4YOGA

Hku4-3clpro bound to non-covalent inhibitor 3b
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
molecule tags Hydrolase/hydrolase inhibitor
total genus 91
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yogA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yogA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yogA02
3GY5A 2XBYA 2DE8A 1J16A 1MTNC 4OS2A 2XTTB 3TJVA 1GJBB 2Y5GA 3FZZA 4FUIA 1XVOA 3RP2A 1C5PA 1WTGH 5LPEA 4WY3A 2ZQ2A 5CHAB 2F9VA 3MI4A 4UFFH 2W3KA 2YOLA 1P2KA 2VB0A 5TCCA 1ZSJA 4B75A 4Z6AH 3VEQB 3W94A 1UTPA 3ZVAA 1QBVH 2BD5A 1SVPA 8KME2 1NRNH 2GCHG 3MU1A 3BTME 3GCHC 2R9PA 2GZ9A 2PKSB 3TIUA 5FCRA 4GCHG 3Q00A 4K60A 4X2VA 1DVAH 1QRWA 1TFXA 1C5WB 1AKSA 1DFPA 4O03A 1SL3A 1TBQH 1CBWC 1AUJA 1F0RA 1OWHA 3DFLA 4ZKSU 3DD2H 2BDBA 4DOQA 3RXDA 4UONA 2OCVB 3VXFH 4A1XA 2M5TA 2FX4A 1QJ1B 1A46H 2A5AA 1P2NA 1A7SA 3F9GA 1TE0A 3RXFA 3M3SA 1EJMA 3SNDA 1D3PB 4MNWA 3GOVB 2J9NA 1YBWA 1TMBH 4ABIA 1OSSA 1QB9A 4DY7B 1E35B 1MKXK 2DE9A 3SU5A 3I77A 3QTOH 1O38A 2XC4A 1XUKA 1QCPA 4FUDA 4CRFA 1HRTH 2ZWLH 4BTTB 3MO3A 2GMTC 5FCKA 4YESB 3S7KB 2CHAB 3UOPA 1E37B 5HGGA 1B0FA 3TGKE 3A7YA 1RD3B 4H6TA 1O2RA 4ASHA 1OWJA 3NPSA 2BX3A 3AAVA 1W0ZU 1K2I1 4Q7ZA 1CQQA 1JXPA 2BVXH 1RIWC 3RXBA 1UVOA 2TGAA 5F6MA 1SI5H 1T4VH 2A2XH 4AFUA 5EQSA 3IWMA 1VZQH 1ELTA 3GY6A 1G3EA 4Y6DA 1XUGA 1TRYA 2ZDKA 1O2ZA 3K65B 3GY7A 2G5NA 1LHCH 3P8NA 1MZDA 2QXGA 4TWWA 1TQ0B 1F7ZA 5EXNA 3SUDA 1PPGE 2Z9GA 1BTUA 1NFWA 1AQ7A 2HWLB 1E38B 1YPHC 1O3JA 4NWLA 1C5UA 2PHBA 1TIOA 2QA9E 1NU7B 2NU3E 1QL7A 1UTOA 3M36A 2VIDA 1H9HE 4Y0ZE 1EJAA 2P16A 3ATLA 1VITG 2QXIA 4Y8XA 1DDJA 4X1RU 4A1TA 3LGIA 1DXPA 1TRNA 4AX9H 3HATH 3IITA 4NIVA 2Z3EA 2R2WU 5A8YA 1F0SA 2D2DA 3LGYA 3PMJA 2XBXA 3UR6A 5DP7A 1GI8B 4ZHAA 1LO6A 1P10A 3R3GB 3SU2A 1LHDH 3RXTA 5FPTA 4KKDA 4B76A 4I8HA 5EQRA 2ZI2H 1DE7H 4YZUA 1DOJA 4JZ1A 2V3HH 4ISOA 3SO3A 3ZVDA 2W5EA 5GPIB 3N7OA 6ESTA 1YPLH 1E36B 1HGTH 2J94A 4HTCH 1HAZB 2UUJB 1C1VH 4JZDH 3QWCH 1O2TA 3CENA 4I7YH 4ZROA 2Z9LA 1AZZA 2ZCHP 5JBTA 3VB6A 3BG4B 3KQEA 4ABFA 3ENSB 2UUFB 3NCLA 3MWIU 2F9NA 3M7QA 3CS7A 1CU1A 1FIZA 3SGBE 1Y8TA 2BYAX 3NWUA 1FY1A 3K2UA 1BZXE 4ABAA 1YLDA 3ZZ3A 2O8TA 1GHWH 1T8MA 3KCGH 3E0NB 2SGQE 4NWKA 5EXLA 3U9AH 4E06H 1K28D 2PSYA 4IGDA 1GBJA 2ZU2A 1DANH 1GBFA 3A8AA 2G4TA 3B23B 1HB0B 2O8WA 3RC4A 1EB2A 1SFIA 1EX3A 5JPMH 3HGNA 1F5RA 4RSPA 2AS9A 2A4OA 7GCHF 1AIXH 1YC0A 1DWEH 2FOAA 1RGQA 1K1IA 2ZGJA 2WINI 2NU2E 1O37A 3A86A 5C67A 4XFQA 2YNBA 3LDXH 2BY9X 4WXVA 3LPRA 3T26A 3H5CB 4OS1A 4K1SA 3R0FA 1PQ8A 1QJ6B 1WTHD 2ZG0H 3SNAA 3A8DA 4ZHMU 3A7VA 3PMAB 1OWIA 2XBVA 4ABEA 1T31A 3UNQA 1SLWB 3STJA 2R2MB 6CHAC 4B2BA 1SGYE 1ORFA 2Z3CA 3URCA 1J14A 5AHGH 3A81A 1HCGA 1MBQA 1JIMA 2C3SA 1NRSH 2ZFQH 4XBBA 3RMLH 2FX6A 1NT1A 1O2YA 4FVDA 1AB9C 2ZCLP 1LMWB 3RXHA 3LONA 1NESE 1MH0A 4Y0YE 1NS3A 1EQ9A 5E8EH 1LHGH 3P70B 1VJ9U 1BJUA 3W95A 1TBRH 1WQSA 4LZ4B 2ZF0H 1EASA 1THRH 1GVKB 3B9FH 1GI0A 1GHBF 1V2ST 1P03A 3L6PA 1KLTA 1HIAA 4CHAB 1Z8RA 4H4FA 5HM2A 1PPBH 4BAQB 1O2KA 1RIWB 1P2OA 2VWNA 2ALVA 1HAVB 1QQ4A 2BD4A 4B2AA 1SQOA 2HLCA 1CA0B 1DM4B 4X1QU 2FP7B 3GICB 5E0GA 2TGPZ 1X7AC 1LQDB 2ZDAH 3VXEH 3Q3YA 1GI7B 1GVZA 1ZTJA 1S5SA 2B0FA 4Y79A 3LT3A 1LHEH 1S82A 1WCZA 2VVCA 1XVMA 5A0AE 4X2YA 1C2HA 1Y3YA 3SOSA 3FANA 4UEHH 1O0DH 1O31A 1IQMA 3MOCA 3U8OH 1AZ8A 4X1SU 3MO9A 1GBTA 1MCTA 2ZNKH 1N6YA 3BSQA 3ZZ8A 1K1JA 3P8OA 1KXAA 4MLFB 2XBWA 1M9UA 3RXPA 1HAHH 2I6QA 3AW1A 1GMHG 1GJ9B 2H1UA 1H9LB 2BMGB 2ZDVH 1UVPA 2ZFSA 2VU8E 5C5OA 4VGCB 1MD8A 1BHXB 1EZXC 1Z8GA 2F83A 4A5TS 2FIRH 3UWIA 1C5MD 4H6SB 1ZPCA 2W7UA 3UUZA 3LU9B 4AG1A 1A0LA 2SFAA 2Z9JA 1CA8B 1FY3A 5L2YH 3RUOA 3RXKA 1XUHA 2P94A 1BDAA 1BMNH 4Q80A 2XXLA 1K1PA 3QGJA 2ZPSA 4J2YB 1L1JA 3MNXA 3UQVA 5L2ZH 2AFQB 4DJZB 3EA7A 5DP9A 3MNBA 2EA3A 5FBIA 1O3IA 2H9EH 2GD4B 1DX5M 1G2MA 1AUTC 4FVBA 1Y3UA 1AE5A 3A82A 1QY6A 3A8BA 2FS8A 1L1NA 4WXIA 1V2JT 1SGFA 1MKXH 1ZMLA 1P02A 1W7GH 2ZPQA 1K9OE 1C1PA 4ESTE 5ETXA 1EAXA 5F8TA 2PUQH 3A7WA 3VB3A 1GDUA 2ZA5A 1WYKA 1GBDA 1K1LA 1QQUA 3PO1B 2F91A 2WPKS 1GGDC 1SGTA 3TGIE 3MTYA 1CGIE 1KYNA 3L33A 1DSTA 1MTVA 1F5KU 1TNHA 4OGXA 1BUIA 3E0PB 3BV9B 5C1XA 1DICA 1HJ9A 2BTCE 1CVWH 1TGCA 5EW1H 2ZP0H 4LXBH 1QTFA 1KLJH 3PLKA 2V6NA 5FAHA 3HK6B 1HPGA 1VR1H 1EXFA 1O33A 1SGCA 1IOEA 2GVFA 2ZPRA 3S9BA 1P2JA 4KTUA 4FUJA 1OXGA 3P17H 1THSH 1S6FA 1YCPM 1UMAH 3QZQA 2CXVA 1WV7H 1O3LA 1BBRK 1V2VT 2AIQA 3M37A 1DLKB 1WBGB 4BNRA 1GMCG 3S9AA 4RKJB 1QR3E 1NROH 1GBEA 1AWHB 1ZYOA 1GBBA 1BRBE 3FP7E 1MBMA 1BT7A 2PKAA 1BTZA 1V2TT 1V2QT 2PUXB 1YPHE 4LK4A 1W2KH 2BLOA 1AFEH 1GMDF 4NA9H 2BB4A 1EOJA 6GCHG 1PQ5A 4A1VA 1F0TA 1O2OA 2XC5A 1W13U 2SNWA 4KGAA 2G8TA 1D9IA 3FP8E 3MFJA 3RC5A 4AGJA 1BQYA 1LQEA 2ZECA 1GJ4H 4IMZA 2HNTF 1C1UH 1CT4E 1EAWA 1SG8B 1N8OB 4F49A 3UTUH 3ZZ7A 1MTUA 2HPQH 1RXPA 2BDCA 2J38A 5DG6A 1HAYB 1AY6H 4B74A 3SNCA 3RC6A 1D3DB 1O32A 4TPIZ 2NU1E 1Z6JH 2BLQA 1Z1JA 2FLRH 3SGAE 1LVBA 1NU9A 3E8LA 2WPHS 4SGAE 1QRZA 1VJAU 2Q1JA 3MMGA 4FXGH 1C5RA 3FFGA 3TJOA 2QCYA 1AHTH 4WH8A 4AN7A 7LPRA 1CGJE 1TA6A 3GYLB 2BDGA 3B8JA 5T6GA 3BTEE 2ZKSA 3ODFA 2VIVA 