2J97A

Human coronavirus 229e non structural protein 9 (nsp9)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
98
Chain Sequence
KMKVKATKGEGDGGITSEGNALYNNAFMYAYVTTKPGMKYVKWEHDSGVVTVELEPPCRFVIDTPTGPQIKYLYFVKNLNNLRRGAVLGYIGATVRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords REPLICASE POLYPROTEIN 1AB
publication title Variable Oligomerization Modes in Coronavirus Non-Structural Protein 9.
pubmed doi rcsb
source organism Human coronavirus 229e
total genus 21
structure length 98
sequence length 102
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 2j97A01
2J97A 2J98B 2J98A 5C94A 1QZ8A 5HIYA 1UW7A 5HIZA 3EE7A
chains in the Genus database with same CATH superfamily
1YPKH 5LPEA 3DD2H 2JH6D 4KTSA 3K65B 1XUKA 3BTQE 2KAIB 4K1SA 1GBTA 1TA6A 2KZ4A 1W14U 1W3CA 3SJ9A 3ATWA 1HFDA 2GZ8A 1OPHB 1F7ZA 1B0FA 4MNYA 1TPSA 4ZROA 1Y3VA 3D23A 3RXTA 3SBKA 1MU6B 4ISHH 3STJA 2YNBA 1BIOA 3ZIAD 2VJ1A 4P02A 3I29A 1HAGE 3F6UH 1N6XA 3ZVGA 1W0KD 1XXFA 3N7OA 1O2PA 1FV9A 1K0HA 2SNWA 2QV1A 5G4BA 1WAYB 2ZO3H 3SV6A 5EGMA 1O5AB 1OP2A 4JK6A 5JB9S 1GBBA 1A0JA 1J9CH 2ZU2A 2GT7A 3P92A 2Z9JA 2PGBB 4LZ4B 1PPCE 2WPKS 1C1OA 1UTNA 3RXKA 1LPKB 5DK1A 3ZVAA 2ASUB 2ZGXH 1L4DA 3A8BA 1AVXA 1LPGB 2IPHA 1TALA 3UNQA 3WWFA 4NIWA 3JZ1B 3LKWA 1C1NA 3QZQA 5LH8A 1Q31A 1QR3E 1GBMA 2FZZA 1QGFA 1FY1A 3L33A 1S6LA 1O2JA 2ZA5A 2GCHG 2ZCKP 1O37A 3MYWA 4ASUD 5GXPA 1Z7KA 1GBCA 2BLOA 1TOCB 4Z0KA 3PO1B 3RUOA 4BAKB 1DWEH 1EP5A 1FY3A 3SO3A 1GI4A 1SKYE 1ZYOA 2M2AA 1TRMA 1BRUP 3LT3A 2GMTB 1OP0A 1CQQA 2A5IA 3TGKE 3Q77A 2JDID 3A84A 5E0JA 1SOZA 3SU2A 5HM9A 1C1SA 5HM2A 1ELEE 2C8ZB 3URCA 1GHAG 2G5NA 3R0FA 4JZEH 1TBRH 3LPRA 3A89A 3E8LA 3LH1A 2ZDNA 3MU5A 4MNVA 1RTFB 5J4QA 1EFRD 2FI5E 1OKXA 1L2EA 3W95A 2ODQA 2TPIZ 1AQ7A 4YOGA 1ZHPA 1WBGB 2VIOA 2AMPA 4UFFH 1W11U 3PLPA 3A85A 2VVVA 1UTOA 3TK5A 4DY7B 2FOCA 1ZTJA 5FPYA 1ABIH 3PO1C 3QWCH 1Y3WA 4Y71A 2BQ6B 3A8DA 2RA3A 5FBEA 1K9OE 5C0TA 1E37B 1HJAB 1QL7A 2PKSB 4GCHF 2GMTC 1MQ5A 4ABBA 1P57B 2B7DH 2XBXA 2OCVB 3VB5A 1F92A 2WUBA 1O3HA 3KF2A 2CK3D 4TY6A 4X1RU 1O2WA 1GHBG 1SGYE 1WQSA 1Z1JA 3H7OA 1QBNA 2QXGA 1H8IH 5CHBA 1QTFA 3CENA 8KME2 2H5CA 4OS7A 3S7HB 1DSUA 1QB1A 4XE4A 4JZDH 1MABB 3TJVA 1FONA 1C2GA 4MQAA 2LP6A 1V3XA 1WCZA 1HAOH 1ZPCA 1QZ8A 4CBNA 1C5YB 1HJAC 1WTGH 3F9EA 1GJ7B 2TGTA 3UOPA 3UWJH 1UVPA 1A0LA 1AUTC 1CGJE 1LDTT 5FX5A 1ESTA 1RJXB 4CR9A 5JPMH 1FN8A 3TNSA 1UVOA 4ZKOU 3UFAA 1O2NA 1HAYB 2GDDA 3RLWH 2ZF0H 1FY8E 1GGDB 3U1JB 2ZI2H 2VIDA 4INKA 2Y82A 1DLEA 1GHXH 1ZR0A 3HK3B 2ZCHP 4F49A 3RXJA 1J16A 3QUMP 5L30H 1XKBC 3S69A 1MBQA 1TAWA 3A81A 1QL9A 2NU4E 1BBRK 1TX7A 5EOKA 1DITH 1SGIB 4O9VA 5C67A 3KHVA 3PB1E 1TPPA 1UTKA 2UUKB 1DSTA 2VH0A 4K5ZA 5FBIA 4RT1A 1F0RA 4MPWA 3SJ8A 2BD4A 1IQGA 3AASA 1PFXC 1V2RT 1O35A 1VITH 1CT0E 3P70B 5JB8S 4ZXYH 1ARBA 4PROA 5KGOA 4NG9H 3W1EA 4BXWA 3LGTA 1QJ7B 3ZVCA 1QBVH 5GCHG 2G4UA 4JZ1A 2TIOA 2HRVA 4UFDH 4MVNA 3TH2H 1DM4B 4BAMB 2PSYA 1HXEH 1G3BA 4ABAA 4NZQA 1FJSA 2QC2A 2EEKA 1V2TT 2FODA 2BOHB 4DT4A 5C94A 3VGCB 3RXGA 4O3UA 3A86A 1Y3XA 3ZZ6A 4WMFA 3BEUA 1DUAA 4DT7B 1AO5A 1FPHH 4XOJA 3SQHE 2FOAA 1HAPH 1HAHH 1ZLRA 1THPB 1CHOF 3LH3A 3TK6A 3QGJA 1GJ6A 3ESTA 1ACBE 1FNIA 1BBRH 3UAIC 4X8TH 2F4LA 4ASHA 1QRXA 2H2ZA 3AAUA 3SNAA 3LU9B 4XD7D 2QY0B 1O5FH 3TH3H 1FAKH 2AGEX 2FTLE 5IDKA 3MO6A 4Q80A 1ZTKA 1EASA 2V3MA 2ZQ2A 4AORA 1NFUA 3SJKA 4R0IA 1LQDB 4A1VA 3PV4A 1AVGH 3LC3A 4ZHMU 1P2IA 1V2QT 5T6GA 1RGQA 5AFYH 2GT8A 1LQEA 1UCYH 3BIUH 3SHCH 4B6EA 1K1LA 1Y3UA 1FQ3A 4Y0YE 3EE7A 1WSSH 1IQIA 1BITA 1EAXA 3VGCC 1DLKB 1O3PB 2B5TB 3WY8A 4MPVA 1TQ0B 1YKTA 5A8XA 2GJGA 1O0DH 2RDLA 3MO9A 5HGGA 3SU1A 1UCYE 2WUCA 1H8DH 1AY6H 1HUTH 2ANMH 2ZU4A 2BVRH 1KXBA 1F0TA 3TJNA 2AIQA 4Y6DA 9ESTA 5K7RA 1GHVH 4ZUHA 3ZZ7A 3SU0A 1F5KU 2UUYA 2A4OA 1GBDA 1NPMA 1O34A 2FXRA 2WPDD 1LKBA 1T8MA 2JJ2D 1XVMA 2Z9LA 1V2LT 4NSYA 1TRYA 2W7UA 4RSPA 4ISOA 3PWCA 3A88A 4FUHA 4AYYB 1V2UT 2XBWA 3GY3A 4UONA 1YLCA 5EJ1A 1VGCB 1EPTA 2ANYA 1C4Y2 1C9TA 3RXCA 3SV8A 2ESTE 3QX5H 1C1TA 1ZTLA 1YPGH 4JYVH 4JZIA 1ZGVA 4ZHLU 2BX4A 3QGNB 2VBCA 2L6OA 2XCNA 3F0OA 2WHXA 1LVMA 1TNGA 1YBWA 2VH6A 2BDYA 2VIPA 2GDEH 3MNBA 3G01A 4FXGH 2XC5A 3SUDA 1Q2WA 1Y5AT 3M37A 4CRBA 4VGCB 5A0AE 1O3JA 2OBOA 2Y80A 1SI5H 3PLBA 2FOMB 7GCHG 1L4ZA 2W26A 3TNTA 1UTPA 1C1PA 3N7DA 5C17A 1ZJKA 2CV3A 3MHWU 1C2MA 2WPLS 2ZHEH 1QA0A 1G9IE 3UREA 1GJAB 3M7QA 4TSFD 5DN6D 1VGCC 3V12A 3EGKH 1BTWA 2VIWA 2HPQH 4AN7A 4FUDA 4AC9A 2FOFA 1SPJA 2BDIA 3SGBE 1F2SE 4QT8C 1C9PA 1GL1A 1VJAU 3DHKH 1KLIH 5ESBA 5DP5A 2B9LA 2PUXB 1TWXB 5JBAS 1GCDA 2PSXA 1ZHRA 1A5GH 1O3OA 3PWBA 4K2YA 1P2JA 3A8AA 2GX4A 1Z8GA 3RXUA 1C2KA 4M7GA 4VGCC 2FS8A 1KTSB 5FL7D 1C5PA 1XUIA 3IITA 2WPJS 1FDPA 1AFEH 3NWUA 3NXPA 2XBYA 4YLQH 1P03A 2EI6A 2XWAA 1GI6A 1V2VT 2AFQB 1ZHMA 1CT2E 1B5GH 3KQ5A 1O2YA 2B0FA 1DWCH 2UWOA 2F3CE 1KLTA 4UDWH 5AHGH 3AW0A 3LGYA 1KXEA 1YPHC 3FP7E 3KYFA 2SGAA 2A2QH 2STBE 1QY6A 3E91A 5C1UA 2IOTA 3LJOA 4U01A 1YLDA 3SW2B 3NKKA 1P06A 2P3FH 3SU4A 3KL6A 1DDJA 1W7XH 4GVUA 4ESTE 3T26A 1ORFA 3GDVA 5FAHA 3SQEE 2BM2A 1TBZH 2ZDAH 1QB9A 1VCWA 2Q1JA 2ZG0H 3PTBA 3OTPA 4INHA 3HKJB 2Z9GA 1OWIA 2BY9X 1AMHA 1OWEA 1A1RA 1C5VA 4I8GA 1SGTA 2HVXA 2AHME 3KN2A 1MAYA 3S9CA 1OHHD 4Q7ZA 2Y5GA 2XXLA 3F68H 2A2XH 1TBQH 1NFWA 2H5DA 2AGGX 4MLFB 4B6FA 1RTLA 3B9FH 4B74A 7KMEH 4WJG2 4BAHB 1BMNH 5DPAA 3ZZ5A 2LNCA 2BY5X 3SJOA 2PTCE 3JZ2B 3IG6B 3BTFE 3GCHC 1KXDA 2ANKH 