D65E 1ARBA 3L3TA 5HXFA 2BDAA 1Y5BT 2UUKB 1BRUP 3M36A 3LKWA 2TBSA 1O2WA 4GCHG 1AB9B 1C2MA 1P9SA 4TPIZ 1KTTB 3GCOA 4X6PA 1FY8E 3S9AA 1W14U 3TK9A 1P3CA 1HUTH 1ANDA 1EJNA 2C8YB 3ZZCA 3LIWA 5C2ZA 4KTCA 1UTLM 3RXRA 5J4SA 3SJ8A 4XRNA 1ZMLA 1OHHD 1A0JA 1HLTH 7KMEH 5E2OA 1T32A 3M35A 2AMDA 1UTJA 3BG8A 2A5KA 1TFXA 2FOCA 2B5TB 4DIIH 3RXSA 4XD7D 1ZMNA 1SR5C 5ETXA 2ZI2H 1LDTT 2WPHS 1P03A 2SNWA 1TABE 2QE7D 1AVXA 5EXLA 1C2DA 2BX3A 1OWJA 2A31A 2XW9A 2BLVA 2BDCA 2C4FH 1WU1A 1OP8A 1L2EA 4NWLA 2J97A 1YKTA 2GV6A 3BTDE 5L2YH 2B7DH 1G37A 3BV9B 1K9OE 5GCHF 4HFPB 3A85A 2UUYA 1DICA 4WF8A 2P59A 4B2CA 4BTTB 2RA0A 3VEQB 5LPFA 2H9EH 3MHWU 1MTUA 3RC6A 1V3XA 3VGCB 2VWNA 1PQ7A 4OS2A 3SU2A 2C90B 3LGYA 4NA8A 1O3EA 2QF5A 1IQGA 1Y3XA 5EGMA 5CHAB 1TGSZ 2HALA 1FUJA 4LXBH 2F43B 4F55A 1ZTKA 3DSOA 5C67A 2YNBA 1LHEH 1KXEA 1H8DH 2EC9H 1S6FA 4GLYA 4FXGH 2ZPSA 2A4OA 1VCPA 4WH8A 1G3EA 4X6NA 2A7JA 2Y81A 3I29A 1BJVA 2PUXB 2Y5HA 4JZIA 1SGQE 1EASA 1E0FD 2Z3CA 1C5VA 1RIWC 1W2KH 2R0LA 3ZYDA 2TIOA 4GPGA 3F9GA 3GDUA 4I8KA 2THFB 3TPIZ 4JZ1A 1C1TA 3BEFB 1Z8RA 3K6ZA 3UAIC 1AE8H 1BBRH 1C5XB 3OY6U 3MNXA 3E8LA 3TH3H 4E7RG 2VH0A 1W0ZU 4TWWA 3AK5A 3QK1A 2KCOA 3RXLA 1O2HA 2A1DB 1JIMA 2IPHA 1GG6B 5K0HA 3RP2A 2F83A 4LK4A 1SQOA 2WUCA 3TK5A 1SL3A 1SGYE 3UWIA 2GVFA 1QNJA 1BHXF 3BEIB 4J1YA 1O3PB 1LKAA 1BCUH 1GBJA 2VIWA 1TGTA 1GHZA 5EJLA 4DOQA 2AIQA 4M7GA 5DP6A 4NA7A 1V2OT 2GCTB 2ZFRH 7LPRA 2WV5A 1WOFA 2PWXA 1BQYA 1DVAH 1GBBA 1GGDC 3A7TA 3GYMA 3LGWA 5A8YA 6ESTA 4DJZB 1SGFG 8ESTE 4ABJA 3P70B 1GMHF 2IJD1 1TLDA 1N1LA 1YP9A 2CK3D 4YXWD 5FBIA 1D3DB 2FM2A 1O3AA 1CSOE 3IWMA 2FOBA 1O39A 1GJCB 3M37A 4MNVA 2AERH 1P2IA 3RXOA 4CRBA 1PPFE 2BM2A 3A7WA 3UNQA 2Y5FA 1FI8A 3T28A 1BIOA 1GHAF 5I25A 3QZQA 1GI5A 4X8UH 4BAHB 4B74A 4D76A 1Z1JA 1GHYH 2ZNKH 4K5ZA 4XBBA 5DP4A 3DA9B 2HWLB 3A8BA 3BTQE 4Y8XA 1QBOA 4K8BA 4QT8C 1ANCA 3UOUA 1WSSH 1O36A 1SGIB 3KYGA 5DKMA 2ZHQH 3H7TA 3LOXA 2IN2A 3U8TH 1UVUH 1KIGH 5E0HA 2FP7B 1WQSA 1QFKH 1LVMA 2OC1A 3BTKE 3S9CA 1VCWA 3UNSA 2AMPA 1BTHH 1ZGVA 1V2LT 2O8TA 2CXVA 3U1IB 4MG3A 2ZDLA 2GKVE 2BVSH 1O2IA 1A61H 3PRDA 2FI5E 2OTVA 3SBKA 1J14A 1O5CB 1K1MA 1MCTA 2SGPE 1COWD 5GNDA 3RU4D 1HAVB 1GCTB 3WWBA 1YPEH 2BD5A 1GHXH 2PSYA 3N7DA 4KELA 1ETSH 2V3MA 1BHXB 1Z8GA 2OQUA 3TH2H 2A7HA 3N99A 1AMHA 1GBDA 3SJOA 2VWLA 4BTIB 4THNH 4YLQH 3ZVCA 2QIQA 3UIRA 2WUBA 2WHXA 2ZGJA 3UB0A 4KGAA 1ACBE 2XTTB 3MU0A 1ETRH 3A7XA 3A84A 3SW2B 1DANH 3F2GA 3WY8A 2CHAC 1IQFA 2V35A 3DFJA 5H4IB 2GP9B 2AFQB 3LDXH 3A8DA 3P17H 1ETTH 3TJUA 3A8CA 1ABIH 1HAXB 