3ZZAA 2HNTC 2A4QA 4BTUB 3U1JB 2Q6FA 4ZHLU 3OU0A 2AIPA 2FMJA 5E2OA 3UIRA 2B8OH 1S84A 1GG6C 4B1TA 1QNJA 3D62A 8GCHG 1FY5A 2SGEE 1AU8A 2BQ7B 3ODDA 4FUEA 3VB5A 4NFFA 1SOTA 1G3BA 4RN6A 3QN7A 3GY3A 1FV9A 1CT2E 1GCDA 4K1TA 3V7TA 2ZHEH 1KY9A 2SGPE 1A5IA 2QIQA 2STBE 9ESTA 1OOKB 3SJIA 1FJSA 4E7NA 3PMBB 1VGCB 4Y8YA 1J9CH 3GCOA 1HXFH 1G32B 1SHYA 2P59A 4DIHH 1Z7KA 1S0RA 4UE7H 1SGDE 1W12U 1GPZA 5PTPA 3SJ8A 1TB6H 1SB1H 4HGCA 4K8YA 4FUHA 2JETB 1NZQH 2BVRH 1EPTA 1MUEB 1TMTH 2G51A 3HPTB 3TPIZ 3L3TA 1XUJA 4NIXA 1XXFA 2BY6X 2VVVA 1B5GH 5GCHF 1HAPH 3UR9A 5A8ZA 1FY8E 5T6DA 3BIUH 2ZGXH 3TJNA 1VCWA 3AAUA 4X8UH 3ZZ5A 1C1NA 2Y7ZA 2FPZA 3MU5A 2CF8H 3BEIB 1EZQA 3T5FH 1UVSH 1GGDB 1NY22 1PQAA 4OS7A 3ZZCA 2FXRA 1P3CA 1GJAB 1GL0E 3SV8A 1K1OA 1TGSZ 1UCYE 1HBTH 1A5HA 2LNCA 5FXLA 1HNEE 1DSUA 1RFNA 1O5GH 1V2UT 3GYMA 1MKWK 2A7JA 2AERH 1ESAA 1BMLA 4WMFA 1SLXB 2BLWA 5L30H 1PPCE 1LVMA 1C1QA 2BOKA 1HDTH 1ZSKA 1AWFH 1LHFH 3RLYH 4NGAH 1THPB 4I8JA 1OP2A 3GY4A 3P6ZB 3CP7A 1O3HA 1GBLA 1GI1A 1EP6A 1ARCA 3Q77A 1IQNA 1P8VC 3ZZ9A 1HFDA 3F6UH 4Y76A 4YTAA 2PW8H 3NZIA 1UTLM 3GDVA 1SFQB 3EQ0H 2BOHB 1YM0A 2VIOA 3A85A 2PLXA 4CR9A 1T32A 1GHVH 2XNIA 1TPOA 5K0HA 3SNEA 1O3NA 1V2OT 1UCYK 1SGEE 1C2GA 1BMAA 3GDUA 3E6PH 1Y3WA 4BAOB 1GJCB 2EI8A 2FI5E 2VIQA 4YM9A 2P93A 2XWAA 3I29A 3M61U 1DUAA 1QA7A 5L6NH 1CHOF 3ZZDA 2KAIB 2WUCA 1O3PB 1Y5BT 4LOYH 2A0QB 1NPMA 1ETRH 2PTNA 1DITH 5JBBS 5LH8A 4B2CA 3K6ZA 1D4PB 2ZTZA 1GCTC 3A7TA 3M3VA 2A4GA 4KTSA 3BTGE 2XC0A 2NU4E 4YLQH 1ZHRA 2OC1A 6LPRA 1BHXF 5EXMA 1TNJA 2XCFA 1Y3XA 3FP6E 2TGTA 5IYTA 2A45B 3K6YA 4OS4A 2F9BH 2GZ8A 1DY8A 2DUCA 1O2HA 3M7UA 4TY7A 4QT8C 1C5XB 3FZDA 2BX4A 3K9XB 1SMFE 1RJXB 1Q2WA 2AGGX 5JBAS 1O3MA 3SV7A 1J17T 2C8WB 5DGJA 1LPZB 2ZGHA 2F9OA 4GUXA 3GY2A 4ZAEA 4GPGA 3SU6A 2FYQA 5TCAA 1KLIH 3Q76A 2OP9A 4UFGH 3MO6A 2OXSA 1TX8A 3QZRA 3F1SB 1GHAF 1ZJDA 3GY8A 4Y71A 2NWNA 3RXCA 1OKXA 4ISLA 3U69H 3SU0A 4D7GA 3MU8A 2QN5T 1WOFA 2BD9A 5EGMA 2FOCA 3F9EA 1RTLA 1IQFA 1Z8JB 2VGCC 2ZFFH 3EAJA 3D49H 1LVOA 4AFSA 4BOHA 1BBRH 1IQGA 2BY8X 1QL9A 1Z1IA 1T4UH 1E34B 4O9VA 1MTNB 3ZVBA 2GKVE 1GBKA 3VB7A 2FOGA 1BTXA 2H9TH 1P57B 2Z9IA 3DA9B 5JB9S 3BTHE 4BXSA 1IQLA 3OTJE 2H6MA 2XWBI 3QGNB 1ZSLA 4I8LA 4SGBE 5LGOA 2GT7A 5C3NA 2FOHA 2GCHF 2K7XA 2ODPA 1IHSH 4NZQA 4GCHF 1FY4A 4FU9A 3BF6H 2ZU1A 2Z9KA 2STAE 3DFJA 5C5NA 4ZKRU 1C1RA 3GCHB 4CREA 4GAWA 1YPEH 4O3TA 2ZU3A 1UTKA 3KQCA 1GBCA 3BG8A 2RDLA 3U1IB 3UREA 3A83A 4K1EA 4J1YA 1C5SA 4MPWA 4JMYA 1O5CB 1CBWB 5LPFA 1O2XA 3BEFB 5DK1A 5FX6A 2A5IA 4NZLA 4ZH8A 2QC2A 3KQDA 1WAYB 2O8MA 2A31A 3FVFB 3RXEA 1HAGE 2ZDLA 2ZDMA 2D1JA 3V13A 4WJG2 1XUFA 5EPNA 1DUEA 2W3IA 2P3UB 1D6WA 1C2MA 2QY0B 3Q3KA 4FUCA 1ID5H 1GBAA 3VGCC 1VCQA 4BANB 1QB6A 3E91A 1C4U2 2GMTB 1GJ8B 1ZRBA 1S83A 3SU3A 5JBCS 2JH0D 1TAWA 1AE8H 1O35A 3SBKA 1ZZZA 3U98H 3SW2B 2ULLA 3LC5A 3C27B 3QUMP 5A0CA 1Z71A 1EKBB 2WYGA 1AFQC 4WVPE 3LOXA 3FAOA 1FDPA 3NK8A 5GJ4B 3SZNA 2ILNA 1DWBH 1HV7A 5G4BA 3VPKA 1GHYH 5FX5A 2GV7A 2C90B 2VVUA 1GI4A 1P9UA 2R0LA 3A88A 4Y7BA 1O34A 2SGDE 5I46H 1K22H 2GCTC 5JYIA 2ALPA 4IN1A 9LPRA 1AVXA 4E05H 1JOUB 1TPSA 4F4OC 1PYTC 2XW9A 4U01A 5A09A 1BIOA 3RXRA 1EPTC 2AH4X 2ASUB 1VCPA 4CH8B 2ZHFH 3SV6A 1NN6A 1XM1A 3OYPA 2BXTH 1JWTA 4FUBA 2A4RA 3F68H 1G30B 2OC0A 2V0BA 4X1NU 3M3TA 2G4UA 3Q3XA 1SHHB 1NO9H 1BMMH 1V6DA 1C2FA 3V12A 2VIPA 1Y5UT 3A80A 4D8NA 1TA2A 3RLWH 2HGTH 4IC5A 4ISIH 1KXBA 2QYIA 3HGPA 2THFB 1WQVH 1O2MA 1HJAC 1MQ5A 2VNTA 3SV9A 1V2KT 3GCTG 1JBUH 2BQ6B 3S7HB 3PWCA 2C8XB 3KEEA 2FOFA 4GVUA 2TIOA 2VWMA 1BRCE 4Y8ZA 4DGJA 4CRCA 1GVLA 1TRMA 2UUKB 4A6LA 1QRXA 2AMQA 2Y5FA 1UTNA 2PR3A 3SI3H 4MNYA 1K1NA 5DP4A 5DO4H 1ZPBA 4X6MA 1HAVA 4R0IA 2HALA 1OX1A 1YCPH 2J34A 1RS0A 1MKWH 2B5TB 1ZMNA 4E7RG 2I6SA 1UHBB 2G52A 2FM2A 3P8FA 1FXYA 3PB1E 1O2SA 3RXUA 1FPCH 3RXQA 1GI3A 2A32A 3ATWA 3ZVGA 1T8NA 2P3FH 3ZV9A 3KL6A 2WV4A 7KMEH 1KDQB 1W10U 3ESTA 4FUGA 1T8LA 1TNGA 2ZU5A 2FOMB 2TBSA 1FAKH 2OC7A 1O2IA 1WU1A 3U8RH 4NG9H 1BITA 1SLUB 3A7XA 5IDKA 3SNBA 2HOBA 1EOLA 3DHKH 4I8GA 4IS5A 1EAIA 2Z3DA 5DP3A 4DIIH 3LJJA 2Y81A 3A7ZA 3D23A 1DWDH 4O3UA 4WF8A 1RRKA 4IC6A 1UTJA 2FI3E 1O39A 1UCYH 1O36A 5GCHG 5TJXA 3S0NA 4B71A 5C1YA 1HAIH 3BEUA 1ZTLA 4MG3A 3A84A 1DXWA 1TPPA 1ABJH 2FOEA 5JDUB 1GI5A 1P9SA 1P12E 2LPRA 5DP8A 1PPFE 1IQIA 1ELEE 1V2WT 3MHWU 3MU0A 3SU4A 3A89A 1ZHMA 4NIYA 2O8LA 2ZZUH 1LVYA 5BPEA 1JIRA 2NU0E 3O8DA 1LPKB 4YT6H 4D76A 4OS6A 4CR5A 1CHGA 2BQWB 6CHAB 1TABE 2CJIA 2J2UA 1TOMH 3SQHE 5A0BA 2ZTYA 2FTMA 1GJ6A 5E0HA 2OQUA 2AMDA 1HJ8A 3QDZB 4M7GA 5CE1A 1OWKA 5HM9A 5C1UA 1WSSH 1UK2A 5DPAA 1AB9B 4NSYA 5T6FA 1EP5A 2CHAC 2F3CE 2GZ7A 1DS2E 4JZIA 2WPLS 4MNVA 4YOJA 1TNIA 1J15A 1BCUH 2Y7XA 3RU4E 4XSKU 1LKAA 4ABBA 3H7OA 4TWYA 1VITH 1C2EA 1ZTKA 3QK1A 1A0JA 2A2QH 2G00A 2RG3A 1OYQA 3KF2A 3ZVCA 1MAXA 1SGRE 1G3CA 2PTCE 3D65E 4X6NA 1TBZH 1SGFG 8LPRA 1MZAA 1PPHE 3OX7U 1O3FA 1SQTA 1B0EA 1Y59T 2ANKH 1OWDA 1L4DA 1QA0A 1C1OA 2GT8A 1GL1A 3RXIA 2AGIX 3EDXB 5T3HA 3RMOH 3RXOA 1G2LA 2BD7A 3OY5U 5F8XA 1DT2A 4ABHA 1GDNA 2SNVA 2ZU4A 2VWLA 1O2UA 1V2MT 2VWOA 4UFDH 4U30A 1A4WH 1MQ6A 3AW0A 2ODYB 3VFEA 1O3DA 