2J97A

Human coronavirus 229e non structural protein 9 (nsp9)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
98
Chain Sequence
KMKVKATKGEGDGGITSEGNALYNNAFMYAYVTTKPGMKYVKWEHDSGVVTVELEPPCRFVIDTPTGPQIKYLYFVKNLNNLRRGAVLGYIGATVRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variable Oligomerization Modes in Coronavirus Non-Structural Protein 9.
pubmed doi rcsb
source organism Human coronavirus 229e
molecule tags Rna binding protein
molecule keywords REPLICASE POLYPROTEIN 1AB
total genus 21
structure length 98
sequence length 102
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 2j97A01
2J98A 2J98B 3EE7A 2J97A 1QZ8A 5HIYA 1UW7A 5HIZA 5C94A
chains in the Genus database with same CATH superfamily
1O3OA 3HK6B 1QZ8A 2FWWA 2XC4A 2IPQX 3AASA 1O2RA 1RXPA 2PHBA 2ZDMA 3UR9A 1PJPA 3ZZDA 2GCTB 4BAOB 3VB6A 1UTMA 4TY6A 2YNBA 1ABJH 1E35B 2GV7A 1C1QA 2FTMA 1ETTH 5HXFA 3DFJA 3RXHA 5JBAS 1GBTA 1YKTA 1C4Y2 1LVMA 1UJ1A 2ULLA 3BIVH 2J94A 2H5DA 1FUJA 1YGCH 2RA0A 1UVTH 2FS8A 2G5VA 1H9IE 2PP6A 1FIWA 2BD5A 1MZDA 2JH5D 1FV9A 2NWNA 1SFQB 2KZ4A 1B5GH 1S81A 1K0HA 4BNRA 1BHXB 1J8AA 2CF9H 3RMLH 1YPHE 2QY0B 2OTVA 1S5SA 2FTLE 2QC2A 3OX7U 3P17H 5AHGH 2BYAX 2JKHA 3A86A 1W8BH 2OC0A 4ZAEA 4A5TS 5LPFA 2EI7A 2XTTB 2PUXB 1MZAA 4X8TH 3DHKH 5IK2D 1KYNA 3STIA 1FQ3A 1ELVA 1KLJH 2WZQA 4WH6A 2SGFE 4FUCA 1CA8B 2B5TB 1O2MA 2BVXH 1OWEA 4IC6A 5EJ1A 2YNAA 1ORFA 1HXEH 2FS9A 3C1KA 3LH1A 4Q4LA 3SNAA 1K1OA 1RIWB 4RI0A 2V6NA 1QL7A 5DG6A 2FOGA 4I8JA 4Y0ZE 2G8TA 1EAIA 1G2MA 1LHCH 3H7TA 4FUIA 1EZXC 2ZZUH 2GTBA 2XBYA 2FIRH 1L0ZA 4LOYH 3MHWU 4OGXA 3E1XB 2OC8A 1C5LH 4ZKNU 2Q6GA 3U8OH 1SSXA 3SQHE 2OXSA 1S85A 2K0QA 3CNRA 4OS5A 4E7NA 1FPCH 3D65E 1GHVH 5FXLA 4DOQA 2BZAA 2OBQA 5E2OA 3H5CB 5PTPA 1DPOA 1GBCA 2BY6X 1HBTH 4I8GA 1W7XH 2W7UA 3ZZ6A 1O2KA 1GI4A 