1PYTC 1KXFA 4RN6A 5EQQA 2GKVE 1C1QA 1O3MA 1V2PT 4J1YA 1EZXC 2R9PA 2A31A 3BIVH 4GAWA 5EJLA 1BZXE 2PKAB 1P09A 2BY8X 5HMAA 4YZUA 3ODDA 2PKAA 3T2NA 3I77A 1KDQA 1WU1A 2WPMS 4A6LA 4Y0ZE 3A8CA 4BAOB 1NESE 1MKWK 3DSPA 3VB4A 3V7TA 1O2VA 3F2FA 4FU8A 3EE0B 5EODA 1C2HA 1SLXB 4IMZA 4GHQA 3RMLH 2VVCA 2GVFA 4AGJA 1LPZB 4I8LA 3TGIE 3RXMA 4K1TA 3VB6A 3VXEH 3ATKA 2FPZA 1TOMH 1FI8A 3HATH 4FU7A 1AKSB 1EX3A 1YCPH 3PV2A 3HPTB 1GBJA 1BTUA 1E38B 4F48B 4NA9H 2ZFTA 3D49H 1A7SA 1O5DH 2W3KA 3T5FH 4NIVA 1O3EA 1LHEH 1H8HD 3RXSA 2OC1A 1SGFA 1H1BA 1W10U 1THRH 1HAZB 1E1RD 1QNJA 3PM3A 4Q2KA 2VGCB 2I6SA 1SL3A 1G37A 4CH2B 3BTDE 1A46H 1C2IA 1F0UA 2AEIH 4SGBE 1E1QD 3P8FA 4KP0A 1C5XB 2G5VA 1PQAA 1BDAA 1EAWA 1QL8A 1GBHA 1ZSLA 2J5UA 3OAAD 2OINA 4Y11E 4TPYA 1D3DB 4UFEH 9LPRA 3MH5A 2K1QA 3ZZAA 2XRCA 4ZKNU 4B2BA 5C3NA 4WY3A 5CHAB 1SBWA 3NCLA 5CE1A 2BDBA 4BNRA 2ZGBH 1O3AA 1FN6A 2D2DA 3SUGA 4JYTA 6ESTA 1P05A 1GHYH 3EA9A 1BA8B 1RIWB 3HGPA 2JETB 2B8OH 1LTOA 3UY9A 1BMFD 4ABEA 1ELFA 1FY5A 4F4OC 1AWHB 3KEEA 1ZMJA 2OQUA 3DFLA 2BLWA 4K60A 1C1RA 1QIXB 2OC0A 2VGCC 5F8XA 5KEDA 1GI2A 2HLCA 2OLGA 1NBMD 1HYLA 1O2LA 2O8UA 1AFQB 2F83A 4AG1A 2K0QA 2ZDMA 3H09A 1TPAE 1B0EA 1N8OB 2ZU5A 3SHAH 1EZSC 1K1JA 3TH4H 2XNIA 1ETSH 1UO6A 2LELA 3SNCA 1GMDG 1GI7B 4NIXA 4D7FA 1NFYA 2ILNA 1IQFA 3SZNA 1T8OA 5CHAC 1CGIE 1CO7E 3RM0H 3UQVA 4I7YH 2NU1E 1EJMA 3W94A 1IQNA 1TE0A 4OS2A 3A87A 1GCTB 5EXNA 5F8ZA 1FPCH 4GSOA 4JYUH 1O3GA 2ZFFH 1IAUA 1RIWC 2JETC 5T3HA 2QXJA 3RC6A 1FX0B 1GWAA 4O97A 4NWLA 3FOAA 1EOLA 3VFEA 2JH0D 2OC8A 1LKAA 1O2TA 1S0QA 3QTVH 2V35A 3AK5A 2EC9H 5HXFA 1YF4A 1KXAA 3GCTG 1SMFE 2G4TA 3WWBA 1XUHA 3OY6U 2ZHDA 1P2KA 4D8NA 2CJIA 4NSVA 1AHTH 3ZVBA 1AFQC 1GL0E 1TA2A 3NK8A 4JK5A 4ABFA 2BLQA 3FFGA 3P8NA 1ELGA 1S5SA 2BVSH 1J8AA 5A8ZA 1N8OC 3SI3H 2A0QB 2BDGA 2QF0A 4RKOB 1HAIH 1BMLA 2BXUH 3D65E 2SGFE 1KY9A 1P12E 1O36A 1ZOMA 1D3TB 2ZFPH 5F03A 1P10A 4A1TA 1ARCA 4NA7A 3MNSA 4KELA 1LHFH 3B8JA 3O8BA 4X8SH 2F9UA 4NCYA 1LVBA 2IPQX 1GCTC 1EB2A 3F9GA 3HGNA 1W0ZU 1V2OT 4Y10E 4HTCH 1AVWA 4WXIA 4KTUA 3UWIA 5BPEA 3LGVA 1Y8TA 1O3DA 2J9NA 2V0BA 1SGDE 3RC5A 3CNRA 1TGTA 1O2GH 1OWKA 1H8ED 1NRRH 1GJ9B 3FZZA 5DP4A 1S85A 1DXWA 5F6MA 4AG2A 3P6ZB 2P3TB 4ISLA 1OWJA 2FDAA 4A5TS 3UPEA 2A45B 3P95A 1Z8IB 3NRLA 2BY7X 1YY3A 1GMCG 2PGQB 2EI7A 1TFXA 1ZSKA 4Q63A 4FUBA 1AUJA 5B6OA 2HLDD 1CE5A 3KCGH 4MPXA 3RXHA 3GCOA 1EUFA 2D8WA 3PTNA 5GIBA 1TYNA 2BVXH 1DPOA 1DS2E 2VIQA 5ESTE 3FP6E 3CS7A 4THNH 5DKMA 5E8EH 1QJ1B 4WMDA 2VB0A 4A1XA 2Y5HA 1PPZA 1QQ4A 5ETXA 4ACBA 1A3BH 5I25A 3F9FA 5AFZH 1TLDA 1BMAA 2STAE 3TLOA 1SR5C 3V3MA 5CMXH 1LHDH 1RD3B 3DT0H 2J38A 2XW9A 2F9PA 5DO4H 1A4WH 2WV4A 2IJD1 4B73A 1OOKB 4X1SU 1ZRBA 4AX9H 2JKHA 4TYDA 1GJCB 1V6DA 4MPUA 3VPKA 1NRPH 2PV9B 1ESAA 4X1PU 3CS0A 3M3SA 4IN2A 3Q3XA 1E34B 3MFJA 1NN6A 2QGRA 3M7UA 2BX3A 2AH4X 2BZAA 1KTTB 4ACAA 1KSNA 1QBOA 3MH6A 1TX6A 2IJOB 2ZCLP 1AGJA 1FMGA 2A7CA 2GV7A 2ZDVH 4YESB 5L2ZH 3A7ZA 2PR3A 1BJVA 3SNEA 1MMJN 5EPNA 1SGRE 1O2MA 4SGAE 1GBFA 1FZZA 2BQWB 2QN5T 2ZTXA 3GS9A 3F0PA 1G32B 1THSH 4IGDA 3ZYDA 5F53A 2Z9KA 1G3DA 5F8TA 5EQRA 1QQUA 2BY6X 3ZV8A 2QXHA 1O2XA 1WOFA 2RDEA 4FOUC 2XOKD 1SGEE 4K8YA 1MD7A 1T4UH 4YLUA 1UW7A 2GZ7A 4Y7BA 5IK2D 1O2QA 1PYTD 2CXVA 1RXPA 6LPRA 1UK4A 2PWXA 2IN2A 3PLKA 5EJZA 3STIA 1ABJH 2NU0E 1EP6A 3GY5A 2C4FH 1K1IA 2SGQE 1BTYA 1FXYA 5SGAE 3MOCA 5A8YA 3M61U 1TNIA 4U2WA 2BZ6H 1SFQB 1UHBA 2PFEA 3A82A 2VWOA 3UNSA 1MU8B 1S0RA 1V2KT 5JYIA 1TRNA 4ABDA 3TPIZ 1W12U 4H6SB 3MI4A 1BBRE 3NPSA 5EG4A 2P93A 1SQRA 2THFB 2J94A 5PTPA 3GISB 4K3JA 4I32A 2P59A 1OYTH 1VITG 1GVLA 3QZRA 1C2DA 1GI0A 4XFQA 1GMHG 2HWLB 2UWPA 1NRNH 3RM2H 5DG6A 3BEIB 2TRMA 4XRNA 4E06H 3TIUA 1ELBA 4WXVA 2ZPQA 5KECA 1H9IE 1UTJA 1E36B 1IQMA 3MNXA 1Z71A 4IN1A 2F9OA 3S0NA 1K2I1 1Z8JB 1YLNA 5GPIB 2GCHF 2SNVA 3ZZ3A 1BUIA 1KMHB 2YOLA 2C93B 2RCEA 1NRSH 2ZP0H 4KKDA 3ZZ9A 1O2KA 3DSGA 4Z6AH 1MUEB 2G00A 2ZHQH 4NWKA 1Y5UT 1JXPA 1P9UA 4ZHAA 2FLBH 1BB0B 4YTAA 4WMEA 3KIDU 1HAVA 1BRCE 2OQ5A 1TGNA 1XM1A 3K2UA 1CVWH 3OSYA 2C8WB 3KGPA 4NGAH 3PYHA 3PV5A 1GHAF 2FTMA 1K22H 4DIHH 3A7TA 4B1TA 3U8TH 4FUEA 2R2WU 1PQ7A 1SLVB 4TT3D 5C0UA 1SGFG 1VCQA 2A1DB 1ZGIA 2O8LA 2V3HH 4YOIA 1NO9H 4TPIZ 4OS6A 5DP3A 1DT2A 1G2MA 1K1PA 2FOGA 3EA8A 4I86A 1EPTB 2KFWA 1SC8U 1HJ9A 5C2ZA 3QTOH 5A09A 2W3IA 3SV9A 3MNCA 1QA7A 5GWZA 1FLEE 1TX8A 1UTMA 4NFFA 1NTPA 1WQVH 4WF8A 1NRQH 2GP9B 1G2LA 4XBDA 4FUCA 1GBLA 2WYJA 4D76A 2FMJA 2BDCA 4ZMAH 1TNJA 1GI5A 4K8BA 1LO6A 2FM2A 2VWLA 1CU1A 1GJ8B 3ZV9A 1O5EH 1YWUA 2H6MA 2XC0A 3LIWA 2V7QD 4ZH8A 1QB6A 1T4VH 4ISIH 3BEFB 2NWNA 1X7AC 3K6YA 1GHBF 2OTVA 3KQEA 4Y79A 5HIYA 4ZKRU 1Q3XA 4X2XA 3HKIB 4X6MA 3TK9A 3MH4A 3F9HA 1DFPA 2A7HA 2HGTH 1A5HA 1EPTC 1MBMA 1C5OH 1W7GH 3SORA 1UK2A 1SGQE 3IWMA 3ITIA 1PQ5A 1GI3A 2PP6A 1MKXK 4FUGA 1GDUA 4E7RG 3SU3A 4O3TA 2BD9A 2WINI 3U28C 2WZQA 2Z9IA 4NFEA 1Y59T 1HB0B 3SGQE 2TGPZ 2P95A 3D62A 3RU4D 1GBIA 3ATLA 4YM9A 1C4V2 1J15A 2EI8A 5HIZA 3TJUA 1O3KA 1ELVA 2M5TA 1DWDH 2LPRA 2HNTC 3FANA 4NIYA 2A4QA 4X1QU 3UOUA 3UUZA 1P2QA 1P3EA 4BANB 1BTHH 2D1JA 6CHAB 1UMAH 5BRRE 5LGOA 1HNEE 2J98A 4I8KA 2PLXA 2ZFRH 1JMOH 2HALA 2ULLA 1ZPBA 3A7WA 1TPOA 3PMAB 3SU6A 1D6RA 4AZ2B 1MTNB 5JBBS 2HOBA 4P00A 4FU9A 2ALVA 5J4SA 3BTTE 3FP8E 3GCHB 4ZXXH 4XSKU 2F91A 1E79D 4X2YA 1O5BB 1GDQA 1MCTA 3OYPA 4FVDA 1O32A 2FLRH 1O2RA 3MO3A 5GCHF 3UTUH 4AB8A 2J2UA 4KGAA 3K6ZA 1D6WA 1XUGA 5A0CA 3DUXH 3V0XA 