5HXFA 1XUIA 2UWLA 2XRCA 1GMHF 2ESTE 1SSXA 1O5AB 1KTTB 1P2IA 2W7SA 3SV2H 1F0UA 2TPIZ 3HKJB 4Q7XA 2YNAA 1QB1A 1HYLA 1C1MA 4BTIB 4INLA 1A5GH 3EYDA 2P8OC 3RDZA 1P05A 5K7RA 1O3KA 1TNKA 2ANYA 1AKSB 1ELGA 4YT7H 2IJOB 1LKBA 1FIWA 5BRRE 1O3OA 3F9FA 3TVJB 1JRTA 5EQQA 2O9QA 2VH0A 2ZHDA 3ATMA 4AG2A 3RM2H 3UOUA 2FWWA 1YKTA 4AB8A 1MTWA 1TLDA 3BG4C 5GDSH 4R8TB 1MMJN 2C8YB 2CMYA 3BTFE 1C5TA 2BVSH 3M5LA 2BDYA 1ELAA 1GHAG 3RXVA 2WPJS 5AFYH 2ANWA 2A7CA 4ZMAH 5AFZH 2PFEA 3T28A 1K1MA 4NFEA 1SQAA 1JRSA 2P95A 3RXGA 1A0HB 2AYWA 1FONA 2EI7A 2OC8A 1H9IE 1S0QA 1TALA 5HMAA 4MTBA 3SQEE 4HI3A 1FQ3A 1TQ7B 1YPKH 4ISNA 3QLPH 2C93B 2QF0A 4FUFA 3EGKH 1SGNE 2WV5A 1FNIA 4K5ZA 3TU7H 5H4IB 1TX7A 4X2XA 1TONA 3GISB 3TH4H 1LPGB 1KXCA 1LCYA 1YCPK 2ZHWH 7GCHG 3KNXA 1BRAA 2RCEA 3LKWA 1AD8H 3SI4H 5SGAE 1L2EA 4AYYB 1GI9B 1MU8B 1E0FD 3AASA 4IBLH 5FPSA 4MNXA 1GMCF 4UD9H 3BN9A 1A1RA 1O2VA 1WUNH 1JMOH 1UJ1A 1GDQA 3KHVA 1AMHA 2Q6DA 1FZZA 3KQBA 4FU7A 1LDTT 1C5NH 1C2JA 2LIZA 3RXLA 3ZV8A 2BXUH 1C2DA 2F9UA 2JH6D 1GJ5H 1C1TA 4JK6A 1KXDA 4DVAU 3MU4A 4XE4A 2WPMS 1P09A 1C5VA 1FLEE 4IN2A 6GCHF 2OBOA 2OQ5A 1ABIH 2R3YA 3LJOA 4CRDA 1N6XA 1DY9A 1QJ7B 5I25A 1O2WA 1L4ZA 3ITIA 1G37A 1YPMH 3TNTA 1HUTH 2D26C 2ODQA 2BDHA 3JZ2B 5EU8A 1ANCA 4D9RA 3PTNA 1BTPA 4X1PU 4X0WU 1XXDA 1F5LA 1P2MA 1MD7A 1UK3A 2A7HA 1Y3VA 2BD2A 4JK5A 2SGFE 3M5OA 1BA8B 3PYHA 5A2MH 4JZEH 4OS5A 4CHAC 4H42U 5FBEA 3TK5A 1G36A 1W0YH 1OWEA 4ZKNU 1HAXB 4Y11E 1FAXA 5GXPA 4IMQA 2RA3A 1GHBG 5EW2H 5DP6A 2GDDA 4XDEA 1CA0C 4AFZA 3QO6A 1B7XB 4Y10E 1BOQA 4Q2KA 1NM6A 1CO7E 1J8AA 3SUFA 1GI2A 3T25A 4MPXA 1K21H 1C1WH 4UDWH 5CMXH 1MU6B 3C1KA 3PWBA 1ZGIA 3ZYDA 3ZZ4A 1H8IH 2GGVB 1GJ7B 4U32A 1ELVA 1XKAC 1ZJKA 4DG4A 3O8RA 1YLCA 2G5VA 2BLVA 3RU4D 2HPPH 3ZVEA 2FESH 2WYJA 4I32A 4GHQA 4X8VH 3UQOA 8GCHF 4I31A 4KP0A 2G55A 1GHZA 2TGDA 4FU8A 1GBHA 4INKA 1C4Y2 1SLVB 4VGCC 1W14U 2ZO3H 2VINA 5EODA 1G3DA 1GG6B 3AVZA 3ELAH 4CH2B 3OSYA 4ZXYH 3ATKA 1GBIA 2ZDNA 1MCVA 1O3EA 1LTOA 2P8OB 4K2YA 4YO9A 1SC8U 1NFXA 1AO5A 1FMGA 2ZGBH 2UUYA 3S69A 4YOIA 1OYTH 5DKMA 1S85A 1YF4A 2Y80A 2Q6GA 3M7TA 2KAIA 3MH7A 3QTVH 4KELA 5C2ZA 5LPRA 3PLPA 3T29A 1HXEH 2Z7FE 1F2SE 4ABDA 1O2GH 3ATIA 3SHCH 3RXMA 1ESTA 1ANBA 1T7CA 1EJNA 2SGAA 1UVTH 3KGPA 3SJ9A 2RA0A 3RXAA 3RXJA 1NTPA 1S6HA 2BD8A 3SUEA 1AVGH 4NSVA 1ARBA 2GX4A 1QURH 1NFUA 2R3UA 4BAHB 1NRRH 3SORA 3T27A 2FI4E 2H2ZA 2ZFPH 4JYTA 4K3JA 1TNLA 1H8DH 1L0ZA 2G81E 3SU1A 1KXEA 4RKOB 4GLYA 1MTSA 4AZ2B 1O3AA 3PO1C 1DLEA 3BTQE 1N1LA 1O5FH 4WWYA 2FO9A 1O2JA 3ZYEA 1KTSB 1S81A 1GHXH 1HIAB 3ZZ6A 3BTWE 3WY8A 1SOZA 4X8SH 1O3BA 1CT0E 4IW4E 1TWXB 4WH6A 4A7IB 5C20A 5J4QA 1QBNA 5F8ZA 3M35A 4XOJA 2OUAA 1CGHA 2FDAA 1ACBE 5J4SA 4ZXXH 1AGJA 3M5NA 1V2LT 3G01A 1BB0B 1P04A 3ZZBA 5GIBA 2GDEH 1AN1E 2ZFRH 1AI8H 1FPHH 2FYRA 2K1QA 1IQEA 3E3TA 7ESTE 1O5BB 1TGTA 1C2LA 1GJDB 3TK9A 2BM2A 1U6QA 3A8CA 3LGUA 1Z6EA 1C5LH 2QXHA 3EA8A 2FLBH 4KTCA 2BZAA 4DW2U 4HZHA 1P06A 4INHA 2A5KA 4NCYA 4D9QA 2C8ZB 3LC3A 1D3QB 2IN2A 2Y6TA 2ZC9H 1EATA 1ZGVA 1EAUA 1NC6A 3HK3B 2ZTXA 2IPHA 4JYUH 1NRQH 2HVXA 2PGQB 2HNTE 2ANMH 3BTTE 1GMDG 4TY6A 1F92A 2OBQA 3VB4A 4WMDA 4YLUA 2GTBA 2FS9A 5A8XA 4D7FA 4DCDA 1TYNA 3ZVFA 3TH2H 1SBWA 2QGRA 1ZHPA 4JZFH 3QX5H 1UVUH 1PFXC 2VH6A 3KIDU 3TITA 1GWAA 2PWXA 1ZPZA 2EC9H 2F9PA 3O8CA 1XMNB 1N8OC 1VITF 3PROA 1YPJH 4O97A 3MH6A 5GWZA 1GCTB 3E90B 3MNCA 1ZMJA 2Y82A 4I8KA 2IOTA 2V3OH 2OINA 1UTQA 1OP8A 4JYVH 1PYTD 2QV1A 2CN0H 2FEQH 2R0KA 3DUXH 3TJUA 2ZIQH 3GDSA 4XBDA 1V2NT 5AF9H 3BTKE 4U2WA 2D8WA 1C9TA 4MDSA 3LGWA 1PPZA 5DP5A 2EI6A 1C2IA 3LGVA 1P01A 4GHTA 1FI8A 4PROA 4K8BA 2QAAA 2B7DH 2VJ1A 1MAYA 1C1SA 4NIWA 1UO6A 3GCNA 4CRGA 2BD3A 4XBCA 4BAMB 4THNH 4CBOA 4X6PA 3MH4A 1TGNA 4ABJA 2C4FH 2FZZA 3E16B 4YOGA 2B9LA 1DWCH 2H9HA 3T2NA 1H1BA 4ABGA 1A61H 1YGCH 5HYOA 5DJ7A 4ZUHA 2BY5X 4AB9A 3PLBA 1ESBA 3A87A 3PTBA 2A1DB 3TNSA 4I33A 1RTKA 1ELCA 4NA7A 4A92A 1ELBA 3CS0A 4MQAA 2BDIA 3HKIB 1EZSC 1HLTH 1C5OH 3SGQE 1TOCB 1G9IE 1O2LA 1VGCC 5F03A 3UWJH 1UK4A 1O2PA 2W26A 1P11E 1SPJA 4AFQA 2VGCB 5B6OA 2Y5HA 4GSOA 1OP0A 3DT0H 1BTHH 1H4WA 1V2RT 1YYY1 3IG6B 2JETC 8ESTE 4TYDA 5EG4A 5CHAC 1L1GA 3S9CA 3JZ1B 5EOKA 2PKAB 3RMMH 4MVNA 3V0XA 4LZ1H 1A3EH 4Z0KA 1RTFB 1ELDE 3EE0B 1C4V2 1O5DH 1PPEE 3BTDE 2ZFTA 5FPYA 1BBRE 5JB8S 3SJOA 1QFKH 1KXFA 1EUFA 2UWOA 1ZRKA 3EBNA 3MYWA 2ZEBA 1A3BH 2OLGA 3LH1A 2PKSC 3TLOA 3MNSA 2ZHQH 1PJPA 2OTVA 4NA8A 4X2WA 3E1XB 1O5EH 1SGPE 1IQKA 1DPOA 3STIA 1D6RA 1P2QA 1Q3XA 2ZGCA 1Q31A 4DURA 1TMUH 2CGAA 4MPVA 1T8OA 1TGBA 3M5MA 3SUGA 4Y7AA 4MPUA 1GI6A 1XX9A 2AMPA 3U8TH 2V35A 2FODA 3NUMA 1ZR0A 1QIXB 3NKKA 4AGKA 2PSXA 1ZLRA 1FN8A 1O2QA 4ZKOU 3LGTA 1UHBA 4OGYA 1ANDA 1FUJA 2CF9H 4BXWA 1CE5A 1W11U 4AORA 2Z94A 2OD3B 3VGCB 2BDAA 1BTWA 2HRVA 1P3EA 3KN2A 2GP9B 3PMHB 2AGEX 3RXSA 1Y5AT 2GV6A 2XYAA 4AYVB 4CBNA 1KDQA 2FTLE 1D3TB 2AEIH 2ZCKP 3RM0H 1QHRB 3BIVH 3UPEA 2UWPA 1BRUP 2EEKA 1AFQB 2WUBA 1YP9A 1EZUC 2PGBB 5FHTA 1SR5C 1V3XA 1AVWA 3P92A 3V3MA 2JH5D 2BHGA 3P95A 1SGQE 4CRAA 1QGFA 2VIWA 4K69A 4CRBA 2J4IA 1NRPH 3PV4A 5ESTE 2GCTB 2P3TB 4WMEA 1C5ZB 3F9HA 4BAKB 1W3CA 1Z8IB 4ISHH 3P8GA 2Z6BD 1IQHA 1QBOA 2J95A 1CHOG 3OY6U 5AVDA 1UTMA 1P0SH 2WPIS 1EPTB 1C5YB 1QL8A 1KSNA 1V2PT 1TPAE 3EA9A 3SJKA 2QXJA 3PM3A 1ETSH 1IHTH 3T62A 1XKBC 3H7TA 1O30A 1BJVA 1W7XH 1TX6A 1SGIB 3TK6A 1GBMA 2J92A 3SHAH 1O2NA 3RMNH 2FOBA 2H5DA 1ZOMA 2H5CA 1PQ7A 3O8BA 4AOQA 1O3CA 3GCTF 1YPGH 1INCA 2PV9B 3NXPA 2BY7X 4X8TH 3LH3A 1HJAB 5E2PA 4TPYA 1NFYA 5EPYA 1W8BH 3SN8A 4DT7B 3TH3H 1ELFA 3UFAA 1KIGH 1C2KA 2TRMA 1C5QA 1OPHB 1ANEA 3RU4T 4Q7YA 2O8UA 1HAOH 1FN6A 1A2CH 2BZ6H 3MH5A 3UY9A 1ETTH 1O3GA 3LIWA 2ZQ1A 3TGJE 5E0JA 4B73A 1IQJA 2XCNA 3UNSA 2JKHA 3UNRA 1BTYA 1C9PA 4JCNA 3I78A 4HFPB 2QF3A 1CSOE 4UFEH 1IAUA 5ESBA 5ABWA 1EB1H 1OS8A 2CV3A 4X6OA 3URDA