4XSKU 2ZPQA 2CJIA 4INHA 4NZQA 2WYJA 1W0KD 1ZGIA 2VU8E 1MU6B 3BG4C 4DW2U 1OXGA 4VGCB 1CBWB 3RC5A 2QF0A 1AHTH 1ANEA 1MZDA 3LH3A 3TK6A 3HPTB 1HAPH 2OBOA 1G3BA 1FY5A 1YCPH 5IDKA 1RTFB 1ABJH 3JZ2B 1HAYB 5JBTA 1W10U 1GBLA 4ASHA 3V12A 1Z71A 3BN9A 1SKYE 1C4V2 3VFEA 6GCHF 2XNDD 3RUOA 1C1SA 1VKYA 3U98H 1BMLA 1K22H 1MBQA 5EODA 1K1PA 1SC8U 3QN7A 1AZZA 4HG6A 3OYPA 3M7TA 2HNTC 1TONA 4CRFA 3BTGE 1AKSB 2JH0D 1SMFE 4XDEA 1GBHA 3S69A 2P93A 3A87A 1OYQA 3F9EA 2AMQA 1EP5A 9LPRA 4TWYA 2FLBH 3ODFA 5FPYA 3RXBA 1P06A 3QUMP 1PPBH 2W6JD 3MQKC 1FN8A 4B6EA 5C5OA 3SZNA 1E36B 4H6SB 3M3VA 1UK2A 1P2KA 3DSGA 1HFDA 3AAVA 2WV4A 1P04A 2O8LA 4MPVA 1SG8B 2ZU5A 1DWDH 1O0DH 5LPEA 1P2MA 3MMGA 1V2KT 3LJOA 1NBME 1W8BH 2PTNA 3UOPA 2ZECA 1Y3WA 4WJG2 1RGQA 2ZIQH 2WINI 5AFZH 2R3YA 4ZHAA 4MNYA 1SVPA 1V2ST 2O8UA 2J98B 1GI6A 1QZ8A 8LPRA 1O35A 2BLOA 1O2QA 1H8HD 2GV7A 2Y7XA 5A0AE 1GBMA 4U01A 2FOEA 2WPLS 3MTYA 2TGAA 3MH5A 3NCLA 1MAYA 1DDJA 1LMWB 4Y76A 3MO6A 4K60A 1ZHRA 1O5AB 1ZYOA 2H2ZA 1YLCA 2YMSD 1GJ4H 1PQ8A 2ZHWH 3HATH 3KNXA 1ZSKA 1BTYA 3HK3B 1QB6A 2OBQA 1KDQB 4Z6AH 1TGCA 4ZUHA 2BOHB 3UQVA 2XC0A 2J38A 1DX5M 2UUJB 2XC5A 2FEQH 1E1RD 2PKSC 1OPHB 1HAOH 2BY6X 2JDID 2GDDA 5JBCS 3UNRA 3SNDA 4B76A 1KTSB 2QAAA 4IC6A 2QCYA 1GDNA 1P10A 2RDLA 3F9HA 3ZZ4A 1LCYA 3VB3A 4I8LA 4XBCA 4ABDA 2ZTXA 4CRDA 1DT2A 1G2MA 1O3LA 2UWOA 1BBRE 1TNIA 4JMYA 1Z8JB 1EZSC 2H6MA 3OTPA 3KHVA 3LPRA 2BY5X 1KXBA 4X6OA 5TJXA 1YF4A 1TE0A 4X6MA 2QV1A 3RDZA 3FP8E 3BEUA 1S85A 1GJDB 3Q77A 1HV7A 1C5QA 4UFFH 4B75A 4OM9A 1GHBF 2A0QB 4D9RA 3E1XB 1HB0B 5DGJA 1HRTH 3F6UH 4GSOA 2LNCA 1FY4A 1TIOA 1NFYA 3GCHC 2PKAB 3VB4A 3A88A 5DP9A 2KM0A 3F2HA 3OX7U 2FIRH 2TRMA 4AFSA 2YOLA 1PYTC 1AN1E 1W12U 2ZDNA 2AEIH 4YM9A 1RTKA 1Y8TA 4TSFD 3T26A 1A7SA 1SOZA 3O8RA 1DM4B 3QO6A 4J2YB 5EW1H 2G5VA 1SGDE 1ELGA 2OC8A 4MPXA 1O30A 5T6DA 1C2HA 1LVYA 1PPHE 1FONA 3AASA 4B6FA 2BLWA 1UTNA 4CHAB 1JBUH 2C8XB 1TRYA 1F2SE 1KXFA 1DSUA 1NRSH 5DP7A 3KQ5A 5GIBA 4I8JA 2BD4A 2Z3EA 1FAXA 4GVUA 1TNLA 6CHAC 1AE5A 5C1XA 1NZQH 1HCGA 1AGJA 2BB4A 2XWBI 1S0QA 3KEEA 1GMCF 1FPHH 1BITA 1AQ7A 3T2NA 3L33A 3EA8A 2J4IA 1ELDE 3DUXH 1O3JA 2BYAX 4BOHA 1HJAB 1TGBA 1A0LA 5HYOA 1FIZA 3AVZA 3FFGA 2ZKSA 2GZ7A 4XBDA 3ATIA 5HM2A 1WQVH 1XKBC 2VVUA 1HJ8A 1TX6A 1L4DA 1MD8A 4AC9A 1P11E 3JZ1B 1A1RA 4YESB 3O8CA 1QCPA 1C2LA 1DXPA 4LZ4B 1S6HA 1IQMA 3UWJH 1EZUC 1C5ZB 1TOCB 1EPTB 3RXDA 1A2CH 2OLGA 3GCNA 5FHTA 3FANA 1AB9C 2V7QD 3A80A 1AU8A 2V3OH 1CT0E 1GI7B 4JZEH 2W26A 1VITF 5C1UA 1S84A 1GMDG 1LQDB 4ZKSU 3SUDA 4ABGA 3SV6A 1H9IE 