4YOGA

Hku4-3clpro bound to non-covalent inhibitor 3b
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
total genus 91
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yogA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yogA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yogA02
3ATKA 3SO3A 2BZAA 3U8RH 3KCGH 1ZSJA 1D3QB 4CHAC 1O3KA 3SNEA 3K6YA 1EZQA 3R3GB 2SGAA 1UJ1A 5L2ZH 4Y8ZA 5AVDA 1OWEA 3G01A 1SLUB 1GHYH 3NK8A 2J92A 2D26C 3RMNH 1P06A 2F91A 3RXRA 1LHGH 3BG8A 3RXDA 2H9HA 1UK2A 2WUBA 1K1MA 1O3FA 3W95A 1IHSH 1DANH 3PTNA 3A7WA 3ITIA 1NT1A 1TAWA 1AGJA 3E1XB 4DG4A 2ZPQA 3SNCA 1RXPA 1FAXA 4AX9H 5C67A 2J94A 3FP7E 4VGCC 1CGJE 5A09A 4WWYA 4Y6DA 1DWCH 4INHA 1UO6A 4ZH8A 1ELBA 1BTXA 1HV7A 3DUXH 1V2RT 2Q6FA 1KDQA 2FM2A 1GBIA 1TBZH 5EU8A 2P94A 2UUYA 2HLCA 5L30H 1AKSA 3B8JA 2IJOB 1RTFB 3MWIU 1EAWA 2BY9X 3NUMA 1EJMA 1CO7E 3E6PH 2BXUH 5DP4A 5GCHF 1HAVA 1B7XB 1K28D 1TALA 1EP5A 3U98H 3RXGA 4BAMB 1YP9A 1J15A 3U8OH 4U01A 3ZZ5A 3MNCA 5FXLA 1EASA 3RMOH 1PQ7A 1MTVA 4Z0KA 2C8YB 1MZAA 4H42U 1AVGH 4ISLA 3SGBE 3EAJA 2Z3CA 2ZU2A 3OY6U 3ATLA 1V2LT 2P59A 1MH0A 3MMGA 2BDYA 2VU8E 1T31A 3TGIE 3E16B 4CR9A 7KMEH 3LOXA 1P2OA 3QZQA 1EAXA 2PUXB 2GX4A 1P3CA 1OS8A 2CN0H 1W2KH 1U6QA 1QQUA 3R0FA 2A32A 1YYY1 2OQUA 4K1EA 2J38A 2UWPA 2P93A 1JRSA 4X2VA 1H4WA 2OINA 2PUQH 1MQ6A 4NIXA 5A8YA 1O3JA 1C2LA 4FVDA 4FUDA 4FUHA 1LPGB 5L6NH 1FY3A 1O31A 1GGDB 1RTLA 3GY7A 1CGIE 1KXCA 5FBEA 1D6WA 2ZHWH 3PO1B 1BCUH 2HNTC 1WTHD 3Q3YA 1L1GA 1GBDA 1XVOA 2BD3A 3SHAH 1AFQB 1ZZZA 3Q3KA 1O2JA 3F9EA 2B0FA 4K8YA 1Y3UA 4JZDH 3RXLA 5EXNA 1HIAA 3I29A 1ACBE 1SC8U 4BTIB 1VCPA 2W7SA 1BOQA 1NESE 1DWEH 3UNQA 3UWIA 8GCHG 3I78A 2A5KA 1RTKA 1GJAB 3EQ0H 1AZ8A 4X1QU 2O8MA 1CBWB 2W3IA 3RXOA 2UWLA 3MH6A 3SI3H 1GPZA 4UFGH 3AASA 5DJ7A 1T8LA 2LNCA 3M3SA 2OC8A 2CF9H 1DT2A 1YLCA 1TQ0B 4O03A 1GJ8B 1S84A 1Z6EA 2AFQB 3KHVA 2BD5A 5BRRE 1FNIA 3BG4B 4X2WA 3LU9B 2DUCA 4AFUA 3ZVEA 2HWLB 1SLVB 1O39A 1ZMJA 1V2QT 2QYIA 3RLWH 1V2VT 3MO9A 2AMDA 4B74A 2BDIA 3LKWA 3NKKA 2G55A 3LGYA 1GMCF 1YPGH 7LPRA 3GCOA 3OYPA 4MVNA 3STIA 2IPHA 1ZHPA 3LT3A 3GDUA 4HZHA 1UCYE 4NG9H 1EKBB 3RXSA 4NA8A 1DY9A 1P2QA 1WAYB 3S69A 5GWZA 3ZVAA 3MTYA 5EODA 2ZHQH 2PSXA 1D3PB 1GBFA 3BTTE 2FOBA 1IQFA 3PMHB 5JBBS 4RSPA 1BBRH 3BEFB 3LJJA 1SGRE 4NIWA 1QJ7B 5ABWA 1GDQA 3RC6A 5BPEA 5T3HA 3AAVA 1KXBA 4LOYH 4I8JA 4UEHH 5F8TA 2AMPA 1GJ9B 1C1PA 1TX7A 4I8HA 1YBWA 3PB1E 1MCVA 1C1OA 1ANDA 1IQLA 1UTJA 3T26A 1A3EH 1GGDC 4ZHMU 2TBSA 2FI3E 3FVFB 5JBAS 2QV1A 1K1OA 2HNTE 3ATMA 2WYJA 4NZQA 3TVJB 4KELA 2GDDA 1P2NA 3PO1C 4HTCH 3LC5A 1J16A 1QQ4A 3RXTA 1BUIA 1CT4E 5F6MA 1GMDG 1A4WH 4YTAA 3A7VA 2WV4A 4HFPB 1V2ST 2QIQA 1AFQC 1F7ZA 1C2EA 1XUHA 3QLPH 2GCHG 1G30B 1SGTA 1O36A 1F5KU 4WJG2 2G81E 1GI2A 5I25A 2ZHFH 1VR1H 1XUKA 5B6OA 2BQWB 1RD3B 1YF4A 2VWNA 4CRCA 1PPGE 1UCYK 1FZZA 1DWDH 3ESTA 1FLEE 5JPMH 4WMEA 4IGDA 1GVKB 1ZPBA 1CBWC 1MQ5A 2PKAA 1FN6A 5GJ4B 1E38B 4ABEA 2SGDE 1TNJA 2FX4A 5EW2H 1RIWB 1CHOG 1ELAA 3QTOH 3RM2H 5FBIA 1GG6B 3UUZA 1IHTH 1YPHC 3A8AA 1C5XB 3RMLH 2TRMA 4JZEH 1NRQH 1ZTJA 1MD8A 1YCPK 4Q7ZA 1LO6A 1J17T 3BG4C 3CS0A 1B5GH 1MTUA 1Y3XA 2YNBA 1GHVH 1W8BH 2W26A 1XXFA 1LVYA 2B5TB 3BTKE 1BTYA 3SV8A 3RP2A 1BTZA 1JRTA 4FUJA 2QF0A 2J34A 2BQ6B 3P8NA 3L33A 1O5DH 2IN2A 1O5GH 2Y5HA 1GHXH 3TK5A 2ZCLP 1W10U 2HRVA 4A1TA 1O3LA 1BQYA 1HCGA 1W7GH 1SFQB 4YLUA 2GT7A 1MCTA 3T2NA 1BMMH 2BVSH 3NCLA 4BAHB 1P2JA 1TGCA 4X1RU 5FCRA 1BRCE 4IMQA 1HJ8A 4NSYA 1LHDH 2UUJB 3SUDA 1CA8B 4LZ4B 1EJNA 2H5CA 2RDLA 8LPRA 3V0XA 1XM1A 1AD8H 3Q3XA 1Y3WA 2P95A 3ZZ6A 1C2JA 4Y76A 1G9IE 1UTQA 1TRYA 2HVXA 3A8CA 2V35A 1LPZB 1SGQE 1C5ZB 2V0BA 1LHEH 1AUTC 1Y5AT 1O2ZA 5EQQA 3QZRA 4FUIA 2OBOA 1UK4A 2Z9IA 6GCHF 5C3NA 2P16A 2PV9B 3URCA 3QN7A 1CSOE 2H9EH 1UTMA 3SGAE 2TGPZ 1GJBB 1P01A 1C5SA 3KGPA 2XYAA 1ANCA 1TOCB 3SUGA 1AVXA 5K0HA 2ZU4A 2B9LA 2ZNKH 3RXHA 1HNEE 2G52A 4FUCA 1EPTB 1RS0A 5DP9A 5C1XA 4JZ1A 1UTLM 2A1DB 1AVWA 1IQMA 4ZROA 2Z9KA 1FDPA 2F9UA 1MAYA 3E8LA 1HAPH 2HGTH 2XNIA 1WTGH 1SQTA 5A0CA 3LIWA 4AG2A 4LK4A 1A2CH 2AEIH 2AS9A 4X1SU 3DD2H 5G4BA 3ZVDA 1FMGA 4MNVA 1IQKA 2BY5X 1BJUA 1CA0B 1DLEA 1THRH 4XDEA 2Z94A 1ELGA 2ODPA 1RIWC 1YPHE 2PTNA 5EQRA 1K9OE 3A7ZA 4JK6A 2BD7A 2BD9A 5JBCS 1J8AA 3A80A 1N8OB 2EA3A 2FOAA 1GG6C 3RDZA 1ARCA 1JXPA 1FV9A 4FUBA 2ZCKP 4AFZA 1SGFG 2CMYA 1S81A 2C4FH 5FAHA 1PPCE 1SI5H 2VB0A 2ZECA 2K7XA 3HKIB 5GPIB 3VB3A 1YM0A 2OC1A 1LVBA 1NRRH 1O32A 4E7RG 4R8TB 2O8TA 4IN1A 2WYGA 4CBNA 1BMAA 1FI8A 1DVAH 3BV9B 1ZLRA 1TNGA 4DJZB 4I8GA 4BTUB 1F5RA 4BTTB 1W3CA 3RLYH 4BANB 5JB8S 1EXFA 1AWFH 4MPXA 1BMNH 3BTHE 3MOCA 3K65B 2PTCE 2EEKA 1UVOA 3UNSA 4TY6A 2CGAA 3TJNA 3TU7H 1C1RA 1DUAA 3GY8A 1QCPA 2FYRA 1AUJA 1TWXB 3PMAB 2ZU5A 4DT7B 5E0GA 1LTOA 4NA7A 1QHRB 5PTPA 1TABE 2ULLA 2ZHDA 4Y79A 1Z7KA 1AWHB 1ESAA 4ZMAH 4KTSA 3LH3A 1Y59T 4TYDA 3STJA 3ZYDA 2Z6BD 2AGGX 1C9PA 1GBBA 1LHFH 1EATA 1H9IE 2TGDA 2ZFRH 3C1KA 4RKOB 4U2WA 5JDUB 2RCEA 1KXDA 3MFJA 2V3OH 3L3TA 2JH5D 1TNIA 3HKJB 3SBKA 1O0DH 4D9RA 2AYWA 4NZLA 1AY6H 1WSSH 2NU0E 1UHBB 1E36B 3OY5U 1G3EA 1C4V2 1EPTC 4B1TA 1BZXE 2BDCA 1T8OA 4B2AA 4FUEA 