chains in the Genus database with same CATH superfamily
3GY5A 2XBYA 2DE8A 1J16A 1MTNC 4OS2A 2XTTB 3TJVA 1GJBB 2Y5GA 3FZZA 4FUIA 1XVOA 3RP2A 1C5PA 1WTGH 5LPEA 4WY3A 2ZQ2A 5CHAB 2F9VA 3MI4A 4UFFH 2W3KA 2YOLA 1P2KA 2VB0A 5TCCA 1ZSJA 4B75A 4Z6AH 3VEQB 3W94A 1UTPA 3ZVAA 1QBVH 2BD5A 1SVPA 8KME2 4F48B 1NRNH 2GCHG 3MU1A 3BTME 3GCHC 2R9PA 2GZ9A 2PKSB 3TIUA 5FCRA 4GCHG 3Q00A 4K60A 4X2VA 1DVAH 1QRWA 1TFXA 1C5WB 3EE7A 1AKSA 1DFPA 4O03A 2EQNA 1SL3A 1TBQH 1CBWC 1AUJA 1E79D 5EJ1A 1F0RA 1OWHA 3DFLA 4ZKSU 3DD2H 2BDBA 4DOQA 3RXDA 4UONA 2OCVB 3VXFH 4A1XA 2M5TA 2FX4A 1QJ1B 1A46H 2A5AA 1P2NA 1A7SA 3F9GA 1TE0A 3RXFA 2V3MA 3M3SA 1EJMA 3SNDA 1D3PB 4MNWA 3GOVB 2J9NA 3MQKC 1YBWA 1TMBH 4ABIA 1K0HA 1OSSA 1QB9A 4DY7B 1E35B 1MKXK 2DE9A 3SU5A 3I77A 3QTOH 1O38A 2XC4A 1XUKA 1QCPA 4FUDA 4CRFA 1HRTH 2ZWLH 3OFND 4BTTB 3MO3A 2L6OA 2GMTC 5KGOA 5FCKA 4YESB 3S7KB 2CHAB 3UOPA 1E37B 5HGGA 1B0FA 3TGKE 3A7YA 1RD3B 4H6TA 1O2RA 4ASHA 1OWJA 4Z1MD 3NPSA 2BX3A 3AAVA 4ASUD 1W0ZU 5C94A 1K2I1 4Q7ZA 1CQQA 1JXPA 2BVXH 1RIWC 3RXBA 1UVOA 2TGAA 5F6MA 1SI5H 1T4VH 2A2XH 4AFUA 5EQSA 3IWMA 1VZQH 1ELTA 3GY6A 1G3EA 4Y6DA 1XUGA 1TRYA 2ZDKA 1O2ZA 5F53A 3K65B 2KCYA 3GY7A 2G5NA 1LHCH 3P8NA 1MZDA 2QXGA 4TWWA 1TQ0B 1F7ZA 5EXNA 3SUDA 1PPGE 2Z9GA 1BTUA 1NFWA 1AQ7A 2HWLB 1E38B 1YPHC 1O3JA 4NWLA 1C5UA 2PHBA 1TIOA 2QA9E 1NU7B 2NU3E 1QL7A 1UTOA 3M36A 2VIDA 1H9HE 4Y0ZE 1EJAA 2P16A 3ATLA 1VITG 2QXIA 4Y8XA 1DDJA 4X1RU 4A1TA 3LGIA 1DXPA 1TRNA 4AX9H 3HATH 3IITA 4NIVA 2Z3EA 2R2WU 5A8YA 1F0SA 2D2DA 3LGYA 3PMJA 2XBXA 3UR6A 5DP7A 1GI8B 4ZHAA 1LO6A 1P10A 3R3GB 3SU2A 1LHDH 3RXTA 3W1EA 5FPTA 4KKDA 4B76A 3PRDA 4I8HA 5EQRA 2ZI2H 1DE7H 4YZUA 1DOJA 4JZ1A 2V3HH 4ISOA 3SO3A 3ZVDA 2W5EA 5GPIB 3N7OA 6ESTA 1YPLH 1E36B 1HGTH 2J94A 4HTCH 1HAZB 2UUJB 1C1VH 1NBME 1YY3A 4JZDH 3QWCH 1O2TA 3CENA 4I7YH 4ZROA 2Z9LA 1AZZA 2ZCHP 5JBTA 3DSPA 3VB6A 3BG4B 3KQEA 4ABFA 3ENSB 2UUFB 3NCLA 3MWIU 2F9NA 3M7QA 3CS7A 1CU1A 1FIZA 3SGBE 1Y8TA 2BYAX 3NWUA 2W6ID 2YMSC 1FY1A 4I86A 3K2UA 1BZXE 4ABAA 1YLDA 3ZZ3A 2O8TA 1GHWH 1T8MA 3KCGH 3E0NB 2SGQE 4NWKA 5EXLA 3U9AH 2WZQA 2WV9A 4E06H 1K28D 2PSYA 4IGDA 1GBJA 2ZU2A 1DANH 1GBFA 3A8AA 2G4TA 3B23B 1QZ8A 1HB0B 5FL7D 2O8WA 3RC4A 1EB2A 3KQ5A 1SFIA 1EX3A 5JPMH 3HGNA 2RDEA 1F5RA 4RSPA 2AS9A 2A4OA 7GCHF 1AIXH 1YC0A 1DWEH 2FOAA 1RGQA 1K1IA 2ZGJA 2WINI 2NU2E 1O37A 3A86A 5C67A 4XFQA 2YNBA 5HKKD 3LDXH 2BY9X 4WXVA 3LPRA 3T26A 3H5CB 4OS1A 4K1SA 3R0FA 1PQ8A 1QJ6B 1WTHD 2ZG0H 3SNAA 3A8DA 4ZHMU 3A7VA 3PMAB 1OWIA 2XBVA 4ABEA 1T31A 3UNQA 1SLWB 3STJA 2R2MB 6CHAC 4B2BA 1SGYE 1ORFA 2Z3CA 3URCA 1J14A 5AHGH 3A81A 1HCGA 1MBQA 1JIMA 2C3SA 1NRSH 2ZFQH 4XBBA 1YLNA 3RMLH 1OHHD 2FX6A 4B6EA 1NT1A 1O2YA 4FVDA 1AB9C 2ZCLP 4AC9A 1LMWB 3RXHA 3LONA 1NESE 1MH0A 4Y0YE 1NS3A 1EQ9A 5E8EH 1LHGH 3P70B 1VJ9U 1BJUA 3W95A 3OE7D 1TBRH 1WQSA 3OEED 4LZ4B 2ZF0H 1EASA 1THRH 1GVKB 3ZIAD 3B9FH 1GI0A 1GHBF 1V2ST 1P03A 3L6PA 1KLTA 1HIAA 4CHAB 1Z8RA 4H4FA 5HM2A 1PPBH 4BAQB 1O2KA 1RIWB 1P2OA 2VWNA 2ALVA 1HAVB 2LP6A 1QQ4A 2BD4A 2F43B 1SQOA 2HLCA 4B2AA 2QE7D 1CA0B 1DM4B 4X1QU 2FP7B 2JJ2D 3GICB 5E0GA 3N99A 2TGPZ 1X7AC 1LQDB 2ZDAH 3VXEH 3Q3YA 1GI7B 1UW7A 1GVZA 1ZTJA 1S5SA 2B0FA 4Y79A 3LT3A 1LHEH 1S82A 1WCZA 2VVCA 1XVMA 5A0AE 4X2YA 1C2HA 1Y3YA 3SOSA 3FANA 4UEHH 1O0DH 1O31A 1IQMA 3MOCA 3U8OH 1AZ8A 4X1SU 3MO9A 4M9FA 1GBTA 1MCTA 2ZNKH 1N6YA 2KR7A 3BSQA 3ZZ8A 1K1JA 3P8OA 1KXAA 4MLFB 2XBWA 1M9UA 3RXPA 1HAHH 2I6QA 3AW1A 1GMHG 1GJ9B 2H1UA 1H9LB 2BMGB 2ZDVH 1UVPA 2ZFSA 2VU8E 5C5OA 4VGCB 1MD8A 1BHXB 1EZXC 1Z8GA 2F83A 4A5TS 2FIRH 3UWIA 1C5MD 4H6SB 1ZPCA 2W7UA 3UUZA 3LU9B 4AG1A 1A0LA 2SFAA 2Z9JA 1CA8B 5KEDA 1FY3A 5L2YH 3F3BA 4B6FA 3RUOA 3RXKA 1XUHA 2P94A 1BDAA 1BMNH 4Q80A 2XXLA 1K1PA 3QGJA 2ZPSA 4J2YB 1L1JA 3MNXA 3UQVA 5L2ZH 2AFQB 4DJZB 3EA7A 5DP9A 3MNBA 2EA3A 5FBIA 1O3IA 2H9EH 2GD4B 1DX5M 5C0TA 1G2MA 1AUTC 4FVBA 1Y3UA 1AE5A 3A82A 1QY6A 3A8BA 2FS8A 1L1NA 4WXIA 1V2JT 2IJD1 1SGFA 1MKXH 1ZMLA 1P02A 1W7GH 2ZPQA 1K9OE 1C1PA 4ESTE 5ETXA 1EAXA 5F8TA 2PUQH 3A7WA 3VB3A 1GDUA 2ZA5A 1WYKA 1GBDA 1K1LA 1QQUA 3PO1B 2F91A 2WPKS 1GGDC 1SGTA 3TGIE 2RFKC 3MTYA 3FKSD 1CGIE 1KYNA 2J98B 3L33A 1DSTA 1MTVA 1F5KU 1TNHA 4OGXA 1BUIA 3E0PB 3BV9B 5C1XA 1DICA 1HJ9A 2BTCE 1CVWH 1TGCA 5EW1H 2ZP0H 4LXBH 1QTFA 1KLJH 3PLKA 2V6NA 5FAHA 3HK6B 1HPGA 1VR1H 1EXFA 1NBMD 1O33A 1SGCA 1IOEA 2GVFA 2ZPRA 3S9BA 1P2JA 4KTUA 4FUJA 1OXGA 3P17H 1THSH 1S6FA 1YCPM 1UMAH 3QZQA 2CXVA 