4U30A 1VITH 4FVBA 1GJ8B 1NC6A 2EQNA 3N7OA 1E37B 2CN0H 2ULLA 2ZGCA 2ZFPH 3ATWA 1CHOG 3ZZAA 1SGNE 2H5CA 3ZZ9A 1OP0A 1QL8A 3MI4A 3W95A 3H09A 3QTOH 4ZHMU 1X7AC 2KCYA 1BTXA 1EXFA 3ZZ5A 5SGAE 2G8TA 1Z8IB 3LC5A 5KGOA 3ZV9A 2FX6A 2QXGA 1LVBA 4ISLA 1D4PB 1G36A 3A83A 2QYIA 2Q1JA 2ZG0H 4HZHA 4ABAA 3NWUA 3TITA 3SI4H 1ELCA 1UTQA 5JPMH 1GI1A 2TGDA 3A7VA 5A0BA 1K1NA 4OS5A 2EI6A 4BXSA 3FO8D 1P02A 1PQAA 4CRCA 5DSFA 4Y10E 4F48B 1F5RA 1FV9A 3DCLA 4GHQA 2FO9A 1TA6A 1C1RA 1TQ7B 2FODA 1NRNH 3KIDU 2C93B 4Q7YA 4YOJA 2AHME 1UCYH 1UTMA 1VGCB 4TT3D 2W7SA 3NUMA 3F0OA 3VG8A 1ELVA 3VGCC 1EJAA 1V2MT 2WPDD 1DUAA 1T4VH 2ESTE 3M5OA 4NSVA 1CO7E 1CGJE 1H9HE 1TMBH 5CHAC 1UVSH 1MTNB 2ZPRA 2XBYA 2J92A 5EQQA 2DE8A 3GY4A 3ITIA 2Z9KA 4X2WA 1LQEA 1K2I1 1ZMJA 3V7TA 1RFNA 3GY2A 5L6NH 1NRPH 4I32A 1H8ED 2BQWB 4X8SH 3VB7A 3TIUA 1CQQA 1OSSA 2VIVA 3ZZDA 3GYLB 3MO3A 3PMBB 1V2VT 4ESTE 1MABB 2QXHA 4CRAA 3SHAH 3A81A 4YO9A 4KTSA 1PPZA 2FPZA 2R0KA 8KME2 2ZGBH 4CR5A 1SB1H 2OINA 1NRRH 2ZU3A 2EA3A 2XBXA 4Z1MD 3D23A 1GG6C 1FNIA 3DHKH 4FUFA 3OSYA 4NFFA 4Y7BA 2AYWA 5HIYA 1P2JA 3VB6A 2KCAA 4ISIH 2HPPH 2OQ5A 5GCHG 3F2FA 4I8GA 4NIVA 5J4QA 3ZVFA 1D9IA 1XUHA 4JYUH 2VB0A 4O9VA 4Y6DA 4Y8YA 4DGJA 1ELBA 1SQAA 5EJZA 3U9AH 3ZVEA 2O8MA 2GCTC 2VGCB 2XYAA 2FTMA 1EP6A 3SN8A 4DCDA 1QL7A 2ODYB 3TJOA 1WV7H 4X1QU 1C5LH 1A0HB 1ZHMA 2STBE 5KEDA 4TPYA 3MH7A 3EBNA 5DP8A 4TY7A 4Q63A 5EOKA 3LGUA 3U28C 3TGKE 2DUCA 4FUCA 2ANYA 1XUFA 1YPMH 1T8LA 1O3IA 1P2OA 5JBBS 5KECA 1WCZA 1XKAC 1H9LB 5AF9H 1EAUA 1D6RA 2C8ZB 1FY1A 3ZZ6A 1D3PB 2BZAA 1N8OC 2B9LA 1O2PA 2A4QA 3RMNH 2UUFB 1JRTA 3GY8A 2BY8X 5JDUB 1VZQH 3Q3XA 5C17A 3EE7A 1TNKA 4X2VA 1BRCE 5EXMA 2NU1E 1A3EH 4DY7B 3QTVH 1V2UT 1LPGB 3E90B 1FN6A 1N6XA 2BDYA 2BDBA 1XUJA 1YY3A 2AGEX 3BF6H 4H6TA 3SUGA 2A5IA 1T8NA 1K0HA 1P9UA 3FOAA 1E38B 2FOMB 1HGTH 1EFRD 1TX8A 2XNIA 3F3BA 4A1VA 4YT7H 2GTBA 2ZZUH 2Y6TA 4ZKNU 3RXQA 3B8JA 3ESTA 3KGPA 3GY3A 1GL1A 2IOTA 4AN7A 1QA0A 1GI9B 1NROH 4BNRA 1KLJH 2BY9X 1HBTH 5CMXH 1V2TT 4OGXA 3RXCA 2W7UA 2WV9A 2PV9B 2A2XH 4BANB 3T29A 3PLPA 4NFEA 1GCTC 2ODPA 2ZO3H 1GCDA 1S6LA 2C8WB 1V2RT 5F8ZA 1V2NT 1W0YH 2KAIA 3ZV8A 1K28D 2VNTA 1QBNA 5AHGH 1OP2A 1Y3VA 5ESBA 1VR1H 4X2XA 2O9QA 2AH4X 1C9PA 3BIVH 5FAHA 1JIRA 1FX0B 1BTZA 4ABFA 3VPKA 1UK3A 1O34A 1D3TB 1MBMA 1WTHD 3M7UA 1GI8B 2VWMA 1GHAG 2PFEA 2OC7A 5IK2D 2G5NA 3PTNA 3NK8A 4B71A 3H7OA 2ZTZA 5FL7D 1GJBB 2ZDVH 1UK4A 1O3FA 1OOKB 1C1NA 2ZDMA 1TOMH 5GWZA 2A45B 1W7GH 3KN2A 1AI8H 1LPKB 1VJ9U 3SV7A 1SGEE 4VGCC 3ZZ8A 1CBWC 3K6YA 1YBWA 1ANBA 