2PHBA 1GJ5H 2B7DH 3RXQA 4YM9A 1EOLA 1Z8RA 1OX1A 5JBTA 2PGQB 1JIMA 2VWMA 4B2CA 2A2XH 1Q2WA 1O30A 7GCHG 2ZGXH 2BX4A 2FLRH 4B76A 1E34B 1FONA 3RXCA 2D8WA 3D23A 1OWKA 2PKSB 3GY3A 4YT6H 1CA0C 1TPAE 4HGCA 4ZXXH 1GI8B 1SHHB 3OX7U 1DICA 4X6NA 2BZ6H 2JETB 4GCHF 1O34A 2ZO3H 4BAQB 1GL1A 1N8OC 2RA3A 1P57B 3A87A 4RKJB 1CQQA 5H4IB 1F0UA 2BHGA 3MYWA 1O3CA 5JYIA 3UWJH 4Z6AH 4WF8A 4A92A 1OP8A 2FPZA 1TNLA 1O2UA 4WH6A 1O5BB 4YOJA 1A1RA 3DFJA 2CJIA 1EQ9A 5HYOA 1YC0A 1SLWB 1GI6A 4AYYB 1AN1E 4CH2B 1GHBF 3RU4D 2GKVE 2FODA 5CHAB 4UFEH 1C5OH 3FFGA 3QUMP 4ESTE 1KLJH 1V2UT 2G00A 3MU5A 1K22H 3T5FH 2EI6A 4TPIZ 1NC6A 5ESTE 1BITA 1GI7B 1Y3VA 3HGPA 1S0RA 2ZGCA 3UQVA 1ANEA 5LPEA 3GICB 1WOFA 3LPRA 1RFNA 3RXJA 1P09A 3EA8A 1VITG 1TOMH 2BDAA 2Z7FE 2ZFTA 2WPMS 1HJAB 3H5CB 4XOJA 1ZTKA 3DT0H 1VCQA 1ZTLA 4BAKB 4YLQH 2Q6GA 5ETXA 2OCVB 1W0YH 4AB8A 4WY3A 4XBDA 2QC2A 4NFFA 1Z8IB 1T32A 1D3TB 1WYKA 2JH0D 5DP7A 2GD4B 3MNSA 2R3YA 4IS5A 3S9CA 1QTFA 2WPHS 2BLWA 3UPEA 3A7TA 2C8XB 1Z8JB 3MU1A 2OP9A 3O8CA 3TGJE 1PPZA 3L6PA 3M7UA 3UQOA 4IC6A 1P05A 4ZUHA 2A5AA 1VGCB 1SQAA 3PLBA 3EE0B 1O3IA 2BDGA 1QIXB 2A4OA 1OYQA 3LONA 2OC0A 2C8ZB 2AIPA 2F9PA 1O5CB 4AOQA 3JZ2B 1G37A 2Z9LA 2CV3A 1QL8A 4GPGA 4B73A 2BLVA 1YGCH 1ZOMA 2AH4X 3SU2A 2YNAA 1NFYA 3LGUA 1O2WA 2ANWA 4UONA 3GCTF 2PLXA 1S6HA 3RXIA 1FIWA 1O2GH 2A7HA 2ZPSA 1YPLH 4OS1A 4GHQA 3SZNA 1D9IA 1WQVH 3TK6A 2PKSC 2C8WB 2Q1JA 2Y82A 1F5LA 3SJ8A 1C4U2 4JK5A 1L1JA 2CHAC 1KIGH 5F8XA 3PM3A 1V2WT 1MMJN 2JETC 2PWXA 1J9CH 4KTCA 1V2KT 2TGTA 4MPWA 2GDEH 4IN2A 1NU9A 2PR3A 2GV6A 2BLOA 2PSYA 2Y7XA 3UR9A 3MO3A 2GTBA 5A8ZA 1W7XH 1CVWH 2R0LA 1ARBA 3NPSA 2ZTYA 1CE5A 2VVCA 1EX3A 1G2MA 1RRKA 5CHAC 2O8WA 4ABHA 1PYTD 3SJ9A 1F0TA 1UTKA 2G51A 1C5NH 1MTWA 3OTJE 5HGGA 1Q3XA 1GMHG 1TYNA 3SW2B 1O2QA 1V2NT 2BLQA 3LGVA 3UNRA 4ZKNU 1WV7H 2BY8X 1UTNA 1TGNA 1G3CA 2VVVA 2Y6TA 2VNTA 1MD7A 1QRZA 2EI8A 2HPPH 1MBMA 3S7HB 2ZF0H 1BTWA 4AGJA 1LKBA 4K5ZA 1NN6A 1S83A 1HJAC 1S6FA 5J4SA 1GI3A 1TPOA 1MKXH 4A1VA 1UK3A 3UR6A 4ABDA 1C2MA 3KQDA 1ZMNA 1SBWA 3HPTB 3T29A 1TPSA 1P2MA 3QTVH 4UD9H 5J4QA 1AMHA 4X8UH 4ASHA 3E90B 1ORFA 2ANMH 1FY8E 1OWHA 1P2KA 4AYVB 2K1QA 1SGEE 1GI0A 1FJSA 1SB1H 2WPLS 5AHGH 2STBE 4NGAH 4DVAU 1TX6A 3S9BA 1SGCA 4JMYA 3BTDE 1O2HA 3SU4A 4MLFB 3RXFA 2NU3E 2RA0A 1VGCC 4GUXA 1ZGIA 3K2UA 1HAHH 1O3BA 3SU1A 1D6RA 1W12U 2TIOA 1Z8GA 4FU9A 5E2OA 1BRAA 2ALPA 3BEUA 3ZZCA 2W5EA 4DIIH 1XKAC 2DE8A 4X8VH 7ESTE 1ZR0A 2UUFB 4D76A 2FOMB 5E2PA 2VGCB 3UOUA 1L0ZA 4X6MA 4DURA 1OP0A 3SV6A 1QJ6B 1VCWA 4E05H 2AIQA 3WY8A 3A8DA 1A3BH 9LPRA 1BHXF 1SFIA 1DX5M 1HB0B 3SU0A 3KQCA 1GL0E 2ODQA 1AI8H 1HXFH 1TGTA 2Q6DA 8ESTE 1BB0B 1HAOH 5T6DA 1KTTB 1PQ5A 1C1VH 1FPHH 1H1BA 1NU7B 2XBXA 2NWNA 3ZZAA 1SL3A 1NRPH 1H9HE 3E3TA 2FWWA 1AHTH 1JOUB 1MTSA 1BTUA 3ZZ3A 4SGAE 2BVRH 5C5OA 1F0SA 1YLDA 4JYUH 1O5EH 1KXFA 3HATH 3V13A 3A81A 4JCNA 1D4PB 1XUJA 2GVFA 2OQ5A 4J2YB 1NZQH 3TH2H 3RUOA 1ZHRA 1W0ZU 1GCTB 3M5MA 2M5TA 4X6OA 3VB5A 5IYTA 3QGNB 1O2RA 2FOEA 2ESTE 1T4VH 1N1LA 1EPTA 1DS2E 3TITA 1GBHA 3VEQB 5JB9S 1HXEH 1HLTH 1TNKA 1G32B 2ZDLA 4ZKSU 1A46H 1K1IA 5EGMA 1QL9A 5DP5A 4Y0ZE 1BA8B 2O9QA 3GYLB 1TA6A 1BTPA 4OS5A 1BBRE 2CF8H 3PROA 1H9LB 4K2YA 1TONA 2H5DA 1O5AB 2ZDAH 1E35B 3TLOA 4KTUA 1GJCB 1ZPCA 3Q00A 2FO9A 1OWDA 1ZGVA 2P8OB 4FUFA 4UDWH 3RXBA 4MNYA 1S85A 4ISIH 5ESBA 5DP6A 2GZ8A 2VIVA 1HAYB 4TWYA 4XBCA 3O8DA 4IW4E 1GJ6A 2XW9A 2ZFPH 8GCHF 5EW1H 1GI5A 2A7CA 3Q77A 4M7GA 1KYNA 1SR5C 3S7KB 3MH7A 1DPOA 1W13U 2XBWA 3OSYA 4NSVA 1SHYA 2XRCA 4JZIA 3M36A 4D8NA 2Z9GA 3M35A 3VPKA 4K69A 2ILNA 4U32A 4CRBA 1QNJA 3SJKA 1NPMA 1BDAA 2F9BH 1GHWH 5FPTA 2VH0A 1CGHA 3F68H 3F9FA 1GBTA 1MKWH 1A5IA 2ZZUH 2VGCC 2OBQA 1O5FH 2FS8A 2HPQH 1TRMA 1GHAG 1ZHMA 4A1XA 2W3KA 1DXWA 2G5NA 4AFSA 1FXYA 4AN7A 2H2ZA 4I8KA 5I46H 1O2LA 1NRSH 2ZCHP 2A0QB 3PMBB 1C2GA 3ZVGA 1BBRK 1O37A 3BTFE 3GYMA 4KP0A 4E06H 1DLKB 1CT0E 2FS9A 3HK3B 1XUIA 3H7TA 1UVUH 1WUNH 3KN2A 1FUJA 1BIOA 4GAWA 1C5RA 3BF6H 1IQJA 1C5QA 1C5YB 5F03A 2Z3EA 1GI1A 1Y8TA 1K1PA 2VWOA 3A7XA 2ZDNA 5TCAA 2BD4A 4Y11E 4GCHG 1GDUA 1EP6A 3BSQA 4ISHH 1GCTC 1SGFA 4Y7AA 3ZVFA 1O2YA 1O2SA 3ODDA 1UHBA 1GCDA 2A2QH 3RXUA 4FU7A 1JMOH 4IMZA 1SVPA 4Y71A 1NFXA 4FVBA 4ZKOU 3ENSB 4GVUA 1A0JA 1YCPM 2ANKH 5EPNA 3BEIB 3UREA 4CRFA 1JBUH 2QXHA 2R9PA 3GOVB 1KSNA 3MO6A 4WVPE 1GMDF 1SMFE 1Y5UT 2QCYA 2THFB 3PWCA 1QJ1B 2Y81A 1C1UH 2J2UA 3M5LA 4DGJA 1KLTA 1YPKH 1TIOA 2BM2A 3U1JB 2J9NA 1XUGA 3F9GA 2P8OC 2ZPRA 3A83A 1ETSH 2F3CE 2FI5E 2GT8A 4AFQA 2P3UB 4IC5A 2R2WU 1C1MA 1ETTH 2OXSA 2FXRA 1K2I1 1X7AC 2VIPA 5C20A 4ABFA 1C5MD 1QR3E 3GISB 1GI4A 2SGQE 3S9AA 2Y5FA 3TIUA 1MU6B 1FQ3A 1PQ8A 3H7OA 4H4FA 3EBNA 1O2IA 1VZQH 1NFWA 2QXGA 5C2ZA 5GCHG 2A45B 3RXKA 2C93B 2FMJA 2ZEBA 1EJAA 3PWBA 1QBOA 4H6SB 4ABBA 2VH6A 2ZGBH 3V12A 4A5TS 5C1YA 2JKHA 1LVMA 3B9FH 1QBVH 2BVXH 2A4QA 1P0SH 1TE0A 4TWWA 3KQBA 1XXDA 1ZPZA 1C2HA 1B0FA 4YESB 3UFAA 1YPMH 2XXLA 3MNXA 2SGEE 4ZKRU 2ZFFH 3OU0A 3CENA 2ALVA 9ESTA 2BY6X 1TRNA 1DFPA 1GBEA 1ID5H 1S0QA 2ZI2H 4XFQA 3A82A 4FXGH 5LPFA 4ABGA 2VIWA 1C1WH 1GDNA 3AW1A 3TH4H 3LGIA 2BTCE 5GDSH 4E7NA 1E0FD 2BXTH 2F9NA 