1WV7H 1O3LA 5EJZA 3CNRA 1BBRK 1V2VT 2AIQA 3M37A 1DLKB 1WBGB 4BNRA 1GMCG 3S9AA 4RKJB 3KYGA 2KX4A 1QR3E 5KECA 1NROH 1GBEA 1AWHB 1ZYOA 3SYJA 1GBBA 1BRBE 3FP7E 1MBMA 3VG8A 1BT7A 2PKAA 1BTZA 1V2TT 1V2QT 3UB0A 2PUXB 1YPHE 4LK4A 1W2KH 2BLOA 1AFEH 1GMDF 4NA9H 2BB4A 1EOJA 6GCHG 1PQ5A 4A1VA 1F0TA 5DSFA 3GS9A 1O2OA 2XC5A 1W13U 2K0QA 2SNWA 4KGAA 2G8TA 1D9IA 3FP8E 3MFJA 3RC5A 4AGJA 1BQYA 1LQEA 2ZECA 1GJ4H 4IMZA 2XOKD 2HNTF 1C1UH 1CT4E 1EAWA 1SG8B 1N8OB 4F49A 3UTUH 3ZZ7A 1MTUA 2HPQH 1RXPA 2BDCA 2J38A 5DG6A 1HAYB 1AY6H 4B74A 4XD7D 3SNCA 3RC6A 1D3DB 1O32A 4TPIZ 2NU1E 1Z6JH 2BLQA 1Z1JA 2FLRH 3SGAE 1LVBA 1NU9A 2WPDD 2WPHS 3E8LA 1QRZA 1VJAU 2Q1JA 3MMGA 4FXGH 1C5RA 4SGAE 3FFGA 3TJOA 2QCYA 1AHTH 4WH8A 4AN7A 7LPRA 1CGJE 1TA6A 3GYLB 2BDGA 3B8JA 5T6GA 3BTEE 4ACBA 2ZKSA 1KMHB 3ODFA 2VIVA 3ZZAA 2HNTC 2A4QA 4BTUB 3U1JB 2Q6FA 5EJLA 3PRBA 4ZHLU 3OU0A 2AIPA 2FMJA 5E2OA 3UIRA 2B8OH 1S84A 1GG6C 4B1TA 1QNJA 3D62A 3H09A 8GCHG 2VBCA 1FY5A 2SGEE 1AU8A 2BQ7B 3ODDA 4FUEA 3VB5A 4NFFA 1SOTA 1G3BA 4RN6A 3QN7A 1E1RD 3GY3A 1FV9A 1CT2E 1GCDA 4K1TA 3V7TA 2ZHEH 1KY9A 2SGPE 1A5IA 2QIQA 2STBE 9ESTA 1OOKB 3SJIA 1FJSA 4E7NA 3PMBB 1VGCB 4Y8YA 1J9CH 3F2HA 3GCOA 1HXFH 1G32B 1SHYA 2P59A 4DIHH 1Z7KA 1S0RA 4UE7H 1SGDE 1W12U 1GPZA 5PTPA 3SJ8A 1TB6H 1SB1H 3AK5A 4HGCA 4K8YA 4FUHA 2JETB 1NZQH 2BVRH 1EPTA 1MUEB 1TMTH 2G51A 3HPTB 3TPIZ 3L3TA 1XUJA 3N7EA 4NIXA 1XXFA 2BY6X 2VVVA 1B5GH 5GCHF 1HAPH 3UR9A 5A8ZA 1FY8E 5T6DA 3BIUH 2ZGXH 3TJNA 1VCWA 3AAUA 4X8UH 3OEHD 2XNDD 3ZZ5A 1C1NA 2Y7ZA 2FPZA 3MU5A 2CF8H 3BEIB 1EZQA 3T5FH 5C0UA 1UVSH 1GGDB 1NY22 1PQAA 4OS7A 3ZZCA 2FXRA 1P3CA 5CDFE 1GJAB 4F55A 1GL0E 3SV8A 1K1OA 1TGSZ 1UCYE 1HBTH 1A5HA 2LNCA 5FXLA 1HNEE 1DSUA 1RFNA 1O5GH 1V2UT 3GYMA 1MKWK 2A7JA 2AERH 1ESAA 1BMLA 4WMFA 1SLXB 2BLWA 5L30H 1PPCE 1LVMA 1C1QA 2AHME 2BOKA 1HDTH 1ZSKA 1AWFH 1LHFH 1H8ED 4NGAH 1THPB 3RLYH 4I8JA 1OP2A 3GY4A 3P6ZB 3CP7A 1O3HA 1GBLA 1GI1A 1EP6A 1ARCA 3Q77A 1IQNA 1P8VC 3ZZ9A 1HFDA 2LELA 3F6UH 4Y76A 4YTAA 2PW8H 3NZIA 1UTLM 3GDVA 1SFQB 3EQ0H 2BOHB 1YM0A 2VIOA 3A85A 2PLXA 4CR9A 1T32A 1GHVH 2XNIA 1TPOA 5K0HA 3SNEA 1O3NA 1WDIA 1V2OT 1UCYK 1SGEE 1C2GA 1BMAA 3GDUA 3E6PH 1Y3WA 4BAOB 1GJCB 2EI8A 2FI5E 2VIQA 3F2GA 4YM9A 2P93A 2XWAA 3I29A 3M61U 1DUAA 1QA7A 5L6NH 1CHOF 3ZZDA 2KAIB 2WUCA 1O3PB 1Y5BT 4LOYH 2A0QB 1NPMA 1ETRH 2PTNA 1DITH 5JBBS 5LH8A 4B2CA 3K6ZA 1D4PB 2ZTZA 1GCTC 3A7TA 3M3VA 2A4GA 4KTSA 3BTGE 2XC0A 2NU4E 4YLQH 1ZHRA 2OC1A 6LPRA 1BHXF 5EXMA 1TNJA 2XCFA 1Y3XA 3FP6E 2TGTA 5IYTA 2A45B 3K6YA 4OS4A 2F9BH 2GZ8A 1DY8A 2DUCA 1O2HA 3M7UA 4TY7A 4QT8C 1C5XB 3FZDA 2BX4A 3K9XB 1SMFE 1RJXB 1Q2WA 2AGGX 5JBAS 1O3MA 3SV7A 1J17T 2C8WB 5DGJA 1LPZB 3WWBA 2HVYB 2ZGHA 2F9OA 4GUXA 3GY2A 4ZAEA 4GPGA 3SU6A 2FYQA 5TCAA 1KLIH 3Q76A 2OP9A 4UFGH 3MO6A 2OXSA 1TX8A 3QZRA 3F1SB 1GHAF 1ZJDA 3GY8A 4Y71A 2NWNA 3RXCA 1OKXA 4ISLA 3U69H 3SU0A 4D7GA 3MU8A 2QN5T 1WOFA 2BD9A 5EGMA 2FOCA 3F9EA 1RTLA 1IQFA 1Z8JB 2VGCC 2ZFFH 3EAJA 3D49H 1LVOA 4AFSA 4BOHA 1BBRH 1IQGA 2BY8X 1QL9A 1Z1IA 1T4UH 1E34B 4O9VA 3UAIC 1MTNB 3ZVBA 2GKVE 1GBKA 3VB7A 2FOGA 1BTXA 2H9TH 1P57B 2Z9IA 3DA9B 5JB9S 3BTHE 4BXSA 1IQLA 3OTJE 2H6MA 2XWBI 3QGNB 1ZSLA 4I8LA 4SGBE 5LGOA 2GT7A 5C3NA 2FOHA 2GCHF 2K7XA 2JJ1D 1IHSH 2ODPA 4NZQA 3DCLA 4GCHF 1FY4A 4FU9A 3BF6H 2V7QD 2ZU1A 2Z9KA 2STAE 3DFJA 5C5NA 4ZKRU 1C1RA 1E1QD 3GCHB 4CREA 4GAWA 1YPEH 1WXRA 4O3TA 2ZU3A 1UTKA 3KQCA 1GBCA 3BG8A 2RDLA 3U1IB 3UREA 4ACAA 3A83A 4K1EA 4J1YA 1C5SA 4MPWA 4JMYA 1COWD 1O5CB 1CBWB 5LPFA 1O2XA 3BEFB 5DK1A 5FX6A 2A5IA 4NZLA 4ZH8A 2QC2A 3KQDA 1WAYB 2O8MA 2A31A 3FVFB 3RXEA 1HAGE 2ZDLA 2ZDMA 2D1JA 3V13A 4WJG2 1XUFA 4YXWD 5EPNA 1DUEA 2W3IA 2P3UB 1D6WA 1C2MA 2QY0B 3Q3KA 4FUCA 1ID5H 1GBAA 3VGCC 1VCQA 4BANB 1QB6A 3E91A 1C4U2 2GMTB 1GJ8B 1ZRBA 1S83A 3SU3A 5JBCS 2JH0D 1TAWA 1AE8H 1O35A 3SBKA 1ZZZA 2KFWA 3U98H 3SW2B 1SQRA 2ULLA 3LC5A 3C27B 3QUMP 5A0CA 1Z71A 1EKBB 2WYGA 1AFQC 4WVPE 3LOXA 3FAOA 1FDPA 3NK8A 5GJ4B 3SZNA 2ILNA 1DWBH 1HV7A 5G4BA 3VPKA 1GHYH 5FX5A 2GV7A 2C90B 2VVUA 1GI4A 1P9UA 2R0LA 3A88A 4Y7BA 1O34A 2SGDE 5I46H 1K22H 2GCTC 5JYIA 2ALPA 4IN1A 9LPRA 1AVXA 4E05H 1JOUB 1TPSA 4F4OC 1PYTC 2XW9A 4U01A 5A09A 1BIOA 3RXRA 1EPTC 2AH4X 2ASUB 1VCPA 4CH8B 2ZHFH 3SV6A 1NN6A 1XM1A 5T1VA 3OYPA 2BXTH 4HG6A 1JWTA 4FUBA 2A4RA 3F68H 1G30B 2OC0A 2V0BA 4X1NU 3M3TA 2G4UA 3Q3XA 3OAAD 1SHHB 1NO9H 1BMMH 1V6DA 3F2FA 2JDID 1C2FA 3V12A 2VIPA 1Y5UT 3A80A 4D8NA 1TA2A 3RLWH 2HGTH 4IC5A 4ISIH 1KXBA 2QYIA 2KZ4A 3HGPA 2THFB 1WQVH 1O2MA 1HJAC 1MQ5A 2VNTA 3SV9A 2PP6A 1V2KT 3GCTG 1JBUH 2BQ6B 3S7HB 3PWCA 2C8XB 3KEEA 5C17A 2FOFA 4GVUA 2TIOA 2VWMA 1BRCE 4Y8ZA 4DGJA 4CRCA 1GVLA 1TRMA 2UUKB 4A6LA 1QRXA 2AMQA 2Y5FA 1UTNA 2PR3A 3SI3H 4MNYA 1K1NA 5DP4A 5DO4H 1ZPBA 4X6MA 1HAVA 4R0IA 2HALA 1OX1A 1YCPH 2J34A 1RS0A 1MKWH 2B5TB 1ZMNA 4E7RG 2I6SA 1UHBB 2G52A 2FM2A 3P8FA 1FXYA 3PB1E 1O2SA 3RXUA 1FPCH 3RXQA 1GI3A 2A32A 3ATWA 2YMSB 3ZVGA 1T8NA 2P3FH 3ZV9A 3KL6A 2WV4A 7KMEH 1KDQB 1W10U 3ESTA 4FUGA 4P00A 1T8LA 1TNGA 2ZU5A 2FOMB 2TBSA 1FAKH 2OC7A 1O2IA 1WU1A 3U8RH 4NG9H 1BITA 1SLUB 3A7XA 5IDKA 3SNBA 2HOBA 1EOLA 3DHKH 