3N7EA 3SGAE 3SNCA 1EZXC 1ZPCA 1HXFH 1NU9A 3F1SB 1YLNA 1CT4E 4K2YA 1C1QA 2H9HA 5C20A 2KCPA 1AO5A 4LZ1H 4DVAU 1DY9A 4Y11E 1V6DA 3NRLA 4A5TS 3RXEA 1RTLA 2OCVB 2SGAA 4P02A 1FXYA 1IQIA 2FI4E 7ESTE 3UR9A 1GHVH 1IQNA 1DWCH 1V2QT 2D26C 4UFEH 3O8DA 4DURA 2ASUB 1AZ8A 1C5YB 1IQKA 5F6MA 5JB8S 1O3CA 1L1GA 1C2FA 2HPQH 1GBIA 3HGPA 3RLYH 2WSSD 3KF2A 1FDPA 5PTPA 1SLWB 3MO9A 4TYDA 4MVNA 3MH6A 1C1MA 4F49A 3A8AA 2BX4A 5DP3A 2BDIA 1O2YA 1BMNH 3SGQE 3A7YA 4UFDH 4NIXA 1QY6A 4BAMB 1VCQA 3FZDA 1QJ6B 2Y82A 3HK6B 2SGQE 2ZC9H 4FVDA 1W3CA 1GJ7B 5L2ZH 3Q3YA 5EPNA 3RXJA 2BQ7B 2R9PA 3OFND 4B2AA 1K1JA 1ZOMA 3PTBA 1K1OA 1YPHE 2K7XA 1RD3B 1C1OA 1IQEA 2CMYA 4K3JA 4AB9A 2EI8A 3UY9A 1ZHPA 3M5LA 3I77A 1PYTD 1NS3A 1AUTC 5CDFE 3SU6A 1JOUB 2ZFSA 3BTTE 2SNVA 5G4BA 1O32A 3A82A 1L4ZA 1FAKH 4D9QA 1J16A 1GBKA 1MKWK 1QRWA 1UMAH 1UHBA 2Y7ZA 5FX6A 1OWIA 1O3HA 2L6OA 2XBWA 2HLCA 3U8RH 1UCYE 1YGCH 1EQ9A 3E0NB 3AAUA 3MFJA 4O03A 1SFQB 1EB1H 1ELEE 3SOSA 2JJ2D 1HYLA 2HRVA 2CHAB 3MYWA 3SGBE 1OYTH 2ZF0H 1P01A 1PPEE 5C0TA 1FMGA 1THRH 3WWFA 1KXDA 4UFGH 1XMNB 3TH4H 4DT4A 4UD9H 2GMTB 4XE4A 2VWOA 7GCHF 3SNEA 4Y8ZA 1AVWA 2ZFTA 5E2PA 5GPIB 2BXTH 2J5UA 1G32B 2A2QH 4Q7ZA 4R8TB 1JXPA 3LONA 4CR9A 3SUFA 5HKKD 3PROA 1V2PT 4O3TA 1GPZA 3DT0H 1HIAA 1YYY1 2ZU4A 1CA0B 1MMJN 2PR3A 3Q3KA 1S0RA 1AUJA 1BZXE 3RXVA 4WWYA 2Z9LA 2PP6A 3BTWE 2GCHG 1TBQH 3C1KA 4JYVH 3UREA 3RM0H 1C2KA 1MAXA 3PMHB 2ZCHP 2Q6DA 3M5NA 4NWKA 2B8OH 1P57B 1PJPA 2W5EA 2XXLA 2Z7FE 3ZVBA 5A8XA 1MCVA 4IGDA 1O3OA 2ZU1A 3CS0A 1CHGA 2KZ4A 4ABHA 4OS7A 2PSXA 2OK5A 2C3SA 3LGIA 3BTHE 3E3TA 2EEKA 1C1UH 3ZVAA 5EQSA 2ZQ1A 4SGAE 1AFQC 3HKIB 2A5AA 3IITA 6LPRA 5FPSA 4X8VH 2LIZA 1TYNA 3LGVA 4WXIA 4I31A 2BD3A 2BOKA 4CH8B 4ISOA 3NZIA 1J9CH 1EAWA 1QHRB 3W94A 3B9FH 3LH1A 1UW7A 5IYTA 1OS8A 1C2JA 4BAQB 4CHAC 3PYHA 4NIYA 5C5NA 4PROA 4OS6A 1HDTH 2A4RA 2V0BA 3QDZB 3ELAH 4JK5A 3UUZA 4D7GA 1SI5H 3OY5U 4K1TA 3MOCA 3GY7A 1J17T 1ZSLA 2VBCA 4FETA 2BTCE 3ZZBA 2VINA 1B5GH 2QXJA 1NN6A 2NU4E 3SU4A 2W6ID 4YT6H 2J9NA 1DFPA 2I6SA 1O2XA 2QF4A 2PLXA 3EE0B 3VB5A 1GJ9B 3TNTA 4RT0A 4X1SU 3RXUA 1HJAC 1BBRK 2Z9GA 1O2NA 3L6PA 5K7RA 1GDQA 1HAIH 1UO6A 1V2WT 1FJSA 4IMZA 4IN1A 1EKBB 3LU9B 3S7HB 2D1JA 1O2GH 1ELFA 4XOJA 1IQLA 1O2TA 3MWIU 2UWLA 2PGBB 3URDA 8GCHF 3TGIE 2F9BH 1G3DA 4ISHH 2I6QA 3PV4A 4JYTA 4Y71A 1Z7KA 1ZJKA 3HKJB 2ZHFH 2D8WA 2XBVA 1EB2A 1EPTC 3STIA 1J15A 4WMDA 1GI2A 4WMFA 1O5DH 4NSYA 1FQ3A 3GICB 3EQ0H 2BD9A 1BMFD 4A1TA 3SV8A 3EGKH 5DP5A 4HI3A 4AZ2B 4AYYB 2VIDA 4DIHH 1O37A 1TNGA 1O3MA 2ALVA 2K0QA 2AIPA 