2RG3A 2ZA5A 4AGKA 2Y7ZA 1PQAA 1DOJA 1LQEA 3DHKH 4KGAA 2WUCA 3FP8E 4A6LA 3EGKH 1TMUH 4MNXA 1TGBA 3HK6B 1UVPA 1VJ9U 1GVLA 1O3PB 1FAKH 1W11U 4WMDA 4CREA 3VXFH 1HPGA 1LKAA 2FOFA 1GWAA 3RM0H 1UTOA 2D2DA 2CHAB 3BTGE 3GDSA 3U8TH 4Y8YA 1DSTA 1MAXA 2ZIQH 4F4OC 1O38A 3TNSA 3PTBA 4GSOA 1S82A 1C5UA 1AIXH 1IAUA 5DO4H 4Y10E 2GGVB 5LPRA 1Y3YA 1HJ9A 2Z9JA 1HAXB 1GBKA 1AU8A 3BTQE 3SU5A 5GIBA 3SUEA 2O8LA 2NU4E 4X8TH 1P9SA 1NROH 4AG1A 3SV9A 2XC5A 2GCTC 4ABIA 3T62A 4D9QA 3Q76A 1AZZA 3I77A 1EAIA 1C2KA 4BXSA 1ZRBA 1C1QA 3RC4A 3O8RA 4K1TA 2ZGJA 1NM6A 2XCNA 3RU4T 1TGSZ 1GBJA 3FP6E 1O3HA 1ELCA 1H8DH 5IDKA 1ZSLA 1AQ7A 3LC3A 1L4ZA 1RGQA 4OS7A 3SNBA 1O3NA 1IOEA 3BTEE 1ABJH 2BD2A 1GMCG 4IBLH 2AERH 4BNRA 1GBAA 1FY5A 1WU1A 1SPJA 4X2XA 3SV2H 1P9UA 1IQNA 2VIQA 2YOLA 3V7TA 1PFXC 2BDBA 2A4GA 1DITH 5HXFA 4YOIA 1BRUP 3RXVA 3K9XB 3ZV9A 1C2IA 2QN5T 1K1JA 2BMGB 1THSH 1PPHE 3EYDA 4A7IB 1O2VA 2ZGHA 4NIYA 4ISNA 2FTLE 4DW2U 2A7JA 2HALA 1SOTA 3AVZA 1LHCH 1WQSA 1V2TT 3UY9A 3FANA 5A0BA 5EQSA 4O3TA 4GHTA 1CT2E 1EOJA 3NZIA 4U30A 2ZG0H 3SGQE 1G2LA 4MNWA 2C3SA 3GCHB 1A0HB 1K21H 3M61U 1ELFA 1O2OA 4TPYA 3VFEA 3TK9A 3ODFA 1O2TA 1RJXB 3ZZDA 2EC9H 4TY7A 2XC0A 2QGRA 2HNTF 1OYTH 4YOGA 1G36A 1GJ4H 1GHZA 2KAIB 2ZTXA 2F9OA 3P6ZB 1XMNB 2FTMA 2A4RA 1SG8B 2QXIA 1QGFA 4I33A 1QA7A 3ZVBA 1BRBE 1DDJA 2R0KA 3SOSA 4DY7B 1XX9A 4RN6A 2LPRA 1V3XA 3E0NB 4K1SA 1ETRH 1UVTH 2SNWA 5FCKA 3KIDU 3TJUA 4YO9A 1G3DA 1N6YA 1OOKB 1O3MA 1QRXA 1LPKB 3LJOA 5EOKA 1OWJA 1UTPA 2A31A 5DGJA 3U1IB 3QK1A 4XE4A 1P8VC 3M3VA 2FOCA 3MNBA 4AZ2B 2ANYA 1C5VA 4HI3A 2H9TH 4I32A 1P2IA 4INKA 5HMAA 2A5IA 3SORA 3GY5A 2BYAX 2AMQA 2CXVA 4J1YA 5A8XA 3P95A 5A2MH 7GCHF 2ZQ2A 5DK1A 1L4DA 5FX6A 2D1JA 1Z71A 1O2KA 4D7FA 1KLIH 1QA0A 5FX5A 2GV7A 2XC4A 1UCYH 2BOKA 3CS7A 1HUTH 3A89A 5T6GA 4WXVA 3VXEH 6ESTA 3RXAA 1OWIA 1BHXB 2SGFE 1O2NA 1TLDA 2ZFSA 2NU1E 5EXLA 3KF2A 4CH8B 1KDQB 2Y5GA 3ZV8A 1ZMLA 1VJAU 4NWKA 2FI4E 3GY2A 2W7UA 1AKSB 2PFEA 1FN8A 2OTVA 1QBNA 4X6PA 5DP3A 3KNXA 1HBTH 1XVMA 1HAVB 2ZDKA 4X0WU 1YCPH 1GJDB 3KQEA 2VINA 1SGDE 3RMMH 1ZYOA 3ZZ8A 3TJVA 1FY1A 1EAUA 1A61H 1JWTA 1FY4A 1GVZA 3BIUH 4Y7BA 4CRGA 1OP2A 2SGPE 4ZAEA 1PPEE 4Y8XA 4NWLA 1O2PA 2FLBH 1NS3A 3MU8A 4QT8C 4WH8A 5CE1A 1VITF 3EA9A 1P04A 4B75A 1XKBC 3GCHC 1HAIH 1L2EA 2GMTB 2Z3DA 2QAAA 6GCHG 3VB7A 5TCCA 4DOQA 3FZDA 2ZC9H 1SOZA 5DPAA 3P92A 4ZXYH 3VGCB 3M7QA 2PGBB 4MG3A 4AORA 1TBRH 4B71A 2V6NA 2UWOA 1NTPA 1ESBA 1O3AA 2DE9A 2FYQA 5GXPA 1NFUA 2BB4A 3P17H 3PLKA 1L1NA 1C5LH 2BD8A 1EZXC 2F83A 4DIHH 1OSSA 2ZQ1A 3P8FA 1HFDA 1WBGB 3PV4A 1TA2A 3W94A 1C2DA 2ASUB 5E0HA 1P11E 2VJ1A 1TFXA 3UOPA 1HYLA 4K3JA 1IQIA 2J95A 1ELDE 1HAGE 1T8MA 3ELAH 5LGOA 4K60A 3A85A 1HIAB 1SSXA 3MH5A 2QA9E 1QB9A 1C5WB 1MTNB 5EXMA 2ZTZA 3GY4A 1ESTA 4XBBA 1NY22 4X8SH 1DWBH 1PPBH 2I6SA 2FEQH 1JIRA 4NCYA 3RXEA 2NU2E 1SGYE 1SGIB 3RC5A 1TNHA 4JYTA 1QURH 3M5NA 1THPB 4MQAA 5AFZH 4X2YA 3GY6A 1P02A 3TNTA 3O8BA 2BQ7B 3SNDA 1C5TA 2OUAA 2OC7A 1VITH 2I6QA 4MTBA 3UTUH 1ZSKA 1SQOA 1Y5BT 1INCA 3A8BA 3TGKE 2XWAA 2ZKSA 5DP8A 4F49A 1YPJH 4OS2A 3M3TA 3NXPA 1TQ7B 1Z1IA 4Q7YA 3A84A 5DG6A 2LIZA 3T28A 4MPUA 5A0AE 3ZZ4A 2J4IA 1MBQA 2HOBA 1LDTT 2R3UA 1DY8A 1GJ7B 1MKXK 3BIVH 2H1UA 5FHTA 1UMAH 4MPVA 1GI9B 1GBLA 1GMHF 1AE8H 4ISOA 3BN9A 2UUKB 1LMWB 2G4UA 3TH3H 3KEEA 1ELEE 3SUFA 4FUGA 1C5PA 1QY6A 4JZFH 3SI4H 1TB6H 1B0EA 1C1NA 4O9VA 1CHGA 1N6XA 2G8TA 1C2FA 3F6UH 1YPEH 1QB6A 4X1NU 3A86A 3TJOA 4AB9A 2FZZA 4OGYA 8KME2 4ABJA 5HM2A 2WPKS 1PPFE 1GBCA 2GMTC 5F8ZA 3HGNA 3NWUA 1V2PT 2VIDA 4K8BA 3LH1A 4CR5A 1O2XA 4H6TA 1DE7H 2XWBI 4X1PU 1KTSB 4O3UA 3VGCC 4R0IA 5K7RA 4Y0YE 3ZZ9A 4BXWA 1KY9A 1ABIH 1C4Y2 3SV7A 1BT7A 1T4UH 2EI7A 2QXJA 2FDAA 3AAUA 1OXGA 3EA7A 4UE7H 5SGAE 3RXMA 2Y80A 2ZU3A 1H8IH 3AW0A 2FX6A 2FOHA 2BDHA 3ZVCA 2G4TA 1ELTA 1O3OA 3U9AH 4CRAA 1F92A 3E91A 3DFLA 1W14U 3MH4A 5TJXA 3D65E 1TPPA 1IQGA 1O3EA 1DUEA 6CHAB 2IOTA 3K6ZA 3QGJA 3PYHA 2AGIX 2FESH 1Q31A 3VB6A 1UVSH 1BMLA 3E0PB 1GBMA 3QO6A 3TPIZ 3SJIA 3MHWU 5C1UA 4WXIA 4LXBH 2ODYB 1V2MT 1IQEA 2ZWLH 1A0LA 1K1LA 4OGXA 3T27A 6LPRA 1AO5A 3QX5H 1J14A 1MTNC 2XBYA 1AB9B 5CMXH 1P12E 1QFKH 1V2JT 1Z1JA 5L2YH 3M37A 1P03A 1TX8A 1O3DA 3LDXH 2ZP0H 3P70B 3D62A 1FIZA 3MI4A 3P8OA 2PKAB 4B2BA 2BX3A 3ATWA 1KXAA 3BTME 3LGTA 3FZZA 3GCNA 2B8OH 3CP7A 4I31A 1BTHH 3GDVA 1HDTH 1GHBG 5FPYA 1BJVA 3RXPA 2ZHEH 2R2MB 2VWLA 4ZHLU 4LZ1H 3SU3A 1EB2A 3EDXB 4Q2KA 1AE5A 2H6MA 3SHCH 3SQHE 2ZDMA 2GCHF 2TPIZ 4MDSA 1HGTH 4UFFH 5E8EH 1A7SA 1EZUC 3IG6B 2GZ9A 2O8UA 4CHAB 3IWMA 3SU6A 4GLYA 2GZ7A 5C5NA 2XBVA 1C1TA 4OS4A 1T8NA 2GCTB 4ZHAA 1F0RA 2TGAA 5AFYH 2ZDVH 4SGBE 2WPJS 1EB1H 1ZJDA 3M5OA 4ABAA 1AFEH 5DKMA 3A7YA 1DSUA 3ZYEA 1A5HA 3V3MA 2XTTB 2SFAA 3PMJA 4XSKU 3T25A 4BOHA 4I7YH 3ZZBA 1S5SA 3B23B 3UIRA 2FP7B 1FPCH 1CHOF 1O3GA 3A88A 1PJPA 4YT7H 1NO9H 1SLXB 1TBQH 4I8LA 3RU4E 2OD3B 1F2SE 1IQHA 4INLA 1KXEA 1MZDA 1T7CA 4WMFA 1Z6JH 2G5VA 4O97A 1QRWA 2V3HH 1E37B 4VGCB 1PYTC 4D7GA 3U69H 5AF9H 3DA9B 1SGNE 3QDZB 2WINI 1MKWK 3SQEE 1K1NA 3SJOA 1OPHB 4UFDH 1O2MA 4THNH 1QL7A 3SN8A 2GP9B 2VIOA 3MU4A 1DXPA 1ANBA 2WV5A 1LVOA 2BY7X 4OS6A 3ATIA 1P3EA 3GCTG 1EZSC 2P3TB 3F1SB 2SNVA 2XCFA 1NRNH 3P8GA 4FU8A 6CHAC 1MU8B 4Q80A 1C9TA 1DM4B 4YZUA 4NFEA 1YKTA 2FOGA 3JZ1B 1QB1A 1OKXA 2AGEX 2QF3A 1CU1A 5EPYA 2QY0B 1GHAF 1ZJKA 1D3DB 1EUFA 5E0JA 3S0NA 5T6FA 3ZZ7A 1XUFA 3BTWE 1AB9C 3M7TA 2ZU1A 1V2OT 1TMBH 2P3FH 3PLPA 4KKDA 2C90B 2JH6D 5FPSA 1MUEB 4JYVH 3LGWA 1LCYA 2PW8H 2WPIS 2ZFQH 1O35A 3KL6A 4PROA 4Q7XA 1C1SA 5LH8A 1V6DA 3MU0A 1O33A 2FIRH 4CRDA 1M9UA 1LQDB 4NA9H 3C27B 1ELVA 2KAIA 5EG4A 4CBOA 1G3BA 2BOHB 3D49H 1HRTH 4NIVA 2F9VA 3QWCH 2VVUA 1SGPE 2OLGA 2STAE 4DCDA 1P10A 1WCZA 3FAOA 3IITA 3F9HA 1HAZB 4BAOB 5HM9A 1ZRKA 1A5GH 3URDA 3SNAA 3N7OA 3VB4A 1TMTH