4I8GA 4IS5A 1EAIA 2Z3DA 5DP3A 4DIIH 3LJJA 2Y81A 3A7ZA 3D23A 1DWDH 4O3UA 4WF8A 1RRKA 4IC6A 1UTJA 2FI3E 1O39A 1UCYH 1O36A 5GCHG 5TJXA 3S0NA 4B71A 5C1YA 1HAIH 3BEUA 4OM9A 1ZTLA 4MG3A 3A84A 1DXWA 1TPPA 1ABJH 2FOEA 5JDUB 1GI5A 1P9SA 1P12E 2LPRA 5DP8A 1PPFE 1IQIA 1ELEE 1V2WT 3MHWU 3MU0A 3SU4A 3A89A 1ZHMA 4NIYA 2O8LA 2ZZUH 1LVYA 5BPEA 1JIRA 2NU0E 3O8DA 1LPKB 4YT6H 4D76A 4OS6A 4CR5A 1CHGA 4TSFD 2BQWB 6CHAB 1TABE 2CJIA 2J2UA 1TOMH 3SQHE 5A0BA 2ZTYA 2FTMA 1GJ6A 5E0HA 2OQUA 2AMDA 1HJ8A 3QDZB 4M7GA 5CE1A 1OWKA 5HM9A 5C1UA 1WSSH 2QF5A 1UK2A 5DPAA 1AB9B 4NSYA 5T6FA 1EP5A 2CHAC 2F3CE 2GZ7A 1DS2E 2F4LA 4JZIA 2WPLS 4MNVA 4YOJA 1TNIA 1J15A 1BCUH 2Y7XA 3RU4E 4XSKU 1LKAA 4DT4A 1VKYA 4ABBA 3H7OA 4TWYA 1VITH 3FO8D 1C2EA 1ZTKA 2WSSD 3QK1A 3F0OA 1A0JA 2A2QH 2G00A 2RG3A 2J98A 1OYQA 3KF2A 3ZVCA 1MAXA 1SGRE 1G3CA 2PTCE 3D65E 4X6NA 1TBZH 5HIYA 2KCOA 1SGFG 8LPRA 1MZAA 3DSOA 1PPHE 3OX7U 1O3FA 1SQTA 1B0EA 1Y59T 2ANKH 1OWDA 1L4DA 1QA0A 1C1OA 2GT8A 1GL1A 3RXIA 2AGIX 3EDXB 5T3HA 3RMOH 3RXOA 1G2LA 2BD7A 3OY5U 5F8XA 1DT2A 4ABHA 1GDNA 2SNVA 2ZU4A 2VWLA 1O2UA 1V2MT 2VWOA 4UFDH 4U30A 3OTPA 1A4WH 1MQ6A 3AW0A 2ODYB 3VFEA 1O3DA 5HXFA 1XUIA 2UWLA 2XRCA 1GMHF 2ESTE 1SSXA 1O5AB 1KTTB 1P2IA 2W7SA 3SV2H 1F0UA 2TPIZ 3HKJB 4Q7XA 2YNAA 1QB1A 1HYLA 1C1MA 4BTIB 4INLA 1A5GH 3EYDA 2P8OC 3RDZA 1P05A 5K7RA 1O3KA 1TNKA 2ANYA 1AKSB 1ELGA 4YT7H 2IJOB 1LKBA 1FIWA 5BRRE 1O3OA 3F9FA 3TVJB 1JRTA 5EQQA 2O9QA 2VH0A 2ZHDA 3ATMA 5IK2D 4AG2A 3RM2H 3UOUA 2FWWA 1YKTA 4AB8A 1MTWA 1TLDA 3KYFA 3WW7A 3BG4C 5GDSH 3WWFA 4R8TB 1MMJN 2C8YB 2CMYA 3BTFE 1C5TA 2BVSH 4Q63A 3M5LA 2BDYA 1ELAA 1GHAG 2M2AA 3RXVA 2WPJS 3PV5A 5AFYH 2ANWA 2A7CA 4ZMAH 5AFZH 2JIZD 2PFEA 5B6LA 3T28A 1K1MA 4NFEA 1SQAA 1JRSA 2P95A 3RXGA 1A0HB 2AYWA 1FONA 2EI7A 2OC8A 1H9IE 1S0QA 1TALA 5HMAA 4MTBA 3SQEE 4HI3A 1FQ3A 1TQ7B 1YPKH 4ISNA 3QLPH 2C93B 2QF0A 4FUFA 3EGKH 1SGNE 2WV5A 1FNIA 4K5ZA 3TU7H 5H4IB 1TX7A 4X2XA 1TONA 3GISB 3TH4H 1LPGB 1KXCA 1LCYA 1YCPK 2ZHWH 7GCHG 3KNXA 1BRAA 2RCEA 3LKWA 1AD8H 5CHBA 3SI4H 5SGAE 1L2EA 4AYYB 1GI9B 1MU8B 1E0FD 3AASA 4IBLH 5FPSA 4MNXA 1GMCF 4UD9H 3BN9A 1A1RA 1O2VA 1WUNH 1JMOH 1UJ1A 1GDQA 3KHVA 1AMHA 2Q6DA 1FZZA 3KQBA 4FU7A 1LDTT 1C5NH 1C2JA 2LIZA 3RXLA 3ZV8A 2BXUH 1C2DA 2F9UA 2JH6D 1GJ5H 1C1TA 4JK6A 1KXDA 4DVAU 3MU4A 4XE4A 2WPMS 1P09A 1C5VA 1FLEE 4IN2A 6GCHF 2OBOA 2OQ5A 1ABIH 2R3YA 3LJOA 4CRDA 1N6XA 1DY9A 1QJ7B 1MABB 5I25A 1O2WA 1L4ZA 3ITIA 1G37A 1YPMH 3TNTA 1HUTH 2D26C 2ODQA 2BDHA 3JZ2B 5EU8A 1ANCA 4D9RA 3PTNA 1BTPA 4X1PU 4X0WU 1XXDA 1F5LA 1P2MA 1MD7A 2KCAA 1UK3A 2A7HA 1Y3VA 2BD2A 4JK5A 2SGFE 3M5OA 1BA8B 2W6JD 3PYHA 5A2MH 4JZEH 4OS5A 4ZCNA 4CHAC 4H42U 5FBEA 3TK5A 1G36A 1W0YH 1OWEA 4ZKNU 1HAXB 4Y11E 1FAXA 5GXPA 4IMQA 2RA3A 1GHBG 5EW2H 5DP6A 2GDDA 4XDEA 1CA0C 4AFZA 3QO6A 1B7XB 4Y10E 1BOQA 4Q2KA 1NM6A 1CO7E 1J8AA 3SUFA 1GI2A 3T25A 4MPXA 1K21H 1C1WH 4UDWH 5CMXH 1MU6B 3C1KA 3PWBA 1ZGIA 3ZYDA 3ZZ4A 4RT1A 1H8IH 3PV2A 2GGVB 1GJ7B 4U32A 1ELVA 1XKAC 1ZJKA 4DG4A 3O8RA 1YLCA 2G5VA 2BLVA 3RU4D 2HPPH 3ZVEA 2FESH 2WYJA 4I32A 4GHQA 4X8VH 3UQOA 8GCHF 4I31A 4KP0A 2G55A 1GHZA 2TGDA 4FU8A 1GBHA 4P02A 4INKA 1C4Y2 1SLVB 4VGCC 1W14U 2ZO3H 2VINA 5EODA 1G3DA 1GG6B 3AVZA 3ELAH 4CH2B 3OSYA 4ZXYH 3ATKA 1GBIA 2ZDNA 1MCVA 1O3EA 1LTOA 2P8OB 4K2YA 4YO9A 1SC8U 1NFXA 1AO5A 1FMGA 2ZGBH 2UUYA 3S69A 4YOIA 1OYTH 5DKMA 1S85A 1YF4A 2L74A 2Y80A 2Q6GA 3M7TA 2KAIA 3MH7A 3QTVH 2KM0A 4KELA 5C2ZA 5LPRA 3PLPA 3T29A 1HXEH 2Z7FE 1F2SE 4ABDA 1O2GH 3ATIA 3SHCH 1W0KD 3RXMA 1ESTA 1ANBA 1T7CA 1EJNA 1S6LA 2SGAA 1UVTH 3KGPA 3SJ9A 2RA0A 3F0PA 3RXAA 3RXJA 1NTPA 1S6HA 2YMSD 2BD8A 3SUEA 1AVGH 4NSVA 1ARBA 2GX4A 1QURH 1NFUA 2R3UA 4BAHB 1NRRH 3SORA 3T27A 2K8IA 2FI4E 2H2ZA 2ZFPH 4JYTA 4K3JA 1TNLA 1H8DH 1L0ZA 2G81E 3SU1A 1KXEA 4RKOB 4GLYA 1MTSA 4AZ2B 1O3AA 3PO1C 1DLEA 3BTQE 1N1LA 1O5FH 4WWYA 2FO9A 1O2JA 3ZYEA 1KTSB 1S81A 1FX0B 1GHXH 1HIAB 3ZZ6A 3BTWE 3WY8A 1SOZA 3N7DA 4X8SH 1O3BA 1CT0E 4IW4E 1TWXB 4WH6A 4A7IB 5C20A 5J4QA 1QBNA 5F8ZA 3M35A 4XOJA 2HLDD 2OUAA 1CGHA 2FDAA 1ACBE 5J4SA 4ZXXH 1AGJA 2J97A 3M5NA 1V2LT 3G01A 1BB0B 1P04A 3ZZBA 5GIBA 2GDEH 1AN1E 2ZFRH 1AI8H 1FPHH 2FYRA 2K1QA 1IQEA 3E3TA 7ESTE 1O5BB 1TGTA 1C2LA 1GJDB 3TK9A 2BM2A 1EFRD 1U6QA 3A8CA 3LGUA 1Z6EA 1C5LH 2QXHA 3EA8A 2FLBH 4KTCA 2BZAA 4DW2U 4Q4LA 4HZHA 1P06A 4INHA 2A5KA 4NCYA 4D9QA 2C8ZB 3LC3A 1D3QB 2IN2A 2J5UA 2Y6TA 2ZC9H 1EATA 1ZGVA 1EAUA 1NC6A 3HK3B 2ZTXA 2IPHA 3U28C 4JYUH 1NRQH 2HVXA 2PGQB 2HNTE 2ANMH 3BTTE 1GMDG 4TY6A 1F92A 2OBQA 3VB4A 4WMDA 4YLUA 3SZEA 2GTBA 2FS9A 5A8XA 2EY4C 4D7FA 4DCDA 1TYNA 3ZVFA 2QF4A 3TH2H 1SBWA 2QGRA 1ZHPA 4JZFH 3QX5H 1UVUH 1PFXC 2VH6A 3KIDU 3TITA 1GWAA 2PWXA 1ZPZA 2EC9H 2F9PA 3O8CA 1XMNB 1N8OC 1VITF 3PROA 1YPJH 4O97A 3MH6A 5GWZA 1GCTB 3E90B 3MNCA 1ZMJA 4RI0A 2Y82A 4I8KA 2IOTA 2V3OH 2OINA 1UTQA 1OP8A 4JYVH 1PYTD 2QV1A 2CN0H 2FEQH 2R0KA 3DUXH 3TJUA 2ZIQH 3GDSA 4XBDA 1V2NT 5AF9H 3BTKE 4U2WA 2D8WA 1C9TA 4MDSA 3LGWA 1PPZA 5DP5A 2EI6A 1C2IA 3LGVA 1P01A 4GHTA 1FI8A 4PROA 4K8BA 2QAAA 2B7DH 2VJ1A 1MAYA 1C1SA 4NIWA 1UO6A 3GCNA 4CRGA 2BD3A 4XBCA 4BAMB 4THNH 4CBOA 4X6PA 