2AGIX 3KL6A 3GS9A 4OS4A 4ZROA 2ZDAH 1QJ1B 2P95A 4K1EA 2JJ1D 4JCNA 3T25A 1C5SA 3EDXB 1QIXB 1BUIA 1KXAA 1NTPA 2LPRA 3CP7A 1YCPM 1TNHA 2Y80A 3RXTA 1YC0A 3D62A 3KQEA 4UE7H 3RXFA 1E34B 1MTWA 1BA8B 1F7ZA 5LGOA 1P0SH 4U2WA 1OWEA 1Y5AT 1GMCG 1T8OA 1ESBA 2GX4A 4Y0YE 2QY0B 4IW4E 4BAOB 1WBGB 2BD8A 1TQ0B 1F0SA 3FZZA 4MPWA 1IHSH 2WYGA 1QR3E 1G2LA 4YOGA 1NBMD 3GY6A 1ZJDA 3P95A 4FUIA 1P09A 4E7NA 3BTFE 3ZVDA 2G51A 5T3HA 3B23B 5DN6D 2JH6D 1C5OH 2ANMH 2VIOA 4RN6A 1NFXA 1SGRE 2G81E 5DK1A 1Q31A 3RXHA 1S5SA 1BOQA 2CV3A 3P8OA 3ATMA 1O3KA 1O2KA 1O5GH 2FTLE 4FUDA 2VH6A 2FWWA 4ISNA 1C1PA 3TGJE 1CHOF 3RXPA 2FXRA 3QWCH 3UQOA 1VGCC 4FUHA 1OWKA 1G9IE 4ZAEA 4H4FA 2WPJS 1VITG 5GJ4B 4AX9H 2ZHDA 5B6OA 4ZKRU 1B7XB 1QURH 3R3GB 1HPGA 1GBAA 3FKSD 1A4WH 2FLRH 2P8OB 3LJJA 1Z6JH 3GOVB 3PO1B 1MTNC 5C94A 3GCTG 4DG4A 4BAKB 2F91A 1QRXA 4FUJA 3KYFA 2OUAA 2BQ6B 1F0TA 2XOKD 1BTWA 3M5MA 4ACAA 1PPCE 2ILNA 1QQUA 5FXLA 4GCHF 1GI0A 2G52A 2ZGXH 3BTME 3OAAD 2ANKH 2XWAA 3IG6B 2W3IA 1WYKA 2ZCKP 4WY3A 3AW1A 1INCA 1Q2WA 1U6QA 2XCNA 3PM3A 1GI4A 3V0XA 1O33A 4IS5A 1UVTH 3SUEA 4YZUA 4E06H 2F9NA 3G01A 2A4GA 3LGTA 1DS2E 1O2SA 2JETB 1SLXB 1FIWA 3CNRA 3S7KB 1CA8B 2FOFA 1C5UA 2TPIZ 2BY7X 1UVPA 1GVLA 2YMSB 3D49H 1H4WA 3SU3A 3K2UA 5HM9A 4RKOB 4ZH8A 1EZQA 5JB9S 1EOLA 2G4TA 2A7CA 2OC0A 1T31A 2G00A 2FYQA 4CH2B 4Z0KA 1YCPK 3T62A 1YPHC 1GBCA 1WXRA 1ZTLA 3SQEE 4ZMAH 1WTGH 2VGCC 5F8TA 3MNCA 5HMAA 5I46H 1C5RA 3PMAB 3EYDA 2ZFQH 4U32A 1OWDA 4BTUB 2FDAA 2FOHA 9ESTA 3A89A 3FP7E 4A6LA 2F9OA 4HGCA 5BRRE 5C1YA 4CBNA 5EXNA 1K21H 1NM6A 1ZPBA 3K9XB 2FX4A 3MU4A 4MNXA 1LVOA 1KY9A 1MU8B 1TAWA 1TALA 4HTCH 4MLFB 3ZIAD 3OEED 2ZDKA 1XXDA 2F9UA 1SSXA 3RU4E 1JWTA 1LTOA 1HAHH 2H9TH 4FU9A 1XUGA 1V2JT 1O2VA 4INKA 1E35B 3R0FA 4X1PU 4AORA 4OGYA 4ABBA 3MU8A 1L0ZA 1DITH 1ZZZA 2WPMS 1O31A 2L74A 1C2EA 2P16A 1SHYA 3SV2H 4K69A 3P6ZB 1MKXK 1DE7H 2ZA5A 3V3MA 3STJA 2VVCA 1YPKH 1F0RA 2QXIA 1P8VC 2RG3A 5F8XA 3WW7A 4AFQA 1C4U2 3DFLA 1IOEA 3SHCH 1A5GH 1KMHB 2SGDE 1A46H 3ATLA 4JZFH 4A92A 4Y7AA 1KXCA 1L1JA 2RFKC 4FU7A 5AVDA 5ESTE 1CT2E 2GT7A 3SO3A 2O8WA 5DPAA 3BIUH 3E91A 5A09A 2Z94A 1ZRKA 2Z9JA 1BB0B 2VIQA 1BRBE 1TBZH 2K8IA 1A3BH 1MQ5A 1C5MD 3H5CB 3W1EA 4FUGA
chains in the Genus database with same CATH topology