3QLPH 3PMBB 1C5QA 2GZ9A 2ODPA 1P02A 3SU5A 1BT7A 2UUJB 2JJ1D 3Q3KA 6CHAC 6GCHG 1ANEA 8GCHG 2JIZD 1DX5M 1YGCH 3DSOA 3ELAH 3OY5U 4X6OA 2DE9A 3SI4H 4D9RA 5I46H 1EOJA 1O3BA 1SGPE 2GV6A 2Y6TA 2I6QA 1MTNC 5K0HA 3E1XB 2R2MB 5T6DA 1UVSH 2XTTB 3F2GA 3BTWE 4I8JA 5HYOA 1O2OA 5EU8A 3O8RA 2W6JD 2ZECA 1YP9A 3TJOA 1O30A 1P2MA 3RXVA 1AI8H 3SOSA 4DURA 1O33A 2R0LA 1KDQB 3ZZ8A 3PMJA 5FHTA 5EW2H 1J14A 1NROH 1U6QA 2CF9H 3LGIA 2ZKSA 4KTCA 1AWFH 4U32A 1HIAA 5TCAA 1MZDA 1T7CA 1GBAA 1AN1E 1MZAA 2WYGA 5EPYA 4YT7H 1Z6EA 2NU3E 1P04A 3SN8A 4AFQA 4F55A 2BD7A 4BTTB 3SNDA 1NY22 1HAXB 3ATIA 1OXGA 2VU8E 2SFAA 3BTME 4UEHH 1Y3YA 1SHYA 1LMWB 3T29A 1C2FA 2FWWA 4HGCA 1O3NA 3S9AA 2OC7A 1KXCA 4GLYA 5A2MH 1EQ9A 1AE8H 1INCA 1HXFH 1DY8A 1A2CH 2PTNA 2QYIA 1HJ8A 3OEHD 2CN0H 1P2NA 1L1NA 3Q76A 2PW8H 5GDSH 1XUJA 3RXOA 3SUFA 1P2OA 3LJJA 4X2WA 1S6FA 4AOQA 3QDZB 3H5CB 2A7JA 3QK1A 1OWDA 1VZQH 5C1YA 1S84A 2W7SA 1BOQA 1MKWH 5EXLA 5EW1H 1L1JA 2ZU1A 1QRZA 3PROA 5DP8A 1JRSA 1NBME 1Z8RA 3AW1A 1ZPZA 2WV5A 3RDZA 1LVOA 2WV9A 1JIRA 1BTPA 2F43B 3MTYA 2P16A 3RXEA 4LZ1H 1HBTH 1SQTA 3K9XB 1NZQH 2H9HA 4YT6H 1T31A 2G8TA 5L6NH 2W6ID 4TY7A 1HGTH 3S9BA 4DGJA 3FN8A 1OWHA 1SQAA 3QO6A 4IW4E 1A5IA 2H9TH 1SHHB 2KAIA 2A4GA 3E3TA 2KM0A 1ZMLA 1CBWB 3BF6H 1G3CA 1ZZZA 4XDEA 4OS5A 2EA3A 3E0PB 2ZHWH 4A92A 5H4IB 2A4RA 2F9VA 1GI9B 1DE7H 1LHCH 1XXDA 3L6PA 1CHOG 4OS4A 7GCHF 2ZDKA 5A0BA 3FZDA 2GD4B 3VG8A 5JBCS 5LPRA 3RC4A 3DA9B 2WPHS 2KR7A 4X0WU 1C2LA 1G36A 1GHZA 4MNXA 1IQKA 1MH0A 4CH8B 1EZQA 1ZJDA 2KX4A 4OS1A 2ZTZA 2J4IA 1PJPA 3ZVEA 3UQOA 1QCPA 1QJ6B 1MD8A 3LOXA 1CSOE 1DXPA 5L2YH 2C90B 3EA7A 3E6PH 4DOQA 3HK6B 3SYJA 3U98H 3SV7A 4AFZA 2O9QA 4DG4A 5T6FA 3UR6A 2AERH 3URDA 1C1MA 4BTUB 1O5GH 1CBWC 5LPFA 3UNRA 2ZIQH 1QURH 4INLA 3PRBA 5T1VA 1MAXA 8LPRA 3BV9B 3GY7A 1ELTA 1AZ8A 1N6YA 1KIGH 8ESTE 1RTKA 4XBBA 2OBQA 2FYQA 1O2HA 3EAJA 2UWLA 1V2JT 3V13A 3Q3YA 1C5ZB 3OU0A 2J95A 1TQ7B 1SSXA 3EQ0H 5DP7A 4BAQB 2Z7FE 4ZCNA 1FIZA 1HV7A 1O38A 1BQYA 2ZGHA 1Z6JH 1UVTH 1S82A 2SGPE 5E2OA 3GYLB 4RT0A 2BD8A 5TCCA 4YO9A 3LGUA 3MU4A 1ZRKA 5C1XA 1ANDA 1HDTH 2ODYB 2QXIA 1O2ZA 1V2NT 1D9IA 4DJZB 4D7GA 1WTHD 5DP9A 1NFXA 3SZEA 2OP9A 2HNTE 4GHTA 1M9UA 3MU8A 2YMSD 1FAXA 3UR9A 1B7XB 1GG6B 3GDSA 3F3BA 2ZPSA 6GCHF 8GCHF 2D26C 2FX4A 2EY4C 2H9EH 4AFSA 1QHRB 4JMYA 1T32A 2R0KA 5E0GA 5AVDA 3LGWA 1DANH 3RXPA 1YPHE 3GY4A 1RRKA 4K1EA 1ZMNA 2QIQA 5CDFE 4GPGA 3TVJB 3T25A 1EATA 1FIWA 4ABIA 2AMQA 3RP2A 3RXFA 3U8OH 1O5CB 1AE5A 2KCOA 1VKYA 4MNWA 3VB7A 2BTCE 3T28A 1HPGA 3P8OA 5C5NA 1YPLH 2P94A 3ZVDA 2TGDA 2FOEA 2O8MA 2UUFB 2ZWLH 3ENSB 4Q4LA 1DUEA 5E0HA 2J92A 3SUEA 1C5WB 4RKJB 1BTZA 2XBVA 2WSSD 2BQ7B 2G52A 3H7TA 3MU1A 1W0YH 2FIRH 3UIRA 1IHTH 3BSQA 1ANBA 1GG6C 2SGEE 1PPHE 4OGXA 1DOJA 2FYRA 1WDIA 1C4U2 3M3VA 1J17T 1JRTA 5EXMA 1C2JA 2FS9A 4DVAU 2PKSC 3T62A 4WVPE 1MTSA 1O3CA 3EDXB 2KCYA 3E16B 3MWIU 2ZZUH 2BLVA 2QCYA 1LHGH 4UD9H 1CA8B 3GYMA 1JBUH 5AF9H 1MTVA 3U8RH 3KQCA 2BOKA 5HKKD 2K8IA 1TGBA 7LPRA 3GY2A 3M5NA 1CT4E 1IQHA 2ZGCA 1D3PB 1CA0B 4WWYA 1YPMH 1D4PB 2J34A 1IOEA 2AIPA 2Y5FA 3C1KA 2ANWA 1G3EA 1KYNA 1NU9A 3OTJE 1ELCA 1IQLA 1C2EA 2ALPA 3ATMA 4X2VA 3GDUA 1H4WA 1N1LA 1OP8A 1PPGE 4IBLH 1YPJH 4Q7YA 1O31A 2HPPH 2P3UB 1GI8B 1C5SA 1O3FA 2FP7B 2RG3A 2Y7ZA 5DSFA 3U9AH 4CR5A 3C27B 2Z3DA 1SGNE 1BTXA 2BDAA 3ZZ4A 3BTKE 1V2WT 2XNDD 1UCYK 1EZUC 1FUJA 1OSSA 1TONA 2XCFA 1ID5H 2GTBA 4LXBH 1P3CA 1C1WH 1SLWB 1UK3A 2A5KA 4X8VH 4DCDA 1UHBB 1EAUA 2FEQH 2O8WA 1CA0C 2VINA 2V6NA 1GGDC 2QE7D 1EJNA 1C5UA 2O8TA 1ANCA 1NC6A 2ZFQH 3TU7H 3ODFA 1F5LA 1EAIA 1K1MA 1SG8B 2BD2A 2A5AA 4CBOA 1PQ8A 4WH8A 2KCPA 1ETTH 2F9NA 4ZKSU 3RXQA 2AYWA 1TGCA 4O03A 1ELDE 1GMDF 2QF3A 4I31A 2HVYB 4K69A 2CF8H 5DP6A 3ZYEA 1A3EH 2FESH 2YNAA 4TWYA 1KLJH 3CP7A 1VR1H 1O39A 2XYAA 4U30A 2AS9A 4I8HA 3FVFB 3M5MA 3GCNA 2PHBA 4ABJA 3WW7A 4B71A 1NT1A 4YXWD 4FUIA 3KNXA 1F0SA 2J97A 1SLUB 2OXSA 2VVUA 1GJDB 2FI3E 4CRCA 2BD3A 2A32A 2C3SA 3LDXH 1TIOA 1C1VH 1FY4A 1HAVB 1OS8A 1YPEH 2GCTB 5C20A 3U69H 5EIYA 3RXBA 1XUFA 3NUMA 3GOVB 3GCTF 1MQ6A 2QAAA 2CGAA 4B2CA 1W2KH 2CHAB 5FXLA 4R8TB 2W5EA 1ESBA 3TGJE 3SGAE 1C5LH 1K1OA 4MTBA 5FX6A 1HLTH 1NU7B 1W8BH 3LC5A 2BYAX 5IYTA 3B23B 3KYGA 2YMSB 2R3YA 2ZPRA 2ZFSA 4HZHA 2GGVB 4YOJA 3S7KB 1PPBH 2G81E 2TGAA 4NA8A 1GVKB 1GVZA 1IHSH 1A61H 3P8GA 3A7XA 1IQEA 2CMYA 1TB6H 4H42U 1L1GA 1ZSJA 1YC0A 2EQNA 4HG6A 4Z1MD 4IS5A 4HFPB 3GY8A 4OGYA 2G51A 5EQSA 4E05H 3M5OA 4FUJA 1A0HB 5FPTA 1MTWA 3LONA 4MDSA 3AAVA 1UTLM 1NM6A 2GCTC 3DCLA 1VCPA 4CREA 1GHWH 4CRFA 2FOHA 4Y76A 2TBSA 2RA0A 1CHGA 2QF5A 3FAOA 3KQDA 4HI3A 1K21H 3M36A 4X6PA 2ZTYA 2OD3B 3RU4E 2CHAC 2ZC9H 1C5TA 1AZZA 1AB9B 1GBEA 1G30B 1T8LA 4NZLA 4JCNA 1E0FD 4AYVB 5JBTA 1COWD 1GDNA 1GMCF 1JOUB 3O8CA 3Q00A 4Y7AA 4OM9A 1PPEE 2ZQ1A 2YMSC 4TWWA 2BB4A 4GUXA 2OUAA 3R3GB 4Y8XA 3GICB 2HNTF 4DW2U 3BTGE 2L74A 4LOYH 4X6NA 2Z3CA 4BXSA 1AD8H 1VJ9U 2FO9A 4I33A 4ZAEA 1H9HE 1LVYA 3MH7A 1P01A 4XBCA 5B6LA 2FI4E 2ZGJA 1F5RA 4ISNA 2ZNKH 4IC5A 3UB0A 3RMOH 1DWBH 1V2MT 1T8NA 3AVZA 3BG8A 1P8VC 3A7VA 1DICA 3KQBA 3ZVFA 1UJ1A 1EXFA 1C5RA 1W13U 4H4FA 3RXRA 1QRWA 1AB9C 3NZIA 2FOBA 1O3LA 2WPIS 4UE7H 3M7TA 3OX7U 1GBKA 3RMMH 1IQJA 3TITA 3U1IB 2VIVA 2J98B 3M3TA 1V2ST 1GJBB 2G55A 1EJAA 3A7YA 2Q6DA 7ESTE 4B2AA 2BXTH 5JDUB 1HCGA 1SOTA 4FVBA 2DUCA 3BTEE 3OE7D 3SNBA 1BJUA 1MCVA 2RFKC 5DGJA 1S81A 3E0NB 2ZEBA 3VXFH 4AFUA 1WXRA 1K28D 3N7EA 3VB3A 2BMGB 4WH6A 2VNTA 1JWTA 