3MH4A 1TGNA 4ABJA 2C4FH 2FZZA 3E16B 1H8HD 4YOGA 2B9LA 1DWCH 2H9HA 3T2NA 1H1BA 4ABGA 1A61H 1YGCH 5HYOA 5DJ7A 4ZUHA 1BMFD 2IPQX 2BY5X 4AB9A 3PLBA 1ESBA 3A87A 3PTBA 2A1DB 3TNSA 4I33A 1RTKA 1ELCA 4NA7A 4A92A 1ELBA 3CS0A 4MQAA 2BDIA 5GNDA 3HKIB 1EZSC 1HLTH 1C5OH 3SGQE 1TOCB 1G9IE 1O2LA 1VGCC 5F03A 3UWJH 1UK4A 1O2PA 2W26A 1P11E 1SPJA 4AFQA 2VGCB 5B6OA 2Y5HA 4GSOA 1OP0A 3DT0H 1BTHH 1H4WA 1V2RT 1YYY1 3IG6B 2JETC 8ESTE 4TYDA 5EG4A 5CHAC 1L1GA 3S9CA 3JZ1B 5EOKA 2CK3D 2PKAB 3RMMH 4MVNA 3V0XA 4LZ1H 1A3EH 4Z0KA 1RTFB 1ELDE 3EE0B 1C4V2 1O5DH 1PPEE 3BTDE 2ZFTA 5FPYA 1BBRE 5JB8S 3SJOA 1QFKH 1KXFA 5EIYA 1EUFA 2UWOA 1ZRKA 3EBNA 3MYWA 2ZEBA 3DSGA 4XRNA 1A3BH 2OLGA 3LH1A 2PKSC 3TLOA 3MNSA 2ZHQH 1PJPA 2OTVA 1W0JD 4NA8A 4X2WA 3E1XB 1O5EH 1SGPE 2WHXA 1IQKA 1DPOA 3STIA 1D6RA 1P2QA 1Q3XA 2ZGCA 1Q31A 4DURA 1TMUH 2CGAA 4MPVA 1T8OA 1TGBA 3M5MA 3SUGA 4Y7AA 2GJGA 4MPUA 1GI6A 1XX9A 2KCPA 2AMPA 3U8TH 2V35A 2FODA 3NUMA 1ZR0A 1QIXB 3NKKA 4AGKA 2PSXA 2OK5A 1ZLRA 1FN8A 1O2QA 4ZKOU 5DN6D 3LGTA 1UHBA 4OGYA 1ANDA 1FUJA 2CF9H 4BXWA 1CE5A 1W11U 4AORA 3NRLA 2Z94A 2OD3B 3VGCB 4TT3D 2BDAA 1BTWA 2HRVA 1P3EA 3KN2A 2GP9B 3PMHB 2AGEX 3RXSA 1Y5AT 2GV6A 2XYAA 4AYVB 4CBNA 1KDQA 2FTLE 1D3TB 2AEIH 2ZCKP 1SKYE 3RM0H 1QHRB 3BIVH 3UPEA 2UWPA 1BRUP 2EEKA 1AFQB 2WUBA 1YP9A 1EZUC 2PGBB 3FN8A 5FHTA 1SR5C 1V3XA 1AVWA 3P92A 3V3MA 2JH5D 2BHGA 3P95A 1SGQE 4CRAA 1QGFA 2VIWA 4K69A 4CRBA 2J4IA 1NRPH 3PV4A 5ESTE 2GCTB 2P3TB 4FETA 4WMEA 1C5ZB 3F9HA 4BAKB 1W3CA 1Z8IB 4ISHH 3P8GA 2Z6BD 1IQHA 1QBOA 2J95A 1CHOG 3OY6U 5AVDA 1UTMA 4RT0A 1P0SH 2WPIS 1EPTB 1C5YB 1QL8A 5HIZA 1KSNA 1V2PT 1TPAE 3EA9A 3SJKA 2QXJA 3PM3A 1ETSH 1IHTH 3T62A 1XKBC 3H7TA 1O30A 1BJVA 1W7XH 1TX6A 1SGIB 3TK6A 1GBMA 2J92A 3SHAH 1O2NA 4FOUC 3RMNH 2FOBA 2H5DA 1ZOMA 2H5CA 1PQ7A 3O8BA 4AOQA 1O3CA 3GCTF 3FOAA 1YPGH 1INCA 2PV9B 3NXPA 2BY7X 4X8TH 3LH3A 1HJAB 5E2PA 4TPYA 1NFYA 1YWUA 5EPYA 1W8BH 3SN8A 4DT7B 3TH3H 1ELFA 3UFAA 1KIGH 1C2KA 2TRMA 1C5QA 1OPHB 1ANEA 3RU4T 4Q7YA 2O8UA 1HAOH 1FN6A 1A2CH 2BZ6H 3MH5A 3UY9A 1ETTH 1O3GA 3LIWA 2ZQ1A 3TGJE 5E0JA 4B73A 1IQJA 2XCNA 3UNSA 2JKHA 3UNRA 1BTYA 1C9PA 4JCNA 3I78A 4HFPB 2QF3A 1CSOE 4UFEH 1IAUA 5ESBA 5ABWA 1EB1H 1OS8A 2CV3A 4X6OA 3URDA
chains in the Genus database with same CATH topology
3GY5A 2XBYA 2DE8A 1J16A 1MTNC 4OS2A 2XTTB 3TJVA 1GJBB 2Y5GA 3FZZA 4FUIA 1XVOA 3RP2A 1C5PA 1WTGH 5LPEA 4WY3A 2ZQ2A 5CHAB 2F9VA 3MI4A 4UFFH 2W3KA 2YOLA 1P2KA 2VB0A 5TCCA 1ZSJA 4B75A 4Z6AH 3VEQB 3W94A 1UTPA 3ZVAA 1QBVH 2BD5A 1SVPA 8KME2 1NRNH 2GCHG 3MU1A 3BTME 3GCHC 2R9PA 2GZ9A 2PKSB 3TIUA 5FCRA 4GCHG 3Q00A 4K60A 4X2VA 1DVAH 1QRWA 1TFXA 1C5WB 1AKSA 1DFPA 4O03A 1SL3A 1TBQH 1CBWC 1AUJA 1F0RA 1OWHA 3DFLA 4ZKSU 3DD2H 2BDBA 4DOQA 3RXDA 4UONA 2OCVB 3VXFH 4A1XA 2M5TA 2FX4A 1QJ1B 1A46H 2A5AA 1P2NA 1A7SA 3F9GA 1TE0A 3RXFA 3M3SA 1EJMA 3SNDA 1D3PB 4MNWA 3GOVB 2J9NA 1YBWA 1TMBH 4ABIA 1OSSA 1QB9A 4DY7B 1E35B 1MKXK 2DE9A 3SU5A 3I77A 3QTOH 1O38A 2XC4A 1XUKA 1QCPA 4FUDA 4CRFA 1HRTH 2ZWLH 4BTTB 3MO3A 2GMTC 5FCKA 4YESB 3S7KB 2CHAB 3UOPA 1E37B 5HGGA 1B0FA 3TGKE 3A7YA 1RD3B 4H6TA 1O2RA 4ASHA 1OWJA 3NPSA 2BX3A 3AAVA 1W0ZU 1K2I1 4Q7ZA 1CQQA 1JXPA 2BVXH 1RIWC 3RXBA 1UVOA 2TGAA 5F6MA 1SI5H 1T4VH 2A2XH 4AFUA 5EQSA 3IWMA 1VZQH 1ELTA 3GY6A 1G3EA 4Y6DA 1XUGA 1TRYA 2ZDKA 1O2ZA 3K65B 3GY7A 2G5NA 1LHCH 3P8NA 1MZDA 2QXGA 4TWWA 1TQ0B 1F7ZA 5EXNA 3SUDA 1PPGE 2Z9GA 1BTUA 1NFWA 1AQ7A 2HWLB 1E38B 1YPHC 1O3JA 4NWLA 1C5UA 2PHBA 1TIOA 2QA9E 1NU7B 2NU3E 1QL7A 1UTOA 3M36A 2VIDA 1H9HE 4Y0ZE 1EJAA 2P16A 3ATLA 1VITG 2QXIA 4Y8XA 1DDJA 4X1RU 4A1TA 3LGIA 1DXPA 1TRNA 4AX9H 3HATH 3IITA 4NIVA 2Z3EA 2R2WU 5A8YA 1F0SA 2D2DA 3LGYA 3PMJA 2XBXA 3UR6A 5DP7A 1GI8B 4ZHAA 1LO6A 1P10A 3R3GB 3SU2A 1LHDH 3RXTA 5FPTA 4KKDA 4B76A 4I8HA 5EQRA 2ZI2H 1DE7H 4YZUA 1DOJA 4JZ1A 2V3HH 4ISOA 3SO3A 3ZVDA 2W5EA 5GPIB 3N7OA 6ESTA 1YPLH 1E36B 1HGTH 2J94A 4HTCH 1HAZB 2UUJB 1C1VH 4JZDH 3QWCH 1O2TA 3CENA 4I7YH 4ZROA 2Z9LA 1AZZA 2ZCHP 5JBTA 3VB6A 3BG4B 3KQEA 4ABFA 3ENSB 2UUFB 3NCLA 3MWIU 2F9NA 3M7QA 3CS7A 1CU1A 1FIZA 3SGBE 1Y8TA 2BYAX 3NWUA 1FY1A 3K2UA 1BZXE 4ABAA 1YLDA 3ZZ3A 2O8TA 1GHWH 1T8MA 3KCGH 3E0NB 2SGQE 4NWKA 5EXLA 3U9AH 4E06H 1K28D 2PSYA 4IGDA 1GBJA 2ZU2A 1DANH 1GBFA 3A8AA 2G4TA 3B23B 1HB0B 2O8WA 3RC4A 1EB2A 1SFIA 1EX3A 5JPMH 3HGNA 1F5RA 4RSPA 2AS9A 2A4OA 7GCHF 1AIXH 1YC0A 1DWEH 2FOAA 1RGQA 1K1IA 2ZGJA 2WINI 2NU2E 1O37A 3A86A 5C67A 4XFQA 2YNBA 3LDXH 2BY9X 4WXVA 3LPRA 3T26A 3H5CB 4OS1A 4K1SA 3R0FA 1PQ8A 1QJ6B 1WTHD 2ZG0H 3SNAA 3A8DA 4ZHMU 3A7VA 3PMAB 1OWIA 2XBVA 4ABEA 1T31A 3UNQA 1SLWB 3STJA 2R2MB 6CHAC 4B2BA 1SGYE 1ORFA 2Z3CA 3URCA 1J14A 5AHGH 3A81A 1HCGA 1MBQA 1JIMA 2C3SA 1NRSH 2ZFQH 4XBBA 3RMLH 2FX6A 1NT1A 1O2YA 4FVDA 1AB9C 2ZCLP 1LMWB 3RXHA 3LONA 1NESE 1MH0A 4Y0YE 1NS3A 1EQ9A 5E8EH 1LHGH 3P70B 1VJ9U 1BJUA 3W95A 1TBRH 1WQSA 4LZ4B 2ZF0H 1EASA 1THRH 1GVKB 3B9FH 1GI0A 1GHBF 1V2ST 1P03A 3L6PA 1KLTA 1HIAA 4CHAB 1Z8RA 4H4FA 5HM2A 1PPBH 4BAQB 1O2KA 1RIWB 1P2OA 2VWNA 2ALVA 1HAVB 1QQ4A 2BD4A 4B2AA 1SQOA 2HLCA 1CA0B 1DM4B 4X1QU 2FP7B 3GICB 5E0GA 2TGPZ 1X7AC 1LQDB 2ZDAH 3VXEH 