1C1VH 5DJ7A 2ZU2A 1NRQH 1ESTA 4IN2A 4GHTA 3SU5A 1Q3XA 4AOQA 3LT3A 1DLEA 1O3GA 4NCYA 3UPEA 4WVPE 1MUEB 3ATKA 5A0CA 4CREA 1P2NA 5LPRA 4YOIA 1EX3A 2FI3E 4AFUA 4ZKOU 3T27A 4AGKA 2AS9A 3SJ9A 1AVGH 2A32A 1SOTA 2NU2E 3UTUH 1O2RA 5DO4H 3SNAA 2PW8H 3EA7A 2Z6BD 1HAVA 1EUFA 1DXWA 2YNAA 5FCRA 3RXMA 3U8OH 3S0NA 3C27B 3T5FH 2BD2A 3M61U 1TNJA 1YPLH 2SGEE 4CRGA 1YPGH 1OWHA 1G30B 3ZVGA 1RIWB 4MQAA 3ENSB 2G55A 3KQCA 1ZSJA 5CE1A 2IJOB 2XC4A 2F9VA 3F68H 1GMHG 2K1QA 1N6YA 3RXGA 4AG1A 1XXFA 2ZEBA 4R0IA 3MNBA 1HJ9A 1H1BA 1O5FH 1SGFA 1S82A 1KLIH 4IBLH 1O5EH 1LHFH 1GHWH 1A5IA 2OXSA 1N8OB 1ZPZA 1CU1A 4GAWA 4B73A 1ZTJA 3V13A 1Y59T 1YPJH 2PUQH 2CGAA 4AGJA 1TGNA 4KKDA 4D7FA 3UR6A 2JH5D 5EG4A 2P3TB 1QTFA 4LOYH 3TU7H 4I33A 1MQ6A 5E8EH 2ZHEH 1QBVH 1O2LA 4YTAA 5F03A 3RM2H 1HAZB 2DE9A 1XUKA 1T7CA 1P2QA 4FUBA 1S83A 4MDSA 2GZ9A 3FAOA 3VXEH 1EOJA 1TB6H 4NIWA 1XUIA 2FMJA 3ZYEA 1GGDB 1K1IA 1QGFA 3RU4T 1QJ7B 1HXEH 3SJIA 1IHTH 1LHGH 3Q00A 5EQRA 1O3NA 1SFIA 1VJAU 3KQBA 5EW2H 1AKSA 4H42U 4FUEA 3CS7A 2VJ1A 2ALPA 1MD7A 3RMOH 2F3CE 4A1XA 2JKHA 3KQDA 1TMUH 2V6NA 1T4UH 1UTOA 3QZRA 3MH4A 4TY6A 3AW0A 1GVKB 1EJMA 1Y3YA 1DWBH 4UEHH 2GD4B 1O3BA 5T6FA 2Y5GA 2ZFFH 2STAE 1C9TA 4GUXA 1ELAA 4XFQA 2B0FA 2H1UA 2TGPZ 4WH6A 1TMTH 1Z6EA 4RKJB 1KLTA 2FS9A 1TA2A 2XRCA 1P05A 2J95A 3TVJB 2HGTH 1H8IH 4MPUA 2UWPA 2M5TA 3SU1A 3PLBA 2KAIB 2HNTF 1P12E 5EU8A 1B0FA 2G4UA 3Q76A 1RXPA 1AY6H 1HAGE 2VIPA 3M3SA 3SJKA 3SNBA 2J2UA 2GMTC 3QGJA 1FPCH 2RA3A 4WXVA 1CGIE 1AFEH 1C4Y2 2ZTYA 1NESE 1DPOA 4Q2KA 1SGCA 5DG6A 1P3EA 3S9BA 3EA9A 4ABIA 2CF8H 5C3NA 3URCA 1JMOH 1CA0C 4IMQA 4Y79A 1PFXC 1NT1A 3E16B 1KDQA 2BHGA 3PWBA 2EI7A 2QF3A 1F5LA 5HGGA 2TGTA 6GCHG 2VVVA 1SGPE 1SPJA 1TRMA 1IQHA 2FESH 3OTJE 3NPSA 3TJVA 1OX1A 2H5DA 3UFAA 3O8BA 3QGNB 1G3CA 1KYNA 1RRKA 4MNWA 3TLOA 1HNEE 2Z9IA 5AFYH 2NU3E 1ID5H 2AGGX 3RXKA 1ZLRA 4YLUA 4RSPA 2PGQB 3PMJA 1RJXB 1GJ6A 1BTUA 4X1RU 2QGRA 5FX5A 3U69H 3BG4B 1M9UA 3P8GA 3GDVA 1UCYK 3ZZ3A 5A8ZA 2BD7A 1YLDA 3SV9A 1AD8H 4ZHLU 3RMLH 2FOGA 1O2OA 1WUNH 4KTUA 5FPTA 1MKXH 1O2MA 1DLKB 1ESAA 2PTCE 4K8YA 3E0PB 1BMAA 1PPGE 1DSTA 1O5BB 1DWEH 2GCHF 2PKAA 3A7ZA 4X0WU 7GCHG 1O2JA 2BZ6H 2GT8A 5FCKA 4F4OC 4I8HA 4JZDH 5FBEA 3RXAA 4ZXXH 3QX5H 1QB9A 2BMGB 3P8FA 2HOBA 1TPPA 2GGVB 3GISB 4UONA 3A86A 1TPOA 1C2GA 1J8AA 1QRZA 1XVOA 2P94A 4JK6A 4A7IB 2QA9E 4O3UA 5ABWA 3BTEE 2J34A 1MTVA 2BVRH 1T8MA 3GDSA 1O3DA 1W7XH 1NFUA 4B2BA 3QLPH 1ZRBA 1GBEA 5A2MH 1AIXH 1GJAB 2XCFA 4B1TA 2NU0E 3KCGH 1UJ1A 1UHBB 1CE5A 3PWCA 4NGAH 5E0JA 5EPYA 5TCCA 3SORA 3I78A 4I7YH 1JRSA 2RCEA 3CENA 3NKKA 1LHCH 2V3HH 4AG2A 1YM0A 1LKBA 1SLUB 1BT7A 1IAUA 2FZZA 3P8NA 1AWHB 3U1JB 4AB8A 4UDWH 3PLKA 5BPEA 1UTPA 4X8TH 2HVXA 3GY5A 4AYVB 1W11U 1O2ZA 2BLQA 2FYRA 2J94A 1GI3A 2Z3DA 1C2IA 1LO6A 2FS8A 1EPTA 3MU5A 3P92A 4Q7XA 1QB1A 