chains in the Genus database with same CATH superfamily
3ATKA 3SO3A 4Z1MD 2BZAA 3U8RH 3KCGH 1ZSJA 1D3QB 4CHAC 1O3KA 3SNEA 3K6YA 1EZQA 3R3GB 2SGAA 1UJ1A 5L2ZH 4Y8ZA 1OHHD 5AVDA 1OWEA 3G01A 1SLUB 1GHYH 3NK8A 2J92A 2D26C 3RMNH 1P06A 2F91A 3RXRA 1LHGH 3BG8A 2K0QA 3KYFA 3RXDA 2H9HA 1UK2A 2WUBA 1K1MA 1O3FA 3W95A 1IHSH 1DANH 3PTNA 3A7WA 3ITIA 1NT1A 2W6ID 1TAWA 1AGJA 3E1XB 4DG4A 2ZPQA 3SNCA 1RXPA 1FAXA 4AX9H 5C67A 2J94A 3FP7E 4VGCC 1CGJE 5A09A 4WWYA 4Y6DA 1DWCH 4INHA 1UO6A 4ZH8A 1ELBA 1BTXA 1HV7A 3DUXH 1V2RT 2Q6FA 1KDQA 1COWD 2FM2A 1GBIA 1TBZH 5EU8A 2P94A 2UUYA 2HLCA 5L30H 1AKSA 3B8JA 2IJOB 1RTFB 3MWIU 1EAWA 2BY9X 3NUMA 1EJMA 1E79D 1CO7E 3E6PH 2BXUH 5DP4A 5GCHF 1HAVA 1B7XB 1K28D 1TALA 1EP5A 3U98H 3RXGA 4BAMB 1YP9A 1J15A 3U8OH 4U01A 3ZZ5A 1YWUA 3MNCA 5FXLA 1EASA 3RMOH 5KEDA 4AC9A 1PQ7A 1MTVA 4Z0KA 2C8YB 1MZAA 4H42U 1AVGH 4ISLA 3SGBE 3EAJA 2Z3CA 2ZU2A 3OY6U 3ATLA 1V2LT 2P59A 1MH0A 3MMGA 2BDYA 2VU8E 1T31A 3TGIE 3E16B 4CR9A 7KMEH 3LOXA 1P2OA 2KFWA 1EAXA 3QZQA 2PUXB 2GX4A 1P3CA 1OS8A 2GJGA 2CN0H 1W2KH 1U6QA 1QQUA 3R0FA 2A32A 1YYY1 2OQUA 4K1EA 2J38A 2UWPA 2P93A 1JRSA 4X2VA 1H4WA 2OINA 3OEHD 2PUQH 1MQ6A 4NIXA 5A8YA 1O3JA 1C2LA 4FVDA 1K0HA 4FUDA 4FUHA 1LPGB 5L6NH 1FY3A 1O31A 1GGDB 1RTLA 3GY7A 1CGIE 3KQ5A 1KXCA 2LELA 5FBEA 1D6WA 2ZHWH 3PO1B 1BCUH 2HNTC 1WTHD 3Q3YA 1L1GA 1GBDA 1XVOA 2BD3A 3SHAH 1AFQB 1ZZZA 3Q3KA 2OK5A 1O2JA 3F9EA 2B0FA 4K8YA 1Y3UA 4JZDH 3RXLA 5EXNA 1HIAA 3I29A 1ACBE 1SC8U 4BTIB 1VCPA 2W7SA 1BOQA 4FETA 1NESE 1DWEH 3UNQA 3UWIA 8GCHG 3I78A 2A5KA 1RTKA 1GJAB 3EQ0H 1AZ8A 4X1QU 2O8MA 1CBWB 2W3IA 3RXOA 2UWLA 3MH6A 3SI3H 1GPZA 4UFGH 3AASA 5DJ7A 1T8LA 2LNCA 3M3SA 2OC8A 2CF9H 1DT2A 1YLCA 1TQ0B 4O03A 1GJ8B 1S84A 1Z6EA 2AFQB 3KHVA 2BD5A 5BRRE 1FNIA 3BG4B 4X2WA 3LU9B 2DUCA 4AFUA 3ZVEA 2HWLB 1SLVB 1O39A 1ZMJA 1V2QT 2QYIA 3RLWH 1V2VT 3MO9A 2AMDA 4B74A 2BDIA 3LKWA 3NKKA 2G55A 3LGYA 1GMCF 1YPGH 7LPRA 3GCOA 3OYPA 4MVNA 3STIA 2IPHA 1ZHPA 3LT3A 3GDUA 3W1EA 4HZHA 1UCYE 4NG9H 1EKBB 3RXSA 4NA8A 1DY9A 1P2QA 1WAYB 3S69A 5GWZA 3ZVAA 3MTYA 5EODA 2ZHQH 2PSXA 1D3PB 1GBFA 3BTTE 2J5UA 2FOBA 1IQFA 3PMHB 5JBBS 4RSPA 5IK2D 1BBRH 3BEFB 3LJJA 1SGRE 4NIWA 1QJ7B 5ABWA 1GDQA 3RC6A 5BPEA 5T3HA 3AAVA 1KXBA 4LOYH 4I8JA 4UEHH 5F8TA 2AMPA 1GJ9B 1C1PA 1TX7A 4I8HA 1YBWA 3PB1E 1MCVA 1C1OA 1ANDA 1IQLA 1UTJA 3T26A 1A3EH 1GGDC 4ZHMU 2TBSA 2FI3E 3FVFB 5JBAS 2QV1A 1K1OA 2HNTE 3ATMA 2WYJA 3N7EA 4NZQA 3TVJB 4KELA 2GDDA 1P2NA 3PO1C 4HTCH 3LC5A 1J16A 1QQ4A 3RXTA 1BUIA 1CT4E 5F6MA 1GMDG 1A4WH 4YTAA 3A7VA 2WV4A 4HFPB 1V2ST 2QIQA 1AFQC 1F7ZA 1C2EA 1XUHA 3QLPH 2GCHG 1G30B 1SGTA 1O36A 1F5KU 4WJG2 2G81E 1GI2A 5I25A 2ZHFH 1VR1H 1XUKA 5B6OA 2BQWB 1RD3B 1YF4A 2VWNA 4CRCA 1PPGE 1UCYK 1FZZA 1DWDH 3ESTA 1FLEE 5JPMH 4WMEA 4IGDA 1GVKB 1ZPBA 1CBWC 1MQ5A 2PKAA 1FN6A 5GJ4B 1E38B 4ABEA 2SGDE 1TNJA 2FX4A 5EW2H 1RIWB 1CHOG 1ELAA 1E1RD 3QTOH 3RM2H 5FBIA 1GG6B 3UUZA 1IHTH 1YPHC 3A8AA 1C5XB 3RMLH 2TRMA 4JZEH 1NRQH 1ZTJA 1MD8A 1YCPK 4Q7ZA 1LO6A 1J17T 3BG4C 3CS0A 1B5GH 1MTUA 1Y3XA 2YNBA 1GHVH 1W8BH 4ASUD 2W26A 1XXFA 1LVYA 2B5TB 3BTKE 1BTYA 3SV8A 3RP2A 1BTZA 1JRTA 4FUJA 2QF0A 2J34A 2BQ6B 2J98B 3P8NA 3L33A 1O5DH 2IN2A 1O5GH 2Y5HA 1GHXH 5T1VA 3TK5A 2ZCLP 1W10U 2HRVA 4A1TA 1O3LA 1BQYA 1HCGA 1W7GH 1SFQB 4YLUA 2GT7A 1MCTA 3T2NA 1BMMH 2BVSH 3NCLA 4BAHB 1P2JA 1TGCA 4X1RU 5FCRA 1BRCE 2KM0A 4IMQA 1HJ8A 2QF4A 4NSYA 1LHDH 2UUJB 2V3MA 3SUDA 1CA8B 4LZ4B 1EJNA 2H5CA 2RDLA 8LPRA 3V0XA 1XM1A 1AD8H 3Q3XA 1Y3WA 2P95A 3ZZ6A 1C2JA 4Y76A 1G9IE 1UTQA 1TRYA 2HVXA 3A8CA 2V35A 1LPZB 1SGQE 1C5ZB 2V0BA 1LHEH 1AUTC 1Y5AT 1O2ZA 2KCOA 5EQQA 3QZRA 4FUIA 2OBOA 1UK4A 2Z9IA 6GCHF 5C3NA 2P16A 2PV9B 3URCA 3OAAD 3QN7A 1CSOE 2H9EH 1UTMA 3SGAE 2TGPZ 1GJBB 1P01A 1C5SA 3KGPA 2XYAA 1ANCA 1TOCB 3SUGA 1AVXA 4F48B 5K0HA 2ZU4A 2B9LA 2ZNKH 3RXHA 1HNEE 2G52A 4FUCA 1EPTB 1RS0A 5DP9A 5C1XA 4JZ1A 1UTLM 2A1DB 1AVWA 1IQMA 4ZROA 2Z9KA 3SZEA 1FDPA 2F9UA 1MAYA 3E8LA 1HAPH 2HGTH 2XNIA 1WTGH 1SQTA 5A0CA 3LIWA 4AG2A 4LK4A 1A2CH 2AEIH 2AS9A 3F2FA 4X1SU 3DD2H 5G4BA 3ZVDA 1FMGA 4MNVA 1IQKA 2BY5X 1BJUA 1CA0B 1DLEA 2JJ1D 1THRH 4XDEA 2Z94A 1ELGA 2ODPA 1RIWC 1YPHE 2PTNA 5EQRA 1K9OE 3A7ZA 4B6FA 4JK6A 2BD7A 2BD9A 5JBCS 3MQKC 1J8AA 3A80A 1N8OB 2EA3A 2FOAA 1GG6C 3F2GA 3RDZA 1ARCA 4I86A 1JXPA 1FV9A 4FUBA 2ZCKP 4AFZA 1SGFG 2CMYA 1S81A 2C4FH 5FAHA 1PPCE 1SI5H 2VB0A 2ZECA 2K7XA 3HKIB 5GPIB 3VB3A 1YM0A 2OC1A 1LVBA 1NRRH 1O32A 4E7RG 4R8TB 2O8TA 1QZ8A 4IN1A 