2AYWA 1EX3A 3UPEA 2TIOA 4IS5A 2P8OC 4IGDA 4B75A 3F6UH 2BZ6H 3SBKA 4UEHH 3S9AA 3U9AH 1QGFA 4DIIH 1YY3A 2O8UA 5DP8A 1HXFH 1IHTH 5T6FA 1WXRA 3QO6A 2C90B 1TGNA 1NT1A 5ESTE 4FETA 3PRBA 3KHVA 1TIOA 1HV7A 4X0WU 5EW2H 1JRSA 1GBLA 4Y71A 4Y8XA 1A5GH 2ZFPH 4NG9H 4NWLA 2K8IA 1MU6B 1EZSC 1EP6A 3SW2B 7GCHG 4ASUD 5F03A 2HRVA 2VIWA 4CR9A 3F68H 2BHGA 4J1YA 1J14A 3B9FH 2A32A 3FAOA 2P95A 1QRWA 3P95A 1TA2A 3NPSA 4DCDA 2GDDA 3TK6A 1C5OH 2TGAA 1V6DA 4GVUA 2Q6DA 1AFQB 4FU8A 1MMJN 2LNCA 3M5OA 1C2LA 1O5DH 5JDUB 5A0CA 1Y3UA 1GMCG 2JETC 2QXIA 4TT3D 1GBEA 4IN2A 1ZJDA 2ZU4A 4X8VH 1CGHA 3OTPA 2F9NA 3F9GA 1YP9A 5E8EH 1LQEA 2ZP0H 3GCHC 3SV8A 4AX9H 3RXAA 2Z3EA 2O8MA 1WTGH 4A92A 1SHYA 1SGTA 3A7ZA 3AW0A 2PWXA 3SNBA 1RTKA 1XKBC 2ZEBA 3LU9B 1F0UA 4U01A 4MPUA 3SU0A 2RDEA 5G4BA 2VJ1A 2WV9A 1DS2E 1MQ5A 1WU1A 2GT7A 2P3FH 1SGFG 1VR1H 1RS0A 4MLFB 3GDVA 1ELAA 2THFB 1DSTA 4AB8A 4ZKOU 1Z8IB 1FN6A 4MQAA 1GG6B 1GBJA 1C1VH 1DFPA 1T8LA 1O2WA 3SI4H 1C5VA 1NN6A 2BLVA 4WJG2 3P92A 4UE7H 1K9OE 3PTNA 3OYPA 3KIDU 1S0RA 1QIXB 3MNBA 4JYUH 2A0QB 1BRBE 2FODA 2FX6A 3G01A 1TGBA 5EU8A 3KYGA 2UUJB 4BTTB 1GJBB 3OEHD 1ZZZA 5HMAA 5CMXH 1UTJA 2ZTYA 3RXLA 1C1NA 1LO6A 4GCHG 3QN7A 4AFQA 2W3IA 8ESTE 4RKOB 3SV7A 2KAIA 3SNCA 3BTDE 4KTSA 1TMBH 1C2DA 3UNQA 8LPRA 2CGAA 1NTPA 2A7JA 1EOJA 1HNEE 1K1MA 1AFEH 2IOTA 3RU4D 1ZHRA 3K6YA 2ANWA 2QE7D 4XBDA 4IMQA 1MKWK 2JH6D 3HKJB 4U32A 2G5NA 1SQAA 1V2OT 3LH3A 1SC8U 1ZOMA 2C4FH 2NU4E 1CA0C 3QX5H 2WPIS 3SYJA 1O2NA 1OWHA 1H9HE 1TNLA 1XUHA 3MU4A 5FCRA 2GZ7A 3VB3A 4HFPB 4RT0A 2BD8A 2XXLA 3URCA 1FI8A 4ZUHA 1UTKA 2GMTB 1OP8A 4NA8A 4X1PU 2F83A 3P6ZB 5K0HA 1DITH 4AYYB 2XBVA 3WWFA 5JBTA 1Q3XA 4UFEH 2GKVE 1HJAB 1XUIA 2G81E 3M7QA 3OSYA 1AFQC 2Z94A 2FDAA 1AVGH 1GWAA 1GBFA 1G9IE 1UTPA 1IQNA 3UWIA 1QHRB 4I7YH 1K1NA 1XM1A 3M61U 3I78A 4FUGA 1YPHC 