1B0EA 1C5NH 4X1NU 3SU0A 2P3UB 1C1WH 3RLWH 1HIAB 1TPSA 3BSQA 1EAXA 1GHBG 2GDEH 3TNSA 2ANWA 5GXPA 1DUEA 5TCAA 4SGBE 1FZZA 1GBTA 2PKSB 4MTBA 2BXUH 2SFAA 1GBFA 1THPB 2CF9H 5E0GA 1AFQB 3NXPA 1D3QB 3FP6E 1RS0A 2ZGHA 1GVZA 2QN5T 2BDGA 5L30H 8GCHG 4Q80A 3SQHE 4NA9H 1ARCA 4BXWA 5JYIA 2OD3B 2F9PA 4IC5A 3LC3A 1CGHA 1KSNA 1MH0A 2OP9A 2WPIS 1A5HA 1C5TA 4NZLA 1UTKA 4Y0ZE 1F0UA 2Q6FA 1GDUA 1MZAA 4X2YA 4KP0A 4D8NA 2ZP0H 3ODDA 3PB1E 1EAIA 4ZXYH 1Y3UA 3K65B 4AFZA 1Y5UT 2D2DA 1O2UA 2SGFE 1TPAE 1TX7A 2GZ8A 2P8OC 1XVMA 1THSH 1IQJA 3PO1C 3TJNA 3M3TA 2NWNA 2ZWLH 1S81A 1L1NA 2BDHA 3GCHB 1TRNA 4INLA 2BVXH 1GJ5H 1O38A 1UVOA 1DY8A 5T6GA 3VXFH 1TWXB 2Q6GA 1NFWA 1W13U 2WPKS 4NG9H 4WMEA 2R2MB 1GMDF 1DOJA 3F9FA 1QA7A 4K1SA 1CVWH 4CBOA 1QQ4A 2R2WU 2FOAA 1BDAA 3EAJA 1NU7B 2ZQ2A 1BJUA 1SBWA 1OKXA 1SQTA 2JETC 2R3UA 1LHDH 3E6PH 1SLVB 3RXIA 5LH8A 1ZR0A 3HGNA 4E05H 1NPMA 3RC4A 2QC2A 1ELTA 1LPZB 4FU8A 6CHAB 5JBAS 1K1LA 4ABEA 3OU0A 1AWFH 1FY3A 2PHBA 3RMMH 1XM1A 3GCTF 2ZCLP 1PQ5A 1BRAA 2P3FH 1QL9A 1Z1IA 1ORFA 1BTPA 1BMMH 3ZZ7A 4DT7B 1MTSA 1WAYB 1XX9A 1SHHB 1NY22 1EATA 1GL0E 1TBRH 2W3KA 3MNSA 3MU1A 1F92A 3M7QA 4O97A 1C5PA 1NO9H 1GWAA 3DD2H 1FLEE 3FVFB 5GDSH 1SGTA 3SI3H 1MKWH 1C5WB 2ODQA 1D6WA 4OS1A 2HNTE 1F5KU 3D65E 1ARBA 3L3TA 5HXFA 2BDAA 1Y5BT 2UUKB 1BRUP 3M36A 3LKWA 2TBSA 1O2WA 4GCHG 1AB9B 1C2MA 1P9SA 4TPIZ 1KTTB 3GCOA 4X6PA 1FY8E 3S9AA 1W14U 3TK9A 1P3CA 1HUTH 1ANDA 1EJNA 2C8YB 3ZZCA 3LIWA 5C2ZA 4KTCA 1UTLM 3RXRA 5J4SA 3SJ8A 1ZMLA 1A0JA 1HLTH 7KMEH 5E2OA 1T32A 3M35A 2AMDA 1UTJA 3BG8A 2A5KA 1TFXA 2FOCA 2B5TB 4DIIH 3RXSA 1ZMNA 1SR5C 5ETXA 2ZI2H 1LDTT 2WPHS 1P03A 2SNWA 1TABE 1AVXA 5EXLA 1C2DA 2BX3A 1OWJA 2A31A 2XW9A 2BLVA 2BDCA 2C4FH 1WU1A 1OP8A 1L2EA 4NWLA 1YKTA 2GV6A 3BTDE 5L2YH 2B7DH 1G37A 3BV9B 1K9OE 5GCHF 4HFPB 3A85A 2UUYA 1DICA 4WF8A 2P59A 4B2CA 4BTTB 2RA0A 3VEQB 5LPFA 2H9EH 3MHWU 1MTUA 3RC6A 1V3XA 3VGCB 2VWNA 1PQ7A 4OS2A 3SU2A 2C90B 3LGYA 4NA8A 1O3EA 1IQGA 1Y3XA 5EGMA 5CHAB 1TGSZ 2HALA 1FUJA 4LXBH 5C67A 1ZTKA 2YNBA 1LHEH 1KXEA 1H8DH 2EC9H 1S6FA 4GLYA 4FXGH 2ZPSA 2A4OA 1VCPA 4WH8A 1G3EA 4X6NA 2A7JA 2Y81A 3I29A 1BJVA 2PUXB 2Y5HA 4JZIA 1SGQE 1EASA 1E0FD 2Z3CA 1C5VA 1RIWC 1W2KH 2R0LA 3ZYDA 2TIOA 4GPGA 3F9GA 3GDUA 4I8KA 2THFB 3TPIZ 4JZ1A 1C1TA 3BEFB 1Z8RA 3K6ZA 1AE8H 1BBRH 1C5XB 3OY6U 3MNXA 3E8LA 3TH3H 4E7RG 2VH0A 1W0ZU 4TWWA 3QK1A 3RXLA 1O2HA 2A1DB 1JIMA 2IPHA 1GG6B 5K0HA 3RP2A 2F83A 4LK4A 1SQOA 2WUCA 3TK5A 1SL3A 1SGYE 3UWIA 2GVFA 1QNJA 1BHXF 3BEIB 4J1YA 1O3PB 1LKAA 1BCUH 1GBJA 2VIWA 1TGTA 