5FCKA 3QN7A 1MKXH 3RLYH 1XKAC 3I78A 2R3UA 1GJ5H 1HRTH 1GPZA 1YM0A 5GNDA 2Y7XA 1EB1H 4CHAB 1P11E 1W0JD 4B76A 3RXIA 3RXLA 3PMHB 1P9SA 2XWBI 2H1UA 3MQKC 2BD5A 5FCRA 2QF4A 1D3QB 3FKSD 2Q6GA 5ABWA 3N99A 1XVOA 1XMNB 1O3IA 1S6HA 1YYY1 3PRDA 1AU8A 3BG4B 1DY9A 1GJ4H 1WUNH 3T27A 4DIIH 1PPFE 4IMQA 2Z3EA 3MMGA 4GCHG 4IC6A 3EYDA 2KCAA 1JIMA 1ETRH 1TMUH 2VWMA 1SGCA 4Y8ZA 2F9BH 5C5OA 4A7IB 1C5MD 1TMTH 1YCPM 1C5NH 5FPSA 1ELAA 3ZZDA 1SVPA 1YCPK 4CHAC 3ZZBA 1TGSZ 1H9LB 1GI1A 1CGHA 4CRDA 1HIAB 3A83A 3OFND 4Y8YA 3BTHE 1SFIA 2P8OB 4CRAA 2ZDLA 1Y5BT 2PUQH 1TNKA 2OK5A 1XX9A 1WV7H 1VITF 3DFJA 1O2SA 4UFGH 1GMHF 3OEED 1DVAH 2JH5D 1L0ZA 2VWNA 3RXAA 3BG4C 2ZU3A 1RFNA 3M35A 2DE8A 1AIXH 2NU2E 3E90B 3SV2H 1MTUA 1SQOA 1TNLA 1NS3A 1TNHA 3VEQB 1O2IA 1EKBB 4BTIB 4RI0A 1BRAA 1K1NA 4X8UH 1OX1A 2C8XB 1BHXB 3F1SB 4X1NU 4AGKA 3P17H 1UTQA 2Z94A 3RXDA 1RS0A 2C8YB 1WYKA 2AMDA 3ZZCA 4FUFA 1TMBH 2BDHA 1Z1IA 1BMMH 5DJ7A 1QFKH 2AGIX 1UVUH 2ZHFH 4D9QA 1AKSA 3L3TA 2XC4A 2P8OC 3MU0A 4CRGA 1BHXF 1S83A 4ABHA 3O8DA 5E2PA 1C1UH 1O2UA 4M9FA 3RMNH 3M5LA 1BRBE 4E7NA 4BOHA 4AB9A 1BCUH 2SGDE 4B75A 3RU4T 2FX6A 3F2HA 2V3OH 3SJIA 3FO8D 4Q7XA 5TJXA 2QA9E 2BHGA 4MG3A 4ABGA 1P0SH 4JZFH 3A80A 4H6TA 2Y81A 1OYQA 3BN9A 4J2YB 1E35B 4FETA 1TABE 2Q6FA 2Z6BD 1SB1H 1LCYA 4LK4A 3GY6A 5GJ4B
chains in the Genus database with same CATH topology
2J97A 2J98B 2J98A 5C94A 1QZ8A 5HIYA 1UW7A 5HIZA 3EE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J97 A;  2J98 B;  2J98 A;  5C94 A;  1QZ8 A;  5HIY A;  1UW7 A;  5HIZ A;  3EE7 A; 
#chains in the Genus database with same CATH topology
 1YPK H;  5LPE A;  3DD2 H;  2JH6 D;  4KTS A;  3K65 B;  1XUK A;  3BTQ E;  2KAI B;  4K1S A;  1GBT A;  1TA6 A;  2KZ4 A;  1W14 U;  1W3C A;  3SJ9 A;  3ATW A;  1HFD A;  2GZ8 A;  1OPH B;  1F7Z A;  1B0F A;  4MNY A;  1TPS A;  4ZRO A;  1Y3V A;  3D23 A;  3RXT A;  3SBK A;  1MU6 B;  4ISH H;  3STJ A;  2YNB A;  1BIO A;  3ZIA D;  2VJ1 A;  4P02 A;  3I29 A;  1HAG E;  3F6U H;  1N6X A;  3ZVG A;  1W0K D;  1XXF A;  3N7O A;  1O2P A;  1FV9 A;  1K0H A;  2SNW A;  2QV1 A;  5G4B A;  1WAY B;  2ZO3 H;  3SV6 A;  5EGM A;  1O5A B;  1OP2 A;  4JK6 A;  5JB9 S;  1GBB A;  1A0J A;  1J9C H;  2ZU2 A;  2GT7 A;  3P92 A;  2Z9J A;  2PGB B;  4LZ4 B;  1PPC E;  2WPK S;  1C1O A;  1UTN A;  3RXK A;  1LPK B;  5DK1 A;  3ZVA A;  2ASU B;  2ZGX H;  1L4D A;  3A8B A;  1AVX A;  1LPG B;  2IPH A;  1TAL A;  3UNQ A;  3WWF A;  4NIW A;  3JZ1 B;  3LKW A;  1C1N A;  3QZQ A;  5LH8 A;  1Q31 A;  1QR3 E;  1GBM A;  2FZZ A;  1QGF A;  1FY1 A;  3L33 A;  1S6L A;  1O2J A;  2ZA5 A;  2GCH G;  2ZCK P;  1O37 A;  3MYW A;  4ASU D;  5GXP A;  1Z7K A;  1GBC A;  2BLO A;  1TOC B;  4Z0K A;  3PO1 B;  3RUO A;  4BAK B;  1DWE H;  1EP5 A;  1FY3 A;  3SO3 A;  1GI4 A;  1SKY E;  1ZYO A;  2M2A A;  1TRM A;  1BRU P;  3LT3 A;  2GMT B;  1OP0 A;  1CQQ A;  2A5I A;  3TGK E;  3Q77 A;  2JDI D;  3A84 A;  5E0J A;  1SOZ A;  3SU2 A;  5HM9 A;  1C1S A;  5HM2 A;  1ELE E;  2C8Z B;  3URC A;  1GHA G;  2G5N A;  3R0F A;  4JZE H;  1TBR H;  3LPR A;  3A89 A;  3E8L A;  3LH1 A;  2ZDN A;  3MU5 A;  4MNV A;  1RTF B;  5J4Q A;  1EFR D;  2FI5 E;  1OKX A;  1L2E A;  3W95 A;  2ODQ A;  2TPI Z;  1AQ7 A;  4YOG A;  1ZHP A;  1WBG B;  2VIO A;  2AMP A;  4UFF H;  1W11 U;  3PLP A;  3A85 A;  2VVV A;  1UTO A;  3TK5 A;  4DY7 B;  2FOC A;  1ZTJ A;  5FPY A;  1ABI H;  3PO1 C;  3QWC H;  1Y3W A;  4Y71 A;  2BQ6 B;  3A8D A;  2RA3 A;  5FBE A;  1K9O E;  5C0T A;  1E37 B;  1HJA B;  1QL7 A;  2PKS B;  4GCH F;  2GMT C;  1MQ5 A;  4ABB A;  1P57 B;  2B7D H;  2XBX A;  2OCV B;  3VB5 A;  1F92 A;  2WUB A;  1O3H A;  3KF2 A;  2CK3 D;  4TY6 A;  4X1R U;  1O2W A;  1GHB G;  1SGY E;  1WQS A;  1Z1J A;  3H7O A;  1QBN A;  2QXG A;  1H8I H;  5CHB A;  1QTF A;  3CEN A;  8KME 2;  2H5C A;  4OS7 A;  3S7H B;  1DSU A;  1QB1 A;  4XE4 A;  4JZD H;  1MAB B;  3TJV A;  1FON A;  1C2G A;  4MQA A;  2LP6 A;  1V3X A;  1WCZ A;  1HAO H;  1ZPC A;  1QZ8 A;  4CBN A;  1C5Y B;  1HJA C;  1WTG H;  3F9E A;  1GJ7 B;  2TGT A;  3UOP A;  3UWJ H;  1UVP A;  1A0L A;  1AUT C;  1CGJ E;  1LDT T;  5FX5 A;  1EST A;  1RJX B;  4CR9 A;  5JPM H;  1FN8 A;  3TNS A;  1UVO A;  4ZKO U;  3UFA A;  1O2N A;  1HAY B;  2GDD A;  3RLW H;  2ZF0 H;  1FY8 E;  1GGD B;  3U1J B;  2ZI2 H;  2VID A;  4INK A;  2Y82 A;  1DLE A;  1GHX H;  1ZR0 A;  3HK3 B;  2ZCH P;  4F49 A;  3RXJ A;  1J16 A;  3QUM P;  5L30 H;  1XKB C;  3S69 A;  1MBQ A;  1TAW A;  3A81 A;  1QL9 A;  2NU4 E;  1BBR K;  1TX7 A;  5EOK A;  1DIT H;  1SGI B;  4O9V A;  5C67 A;  3KHV A;  3PB1 E;  1TPP A;  1UTK A;  2UUK B;  1DST A;  2VH0 A;  4K5Z A;  5FBI A;  4RT1 A;  1F0R A;  4MPW A;  3SJ8 A;  2BD4 A;  1IQG A;  3AAS A;  1PFX C;  1V2R T;  1O35 A;  1VIT H;  1CT0 E;  3P70 B;  5JB8 S;  4ZXY H;  1ARB A;  4PRO A;  5KGO A;  4NG9 H;  3W1E A;  4BXW A;  3LGT A;  1QJ7 B;  3ZVC A;  1QBV H;  5GCH G;  2G4U A;  4JZ1 A;  2TIO A;  2HRV A;  4UFD H;  4MVN A;  3TH2 H;  1DM4 B;  4BAM B;  2PSY A;  1HXE H;  1G3B A;  4ABA A;  4NZQ A;  1FJS A;  2QC2 A;  2EEK A;  1V2T T;  2FOD A;  2BOH B;  4DT4 A;  5C94 A;  3VGC B;  3RXG A;  4O3U A;  3A86 A;  1Y3X A;  3ZZ6 A;  4WMF A;  3BEU A;  1DUA A;  4DT7 B;  1AO5 A;  1FPH H;  4XOJ A;  3SQH E;  2FOA A;  1HAP H;  1HAH H;  1ZLR A;  1THP B;  1CHO F;  3LH3 A;  3TK6 A;  3QGJ A;  1GJ6 A;  3EST A;  1ACB E;  1FNI A;  1BBR H;  3UAI C;  4X8T H;  2F4L A;  4ASH A;  1QRX A;  