1IQEA 1TRMA 1P2QA 1SGNE 4RT1A 5F53A 3ZVCA 2KM0A 2ZGXH 2ZG0H 3E91A 1UHBA 5BRRE 2BDHA 3LJOA 3PO1B 4Z1MD 1C5PA 1FAXA 3NZIA 4D9RA 1GCDA 4YXWD 1O2GH 2B8OH 3TIUA 3GY4A 1V3XA 1ELCA 1W0KD 2BDIA 3BEFB 4NZLA 1ZRBA 3ZV9A 1JOUB 1GI0A 1TNGA 1Y3VA 3R3GB 2AGEX 1V2TT 2ODQA 4ABFA 3HATH 1P11E 4MNYA 5EPYA 5E0HA 4FUFA 1G36A 1CBWB 1BCUH 3FANA 5EQQA 5EW1H 1HIAB 1P02A 5TCAA 3GY3A 2G55A 2ZECA 4KP0A 1WV7H 2A4GA 4B74A 4UDWH 2ANYA 4NFFA 3ZIAD 2BDGA 2JJ1D 4NIXA 1YCPM 2BY7X 3LGIA 5AFZH 1E34B 3ZZAA 1YF4A 1TNIA 2ZF0H 1GBMA 2HVYB 1W2KH 5DSFA 2UWPA 1YM0A 1YCPH 2A7HA 2RG3A 3LC3A 4X1QU 2VH6A 2VIPA 1MTUA 3UOUA 1TGTA 1OYTH 1PYTD 2IPHA 1P2OA 1DWCH 1UVSH 4CR5A 2ZU1A 2AGGX 4ZROA 3RXKA 1ZYOA 4DW2U 2WYGA 1AY6H 2AS9A 2OC1A 1QRZA 3KNXA 3MFJA 3P8GA 2C3SA 1UO6A 1EUFA 3L6PA 1C2HA 4ZHLU 2F3CE 1TFXA 2JJ2D 2HNTC 1EAUA 2W6ID 1DWDH 2FI3E 4E7RG 1EOLA 2J2UA 3W94A 2OCVB 7LPRA 1C1UH 1C4V2 2W3KA 1CE5A 3GDUA 1XMNB 1V2VT 2G51A 1UCYH 5IYTA 5A0BA 2ZGHA 3RXQA 2A4QA 1MD7A 2SFAA 4B6EA 3MQKC 2YMSB 3OE7D 3TH3H 3GY8A 2R2WU 6LPRA 1K2I1 1COWD 4Q7YA 3ENSB 3BEIB 6ESTA 3ZVEA 3F9EA 1HAYB 1L4ZA 6GCHG 1YPJH 2AHME 1C4U2 3PM3A 3SQEE 4MNVA 2JETB 3UOPA 1NROH 3RXCA 3S0NA 1GG6C 5IDKA 4AFZA 3NKKA 3RU4E 3SJ8A 1VITH 5EG4A 3URDA 3EDXB 1QURH 1PPEE 1OWIA 3SV9A 3TLOA 1YC0A 1TRYA 1O37A 1GDNA 3A7TA 1VKYA 4YM9A 5A0AE 4ZH8A 4ABGA 1BMLA 4CHAB 2RDLA 3F2FA 1BTWA 3ATWA 1NRQH 2SNVA 3PYHA 1QBNA 2PKSC 1Y5BT 2I6SA 1KSNA 3PROA 4ZKRU 1BTXA 4WXIA 4A1XA 3E3TA 1AI8H 3SJIA 2BX4A 1FXYA 2P93A 1SGIB 4ZKSU 1KXEA 1PQ5A 1AB9B 1HAXB 1VGCC 5HIYA 4MNXA 1E38B 3A88A 2STAE 2WPLS 2V0BA 2ZPRA 1O2OA 1D3DB 3EGKH 9LPRA 2A5IA 5J4SA 3SJKA 4AG2A 1LVBA 2OK5A 2FI5E 2BD4A 4M9FA 2SNWA 4TY7A 3C27B 4BANB 3T2NA 2M2AA 1S0QA 3O8DA 4Q7XA 1PQAA 3KQDA 1PYTC 1QB1A 5FPYA 1LTOA 3E8LA 4O97A 2Y81A 3UTUH 1BA8B 4HG6A 1EPTC 1J15A 3AAVA 2RA3A 