3Q3YA 1GI7B 1GVZA 1ZTJA 1S5SA 2B0FA 4Y79A 3LT3A 1LHEH 1S82A 1WCZA 2VVCA 1XVMA 5A0AE 4X2YA 1C2HA 1Y3YA 3SOSA 3FANA 4UEHH 1O0DH 1O31A 1IQMA 3MOCA 3U8OH 1AZ8A 4X1SU 3MO9A 1GBTA 1MCTA 2ZNKH 1N6YA 3BSQA 3ZZ8A 1K1JA 3P8OA 1KXAA 4MLFB 2XBWA 1M9UA 3RXPA 1HAHH 2I6QA 3AW1A 1GMHG 1GJ9B 2H1UA 1H9LB 2BMGB 2ZDVH 1UVPA 2ZFSA 2VU8E 5C5OA 4VGCB 1MD8A 1BHXB 1EZXC 1Z8GA 2F83A 4A5TS 2FIRH 3UWIA 1C5MD 4H6SB 1ZPCA 2W7UA 3UUZA 3LU9B 4AG1A 1A0LA 2SFAA 2Z9JA 1CA8B 1FY3A 5L2YH 3RUOA 3RXKA 1XUHA 2P94A 1BDAA 1BMNH 4Q80A 2XXLA 1K1PA 3QGJA 2ZPSA 4J2YB 1L1JA 3MNXA 3UQVA 5L2ZH 2AFQB 4DJZB 3EA7A 5DP9A 3MNBA 2EA3A 5FBIA 1O3IA 2H9EH 2GD4B 1DX5M 1G2MA 1AUTC 4FVBA 1Y3UA 1AE5A 3A82A 1QY6A 3A8BA 2FS8A 1L1NA 4WXIA 1V2JT 1SGFA 1MKXH 1ZMLA 1P02A 1W7GH 2ZPQA 1K9OE 1C1PA 4ESTE 5ETXA 1EAXA 5F8TA 2PUQH 3A7WA 3VB3A 1GDUA 2ZA5A 1WYKA 1GBDA 1K1LA 1QQUA 3PO1B 2F91A 2WPKS 1GGDC 1SGTA 3TGIE 3MTYA 1CGIE 1KYNA 3L33A 1DSTA 1MTVA 1F5KU 1TNHA 4OGXA 1BUIA 3E0PB 3BV9B 5C1XA 1DICA 1HJ9A 2BTCE 1CVWH 1TGCA 5EW1H 2ZP0H 4LXBH 1QTFA 1KLJH 3PLKA 2V6NA 5FAHA 3HK6B 1HPGA 1VR1H 1EXFA 1O33A 1SGCA 1IOEA 2GVFA 2ZPRA 3S9BA 1P2JA 4KTUA 4FUJA 1OXGA 3P17H 1THSH 1S6FA 1YCPM 1UMAH 3QZQA 2CXVA 1WV7H 1O3LA 1BBRK 1V2VT 2AIQA 3M37A 1DLKB 1WBGB 4BNRA 1GMCG 3S9AA 4RKJB 1QR3E 1NROH 1GBEA 1AWHB 1ZYOA 1GBBA 1BRBE 3FP7E 1MBMA 1BT7A 2PKAA 1BTZA 1V2TT 1V2QT 2PUXB 1YPHE 4LK4A 1W2KH 2BLOA 1AFEH 1GMDF 4NA9H 2BB4A 1EOJA 6GCHG 1PQ5A 4A1VA 1F0TA 1O2OA 2XC5A 1W13U 2SNWA 4KGAA 2G8TA 1D9IA 3FP8E 3MFJA 3RC5A 4AGJA 1BQYA 1LQEA 2ZECA 1GJ4H 4IMZA 2HNTF 1C1UH 1CT4E 1EAWA 1SG8B 1N8OB 4F49A 3UTUH 3ZZ7A 1MTUA 2HPQH 1RXPA 2BDCA 2J38A 5DG6A 1HAYB 1AY6H 4B74A 3SNCA 3RC6A 1D3DB 1O32A 4TPIZ 2NU1E 1Z6JH 2BLQA 1Z1JA 2FLRH 3SGAE 1LVBA 1NU9A 3E8LA 2WPHS 4SGAE 1QRZA 1VJAU 2Q1JA 3MMGA 4FXGH 1C5RA 3FFGA 3TJOA 2QCYA 1AHTH 4WH8A 4AN7A 7LPRA 1CGJE 1TA6A 3GYLB 2BDGA 3B8JA 5T6GA 3BTEE 2ZKSA 3ODFA 2VIVA 3ZZAA 2HNTC 2A4QA 4BTUB 3U1JB 2Q6FA 4ZHLU 3OU0A 2AIPA 2FMJA 5E2OA 3UIRA 2B8OH 1S84A 1GG6C 4B1TA 1QNJA 3D62A 8GCHG 1FY5A 2SGEE 1AU8A 2BQ7B 3ODDA 4FUEA 3VB5A 4NFFA 1SOTA 1G3BA 4RN6A 3QN7A 3GY3A 1FV9A 1CT2E 1GCDA 4K1TA 3V7TA 2ZHEH 1KY9A 2SGPE 1A5IA 2QIQA 2STBE 9ESTA 1OOKB 3SJIA 1FJSA 4E7NA 3PMBB 1VGCB 4Y8YA 1J9CH 3GCOA 1HXFH 1G32B 1SHYA 2P59A 4DIHH 1Z7KA 1S0RA 4UE7H 1SGDE 1W12U 1GPZA 5PTPA 3SJ8A 1TB6H 1SB1H 4HGCA 4K8YA 4FUHA 2JETB 1NZQH 2BVRH 1EPTA 1MUEB 1TMTH 2G51A 3HPTB 3TPIZ 3L3TA 1XUJA 4NIXA 1XXFA 2BY6X 2VVVA 1B5GH 5GCHF 1HAPH 3UR9A 5A8ZA 1FY8E 5T6DA 3BIUH 2ZGXH 3TJNA 1VCWA 3AAUA 4X8UH 3ZZ5A 1C1NA 2Y7ZA 2FPZA 3MU5A 2CF8H 3BEIB 1EZQA 3T5FH 1UVSH 1GGDB 1NY22 1PQAA 4OS7A 3ZZCA 2FXRA 1P3CA 1GJAB 1GL0E 3SV8A 1K1OA 1TGSZ 1UCYE 1HBTH 1A5HA 2LNCA 5FXLA 1HNEE 1DSUA 1RFNA 1O5GH 1V2UT 3GYMA 1MKWK 2A7JA 2AERH 1ESAA 1BMLA 4WMFA 1SLXB 2BLWA 5L30H 1PPCE 1LVMA 1C1QA 2BOKA 1HDTH 1ZSKA 1AWFH 1LHFH 3RLYH 4NGAH 1THPB 4I8JA 1OP2A 3GY4A 3P6ZB 3CP7A 1O3HA 1GBLA 1GI1A 1EP6A 1ARCA 3Q77A 1IQNA 1P8VC 3ZZ9A 1HFDA 3F6UH 4Y76A 4YTAA 2PW8H 3NZIA 1UTLM 3GDVA 1SFQB 3EQ0H 2BOHB 1YM0A 2VIOA 3A85A 2PLXA 4CR9A 1T32A 1GHVH 2XNIA 1TPOA 5K0HA 3SNEA 1O3NA 1V2OT 1UCYK 1SGEE 1C2GA 1BMAA 3GDUA 3E6PH 1Y3WA 4BAOB 1GJCB 2EI8A 2FI5E 2VIQA 4YM9A 2P93A 2XWAA 3I29A 3M61U 1DUAA 1QA7A 5L6NH 1CHOF 3ZZDA 2KAIB 2WUCA 1O3PB 1Y5BT 4LOYH 2A0QB 1NPMA 1ETRH 2PTNA 1DITH 5JBBS 5LH8A 4B2CA 3K6ZA 1D4PB 2ZTZA 1GCTC 3A7TA 3M3VA 2A4GA 4KTSA 3BTGE 2XC0A 2NU4E 4YLQH 1ZHRA 2OC1A 6LPRA 1BHXF 5EXMA 1TNJA 2XCFA 1Y3XA 3FP6E 2TGTA 5IYTA 2A45B 3K6YA 4OS4A 2F9BH 2GZ8A 1DY8A 2DUCA 1O2HA 3M7UA 4TY7A 4QT8C 1C5XB 3FZDA 2BX4A 3K9XB 1SMFE 1RJXB 1Q2WA 2AGGX 5JBAS 1O3MA 3SV7A 1J17T 2C8WB 5DGJA 1LPZB 2ZGHA 2F9OA 4GUXA 3GY2A 4ZAEA 4GPGA 3SU6A 2FYQA 5TCAA 1KLIH 3Q76A 2OP9A 4UFGH 3MO6A 2OXSA 1TX8A 3QZRA 3F1SB 1GHAF 1ZJDA 3GY8A 4Y71A 2NWNA 3RXCA 1OKXA 4ISLA 3U69H 3SU0A 4D7GA 3MU8A 2QN5T 1WOFA 2BD9A 5EGMA 2FOCA 3F9EA 1RTLA 1IQFA 1Z8JB 2VGCC 2ZFFH 3EAJA 3D49H 1LVOA 4AFSA 4BOHA 1BBRH 1IQGA 2BY8X 1QL9A 1Z1IA 1T4UH 1E34B 4O9VA 1MTNB 3ZVBA 2GKVE 1GBKA 3VB7A 2FOGA 1BTXA 2H9TH 1P57B 2Z9IA 3DA9B 5JB9S 3BTHE 4BXSA 1IQLA 3OTJE 2H6MA 2XWBI 3QGNB 1ZSLA 4I8LA 4SGBE 5LGOA 2GT7A 5C3NA 2FOHA 2GCHF 2K7XA 2ODPA 1IHSH 4NZQA 4GCHF 1FY4A 4FU9A 3BF6H 2ZU1A 2Z9KA 2STAE 3DFJA 5C5NA 4ZKRU 1C1RA 3GCHB 4CREA 4GAWA 1YPEH 4O3TA 2ZU3A 1UTKA 3KQCA 1GBCA 3BG8A 2RDLA 3U1IB 3UREA 3A83A 4K1EA 4J1YA 1C5SA 4MPWA 4JMYA 1O5CB 1CBWB 5LPFA 1O2XA 3BEFB 5DK1A 5FX6A 2A5IA 4NZLA 4ZH8A 2QC2A 3KQDA 1WAYB 2O8MA 2A31A 3FVFB 3RXEA 1HAGE 2ZDLA 2ZDMA 2D1JA 3V13A 4WJG2 1XUFA 5EPNA 1DUEA 2W3IA 2P3UB 1D6WA 1C2MA 2QY0B 3Q3KA 4FUCA 1ID5H 1GBAA 3VGCC 1VCQA 4BANB 1QB6A 3E91A 1C4U2 2GMTB 1GJ8B 1ZRBA 1S83A 3SU3A 5JBCS 2JH0D 1TAWA 1AE8H 1O35A 3SBKA 1ZZZA 3U98H 3SW2B 2ULLA 3LC5A 3C27B 3QUMP 5A0CA 1Z71A 1EKBB 2WYGA 1AFQC 4WVPE 3LOXA 3FAOA 1FDPA 3NK8A 5GJ4B 3SZNA 2ILNA 1DWBH 1HV7A 5G4BA 3VPKA 1GHYH 5FX5A 2GV7A 2C90B 2VVUA 1GI4A 1P9UA 2R0LA 3A88A 4Y7BA 1O34A 2SGDE 5I46H 1K22H 2GCTC 5JYIA 2ALPA 4IN1A 9LPRA 1AVXA 4E05H 1JOUB 1TPSA 4F4OC 1PYTC 2XW9A 4U01A 5A09A 1BIOA 3RXRA 1EPTC 2AH4X