2H2Z A;  3AAU A;  3SNA A;  3LU9 B;  4XD7 D;  2QY0 B;  1O5F H;  3TH3 H;  1FAK H;  2AGE X;  2FTL E;  5IDK A;  3MO6 A;  4Q80 A;  1ZTK A;  1EAS A;  2V3M A;  2ZQ2 A;  4AOR A;  1NFU A;  3SJK A;  4R0I A;  1LQD B;  4A1V A;  3PV4 A;  1AVG H;  3LC3 A;  4ZHM U;  1P2I A;  1V2Q T;  5T6G A;  1RGQ A;  5AFY H;  2GT8 A;  1LQE A;  1UCY H;  3BIU H;  3SHC H;  4B6E A;  1K1L A;  1Y3U A;  1FQ3 A;  4Y0Y E;  3EE7 A;  1WSS H;  1IQI A;  1BIT A;  1EAX A;  3VGC C;  1DLK B;  1O3P B;  2B5T B;  3WY8 A;  4MPV A;  1TQ0 B;  1YKT A;  5A8X A;  2GJG A;  1O0D H;  2RDL A;  3MO9 A;  5HGG A;  3SU1 A;  1UCY E;  2WUC A;  1H8D H;  1AY6 H;  1HUT H;  2ANM H;  2ZU4 A;  2BVR H;  1KXB A;  1F0T A;  3TJN A;  2AIQ A;  4Y6D A;  9EST A;  5K7R A;  1GHV H;  4ZUH A;  3ZZ7 A;  3SU0 A;  1F5K U;  2UUY A;  2A4O A;  1GBD A;  1NPM A;  1O34 A;  2FXR A;  2WPD D;  1LKB A;  1T8M A;  2JJ2 D;  1XVM A;  2Z9L A;  1V2L T;  4NSY A;  1TRY A;  2W7U A;  4RSP A;  4ISO A;  3PWC A;  3A88 A;  4FUH A;  4AYY B;  1V2U T;  2XBW A;  3GY3 A;  4UON A;  1YLC A;  5EJ1 A;  1VGC B;  1EPT A;  2ANY A;  1C4Y 2;  1C9T A;  3RXC A;  3SV8 A;  2EST E;  3QX5 H;  1C1T A;  1ZTL A;  1YPG H;  4JYV H;  4JZI A;  1ZGV A;  4ZHL U;  2BX4 A;  3QGN B;  2VBC A;  2L6O A;  2XCN A;  3F0O A;  2WHX A;  1LVM A;  1TNG A;  1YBW A;  2VH6 A;  2BDY A;  2VIP A;  2GDE H;  3MNB A;  3G01 A;  4FXG H;  2XC5 A;  3SUD A;  1Q2W A;  1Y5A T;  3M37 A;  4CRB A;  4VGC B;  5A0A E;  1O3J A;  2OBO A;  2Y80 A;  1SI5 H;  3PLB A;  2FOM B;  7GCH G;  1L4Z A;  2W26 A;  3TNT A;  1UTP A;  1C1P A;  3N7D A;  5C17 A;  1ZJK A;  2CV3 A;  3MHW U;  1C2M A;  2WPL S;  2ZHE H;  1QA0 A;  1G9I E;  3URE A;  1GJA B;  3M7Q A;  4TSF D;  5DN6 D;  1VGC C;  3V12 A;  3EGK H;  1BTW A;  2VIW A;  2HPQ H;  4AN7 A;  4FUD A;  4AC9 A;  2FOF A;  1SPJ A;  2BDI A;  3SGB E;  1F2S E;  4QT8 C;  1C9P A;  1GL1 A;  1VJA U;  3DHK H;  1KLI H;  5ESB A;  5DP5 A;  2B9L A;  2PUX B;  1TWX B;  5JBA S;  1GCD A;  2PSX A;  1ZHR A;  1A5G H;  1O3O A;  3PWB A;  4K2Y A;  1P2J A;  3A8A A;  2GX4 A;  1Z8G A;  3RXU A;  1C2K A;  4M7G A;  4VGC C;  2FS8 A;  1KTS B;  5FL7 D;  1C5P A;  1XUI A;  3IIT A;  2WPJ S;  1FDP A;  1AFE H;  3NWU A;  3NXP A;  2XBY A;  4YLQ H;  1P03 A;  2EI6 A;  2XWA A;  1GI6 A;  1V2V T;  2AFQ B;  1ZHM A;  1CT2 E;  1B5G H;  3KQ5 A;  1O2Y A;  2B0F A;  1DWC H;  2UWO A;  2F3C E;  1KLT A;  4UDW H;  5AHG H;  3AW0 A;  3LGY A;  1KXE A;  1YPH C;  3FP7 E;  3KYF A;  2SGA A;  2A2Q H;  2STB E;  1QY6 A;  3E91 A;  5C1U A;  2IOT A;  3LJO A;  4U01 A;  1YLD A;  3SW2 B;  3NKK A;  1P06 A;  2P3F H;  3SU4 A;  3KL6 A;  1DDJ A;  1W7X H;  4GVU A;  4EST E;  3T26 A;  1ORF A;  3GDV A;  5FAH A;  3SQE E;  2BM2 A;  1TBZ H;  2ZDA H;  1QB9 A;  1VCW A;  2Q1J A;  2ZG0 H;  3PTB A;  3OTP A;  4INH A;  3HKJ B;  2Z9G A;  1OWI A;  2BY9 X;  1AMH A;  1OWE A;  1A1R A;  1C5V A;  4I8G A;  1SGT A;  2HVX A;  2AHM E;  3KN2 A;  1MAY A;  3S9C A;  1OHH D;  4Q7Z A;  2Y5G A;  2XXL A;  3F68 H;  2A2X H;  1TBQ H;  1NFW A;  2H5D A;  2AGG X;  4MLF B;  4B6F A;  1RTL A;  3B9F H;  4B74 A;  7KME H;  4WJG 2;  4BAH B;  1BMN H;  5DPA A;  3ZZ5 A;  2LNC A;  2BY5 X;  3SJO A;  2PTC E;  3JZ2 B;  3IG6 B;  3BTF E;  3GCH C;  1KXD A;  2ANK H;  1PYT C;  1KXF A;  4RN6 A;  5EQQ A;  2GKV E;  1C1Q A;  1O3M A;  1V2P T;  4J1Y A;  1EZX C;  2R9P A;  2A31 A;  3BIV H;  4GAW A;  5EJL A;  1BZX E;  2PKA B;  1P09 A;  2BY8 X;  5HMA A;  4YZU A;  3ODD A;  2PKA A;  3T2N A;  3I77 A;  1KDQ A;  1WU1 A;  2WPM S;  4A6L A;  4Y0Z E;  3A8C A;  4BAO B;  1NES E;  1MKW K;  3DSP A;  3VB4 A;  3V7T A;  1O2V A;  3F2F A;  4FU8 A;  3EE0 B;  5EOD A;  1C2H A;  1SLX B;  4IMZ A;  4GHQ A;  3RML H;  2VVC A;  2GVF A;  4AGJ A;  1LPZ B;  4I8L A;  3TGI E;  3RXM A;  4K1T A;  3VB6 A;  3VXE H;  3ATK A;  2FPZ A;  1TOM H;  1FI8 A;  3HAT H;  4FU7 A;  1AKS B;  1EX3 A;  1YCP H;  3PV2 A;  3HPT B;  1GBJ A;  1BTU A;  1E38 B;  4F48 B;  4NA9 H;  2ZFT A;  3D49 H;  1A7S A;  1O5D H;  2W3K A;  3T5F H;  4NIV A;  1O3E A;  1LHE H;  1H8H D;  3RXS A;  2OC1 A;  1SGF A;  1H1B A;  1W10 U;  1THR H;  1HAZ B;  1E1R D;  1QNJ A;  3PM3 A;  4Q2K A;  2VGC B;  2I6S A;  1SL3 A;  1G37 A;  4CH2 B;  3BTD E;  1A46 H;  1C2I A;  1F0U A;  2AEI H;  4SGB E;  1E1Q D;  3P8F A;  4KP0 A;  1C5X B;  2G5V A;  1PQA A;  1BDA A;  1EAW A;  1QL8 A;  1GBH A;  1ZSL A;  2J5U A;  3OAA D;  2OIN A;  4Y11 E;  4TPY A;  1D3D B;  4UFE H;  9LPR A;  3MH5 A;  2K1Q A;  3ZZA A;  2XRC A;  4ZKN U;  4B2B A;  5C3N A;  4WY3 A;  5CHA B;  1SBW A;  3NCL A;  5CE1 A;  2BDB A;  4BNR A;  2ZGB H;  1O3A A;  1FN6 A;  2D2D A;  3SUG A;  4JYT A;  6EST A;  1P05 A;  1GHY H;  3EA9 A;  1BA8 B;  1RIW B;  3HGP A;  2JET B;  2B8O H;  1LTO A;  3UY9 A;  1BMF D;  4ABE A;  1ELF A;  1FY5 A;  4F4O C;  1AWH B;  3KEE A;  1ZMJ A;  2OQU A;  3DFL A;  2BLW A;  4K60 A;  1C1R A;  1QIX B;  2OC0 A;  2VGC C;  5F8X A;  5KED A;  1GI2 A;  2HLC A;  2OLG A;  1NBM D;  1HYL A;  1O2L A;  2O8U A;  1AFQ B;  2F83 A;  4AG1 A;  2K0Q A;  2ZDM A;  3H09 A;  1TPA E;  1B0E A;  1N8O B;  2ZU5 A;  3SHA H;  1EZS C;  1K1J A;  3TH4 H;  2XNI A;  1ETS H;  1UO6 A;  2LEL A;  3SNC A;  1GMD G;  1GI7 B;  4NIX A;  4D7F A;  1NFY A;  2ILN A;  1IQF A;  3SZN A;  1T8O A;  5CHA C;  1CGI E;  1CO7 E;  3RM0 H;  3UQV A;  4I7Y H;  2NU1 E;  1EJM A;  3W94 A;  1IQN A;  1TE0 A;  4OS2 A;  3A87 A;  1GCT B;  5EXN A;  5F8Z A;  1FPC H;  4GSO A;  