2WYGA 4CBNA 1BMAA 1FI8A 1DVAH 3BV9B 2WZQA 1ZLRA 1TNGA 4DJZB 4I8GA 4BTUB 1F5RA 4BTTB 1W3CA 3RLYH 4BANB 5JB8S 1EXFA 1AWFH 4MPXA 1BMNH 3BTHE 3MOCA 3K65B 2PTCE 2EEKA 5FL7D 1UVOA 3UNSA 4TY6A 2CGAA 3TJNA 3TU7H 1C1RA 1DUAA 3GY8A 1QCPA 2FYRA 1AUJA 5KECA 1TWXB 3PMAB 2ZU5A 4DT7B 5E0GA 1LTOA 4NA7A 3KYGA 4XD7D 1QHRB 5PTPA 3ZIAD 1TABE 2ULLA 2ZHDA 4Y79A 1Z7KA 1AWHB 1ESAA 4ZMAH 4KTSA 2EQNA 3LH3A 1Y59T 4TYDA 3STJA 2LP6A 3SYJA 3ZYDA 2Z6BD 2AGGX 1C9PA 1GBBA 1LHFH 1EATA 1H9IE 2TGDA 2ZFRH 3C1KA 4RKOB 4U2WA 5JDUB 2RCEA 1KXDA 3MFJA 2V3OH 3L3TA 2JH5D 1TNIA 3HKJB 3SBKA 1O0DH 4D9RA 2AYWA 4NZLA 1AY6H 1WSSH 2NU0E 1UHBB 1E36B 3OY5U 1G3EA 1C4V2 1EPTC 4B1TA 1BZXE 2BDCA 1T8OA 4B2AA 4FUEA 2PHBA 1GJ5H 2B7DH 3RXQA 4YM9A 1EOLA 1Z8RA 1OX1A 5JBTA 2PGQB 1NBMD 1BMFD 1JIMA 2RFKC 2VWMA 4B2CA 2A2XH 1Q2WA 1O30A 7GCHG 2ZGXH 2BX4A 2FLRH 4B76A 1E34B 1FONA 3RXCA 2D8WA 3D23A 1OWKA 2PKSB 1VKYA 3GY3A 4YT6H 1CA0C 1TPAE 1FX0B 4HGCA 4ZXXH 1GI8B 1SHHB 3OX7U 1DICA 4X6NA 2BZ6H 2JETB 4GCHF 1O34A 2ZO3H 4BAQB 1GL1A 1N8OC 2RA3A 1E1QD 1P57B 3A87A 4RKJB 1CQQA 5H4IB 1F0UA 2BHGA 3MYWA 1O3CA 5JYIA 3UWJH 4Z6AH 4WF8A 4A92A 1OP8A 2FPZA 1TNLA 1O2UA 4WH6A 1O5BB 4YOJA 1A1RA 3DFJA 2CJIA 1EQ9A 2K8IA 5HYOA 1YC0A 1SLWB 1GI6A 4AYYB 1AN1E 4CH2B 1GHBF 3RU4D 2GKVE 2FODA 5CHAB 4HG6A 4UFEH 1C5OH 3FFGA 3QUMP 4ESTE 1KLJH 1V2UT 2G00A 3MU5A 1K22H 3T5FH 2EI6A 4TPIZ 2V7QD 1NC6A 5ESTE 1BITA 1GI7B 4XRNA 1Y3VA 3HGPA 1S0RA 2ZGCA 3UQVA 1ANEA 5LPEA 2JDID 3GICB 1WOFA 3LPRA 1RFNA 3RXJA 1P09A 3EA8A 1VITG 1TOMH 2BDAA 2Z7FE 2ZFTA 2WPMS 1HJAB 3H5CB 4XOJA 1ZTKA 3DT0H 1VCQA 1ZTLA 4BAKB 4YLQH 2KCPA 2Q6GA 5ETXA 2OCVB 1W0YH 4AB8A 4WY3A 2WPDD 4XBDA 2QC2A 4NFFA 1Z8IB 1T32A 1D3TB 1WYKA 2JH0D 5DP7A 2GD4B 3MNSA 2R3YA 4IS5A 3S9CA 1QTFA 2WPHS 2BLWA 3UPEA 3A7TA 3DSGA 2C8XB 1Z8JB 3MU1A 2OP9A 3O8CA 3TGJE 1PPZA 3L6PA 3M7UA 3UQOA 3FN8A 4IC6A 2XNDD 1P05A 4ZUHA 2A5AA 1VGCB 1SQAA 3PLBA 3EE0B 1O3IA 2BDGA 1QIXB 2A4OA 1OYQA 3LONA 2OC0A 2C8ZB 2AIPA 2F9PA 1O5CB 4AOQA 3JZ2B 1G37A 2Z9LA 2CV3A 1QL8A 4GPGA 4B73A 1SKYE 2BLVA 1YGCH 1ZOMA 2AH4X 3SU2A 2YNAA 1NFYA 3LGUA 1O2WA 2QE7D 2ANWA 4UONA 3GCTF 2PLXA 1S6HA 5DSFA 3RXIA 2YMSB 1FIWA 1O2GH 2A7HA 2ZPSA 1YPLH 4OS1A 4GHQA 3SZNA 1D9IA 1WQVH 3TK6A 5F53A 2PKSC 2C8WB 2Q1JA 2Y82A 1F5LA 3SJ8A 1C4U2 4JK5A 1L1JA 2CHAC 1KIGH 5F8XA 3PM3A 1V2WT 1MMJN 2JETC 2L74A 2PWXA 1J9CH 4KTCA 1V2KT 2TGTA 4MPWA 2GDEH 2JJ2D 5DN6D 4IN2A 1NU9A 2PR3A 2GV6A 2BLOA 2PSYA 2Y7XA 3UR9A 3MO3A 2GTBA 5A8ZA 1W7XH 1CVWH 2R0LA 1ARBA 3NPSA 3WWBA 1W0KD 2ZTYA 1CE5A 2VVCA 1EX3A 5EJZA 1G2MA 1RRKA 5CHAC 2O8WA 4ABHA 1PYTD 3SJ9A 1F0TA 1UTKA 2G51A 1C5NH 1MTWA 3OTJE 5HGGA 1Q3XA 1GMHG 1TYNA 3SW2B 1O2QA 1V2NT 2BLQA 3LGVA 3UNRA 4ZKNU 1WV7H 1KMHB 2BY8X 1UTNA 1TGNA 1G3CA 2VVVA 2Y6TA 2VNTA 1MD7A 1QRZA 2EI8A 2HPPH 3U28C 1MBMA 3S7HB 2ZF0H 1BTWA 4AGJA 1LKBA 4K5ZA 1NN6A 1S83A 1HJAC 1S6FA 5J4SA 1GI3A 5CHBA 1TPOA 1MKXH 4A1VA 1UK3A 3UR6A 4ABDA 1C2MA 3KQDA 1ZMNA 1SBWA 3HPTB 3T29A 1TPSA 1P2MA 3QTVH 4UD9H 5J4QA 1AMHA 4X8UH 4ASHA 3E90B 1ORFA 2ANMH 2IJD1 1FY8E 1OWHA 1P2KA 4AYVB 3FO8D 2K1QA 1SGEE 1GI0A 1FJSA 1SB1H 2WPLS 5AHGH 5EIYA 2STBE 4NGAH 4DVAU 1TX6A 3S9BA 1SGCA 4JMYA 3BTDE 1O2HA 3SU4A 4MLFB 3RXFA 2NU3E 2RA0A 1VGCC 5HIYA 4GUXA 5B6LA 2QF5A 1ZGIA 3K2UA 1HAHH 1O3BA 3SU1A 1D6RA 1W12U 2TIOA 1Z8GA 4FU9A 2WHXA 5E2OA 1BRAA 5HIZA 2ALPA 3BEUA 3ZZCA 2J98A 2W5EA 4TT3D 1XKAC 4DIIH 2DE8A 4X8VH 7ESTE 1ZR0A 2UUFB 5GNDA 4D76A 2FOMB 5E2PA 2VGCB 3UOUA 1L0ZA 3OE7D 4X6MA 4ZCNA 4DURA 1OP0A 2YMSC 3SV6A 1QJ6B 1VCWA 4E05H 2AIQA 3WY8A 3A8DA 1A3BH 9LPRA 1BHXF 1SFIA 1DX5M 1HB0B 4ACAA 3SU0A 3KQCA 1GL0E 2ODQA 1AI8H 1HXFH 1TGTA 2Q6DA 8ESTE 1BB0B 1HAOH 5T6DA 1KTTB 1PQ5A 1C1VH 1FPHH 1H1BA 1NU7B 2XBXA 2NWNA 3ZZAA 1SL3A 1NRPH 1H9HE 3E3TA 2FWWA 1AHTH 3DSOA 1JOUB 1MTSA 1BTUA 3ZZ3A 4SGAE 2BVRH 5C5OA 1F0SA 1YLDA 4JYUH 1O5EH 1KXFA 3HATH 3V13A 3A81A 4JCNA 1D4PB 1XUJA 2GVFA 2KCYA 2OQ5A 4J2YB 1NZQH 3TH2H 3RUOA 1ZHRA 1W0ZU 1GCTB 3M5MA 2M5TA 4X6OA 3VB5A 5IYTA 3QGNB 1O2RA 2FOEA 2ESTE 1T4VH 1N1LA 1EPTA 1DS2E 3TITA 1GBHA 3VEQB 4Q63A 5JB9S 1HXEH 1HLTH 1TNKA 1G32B 2ZDLA 3F0OA 1A46H 4ZKSU 1K1IA 5EGMA 1QL9A 5DP5A 4Y0ZE 1BA8B 2O9QA 3GYLB 1TA6A 1BTPA 4OS5A 1BBRE 2CF8H 3PROA 1H9LB 4K2YA 1TONA 2H5DA 1O5AB 3AK5A 2ZDAH 1E35B 3TLOA 4KTUA 3PV2A 1GJCB 1ZPCA 3Q00A 2FO9A 4B6EA 1OWDA 1ZGVA 2P8OB 4FUFA 4UDWH 3RXBA 4MNYA 1S85A 4ISIH 5ESBA 5DP6A 2GZ8A 2VIVA 1HAYB 4TWYA 4XBCA 3O8DA 4IW4E 1GJ6A 2XW9A 2ZFPH 8GCHF 5EW1H 1GI5A 2A7CA 3Q77A 4M7GA 1KYNA 1SR5C 2VBCA 3S7KB 3MH7A 1DPOA 1W13U 2XBWA 3OSYA 4NSVA 1SHYA 2XRCA 4JZIA 3M36A 4D8NA 2Z9GA 3M35A 3VPKA 4K69A 2ILNA 4U32A 4CRBA 1QNJA 3SJKA 1NPMA 5C94A 1BDAA 2F9BH 1GHWH 5FPTA 2VH0A 1CGHA 3F68H 3F9FA 1GBTA 1MKWH 1A5IA 2ZZUH 4YXWD 2VGCC 2OBQA 1O5FH 2FS8A 2HPQH 1TRMA 1GHAG 1ZHMA 4A1XA 2W3KA 1DXWA 2G5NA 4AFSA 1FXYA 4AN7A 2H2ZA 4I8KA 5I46H 1O2LA 1NRSH 2ZCHP 2A0QB 3PMBB 1C2GA 3ZVGA 1BBRK 1O37A 3BTFE 3GYMA 4KP0A 4E06H 1DLKB 4TSFD 1CT0E 2FS9A 3HK3B 1XUIA 3OTPA 3H7TA 1UVUH 1WUNH 3KN2A 1FUJA 1BIOA 4GAWA 1C5RA 3BF6H 1IQJA 1C5QA 1C5YB 5F03A 2Z3EA 1GI1A 1Y8TA 1K1PA 2KR7A 2VWOA 3A7XA 