2C8YB 1ZMJA 1P2JA 2Z9KA 2QXGA 4BAHB 2FOFA 2ALVA 2FOCA 1VCWA 4AGJA 5FBIA 1Y3WA 2ZQ2A 2OINA 2BMGB 4Y8YA 3F9FA 1ZSLA 1EZUC 4UD9H 1K28D 1C9PA 1O3AA 2PGQB 1CGJE 2ZPSA 2STBE 1O39A 1Y5AT 1J17T 1IQKA 1FPHH 1TGCA 4YTAA 3RXIA 4B71A 5CDFE 2W6JD 1W10U 1OP2A 1QJ7B 1HJAC 4Y7BA 3K9XB 5AF9H 4AG1A 2XW9A 4GSOA 2VWNA 1V2QT 1N6XA 1NESE 1ZR0A 1BTZA 3SUFA 2K1QA 3UQOA 1QJ6B 4D9QA 4UFGH 3LDXH 1G3CA 3E6PH 2VBCA 4JYVH 3Q3XA 1GCTB 3M35A 1F2SE 1P2MA 4O3TA 3S7HB 1XXDA 1ZTJA 1TBQH 1YPKH 2DE8A 4NA7A 1AWHB 1QTFA 4ISNA 2HLCA 1L2EA 1O32A 2M5TA 3RXTA 1K21H 1S83A 5HGGA 2J95A 1K22H 2VNTA 1GI5A 4I31A 3B8JA 1A2CH 1ESTA 4JK6A 4DGJA 2ZQ1A 1IOEA 2QF4A 2KAIB 1AD8H 1TAWA 3GY7A 4JK5A 2A2XH 2OUAA 2ZU5A 3DSPA 1C5ZB 1C1WH 1CT0E 2FX4A 1EZQA 1T4VH 3GICB 4XBBA 1N6YA 5E0GA 1TPAE 2UUFB 4X1SU 1C5MD 1G3EA 1B0EA 1C5WB 1S6HA 4JZEH 2QIQA 1G32B 4BTIB 1AIXH 5FCKA 1PFXC 2H9EH 1XVOA 2VINA 4AORA 5LGOA 1AMHA 4GCHF 3PO1C 3H7OA 2PW8H 2H2ZA 1Z71A 3FP8E 1FNIA 3PTBA 3MH4A 1HYLA 1F5LA 1W0ZU 2WYJA 1FY5A 3SJ9A 5FPSA 1IQMA 5DP6A 1QB9A 2J34A 1BBRK 1F0TA 1LDTT 4Q2KA 1ZJKA 3LGUA 4ACBA 4BXWA 5DK1A 2QXJA 2OLGA 1SB1H 1GJ8B 5F6MA 3BTME 1NFXA 3GCOA 2VVCA 1IQGA 1KXAA 2CK3D 3GY2A 4OM9A 3TJUA 1YPGH 2ZNKH 3PMJA 3NUMA 3FP7E 1ZGIA 4MVNA 1EJAA 3V3MA 1S84A 4FU7A 5C0UA 5C67A 2ZPQA 1SGQE 2Z3CA 3QUMP 4U30A 2R3UA 3GS9A 4HI3A 1CT2E 5C1XA 5KEDA 1QB6A 4IN1A 1O3KA 1EPTB 1WYKA 4DY7B 2J5UA 3BTFE 1T8OA 4E05H 4ISIH 3ZVAA 4K2YA 2ZIQH 3PMBB 3L33A 1C2FA 3KN2A 2KCAA 1K1PA 3VGCB 3BG4C 4I8HA 3ZZ8A 2A4OA 4OS6A 2VGCC 4YLUA 1NU7B 8GCHF 3SOSA 1A5IA 1XKAC 3TK5A 2XC0A 2FOMB 3SU5A 1OXGA 3F9HA 1AQ7A 2HPQH 1LPGB 1SR5C 3M7TA 2P94A 5DP4A 2R9PA 5DP9A 1K1IA 5L6NH 3M7UA 1HAOH 3RLYH 2GGVB 1FY1A 2GZ9A 2TGDA 5C1UA 3U1IB 3MH6A 3MU0A 1ZHPA 1N1LA 4DT4A 2SGDE 2DUCA 4SGAE 4I8LA 5C17A 1GI6A 2FP7B 3GYMA 1TNJA 2P59A 4FOUC 