4JYU H;  1O3G A;  2ZFF H;  1IAU A;  1RIW C;  2JET C;  5T3H A;  2QXJ A;  3RC6 A;  1FX0 B;  1GWA A;  4O97 A;  4NWL A;  3FOA A;  1EOL A;  3VFE A;  2JH0 D;  2OC8 A;  1LKA A;  1O2T A;  1S0Q A;  3QTV H;  2V35 A;  3AK5 A;  2EC9 H;  5HXF A;  1YF4 A;  1KXA A;  3GCT G;  1SMF E;  2G4T A;  3WWB A;  1XUH A;  3OY6 U;  2ZHD A;  1P2K A;  4D8N A;  2CJI A;  4NSV A;  1AHT H;  3ZVB A;  1AFQ C;  1GL0 E;  1TA2 A;  3NK8 A;  4JK5 A;  4ABF A;  2BLQ A;  3FFG A;  3P8N A;  1ELG A;  1S5S A;  2BVS H;  1J8A A;  5A8Z A;  1N8O C;  3SI3 H;  2A0Q B;  2BDG A;  2QF0 A;  4RKO B;  1HAI H;  1BML A;  2BXU H;  3D65 E;  2SGF E;  1KY9 A;  1P12 E;  1O36 A;  1ZOM A;  1D3T B;  2ZFP H;  5F03 A;  1P10 A;  4A1T A;  1ARC A;  4NA7 A;  3MNS A;  4KEL A;  1LHF H;  3B8J A;  3O8B A;  4X8S H;  2F9U A;  4NCY A;  1LVB A;  2IPQ X;  1GCT C;  1EB2 A;  3F9G A;  3HGN A;  1W0Z U;  1V2O T;  4Y10 E;  4HTC H;  1AVW A;  4WXI A;  4KTU A;  3UWI A;  5BPE A;  3LGV A;  1Y8T A;  1O3D A;  2J9N A;  2V0B A;  1SGD E;  3RC5 A;  3CNR A;  1TGT A;  1O2G H;  1OWK A;  1H8E D;  1NRR H;  1GJ9 B;  3FZZ A;  5DP4 A;  1S85 A;  1DXW A;  5F6M A;  4AG2 A;  3P6Z B;  2P3T B;  4ISL A;  1OWJ A;  2FDA A;  4A5T S;  3UPE A;  2A45 B;  3P95 A;  1Z8I B;  3NRL A;  2BY7 X;  1YY3 A;  1GMC G;  2PGQ B;  2EI7 A;  1TFX A;  1ZSK A;  4Q63 A;  4FUB A;  1AUJ A;  5B6O A;  2HLD D;  1CE5 A;  3KCG H;  4MPX A;  3RXH A;  3GCO A;  1EUF A;  2D8W A;  3PTN A;  5GIB A;  1TYN A;  2BVX H;  1DPO A;  1DS2 E;  2VIQ A;  5EST E;  3FP6 E;  3CS7 A;  4THN H;  5DKM A;  5E8E H;  1QJ1 B;  4WMD A;  2VB0 A;  4A1X A;  2Y5H A;  1PPZ A;  1QQ4 A;  5ETX A;  4ACB A;  1A3B H;  5I25 A;  3F9F A;  5AFZ H;  1TLD A;  1BMA A;  2STA E;  3TLO A;  1SR5 C;  3V3M A;  5CMX H;  1LHD H;  1RD3 B;  3DT0 H;  2J38 A;  2XW9 A;  2F9P A;  5DO4 H;  1A4W H;  2WV4 A;  2IJD 1;  4B73 A;  1OOK B;  4X1S U;  1ZRB A;  4AX9 H;  2JKH A;  4TYD A;  1GJC B;  1V6D A;  4MPU A;  3VPK A;  1NRP H;  2PV9 B;  1ESA A;  4X1P U;  3CS0 A;  3M3S A;  4IN2 A;  3Q3X A;  1E34 B;  3MFJ A;  1NN6 A;  2QGR A;  3M7U A;  2BX3 A;  2AH4 X;  2BZA A;  1KTT B;  4ACA A;  1KSN A;  1QBO A;  3MH6 A;  1TX6 A;  2IJO B;  2ZCL P;  1AGJ A;  1FMG A;  2A7C A;  2GV7 A;  2ZDV H;  4YES B;  5L2Z H;  3A7Z A;  2PR3 A;  1BJV A;  3SNE A;  1MMJ N;  5EPN A;  1SGR E;  1O2M A;  4SGA E;  1GBF A;  1FZZ A;  2BQW B;  2QN5 T;  2ZTX A;  3GS9 A;  3F0P A;  1G32 B;  1THS H;  4IGD A;  3ZYD A;  5F53 A;  2Z9K A;  1G3D A;  5F8T A;  5EQR A;  1QQU A;  2BY6 X;  3ZV8 A;  2QXH A;  1O2X A;  1WOF A;  2RDE A;  4FOU C;  2XOK D;  1SGE E;  4K8Y A;  1MD7 A;  1T4U H;  4YLU A;  1UW7 A;  2GZ7 A;  4Y7B A;  5IK2 D;  1O2Q A;  1PYT D;  2CXV A;  1RXP A;  6LPR A;  1UK4 A;  2PWX A;  2IN2 A;  3PLK A;  5EJZ A;  3STI A;  1ABJ H;  2NU0 E;  1EP6 A;  3GY5 A;  2C4F H;  1K1I A;  2SGQ E;  1BTY A;  1FXY A;  5SGA E;  3MOC A;  5A8Y A;  3M61 U;  1TNI A;  4U2W A;  2BZ6 H;  1SFQ B;  1UHB A;  2PFE A;  3A82 A;  2VWO A;  3UNS A;  1MU8 B;  1S0R A;  1V2K T;  5JYI A;  1TRN A;  4ABD A;  3TPI Z;  1W12 U;  4H6S B;  3MI4 A;  1BBR E;  3NPS A;  5EG4 A;  2P93 A;  1SQR A;  2THF B;  2J94 A;  5PTP A;  3GIS B;  4K3J A;  4I32 A;  2P59 A;  1OYT H;  1VIT G;  1GVL A;  3QZR A;  1C2D A;  1GI0 A;  4XFQ A;  1GMH G;  2HWL B;  2UWP A;  1NRN H;  3RM2 H;  5DG6 A;  3BEI B;  2TRM A;  4XRN A;  4E06 H;  3TIU A;  1ELB A;  4WXV A;  2ZPQ A;  5KEC A;  1H9I E;  1UTJ A;  1E36 B;  1IQM A;  3MNX A;  1Z71 A;  4IN1 A;  2F9O A;  3S0N A;  1K2I 1;  1Z8J B;  1YLN A;  5GPI B;  2GCH F;  2SNV A;  3ZZ3 A;  1BUI A;  1KMH B;  2YOL A;  2C93 B;  2RCE A;  1NRS H;  2ZP0 H;  4KKD A;  3ZZ9 A;  1O2K A;  3DSG A;  4Z6A H;  1MUE B;  2G00 A;  2ZHQ H;  4NWK A;  1Y5U T;  1JXP A;  1P9U A;  4ZHA A;  2FLB H;  1BB0 B;  4YTA A;  4WME A;  3KID U;  1HAV A;  1BRC E;  2OQ5 A;  1TGN A;  1XM1 A;  3K2U A;  1CVW H;  3OSY A;  2C8W B;  3KGP A;  4NGA H;  3PYH A;  3PV5 A;  1GHA F;  2FTM A;  1K22 H;  4DIH H;  3A7T A;  4B1T A;  3U8T H;  4FUE A;  2R2W U;  1PQ7 A;  1SLV B;  4TT3 D;  5C0U A;  1SGF G;  1VCQ A;  2A1D B;  1ZGI A;  2O8L A;  2V3H H;  4YOI A;  1NO9 H;  4TPI Z;  4OS6 A;  5DP3 A;  1DT2 A;  1G2M A;  1K1P A;  2FOG A;  3EA8 A;  4I86 A;  1EPT B;  2KFW A;  1SC8 U;  1HJ9 A;  5C2Z A;  3QTO H;  5A09 A;  2W3I A;  3SV9 A;  3MNC A;  1QA7 A;  5GWZ A;  1FLE E;  1TX8 A;  1UTM A;  4NFF A;  1NTP A;  1WQV H;  4WF8 A;  1NRQ H;  2GP9 B;  1G2L A;  4XBD A;  4FUC A;  1GBL A;  2WYJ A;  4D76 A;  2FMJ A;  2BDC A;  4ZMA H;  1TNJ A;  1GI5 A;  4K8B A;  1LO6 A;  2FM2 A;  2VWL A;  1CU1 A;  1GJ8 B;  3ZV9 A;  1O5E H;  1YWU A;  2H6M A;  2XC0 A;  3LIW A;  2V7Q D;  4ZH8 A;  1QB6 A;  1T4V H;  4ISI H;  3BEF B;  2NWN A;  1X7A C;  3K6Y A;  1GHB F;  2OTV A;  3KQE A;  4Y79 A;  5HIY A;  4ZKR U;  1Q3X A;  4X2X A;  3HKI B;  4X6M A;  3TK9 A;  3MH4 A;  3F9H A;  1DFP A;  2A7H A;  2HGT H;  1A5H A;  1EPT C;  1MBM A;  1C5O H;  1W7G H;  3SOR A;  1UK2 A;  1SGQ E;  3IWM A;  3ITI A;  1PQ5 A;  1GI3 A;  2PP6 A;  1MKX K;  4FUG A;  1GDU A;  4E7R G;  3SU3 A;  4O3T A;  2BD9 A;  2WIN I;  3U28 C;  2WZQ A;  2Z9I A;  4NFE A;  1Y59 T;  1HB0 B;  3SGQ E;  2TGP Z;  2P95 A;  3D62 A;  3RU4 D;  1GBI A;  3ATL A;  4YM9 A;  1C4V 2;  1J15 A;  2EI8 A;  5HIZ A;  3TJU A;  1O3K A;  1ELV A;  2M5T A;  1DWD H;  2LPR A;  2HNT C;  3FAN A;  4NIY A;  2A4Q A;  4X1Q U;  3UOU A;  3UUZ A;  1P2Q A;  1P3E A;  4BAN B;  1BTH H;  