2ZDNA 5TCAA 2BD4A 4Y11E 4GCHG 1MABB 1GDUA 1EP6A 3BSQA 4ISHH 1GCTC 1SGFA 4Y7AA 3ZVFA 1O2YA 1O2SA 3ODDA 1UHBA 1GCDA 2A2QH 3RXUA 4FU7A 1JMOH 4IMZA 1SVPA 4Y71A 1NFXA 4FVBA 4ZKOU 3ENSB 4GVUA 1A0JA 1YCPM 2ANKH 2KCAA 5EPNA 3BEIB 3UREA 4CRFA 1JBUH 2QXHA 2R9PA 3GOVB 1H8ED 2F4LA 1KSNA 3MO6A 4WVPE 2F43B 1GMDF 1SMFE 1Y5UT 2QCYA 2THFB 3PWCA 1QJ1B 2Y81A 1C1UH 2J2UA 3M5LA 4DGJA 1KLTA 1EFRD 1YPKH 1TIOA 2BM2A 3U1JB 2J9NA 1XUGA 3F9GA 2P8OC 2ZPRA 3A83A 1ETSH 2F3CE 2FI5E 2GT8A 4AFQA 2P3UB 4IC5A 2R2WU 1C1MA 1ETTH 2OXSA 2FXRA 1K2I1 1X7AC 3OEED 2VIPA 5C20A 4ABFA 1C5MD 1QR3E 3GISB 1GI4A 2SGQE 3S9AA 2Y5FA 3TIUA 1MU6B 1FQ3A 1PQ8A 3H7OA 4H4FA 3EBNA 1O2IA 1VZQH 1NFWA 2QXGA 5C2ZA 2AHME 5GCHG 2A45B 3RXKA 2C93B 2FMJA 2ZEBA 1EJAA 4ACBA 3PWBA 1QBOA 4H6SB 4ABBA 3EE7A 2VH6A 2ZGBH 3V12A 4A5TS 5C1YA 2JKHA 1LVMA 3B9FH 1QBVH 2BVXH 2A4QA 1P0SH 1TE0A 4TWWA 3KQBA 1XXDA 1ZPZA 1C2HA 2CK3D 1B0FA 4YESB 3UFAA 1YPMH 2XXLA 3MNXA 2SGEE 4ZKRU 2ZFFH 3OU0A 3CENA 2ALVA 9ESTA 2BY6X 1TRNA 1DFPA 1GBEA 1ID5H 1S0QA 2HLDD 2ZI2H 4XFQA 3A82A 4FXGH 5LPFA 4ABGA 2VIWA 1C1WH 1GDNA 3AW1A 3TH4H 3LGIA 2BTCE 5GDSH 4E7NA 4OM9A 1E0FD 2BXTH 2F9NA 2RG3A 2ZA5A 5HKKD 4AGKA 2Y7ZA 1PQAA 1DOJA 1LQEA 3DHKH 3FKSD 4KGAA 2WUCA 3FP8E 4A6LA 3EGKH 1TMUH 4MNXA 1TGBA 3HK6B 3WWFA 1UVPA 1VJ9U 1GVLA 1O3PB 1FAKH 1W11U 4WMDA 4CREA 3VXFH 1HPGA 1LKAA 2FOFA 1GWAA 3RM0H 1UTOA 2D2DA 2CHAB 3BTGE 3GDSA 3U8TH 4Y8YA 1DSTA 1MAXA 2ZIQH 4F4OC 1O38A 3TNSA 3PTBA 4GSOA 1S82A 1C5UA 1AIXH 1IAUA 2RDEA 5DO4H 4Y10E 2GGVB 5LPRA 1Y3YA 1HJ9A 2Z9JA 1HAXB 1GBKA 1AU8A 3BTQE 3SU5A 5GIBA 3SUEA 2O8LA 4RT0A 2NU4E 4X8TH 1P9SA 1NROH 4AG1A 3SV9A 2XC5A 2GCTC 4ABIA 3T62A 4D9QA 3Q76A 1AZZA 3I77A 2L6OA 1EAIA 1C2KA 4BXSA 1ZRBA 1C1QA 3RC4A 3PRDA 3O8RA 4K1TA 2ZGJA 1NM6A 2XCNA 3RU4T 4RI0A 1TGSZ 1GBJA 3FP6E 1O3HA 1ELCA 1H8DH 2KX4A 5IDKA 3OFND 1ZSLA 1AQ7A 3LC3A 1L4ZA 1RGQA 4OS7A 3SNBA 1O3NA 3DCLA 1IOEA 3BTEE 1ABJH 2BD2A 1H8HD 1GMCG 4IBLH 2AERH 4BNRA 1GBAA 1FY5A 1WU1A 2M2AA 1SPJA 4X2XA 3SV2H 1P9UA 1IQNA 2VIQA 2YOLA 3V7TA 1PFXC 2BDBA 2A4GA 1DITH 5HXFA 4YOIA 1BRUP 3RXVA 3K9XB 3ZV9A 1C2IA 2QN5T 1K1JA 2BMGB 1THSH 1PPHE 3EYDA 4A7IB 1O2VA 2ZGHA 4NIYA 4ISNA 2FTLE 4DW2U 2A7JA 2HALA 1SOTA 3PV5A 4P00A 3AVZA 1LHCH 1WQSA 2IPQX 1V2TT 3UY9A 3FANA 5A0BA 5EQSA 5C0UA 4O3TA 4GHTA 1CT2E 1EOJA 3NZIA 4U30A 2ZG0H 3SGQE 1G2LA 4MNWA 2C3SA 3GCHB 1A0HB 1K21H 3M61U 1ELFA 1O2OA 4TPYA 3VFEA 3TK9A 3ODFA 1O2TA 1RJXB 3ZZDA 2EC9H 4TY7A 2XC0A 2QGRA 2HNTF 1OYTH 4YOGA 1G36A 1GJ4H 1GHZA 2KAIB 2ZTXA 2F9OA 3P6ZB 1XMNB 2FTMA 2A4RA 1SG8B 2QXIA 1QGFA 4I33A 3F3BA 1QA7A 3F0PA 3ZVBA 5EJLA 1BRBE 1DDJA 2R0KA 3SOSA 4DY7B 1XX9A 2J97A 2LPRA 4RN6A 1V3XA 5EJ1A 4P02A 3E0NB 4K1SA 1ETRH 1UVTH 2SNWA 5KGOA 5FCKA 3KIDU 3TJUA 4YO9A 1G3DA 1N6YA 1OOKB 1O3MA 1QRXA 1LPKB 3LJOA 5EOKA 1OWJA 1UTPA 2A31A 5DGJA 3U1IB 3QK1A 4XE4A 1P8VC 3M3VA 2FOCA 3MNBA 4AZ2B 2ANYA 1C5VA 4HI3A 2H9TH 4I32A 1P2IA 4INKA 5HMAA 4F55A 2A5IA 3SORA 3GY5A 2BYAX 2AMQA 2CXVA 4J1YA 5A8XA 3P95A 5A2MH 7GCHF 2ZQ2A 5DK1A 1L4DA 5FX6A 2D1JA 1Z71A 1O2KA 4D7FA 1KLIH 1QA0A 5FX5A 2GV7A 2XC4A 1UCYH 2BOKA 3CS7A 1HUTH 3A89A 5T6GA 4WXVA 3VXEH 6ESTA 3RXAA 1OWIA 1BHXB 2SGFE 3N99A 1O2NA 2W6JD 1TLDA 2ZFSA 4DT4A 5CDFE 2NU1E 5EXLA 3KF2A 4CH8B 1KDQB 2Y5GA 3ZV8A 1ZMLA 1VJAU 4NWKA 2FI4E 3GY2A 2W7UA 1AKSB 2PFEA 2HVYB 1FN8A 2OTVA 1QBNA 4X6PA 5DP3A 3KNXA 1HBTH 1XVMA 1HAVB 2ZDKA 4X0WU 1YCPH 1GJDB 3KQEA 2VINA 1SGDE 3RMMH 1ZYOA 3ZZ8A 3TJVA 1FY1A 1EAUA 1A61H 1JWTA 1FY4A 1GVZA 3BIUH 4Y7BA 4CRGA 1OP2A 2SGPE 4ZAEA 1PPEE 4Y8XA 4NWLA 3NRLA 1O2PA 2FLBH 1NS3A 3MU8A 4QT8C 4WH8A 5CE1A 2WV9A 1VITF 3EA9A 1P04A 4B75A 1XKBC 3GCHC 1HAIH 1L2EA 2GMTB 2Z3DA 2QAAA 6GCHG 3VB7A 5TCCA 4DOQA 3FZDA 2ZC9H 1SOZA 5DPAA 3P92A 3N7DA 4ZXYH 3VGCB 3M7QA 2PGBB 4MG3A 4AORA 1TBRH 1UW7A 4B71A 3PRBA 2V6NA 2UWOA 1NTPA 1ESBA 1O3AA 2DE9A 2FYQA 5GXPA 1NFUA 2BB4A 3P17H 3PLKA 1L1NA 3F2HA 1C5LH 2BD8A 1EZXC 2F83A 4DIHH 1OSSA 2ZQ1A 3P8FA 1HFDA 1WBGB 3PV4A 1TA2A 3W94A 1C2DA 2ASUB 5E0HA 3DSPA 1P11E 2VJ1A 2EY4C 2PP6A 1TFXA 3UOPA 1HYLA 4K3JA 1IQIA 2J95A 1ELDE 1HAGE 1T8MA 3ELAH 5LGOA 4K60A 3A85A 1HIAB 1SSXA 3MH5A 2QA9E 1QB9A 1C5WB 1MTNB 5EXMA 2ZTZA 3GY4A 1ESTA 2JIZD 1NY22 4XBBA 4X8SH 1DWBH 1PPBH 2I6SA 2FEQH 1JIRA 2WSSD 4NCYA 3RXEA 2NU2E 1SGYE 1SGIB 3RC5A 1TNHA 4M9FA 4JYTA 1QURH 3M5NA 1THPB 4MQAA 1S6LA 5AFZH 4X2YA 1WXRA 3GY6A 1P02A 3TNTA 3O8BA 2BQ7B 3SNDA 1C5TA 2OUAA 2OC7A 1VITH 2I6QA 4MTBA 3UTUH 1ZSKA 1SQOA 1Y5BT 1INCA 3A8BA 3TGKE 2XWAA 2ZKSA 5DP8A 4F49A 1YPJH 4OS2A 3M3TA 3NXPA 1TQ7B 1Z1IA 4Q7YA 3A84A 5DG6A 2LIZA 3T28A 4MPUA 5A0AE 3ZZ4A 2J4IA 1MBQA 2HOBA 1LDTT 2R3UA 1DY8A 1GJ7B 1MKXK 3BIVH 2H1UA 5FHTA 1UMAH 4MPVA 1GI9B 1GBLA 1GMHF 1AE8H 4ISOA 3BN9A 2UUKB 1LMWB 2G4UA 3TH3H 3KEEA 1ELEE 3SUFA 4FUGA 1C5PA 1QY6A 4JZFH 3SI4H 1TB6H 1B0EA 1C1NA 4O9VA 1CHGA 1N6XA 2G8TA 1C2FA 3F6UH 1YPEH 1QB6A 4X1NU 1YY3A 3A86A 3TJOA 4AB9A 2FZZA 4OGYA 3WW7A 8KME2 4ABJA 5HM2A 2WPKS 1PPFE 1GBCA 2GMTC 5F8ZA 3HGNA 3NWUA 1V2PT 2VIDA 4K8BA 3LH1A 4CR5A 1O2XA 4H6TA 1DE7H 2XWBI 4X1PU 1KTSB 4O3UA 3VGCC 4R0IA 5K7RA 4Y0YE 3ZZ9A 4BXWA 1KY9A 1ABIH 1C4Y2 