1WCZA 9ESTA 3OTJE 1ACBE 4HGCA 1ZSJA 3RMMH 2XYAA 1C9TA 2GP9B 2WPHS 2Y7ZA 1PQ8A 4ASHA 1Z6JH 3A7VA 3RXOA 3BTQE 1O3MA 3A7YA 4DVAU 1AE8H 1VJAU 2RCEA 3A85A 3RDZA 1TPOA 3FVFB 4P02A 1BQYA 1P06A 3LGWA 3F3BA 2ZGBH 3NCLA 1MTNB 2ZGJA 1FZZA 2J92A 2TRMA 1O2HA 1C1PA 1A0JA 1NBME 1O2QA 3M5NA 5F8TA 2KCOA 4FUJA 2OP9A 2FO9A 3RMOH 2XNDD 2A5KA 1EAXA 1UK3A 2WUCA 1IQFA 4VGCB 4CH8B 1TB6H 5CHAC 2UUKB 5FX6A 1BRUP 3SO3A 1RIWC 5HIZA 1A0LA 3EE7A 1C2JA 2AMPA 5LH8A 1TMTH 1PQ7A 4MG3A 1JMOH 2P16A 1BTPA 2C93B 1FY8E 1BDAA 4JZ1A 1LVYA 3W1EA 2FOEA 3BG8A 3SJOA 1TQ7B 2ESTE 1GCTC 4TPYA 3RU4T 4GPGA 1O33A 1Z8JB 3KL6A 1SVPA 1P2KA 2ZHFH 2VWLA 1CU1A 1BMAA 3RXJA 3TGKE 3KGPA 2QF5A 4BOHA 2WPKS 3N7EA 1YPMH 1O0DH 1P2NA 2ZTZA 4R8TB 3O8CA 1SBWA 1UHBB 2BD9A 5C1YA 2PR3A 3ZZ5A 5EXLA 1C2GA 1ZMLA 1FMGA 4ABJA 1C5QA 3HPTB 1IQJA 1MTVA 4XD7D 3A84A 1SPJA 2ASUB 1FLEE 1V2NT 4FUDA 3OEED 5TCCA 3OY6U 3TNTA 2D2DA 2J97A 1NRNH 1H1BA 4OS7A 4Q63A 1CO7E 1K1LA 1DUAA 1EJNA 2JIZD 5GNDA 1UVUH 1JBUH 3FKSD 4ABDA 4I33A 1F92A 1SGRE 6CHAC 2Y80A 1D3QB 1ELBA 4DURA 2V3HH 3A8AA 1Z8RA 5CHBA 4OGYA 3TK9A 4CRCA 1UTQA 3S7KB 2WPJS 4K5ZA 5DJ7A 1O5GH 1GHXH 1ID5H 3ZYDA 2ODPA 1O2IA 2F91A 1JIRA 1BJVA 1D3TB 1BMFD 2ZHWH 1O2XA 3N99A 5F8XA 3RC4A 1KMHB 2WSSD 3EE0B 1G37A 3EAJA 3CP7A 5JYIA 2A1DB 1ELDE 2QYIA 3QWCH 3F2GA 3RXVA 1P10A 1NO9H 2ALPA 2R0KA 3GCHB 1CHOF 2GDEH 2PTNA 5DPAA 1KXBA 3RC5A 3DT0H 2LP6A 4X2YA 1C5TA 1WAYB 4HZHA 1O5BB 4GHTA 4JMYA 2PGBB 3SGBE 3WY8A 3NRLA 4XDEA 3LONA 1B0FA 1Z7KA 1PPFE 2XCFA 4ABIA 1OKXA 4AGKA 4OS2A 4KGAA 3TJOA 1C1OA 4K1EA 3S69A 1WQSA 1DWEH 4WH8A 2OBOA 3ZZ9A 4LZ4B 4XE4A 3RXRA 1GHZA 2QA9E 3E90B 1BMMH 4BAKB 1HPGA 2ZDLA 1MUEB 1H9LB 1GVZA 4B1TA 1GHAF 4Y6DA 2EI8A 3ZZCA 2AIQA 1GI2A 4HTCH 1G3BA 3GY5A 1C1MA 2AH4X 2EEKA 5JBBS 1ANDA 3SU4A 1SMFE 1QR3E 2B7DH 2CMYA 2J9NA 3VFEA 3V12A 2BDBA 