2D1J A;  6CHA B;  1UMA H;  5BRR E;  5LGO A;  1HNE E;  2J98 A;  4I8K A;  2PLX A;  2ZFR H;  1JMO H;  2HAL A;  2ULL A;  1ZPB A;  3A7W A;  1TPO A;  3PMA B;  3SU6 A;  1D6R A;  4AZ2 B;  1MTN B;  5JBB S;  2HOB A;  4P00 A;  4FU9 A;  2ALV A;  5J4S A;  3BTT E;  3FP8 E;  3GCH B;  4ZXX H;  4XSK U;  2F91 A;  1E79 D;  4X2Y A;  1O5B B;  1GDQ A;  1MCT A;  3OYP A;  4FVD A;  1O32 A;  2FLR H;  1O2R A;  3MO3 A;  5GCH F;  3UTU H;  4AB8 A;  2J2U A;  4KGA A;  3K6Z A;  1D6W A;  1XUG A;  5A0C A;  3DUX H;  3V0X A;  3QLP H;  3PMB B;  1C5Q A;  2GZ9 A;  2ODP A;  1P02 A;  3SU5 A;  1BT7 A;  2UUJ B;  2JJ1 D;  3Q3K A;  6CHA C;  6GCH G;  1ANE A;  8GCH G;  2JIZ D;  1DX5 M;  1YGC H;  3DSO A;  3ELA H;  3OY5 U;  4X6O A;  2DE9 A;  3SI4 H;  4D9R A;  5I46 H;  1EOJ A;  1O3B A;  1SGP E;  2GV6 A;  2Y6T A;  2I6Q A;  1MTN C;  5K0H A;  3E1X B;  2R2M B;  5T6D A;  1UVS H;  2XTT B;  3F2G A;  3BTW E;  4I8J A;  5HYO A;  1O2O A;  5EU8 A;  3O8R A;  2W6J D;  2ZEC A;  1YP9 A;  3TJO A;  1O30 A;  1P2M A;  3RXV A;  1AI8 H;  3SOS A;  4DUR A;  1O33 A;  2R0L A;  1KDQ B;  3ZZ8 A;  3PMJ A;  5FHT A;  5EW2 H;  1J14 A;  1NRO H;  1U6Q A;  2CF9 H;  3LGI A;  2ZKS A;  4KTC A;  1AWF H;  4U32 A;  1HIA A;  5TCA A;  1MZD A;  1T7C A;  1GBA A;  1AN1 E;  1MZA A;  2WYG A;  5EPY A;  4YT7 H;  1Z6E A;  2NU3 E;  1P04 A;  3SN8 A;  4AFQ A;  4F55 A;  2BD7 A;  4BTT B;  3SND A;  1NY2 2;  1HAX B;  3ATI A;  1OXG A;  2VU8 E;  2SFA A;  3BTM E;  4UEH H;  1Y3Y A;  1SHY A;  1LMW B;  3T29 A;  1C2F A;  2FWW A;  4HGC A;  1O3N A;  3S9A A;  2OC7 A;  1KXC A;  4GLY A;  5A2M H;  1EQ9 A;  1AE8 H;  1INC A;  1HXF H;  1DY8 A;  1A2C H;  2PTN A;  2QYI A;  1HJ8 A;  3OEH D;  2CN0 H;  1P2N A;  1L1N A;  3Q76 A;  2PW8 H;  5GDS H;  1XUJ A;  3RXO A;  3SUF A;  1P2O A;  3LJJ A;  4X2W A;  1S6F A;  4AOQ A;  3QDZ B;  3H5C B;  2A7J A;  3QK1 A;  1OWD A;  1VZQ H;  5C1Y A;  1S84 A;  2W7S A;  1BOQ A;  1MKW H;  5EXL A;  5EW1 H;  1L1J A;  2ZU1 A;  1QRZ A;  3PRO A;  5DP8 A;  1JRS A;  1NBM E;  1Z8R A;  3AW1 A;  1ZPZ A;  2WV5 A;  3RDZ A;  1LVO A;  2WV9 A;  1JIR A;  1BTP A;  2F43 B;  3MTY A;  2P16 A;  3RXE A;  4LZ1 H;  1HBT H;  1SQT A;  3K9X B;  1NZQ H;  2H9H A;  4YT6 H;  1T31 A;  2G8T A;  5L6N H;  2W6I D;  4TY7 A;  1HGT H;  3S9B A;  4DGJ A;  3FN8 A;  1OWH A;  1SQA A;  3QO6 A;  4IW4 E;  1A5I A;  2H9T H;  1SHH B;  2KAI A;  2A4G A;  3E3T A;  2KM0 A;  1ZML A;  1CBW B;  3BF6 H;  1G3C A;  1ZZZ A;  4XDE A;  4OS5 A;  2EA3 A;  3E0P B;  2ZHW H;  4A92 A;  5H4I B;  2A4R A;  2F9V A;  1GI9 B;  1DE7 H;  1LHC H;  1XXD A;  3L6P A;  1CHO G;  4OS4 A;  7GCH F;  2ZDK A;  5A0B A;  3FZD A;  2GD4 B;  3VG8 A;  5JBC S;  5LPR A;  3RC4 A;  3DA9 B;  2WPH S;  2KR7 A;  4X0W U;  1C2L A;  1G36 A;  1GHZ A;  4MNX A;  1IQK A;  1MH0 A;  4CH8 B;  1EZQ A;  1ZJD A;  2KX4 A;  4OS1 A;  2ZTZ A;  2J4I A;  1PJP A;  3ZVE A;  3UQO A;  1QCP A;  1QJ6 B;  1MD8 A;  3LOX A;  1CSO E;  1DXP A;  5L2Y H;  2C90 B;  3EA7 A;  3E6P H;  4DOQ A;  3HK6 B;  3SYJ A;  3U98 H;  3SV7 A;  4AFZ A;  2O9Q A;  4DG4 A;  5T6F A;  3UR6 A;  2AER H;  3URD A;  1C1M A;  4BTU B;  1O5G H;  1CBW C;  5LPF A;  3UNR A;  2ZIQ H;  1QUR H;  4INL A;  3PRB A;  5T1V A;  1MAX A;  8LPR A;  3BV9 B;  3GY7 A;  1ELT A;  1AZ8 A;  1N6Y A;  1KIG H;  8EST E;  1RTK A;  4XBB A;  2OBQ A;  2FYQ A;  1O2H A;  3EAJ A;  2UWL A;  1V2J T;  3V13 A;  3Q3Y A;  1C5Z B;  3OU0 A;  2J95 A;  1TQ7 B;  1SSX A;  3EQ0 H;  5DP7 A;  4BAQ B;  2Z7F E;  4ZCN A;  1FIZ A;  1HV7 A;  1O38 A;  1BQY A;  2ZGH A;  1Z6J H;  1UVT H;  1S82 A;  2SGP E;  5E2O A;  3GYL B;  4RT0 A;  2BD8 A;  5TCC A;  4YO9 A;  3LGU A;  3MU4 A;  1ZRK A;  5C1X A;  1AND A;  1HDT H;  2ODY B;  2QXI A;  1O2Z A;  1V2N T;  1D9I A;  4DJZ B;  4D7G A;  1WTH D;  5DP9 A;  1NFX A;  3SZE A;  2OP9 A;  2HNT E;  4GHT A;  1M9U A;  3MU8 A;  2YMS D;  1FAX A;  3UR9 A;  1B7X B;  1GG6 B;  3GDS A;  3F3B A;  2ZPS A;  6GCH F;  8GCH F;  2D26 C;  2FX4 A;  2EY4 C;  2H9E H;  4AFS A;  1QHR B;  4JMY A;  1T32 A;  2R0K A;  5E0G A;  5AVD A;  3LGW A;  1DAN H;  3RXP A;  1YPH E;  3GY4 A;  1RRK A;  4K1E A;  1ZMN A;  2QIQ A;  5CDF E;  4GPG A;  3TVJ B;  3T25 A;  1EAT A;  1FIW A;  4ABI A;  2AMQ A;  3RP2 A;  3RXF A;  3U8O H;  1O5C B;  1AE5 A;  2KCO A;  1VKY A;  4MNW A;  3VB7 A;  2BTC E;  3T28 A;  1HPG A;  3P8O A;  5C5N A;  1YPL H;  2P94 A;  3ZVD A;  2TGD A;  2FOE A;  2O8M A;  2UUF B;  2ZWL H;  3ENS B;  4Q4L A;  1DUE A;  5E0H A;  2J92 A;  3SUE A;  1C5W B;  4RKJ B;  1BTZ A;  2XBV A;  2WSS D;  2BQ7 B;  2G52 A;  3H7T A;  3MU1 A;  1W0Y H;  2FIR H;  3UIR A;  1IHT H;  3BSQ A;  1ANB A;  1GG6 C;  2SGE E;  1PPH E;  4OGX A;  1DOJ A;  2FYR A;  1WDI A;  1C4U 2;  3M3V A;  1J17 T;  1JRT A;  5EXM A;  1C2J A;  2FS9 A;  4DVA U;  2PKS C;  3T62 A;  4WVP E;  1MTS A;  1O3C A;  3EDX B;  2KCY A;  3E16 B;  3MWI U;  2ZZU H;  2BLV A;  2QCY A;  1LHG H;  4UD9 H;  1CA8 B;  3GYM A;  1JBU H;  5AF9 H;  1MTV A;  3U8R H;  3KQC A;  2BOK A;  5HKK D;  2K8I A;  1TGB A;  7LPR A;  3GY2 A;  3M5N A;  1CT4 E;  1IQH A;  2ZGC A;  1D3P B;  1CA0 B;  4WWY A;  1YPM H;  1D4P B;  2J34 A;  1IOE A;  2AIP A;  2Y5F A;  3C1K A;  2ANW A;  1G3E A;  1KYN A;  1NU9 A;  3OTJ E;  1ELC A;  1IQL A;  1C2E A;  2ALP A;  3ATM A;  4X2V A;  3GDU A;  1H4W A;  1N1L A;  1OP8 A;  1PPG E;  4IBL H;  1YPJ H;  4Q7Y A;  1O31 A;  2HPP H;  2P3U B;  1GI8 B;  1C5S A;  1O3F A;  2FP7 B;  2RG3 A;  