3SV7A 1BT7A 1T4UH 2EI7A 2QXJA 2FDAA 3AAUA 1OXGA 3EA7A 4UE7H 5SGAE 3RXMA 2Y80A 2ZU3A 3UB0A 3VG8A 1H8IH 3AW0A 2FX6A 2FOHA 2BDHA 3ZVCA 2G4TA 1ELTA 1O3OA 3U9AH 4CRAA 1F92A 3E91A 3DFLA 1W14U 3MH4A 5TJXA 3D65E 1TPPA 1IQGA 1O3EA 1DUEA 4Q4LA 3FOAA 6CHAB 2IOTA 3K6ZA 3QGJA 3PYHA 2AGIX 2FESH 1Q31A 3VB6A 1UVSH 1BMLA 3E0PB 1GBMA 3QO6A 3TPIZ 3SJIA 3MHWU 5C1UA 4WXIA 4LXBH 2ODYB 1V2MT 1IQEA 2ZWLH 1A0LA 1K1LA 4OGXA 3T27A 6LPRA 1AO5A 3QX5H 1J14A 1MTNC 2XBYA 1AB9B 5CMXH 1P12E 1QFKH 1V2JT 1Z1JA 5L2YH 2XOKD 3M37A 1P03A 1TX8A 1O3DA 3LDXH 2ZP0H 3P70B 3D62A 1FIZA 3MI4A 3P8OA 2PKAB 4B2BA 2BX3A 3ATWA 1KXAA 3BTME 3LGTA 3FZZA 3GCNA 2B8OH 3CP7A 3H09A 4I31A 1BTHH 3GDVA 1HDTH 1GHBG 5FPYA 1BJVA 3RXPA 1NBME 2ZHEH 2R2MB 2VWLA 4ZHLU 4LZ1H 3SU3A 1EB2A 3EDXB 4Q2KA 1AE5A 2H6MA 1SQRA 3SHCH 3SQHE 2ZDMA 2GCHF 2TPIZ 4MDSA 1HGTH 4UFFH 1WDIA 5E8EH 1A7SA 1EZUC 3IG6B 2GZ9A 2O8UA 4CHAB 3IWMA 3SU6A 4GLYA 2GZ7A 5C5NA 2XBVA 1C1TA 4OS4A 1T8NA 2GCTB 4ZHAA 1F0RA 2TGAA 5AFYH 2ZDVH 4SGBE 2WPJS 1EB1H 1ZJDA 3M5OA 4ABAA 1AFEH 5DKMA 4FOUC 3A7YA 1DSUA 3ZYEA 1A5HA 3V3MA 2XTTB 2SFAA 3PMJA 4XSKU 3T25A 4BOHA 4I7YH 3ZZBA 1S5SA 3B23B 3UIRA 2FP7B 1FPCH 1CHOF 1O3GA 3A88A 1PJPA 4YT7H 1NO9H 1SLXB 1TBQH 2YMSD 4I8LA 3RU4E 2OD3B 1F2SE 1IQHA 4INLA 1KXEA 1MZDA 1T7CA 4WMFA 1Z6JH 2G5VA 4O97A 5C0TA 1QRWA 2V3HH 1E37B 4VGCB 1PYTC 4D7GA 3U69H 3GS9A 5C17A 5AF9H 3DA9B 1SGNE 3QDZB 1YLNA 2WINI 3UAIC 1MKWK 3SQEE 1K1NA 3SJOA 1OPHB 4UFDH 1O2MA 4THNH 1QL7A 3SN8A 2GP9B 2VIOA 3MU4A 1DXPA 1ANBA 2WV5A 1LVOA 2BY7X 4OS6A 3ATIA 1P3EA 3GCTG 1EZSC 2P3TB 3F1SB 2SNVA 2XCFA 1NRNH 3P8GA 4FU8A 6CHAC 1MU8B 4Q80A 1C9TA 1DM4B 4YZUA 4NFEA 1YKTA 2FOGA 4RT1A 3JZ1B 1QB1A 1OKXA 2AGEX 2QF3A 1CU1A 5EPYA 2QY0B 1GHAF 1ZJKA 1D3DB 1EUFA 5E0JA 3S0NA 5T6FA 3ZZ7A 1XUFA 3BTWE 1AB9C 3M7TA 2ZU1A 1V2OT 1TMBH 2P3FH 3PLPA 4KKDA 2C90B 2JH6D 5FPSA 1MUEB 4JYVH 1W0JD 3LGWA 1LCYA 2PW8H 2WPIS 2ZFQH 1O35A 3KL6A 4PROA 4Q7XA 2KZ4A 1C1SA 5LH8A 1V6DA 3MU0A 1O33A 2FIRH 4CRDA 1M9UA 1LQDB 4NA9H 3C27B 1ELVA 2KAIA 5EG4A 4CBOA 1G3BA 2BOHB 3D49H 1HRTH 4NIVA 2F9VA 3QWCH 2VVUA 1SGPE 2OLGA 2STAE 4DCDA 1P10A 1WCZA 3FAOA 3CNRA 3IITA 3F9HA 1HAZB 4BAOB 5HM9A 1ZRKA 1A5GH 3URDA 3SNAA 3N7OA 3VB4A 1TMTH
chains in the Genus database with same CATH topology
3ATKA 3SO3A 2BZAA 3U8RH 3KCGH 1ZSJA 1D3QB 4CHAC 1O3KA 3SNEA 3K6YA 1EZQA 3R3GB 2SGAA 1UJ1A 5L2ZH 4Y8ZA 5AVDA 1OWEA 3G01A 1SLUB 1GHYH 3NK8A 2J92A 2D26C 3RMNH 1P06A 2F91A 3RXRA 1LHGH 3BG8A 3RXDA 2H9HA 1UK2A 2WUBA 1K1MA 1O3FA 3W95A 1IHSH 1DANH 3PTNA 3A7WA 3ITIA 1NT1A 1TAWA 1AGJA 3E1XB 4DG4A 2ZPQA 3SNCA 1RXPA 1FAXA 4AX9H 5C67A 2J94A 3FP7E 4VGCC 1CGJE 5A09A 4WWYA 4Y6DA 1DWCH 4INHA 1UO6A 4ZH8A 1ELBA 1BTXA 1HV7A 3DUXH 1V2RT 2Q6FA 1KDQA 2FM2A 1GBIA 1TBZH 5EU8A 2P94A 2UUYA 2HLCA 5L30H 1AKSA 3B8JA 2IJOB 1RTFB 3MWIU 1EAWA 2BY9X 3NUMA 1EJMA 1CO7E 3E6PH 2BXUH 5DP4A 5GCHF 1HAVA 1B7XB 1K28D 1TALA 1EP5A 3U98H 3RXGA 4BAMB 1YP9A 1J15A 3U8OH 4U01A 3ZZ5A 3MNCA 5FXLA 1EASA 3RMOH 1PQ7A 1MTVA 4Z0KA 2C8YB 1MZAA 4H42U 1AVGH 4ISLA 3SGBE 3EAJA 2Z3CA 2ZU2A 3OY6U 3ATLA 1V2LT 2P59A 1MH0A 3MMGA 2BDYA 2VU8E 1T31A 3TGIE 3E16B 4CR9A 7KMEH 3LOXA 1P2OA 3QZQA 1EAXA 2PUXB 2GX4A 1P3CA 1OS8A 2CN0H 1W2KH 1U6QA 1QQUA 3R0FA 2A32A 1YYY1 2OQUA 4K1EA 2J38A 2UWPA 2P93A 1JRSA 4X2VA 1H4WA 2OINA 2PUQH 1MQ6A 4NIXA 5A8YA 1O3JA 1C2LA 4FVDA 4FUDA 4FUHA 1LPGB 5L6NH 1FY3A 1O31A 1GGDB 1RTLA 3GY7A 1CGIE 1KXCA 5FBEA 1D6WA 2ZHWH 3PO1B 1BCUH 2HNTC 1WTHD 3Q3YA 1L1GA 1GBDA 1XVOA 2BD3A 3SHAH 1AFQB 1ZZZA 3Q3KA 1O2JA 3F9EA 2B0FA 4K8YA 1Y3UA 4JZDH 3RXLA 5EXNA 1HIAA 3I29A 1ACBE 1SC8U 4BTIB 1VCPA 2W7SA 1BOQA 1NESE 1DWEH 3UNQA 3UWIA 8GCHG 3I78A 2A5KA 1RTKA 1GJAB 3EQ0H 1AZ8A 4X1QU 2O8MA 1CBWB 2W3IA 3RXOA 2UWLA 3MH6A 3SI3H 1GPZA 4UFGH 3AASA 5DJ7A 1T8LA 2LNCA 3M3SA 2OC8A 2CF9H 1DT2A 1YLCA 1TQ0B 4O03A 1GJ8B 1S84A 1Z6EA 2AFQB 3KHVA 2BD5A 5BRRE 1FNIA 3BG4B 4X2WA 3LU9B 2DUCA 4AFUA 3ZVEA 2HWLB 1SLVB 1O39A 1ZMJA 1V2QT 2QYIA 3RLWH 1V2VT 3MO9A 2AMDA 4B74A 2BDIA 3LKWA 3NKKA 2G55A 3LGYA 1GMCF 1YPGH 7LPRA 3GCOA 3OYPA 4MVNA 3STIA 2IPHA 1ZHPA 3LT3A 3GDUA 4HZHA 1UCYE 4NG9H 1EKBB 3RXSA 4NA8A 1DY9A 1P2QA 1WAYB 3S69A 5GWZA 3ZVAA 3MTYA 5EODA 2ZHQH 2PSXA 1D3PB 1GBFA 3BTTE 2FOBA 1IQFA 3PMHB 5JBBS 4RSPA 1BBRH 3BEFB 3LJJA 1SGRE 4NIWA 1QJ7B 5ABWA 1GDQA 3RC6A 5BPEA 5T3HA 3AAVA 1KXBA 4LOYH 4I8JA 4UEHH 5F8TA 2AMPA 1GJ9B 1C1PA 1TX7A 4I8HA 1YBWA 3PB1E 1MCVA 1C1OA 1ANDA 1IQLA 1UTJA 3T26A 1A3EH 1GGDC 4ZHMU 2TBSA 2FI3E 3FVFB 5JBAS 2QV1A 1K1OA 2HNTE 3ATMA 2WYJA 4NZQA 3TVJB 4KELA 2GDDA 1P2NA 3PO1C 4HTCH 3LC5A 1J16A 1QQ4A 3RXTA 1BUIA 1CT4E 5F6MA 1GMDG 1A4WH 4YTAA 3A7VA 2WV4A 4HFPB 1V2ST 2QIQA 1AFQC 1F7ZA 1C2EA 1XUHA 3QLPH 2GCHG 1G30B 1SGTA 1O36A 1F5KU 4WJG2 2G81E 1GI2A 5I25A 2ZHFH 1VR1H 1XUKA 5B6OA 2BQWB 1RD3B 1YF4A 2VWNA 4CRCA 1PPGE 1UCYK 1FZZA 1DWDH 3ESTA 1FLEE 5JPMH 4WMEA 4IGDA 1GVKB 1ZPBA 1CBWC 1MQ5A 2PKAA 1FN6A 5GJ4B 1E38B 4ABEA 2SGDE 1TNJA 2FX4A 5EW2H 1RIWB 1CHOG 1ELAA 3QTOH 3RM2H 5FBIA 1GG6B 3UUZA 1IHTH 1YPHC 3A8AA 1C5XB 3RMLH 2TRMA 4JZEH 1NRQH 1ZTJA 1MD8A 1YCPK 4Q7ZA 1LO6A 1J17T 3BG4C 3CS0A 1B5GH 