1GHZA 4DOQA 2AIQA 4M7GA 5DP6A 4NA7A 1V2OT 2GCTB 2ZFRH 7LPRA 2WV5A 1WOFA 2PWXA 1BQYA 1DVAH 1GBBA 1GGDC 3A7TA 3GYMA 3LGWA 5A8YA 6ESTA 4DJZB 1SGFG 8ESTE 4ABJA 3P70B 1GMHF 1TLDA 1N1LA 1YP9A 5FBIA 1D3DB 2FM2A 1O3AA 1CSOE 3IWMA 2FOBA 1O39A 1GJCB 3M37A 4MNVA 2AERH 1P2IA 3RXOA 4CRBA 1PPFE 2BM2A 3A7WA 3UNQA 2Y5FA 1FI8A 3T28A 1BIOA 1GHAF 5I25A 3QZQA 1GI5A 4X8UH 4BAHB 4B74A 4D76A 1Z1JA 1GHYH 2ZNKH 4K5ZA 4XBBA 5DP4A 3DA9B 2HWLB 3A8BA 3BTQE 4Y8XA 1QBOA 4K8BA 4QT8C 1ANCA 3UOUA 1WSSH 1O36A 1SGIB 5DKMA 2ZHQH 3H7TA 3LOXA 2IN2A 3U8TH 1UVUH 1KIGH 5E0HA 2FP7B 1WQSA 1QFKH 1LVMA 2OC1A 3BTKE 3S9CA 1VCWA 3UNSA 2AMPA 1BTHH 1ZGVA 1V2LT 2O8TA 2CXVA 3U1IB 4MG3A 2ZDLA 2GKVE 2BVSH 1O2IA 1A61H 2FI5E 2OTVA 3SBKA 1J14A 1O5CB 1K1MA 1MCTA 2SGPE 3RU4D 1HAVB 1GCTB 1YPEH 2BD5A 1GHXH 2PSYA 4KELA 1ETSH 1BHXB 1Z8GA 2OQUA 3TH2H 2A7HA 1AMHA 1GBDA 3SJOA 2VWLA 4BTIB 4THNH 4YLQH 3ZVCA 2QIQA 3UIRA 2WUBA 2ZGJA 4KGAA 1ACBE 2XTTB 3MU0A 1ETRH 3A7XA 3A84A 3SW2B 1DANH 3WY8A 2CHAC 1IQFA 2V35A 3DFJA 5H4IB 2GP9B 2AFQB 3LDXH 3A8DA 3P17H 1ETTH 3TJUA 3A8CA 1ABIH 1HAXB 4XSKU 2ZPQA 2CJIA 4INHA 4NZQA 2WYJA 1ZGIA 2VU8E 1MU6B 3BG4C 4DW2U 1OXGA 4VGCB 1CBWB 3RC5A 2QF0A 1AHTH 1ANEA 1MZDA 3LH3A 3TK6A 3HPTB 1HAPH 2OBOA 1G3BA 1FY5A 1YCPH 5IDKA 1RTFB 1ABJH 3JZ2B 1HAYB 5JBTA 1W10U 1GBLA 4ASHA 3V12A 1Z71A 3BN9A 1C4V2 3VFEA 6GCHF 3RUOA 1C1SA 3U98H 1BMLA 1K22H 1MBQA 5EODA 1K1PA 1SC8U 3QN7A 1AZZA 3OYPA 3M7TA 2HNTC 1TONA 4CRFA 3BTGE 1AKSB 2JH0D 1SMFE 4XDEA 1GBHA 3S69A 2P93A 3A87A 1OYQA 3F9EA 2AMQA 1EP5A 9LPRA 4TWYA 2FLBH 3ODFA 5FPYA 3RXBA 1P06A 3QUMP 1PPBH 1FN8A 5C5OA 3SZNA 1E36B 4H6SB 3M3VA 1UK2A 1P2KA 1HFDA 3AAVA 2WV4A 1P04A 2O8LA 4MPVA 1SG8B 2ZU5A 1DWDH 1O0DH 5LPEA 1P2MA 3MMGA 1V2KT 3LJOA 1W8BH 2PTNA 3UOPA 2ZECA 1Y3WA 4WJG2 1RGQA 2ZIQH 2WINI 5AFZH 2R3YA 4ZHAA 4MNYA 1SVPA 1V2ST 2O8UA 1GI6A 8LPRA 1O35A 2BLOA 1O2QA 2GV7A 2Y7XA 5A0AE 1GBMA 4U01A 2FOEA 2WPLS 3MTYA 2TGAA 3MH5A 3NCLA 1MAYA 1DDJA 1LMWB 4Y76A 3MO6A 4K60A 1ZHRA 1O5AB 1ZYOA 2H2ZA 1YLCA 1GJ4H 1PQ8A 2ZHWH 3HATH 3KNXA 1ZSKA 1BTYA 3HK3B 1QB6A 2OBQA 1KDQB 4Z6AH 1TGCA 4ZUHA 2BOHB 3UQVA 2XC0A 2J38A 1DX5M 2UUJB 2XC5A 2FEQH 2PKSC 1OPHB 1HAOH 2BY6X 2GDDA 5JBCS 3UNRA 3SNDA 4B76A 1KTSB 2QAAA 4IC6A 2QCYA 1GDNA 1P10A 2RDLA 3F9HA 3ZZ4A 1LCYA 3VB3A 4I8LA 4XBCA 4ABDA 2ZTXA 4CRDA 1DT2A 1G2MA 1O3LA 2UWOA 1BBRE 1TNIA 4JMYA 1Z8JB 1EZSC 2H6MA 3KHVA 3LPRA 2BY5X 1KXBA 4X6OA 5TJXA 1YF4A 1TE0A 4X6MA 2QV1A 3RDZA 3FP8E 3BEUA 1S85A 1GJDB 3Q77A 1HV7A 1C5QA 4UFFH 4B75A 1GHBF 2A0QB 4D9RA 3E1XB 1HB0B