2Y7Z A;  5DSF A;  3U9A H;  4CR5 A;  3C27 B;  2Z3D A;  1SGN E;  1BTX A;  2BDA A;  3ZZ4 A;  3BTK E;  1V2W T;  2XND D;  1UCY K;  1EZU C;  1FUJ A;  1OSS A;  1TON A;  2XCF A;  1ID5 H;  2GTB A;  4LXB H;  1P3C A;  1C1W H;  1SLW B;  1UK3 A;  2A5K A;  4X8V H;  4DCD A;  1UHB B;  1EAU A;  2FEQ H;  2O8W A;  1CA0 C;  2VIN A;  2V6N A;  1GGD C;  2QE7 D;  1EJN A;  1C5U A;  2O8T A;  1ANC A;  1NC6 A;  2ZFQ H;  3TU7 H;  3ODF A;  1F5L A;  1EAI A;  1K1M A;  1SG8 B;  2BD2 A;  2A5A A;  4CBO A;  1PQ8 A;  4WH8 A;  2KCP A;  1ETT H;  2F9N A;  4ZKS U;  3RXQ A;  2AYW A;  1TGC A;  4O03 A;  1ELD E;  1GMD F;  2QF3 A;  4I31 A;  2HVY B;  4K69 A;  2CF8 H;  5DP6 A;  3ZYE A;  1A3E H;  2FES H;  2YNA A;  4TWY A;  1KLJ H;  3CP7 A;  1VR1 H;  1O39 A;  2XYA A;  4U30 A;  2AS9 A;  4I8H A;  3FVF B;  3M5M A;  3GCN A;  2PHB A;  4ABJ A;  3WW7 A;  4B71 A;  1NT1 A;  4YXW D;  4FUI A;  3KNX A;  1F0S A;  2J97 A;  1SLU B;  2OXS A;  2VVU A;  1GJD B;  2FI3 E;  4CRC A;  2BD3 A;  2A32 A;  2C3S A;  3LDX H;  1TIO A;  1C1V H;  1FY4 A;  1HAV B;  1OS8 A;  1YPE H;  2GCT B;  5C20 A;  3U69 H;  5EIY A;  3RXB A;  1XUF A;  3NUM A;  3GOV B;  3GCT F;  1MQ6 A;  2QAA A;  2CGA A;  4B2C A;  1W2K H;  2CHA B;  5FXL A;  4R8T B;  2W5E A;  1ESB A;  3TGJ E;  3SGA E;  1C5L H;  1K1O A;  4MTB A;  5FX6 A;  1HLT H;  1NU7 B;  1W8B H;  3LC5 A;  2BYA X;  5IYT A;  3B23 B;  3KYG A;  2YMS B;  2R3Y A;  2ZPR A;  2ZFS A;  4HZH A;  2GGV B;  4YOJ A;  3S7K B;  1PPB H;  2G81 E;  2TGA A;  4NA8 A;  1GVK B;  1GVZ A;  1IHS H;  1A61 H;  3P8G A;  3A7X A;  1IQE A;  2CMY A;  1TB6 H;  4H42 U;  1L1G A;  1ZSJ A;  1YC0 A;  2EQN A;  4HG6 A;  4Z1M D;  4IS5 A;  4HFP B;  3GY8 A;  4OGY A;  2G51 A;  5EQS A;  4E05 H;  3M5O A;  4FUJ A;  1A0H B;  5FPT A;  1MTW A;  3LON A;  4MDS A;  3AAV A;  1UTL M;  1NM6 A;  2GCT C;  3DCL A;  1VCP A;  4CRE A;  1GHW H;  4CRF A;  2FOH A;  4Y76 A;  2TBS A;  2RA0 A;  1CHG A;  2QF5 A;  3FAO A;  3KQD A;  4HI3 A;  1K21 H;  3M36 A;  4X6P A;  2ZTY A;  2OD3 B;  3RU4 E;  2CHA C;  2ZC9 H;  1C5T A;  1AZZ A;  1AB9 B;  1GBE A;  1G30 B;  1T8L A;  4NZL A;  4JCN A;  1E0F D;  4AYV B;  5JBT A;  1COW D;  1GDN A;  1GMC F;  1JOU B;  3O8C A;  3Q00 A;  4Y7A A;  4OM9 A;  1PPE E;  2ZQ1 A;  2YMS C;  4TWW A;  2BB4 A;  4GUX A;  2OUA A;  3R3G B;  4Y8X A;  3GIC B;  2HNT F;  4DW2 U;  3BTG E;  2L74 A;  4LOY H;  4X6N A;  2Z3C A;  4BXS A;  1AD8 H;  1VJ9 U;  2FO9 A;  4I33 A;  4ZAE A;  1H9H E;  1LVY A;  3MH7 A;  1P01 A;  4XBC A;  5B6L A;  2FI4 E;  2ZGJ A;  1F5R A;  4ISN A;  2ZNK H;  4IC5 A;  3UB0 A;  3RMO H;  1DWB H;  1V2M T;  1T8N A;  3AVZ A;  3BG8 A;  1P8V C;  3A7V A;  1DIC A;  3KQB A;  3ZVF A;  1UJ1 A;  1EXF A;  1C5R A;  1W13 U;  4H4F A;  3RXR A;  1QRW A;  1AB9 C;  3NZI A;  2FOB A;  1O3L A;  2WPI S;  4UE7 H;  3M7T A;  3OX7 U;  1GBK A;  3RMM H;  1IQJ A;  3TIT A;  3U1I B;  2VIV A;  2J98 B;  3M3T A;  1V2S T;  1GJB B;  2G55 A;  1EJA A;  3A7Y A;  2Q6D A;  7EST E;  4B2A A;  2BXT H;  5JDU B;  1HCG A;  1SOT A;  4FVB A;  2DUC A;  3BTE E;  3OE7 D;  3SNB A;  1BJU A;  1MCV A;  2RFK C;  5DGJ A;  1S81 A;  3E0N B;  2ZEB A;  3VXF H;  4AFU A;  1WXR A;  1K28 D;  3N7E A;  3VB3 A;  2BMG B;  4WH6 A;  2VNT A;  1JWT A;  5FCK A;  3QN7 A;  1MKX H;  3RLY H;  1XKA C;  3I78 A;  2R3U A;  1GJ5 H;  1HRT H;  1GPZ A;  1YM0 A;  5GND A;  2Y7X A;  1EB1 H;  4CHA B;  1P11 E;  1W0J D;  4B76 A;  3RXI A;  3RXL A;  3PMH B;  1P9S A;  2XWB I;  2H1U A;  3MQK C;  2BD5 A;  5FCR A;  2QF4 A;  1D3Q B;  3FKS D;  2Q6G A;  5ABW A;  3N99 A;  1XVO A;  1XMN B;  1O3I A;  1S6H A;  1YYY 1;  3PRD A;  1AU8 A;  3BG4 B;  1DY9 A;  1GJ4 H;  1WUN H;  3T27 A;  4DII H;  1PPF E;  4IMQ A;  2Z3E A;  3MMG A;  4GCH G;  4IC6 A;  3EYD A;  2KCA A;  1JIM A;  1ETR H;  1TMU H;  2VWM A;  1SGC A;  4Y8Z A;  2F9B H;  5C5O A;  4A7I B;  1C5M D;  1TMT H;  1YCP M;  1C5N H;  5FPS A;  1ELA A;  3ZZD A;  1SVP A;  1YCP K;  4CHA C;  3ZZB A;  1TGS Z;  1H9L B;  1GI1 A;  1CGH A;  4CRD A;  1HIA B;  3A83 A;  3OFN D;  4Y8Y A;  3BTH E;  1SFI A;  2P8O B;  4CRA A;  2ZDL A;  1Y5B T;  2PUQ H;  1TNK A;  2OK5 A;  1XX9 A;  1WV7 H;  1VIT F;  3DFJ A;  1O2S A;  4UFG H;  1GMH F;  3OEE D;  1DVA H;  2JH5 D;  1L0Z A;  2VWN A;  3RXA A;  3BG4 C;  2ZU3 A;  1RFN A;  3M35 A;  2DE8 A;  1AIX H;  2NU2 E;  3E90 B;  3SV2 H;  1MTU A;  1SQO A;  1TNL A;  1NS3 A;  1TNH A;  3VEQ B;  1O2I A;  1EKB B;  4BTI B;  4RI0 A;  1BRA A;  1K1N A;  4X8U H;  1OX1 A;  2C8X B;  1BHX B;  3F1S B;  4X1N U;  4AGK A;  3P17 H;  1UTQ A;  2Z94 A;  3RXD A;  1RS0 A;  2C8Y B;  1WYK A;  2AMD A;  3ZZC A;  4FUF A;  1TMB H;  2BDH A;  1Z1I A;  1BMM H;  5DJ7 A;  1QFK H;  2AGI X;  1UVU H;  2ZHF H;  4D9Q A;  1AKS A;  3L3T A;  2XC4 A;  2P8O C;  3MU0 A;  4CRG A;  1BHX F;  1S83 A;  4ABH A;  3O8D A;  5E2P A;  1C1U H;  1O2U A;  4M9F A;  3RMN H;  3M5L A;  1BRB E;  4E7N A;  4BOH A;  4AB9 A;  1BCU H;  2SGD E;  4B75 A;  3RU4 T;  2FX6 A;  3F2H A;  2V3O H;  3SJI A;  3FO8 D;  4Q7X A;  5TJX A;  2QA9 E;  2BHG A;  4MG3 A;  4ABG A;  1P0S H;  4JZF H;  3A80 A;  4H6T A;  2Y81 A;  1OYQ A;  3BN9 A;  4J2Y B;  1E35 B;  4FET A;  1TAB E;  2Q6F A;  2Z6B D;  1SB1 H;  1LCY A;  4LK4 A;  3GY6 A;  5GJ4 B; 
#chains in the Genus database with same CATH homology
 2J97 A;  2J98 B;  2J98 A;  5C94 A;  1QZ8 A;  5HIY A;  1UW7 A;  5HIZ A;  3EE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...