1MTUA 1Y3XA 2YNBA 1GHVH 1W8BH 2W26A 1XXFA 1LVYA 2B5TB 3BTKE 1BTYA 3SV8A 3RP2A 1BTZA 1JRTA 4FUJA 2QF0A 2J34A 2BQ6B 3P8NA 3L33A 1O5DH 2IN2A 1O5GH 2Y5HA 1GHXH 3TK5A 2ZCLP 1W10U 2HRVA 4A1TA 1O3LA 1BQYA 1HCGA 1W7GH 1SFQB 4YLUA 2GT7A 1MCTA 3T2NA 1BMMH 2BVSH 3NCLA 4BAHB 1P2JA 1TGCA 4X1RU 5FCRA 1BRCE 4IMQA 1HJ8A 4NSYA 1LHDH 2UUJB 3SUDA 1CA8B 4LZ4B 1EJNA 2H5CA 2RDLA 8LPRA 3V0XA 1XM1A 1AD8H 3Q3XA 1Y3WA 2P95A 3ZZ6A 1C2JA 4Y76A 1G9IE 1UTQA 1TRYA 2HVXA 3A8CA 2V35A 1LPZB 1SGQE 1C5ZB 2V0BA 1LHEH 1AUTC 1Y5AT 1O2ZA 5EQQA 3QZRA 4FUIA 2OBOA 1UK4A 2Z9IA 6GCHF 5C3NA 2P16A 2PV9B 3URCA 3QN7A 1CSOE 2H9EH 1UTMA 3SGAE 2TGPZ 1GJBB 1P01A 1C5SA 3KGPA 2XYAA 1ANCA 1TOCB 3SUGA 1AVXA 5K0HA 2ZU4A 2B9LA 2ZNKH 3RXHA 1HNEE 2G52A 4FUCA 1EPTB 1RS0A 5DP9A 5C1XA 4JZ1A 1UTLM 2A1DB 1AVWA 1IQMA 4ZROA 2Z9KA 1FDPA 2F9UA 1MAYA 3E8LA 1HAPH 2HGTH 2XNIA 1WTGH 1SQTA 5A0CA 3LIWA 4AG2A 4LK4A 1A2CH 2AEIH 2AS9A 4X1SU 3DD2H 5G4BA 3ZVDA 1FMGA 4MNVA 1IQKA 2BY5X 1BJUA 1CA0B 1DLEA 1THRH 4XDEA 2Z94A 1ELGA 2ODPA 1RIWC 1YPHE 2PTNA 5EQRA 1K9OE 3A7ZA 4JK6A 2BD7A 2BD9A 5JBCS 1J8AA 3A80A 1N8OB 2EA3A 2FOAA 1GG6C 3RDZA 1ARCA 1JXPA 1FV9A 4FUBA 2ZCKP 4AFZA 1SGFG 2CMYA 1S81A 2C4FH 5FAHA 1PPCE 1SI5H 2VB0A 2ZECA 2K7XA 3HKIB 5GPIB 3VB3A 1YM0A 2OC1A 1LVBA 1NRRH 1O32A 4E7RG 4R8TB 2O8TA 4IN1A 2WYGA 4CBNA 1BMAA 1FI8A 1DVAH 3BV9B 1ZLRA 1TNGA 4DJZB 4I8GA 4BTUB 1F5RA 4BTTB 1W3CA 3RLYH 4BANB 5JB8S 1EXFA 1AWFH 4MPXA 1BMNH 3BTHE 3MOCA 3K65B 2PTCE 2EEKA 1UVOA 3UNSA 4TY6A 2CGAA 3TJNA 3TU7H 1C1RA 1DUAA 3GY8A 1QCPA 2FYRA 1AUJA 1TWXB 3PMAB 2ZU5A 4DT7B 5E0GA 1LTOA 4NA7A 1QHRB 5PTPA 1TABE 2ULLA 2ZHDA 4Y79A 1Z7KA 1AWHB 1ESAA 4ZMAH 4KTSA 3LH3A 1Y59T 4TYDA 3STJA 3ZYDA 2Z6BD 2AGGX 1C9PA 1GBBA 1LHFH 1EATA 1H9IE 2TGDA 2ZFRH 3C1KA 4RKOB 4U2WA 5JDUB 2RCEA 1KXDA 3MFJA 2V3OH 3L3TA 2JH5D 1TNIA 3HKJB 3SBKA 1O0DH 4D9RA 2AYWA 4NZLA 1AY6H 1WSSH 2NU0E 1UHBB 1E36B 3OY5U 1G3EA 1C4V2 1EPTC 4B1TA 1BZXE 2BDCA 1T8OA 4B2AA 4FUEA 2PHBA 1GJ5H 2B7DH 3RXQA 4YM9A 1EOLA 1Z8RA 1OX1A 5JBTA 2PGQB 1JIMA 2VWMA 4B2CA 2A2XH 1Q2WA 1O30A 7GCHG 2ZGXH 2BX4A 2FLRH 4B76A 1E34B 1FONA 3RXCA 2D8WA 3D23A 1OWKA 2PKSB 3GY3A 4YT6H 1CA0C 1TPAE 4HGCA 4ZXXH 1GI8B 1SHHB 3OX7U 1DICA 4X6NA 2BZ6H 2JETB 4GCHF 1O34A 2ZO3H 4BAQB 1GL1A 1N8OC 2RA3A 1P57B 3A87A 4RKJB 1CQQA 5H4IB 1F0UA 2BHGA 3MYWA 1O3CA 5JYIA 3UWJH 4Z6AH 4WF8A 4A92A 1OP8A 2FPZA 1TNLA 1O2UA 4WH6A 1O5BB 4YOJA 1A1RA 3DFJA 2CJIA 1EQ9A 5HYOA 1YC0A 1SLWB 1GI6A 4AYYB 1AN1E 4CH2B 1GHBF 3RU4D 2GKVE 2FODA 5CHAB 4UFEH 1C5OH 3FFGA 3QUMP 4ESTE 1KLJH 1V2UT 2G00A 3MU5A 1K22H 3T5FH 2EI6A 4TPIZ 1NC6A 5ESTE 1BITA 1GI7B 1Y3VA 3HGPA 1S0RA 2ZGCA 3UQVA 1ANEA 5LPEA 3GICB 1WOFA 3LPRA 1RFNA 3RXJA 1P09A 3EA8A 1VITG 1TOMH 2BDAA 2Z7FE 2ZFTA 2WPMS 1HJAB 3H5CB 4XOJA 1ZTKA 3DT0H 1VCQA 1ZTLA 4BAKB 4YLQH 2Q6GA 5ETXA 2OCVB 1W0YH 4AB8A 4WY3A 4XBDA 2QC2A 4NFFA 1Z8IB 1T32A 1D3TB 1WYKA 2JH0D 5DP7A 2GD4B 3MNSA 2R3YA 4IS5A 3S9CA 1QTFA 2WPHS 2BLWA 3UPEA 3A7TA 2C8XB 1Z8JB 3MU1A 2OP9A 3O8CA 3TGJE 1PPZA 3L6PA 3M7UA 3UQOA 4IC6A 1P05A 4ZUHA 2A5AA 1VGCB 1SQAA 3PLBA 3EE0B 1O3IA 2BDGA 1QIXB 2A4OA 1OYQA 3LONA 2OC0A 2C8ZB 2AIPA 2F9PA 1O5CB 4AOQA 3JZ2B 1G37A 2Z9LA 2CV3A 1QL8A 4GPGA 4B73A 2BLVA 1YGCH 1ZOMA 2AH4X 3SU2A 2YNAA 1NFYA 3LGUA 1O2WA 2ANWA 4UONA 3GCTF 2PLXA 1S6HA 3RXIA 1FIWA 1O2GH 2A7HA 2ZPSA 1YPLH 4OS1A 4GHQA 3SZNA 1D9IA 1WQVH 3TK6A 2PKSC 2C8WB 2Q1JA 2Y82A 1F5LA 3SJ8A 1C4U2 4JK5A 1L1JA 2CHAC 1KIGH 5F8XA 3PM3A 1V2WT 1MMJN 2JETC 2PWXA 1J9CH 4KTCA 1V2KT 2TGTA 4MPWA 2GDEH 4IN2A 1NU9A 2PR3A 2GV6A 2BLOA 2PSYA 2Y7XA 3UR9A 3MO3A 2GTBA 5A8ZA 1W7XH 1CVWH 2R0LA 1ARBA 3NPSA 2ZTYA 1CE5A 2VVCA 1EX3A 1G2MA 1RRKA 5CHAC 2O8WA 4ABHA 1PYTD 3SJ9A 1F0TA 1UTKA 2G51A 1C5NH 1MTWA 3OTJE 5HGGA 1Q3XA 1GMHG 1TYNA 3SW2B 1O2QA 1V2NT 2BLQA 3LGVA 3UNRA 4ZKNU 1WV7H 2BY8X 1UTNA 1TGNA 1G3CA 2VVVA 2Y6TA 2VNTA 1MD7A 1QRZA 2EI8A 2HPPH 1MBMA 3S7HB 2ZF0H 1BTWA 4AGJA 1LKBA 4K5ZA 1NN6A 1S83A 1HJAC 1S6FA 5J4SA 1GI3A 1TPOA 1MKXH 4A1VA 1UK3A 3UR6A 4ABDA 1C2MA 3KQDA 1ZMNA 1SBWA 3HPTB 3T29A 1TPSA 1P2MA 3QTVH 4UD9H 5J4QA 1AMHA 4X8UH 4ASHA 3E90B 1ORFA 2ANMH 1FY8E 1OWHA 1P2KA 4AYVB 2K1QA 1SGEE 1GI0A 1FJSA 1SB1H 2WPLS 5AHGH 2STBE 4NGAH 4DVAU 1TX6A 3S9BA 1SGCA 4JMYA 3BTDE 1O2HA 3SU4A 4MLFB 3RXFA 2NU3E 2RA0A 1VGCC 4GUXA 1ZGIA 3K2UA 1HAHH 1O3BA 3SU1A 1D6RA 1W12U 2TIOA 1Z8GA 4FU9A 5E2OA 1BRAA 2ALPA 3BEUA 3ZZCA 2W5EA 4DIIH 1XKAC 2DE8A 4X8VH 7ESTE 1ZR0A 2UUFB 4D76A 2FOMB 5E2PA 2VGCB 3UOUA 1L0ZA 4X6MA 4DURA 1OP0A 3SV6A 1QJ6B 1VCWA 4E05H 2AIQA 3WY8A 3A8DA 1A3BH 9LPRA 1BHXF 1SFIA 1DX5M 1HB0B 3SU0A 3KQCA 1GL0E 2ODQA 1AI8H 1HXFH 1TGTA 2Q6DA 8ESTE 1BB0B 1HAOH 5T6DA 1KTTB 1PQ5A 1C1VH 1FPHH 1H1BA 1NU7B 2XBXA 2NWNA 3ZZAA 1SL3A 1NRPH 1H9HE 3E3TA 2FWWA 1AHTH 1JOUB 1MTSA 1BTUA 3ZZ3A 4SGAE 2BVRH 5C5OA 1F0SA 1YLDA 4JYUH 1O5EH 1KXFA 3HATH 3V13A 3A81A 4JCNA 1D4PB 1XUJA 2GVFA 2OQ5A 4J2YB 1NZQH 3TH2H 3RUOA 1ZHRA 1W0ZU 1GCTB 3M5MA 2M5TA 4X6OA 3VB5A 5IYTA 3QGNB 1O2RA 2FOEA 2ESTE 1T4VH 1N1LA 1EPTA 1DS2E 3TITA 1GBHA 3VEQB 5JB9S 1HXEH 1HLTH 1TNKA 1G32B 2ZDLA 4ZKSU 1A46H 1K1IA 5EGMA 1QL9A 5DP5A 4Y0ZE 1BA8B