4ZHMU 2ZU3A 4H6SB 1XUJA 4TYDA 1MBQA 1D6RA 5GDSH 1Q31A 1DOJA 4ABEA 4KTCA 5EIYA 2BDYA 2Z9JA 1OP0A 1GGDB 2ZC9H 3PV4A 3KQEA 1GHBF 1XX9A 5GCHG 1TA6A 4P00A 3PLPA 4AOQA 3TITA 5E2PA 4AN7A 2RFKC 4F48B 1THSH 1QA0A 2Y5FA 5EQSA 2Y5HA 1TOMH 2R0LA 1T31A 1C2IA 2B0FA 1ZSKA 1IQIA 2AERH 4YOIA 2BVSH 4UFDH 1G30B 1DVAH 4JYTA 4K8BA 2GCHF 2BLQA 3E16B 1E37B 2A2QH 2H9HA 3QGJA 3BTEE 3WWBA 1ETRH 1XXFA 1LVOA 4XSKU 3M5MA 1SHHB 5CHAB 5C20A 1P12E 1RFNA 2FOAA 2O8LA 1RRKA 2FLBH 3ZZ4A 1HUTH 2KCPA 1W13U 2ZFQH 1NZQH 1KTSB 2ZTXA 5DKMA 4GHQA 1P09A 2FYRA 3SHAH 1K1JA 1A46H 2Y7XA 4SGBE 1IAUA 3RM0H 1HFDA 2Q6FA 3GCTF 2KFWA 3T62A 1T7CA 1D4PB 4R0IA 1V2MT 2OD3B 1U6QA 5F8ZA 1L1JA 1E36B 1G2LA 2ZHDA 1SQRA 5EOKA 5DGJA 1LHEH 2BXTH 1UW7A 1MTSA 4CBNA 3I77A 3PV2A 4VGCC 1GJ4H 3ZVGA 1GJ5H 2ZGCA 2BY9X 5C5NA 1O2UA 3MMGA 2ZDKA 1DWBH 1HAIH 2EC9H 1C5YB 4X2XA 5TJXA 1GVLA 5LPEA 2LPRA 1W7GH 5JB9S 1NM6A 3LT3A 2GVFA 1B7XB 1AO5A 1A1RA 1LQDB 4QT8C 4ACAA 2WINI 4Z0KA 1E79D 5HYOA 2GJGA 3MH5A 4DJZB 2FM2A 1WDIA 2Z9LA 1EP5A 4H42U 3PRDA 2WV5A 3Q3YA 3QLPH 2FYQA 2W5EA 2ODYB 2BLOA 1MQ6A 2GZ8A 1TMUH 1T32A 2ZHEH 1O2VA 1BTUA 3CS7A 1OS8A 1P0SH 1UTLM 3PWCA 1P2IA 4WMEA 3MWIU 3ZZ7A 1P3EA 4CHAC 2WPMS 4YT7H 5L2YH 1QL9A 2BTCE 3KQCA 1EAWA 1SQTA 2OQ5A 3HKIB 5HM2A 4ISHH 1GDQA 1F7ZA 1GJAB 3P8OA 3ATIA 2HWLB 1TONA 3SGQE 1IQHA 1L1NA 1O5EH 3MNSA 4Y7AA 1AKSA 3P8FA 5A2MH 1O3JA 1TOCB 1CSOE 1THPB 1W12U 1SLVB 5T6DA 3WW7A 3MYWA 1W0JD 2A7CA 4WF8A 2FMJA 1H8ED 3E0PB 2Y82A 4BAMB 4ZXXH 1NY22 1O3LA 1WSSH 2PKAB 4I8KA 1GMCF 1MD8A 1GJ7B 1MCVA 5JBCS 1DLEA 1UMAH 5K7RA 2PSXA 1O2JA 3RXEA 1E0FD 2GMTC 4A1TA 4X6PA 1Z8GA 1LPKB 3VXFH 5I46H 4IC5A 2FI4E 1C2MA 2F9UA 1AUJA 3GYLB 1ETSH 1HAPH 2ZCKP 1BTYA 3LKWA 3DSOA 2W26A 4BTUB 2BD7A 1H4WA 1ZPCA 3GDSA 2ANMH 2C8XB 5JPMH 1A61H 4DIHH 3JZ1B 1ZTKA 3SZNA 4MPVA 5EJZA 1TBRH 2V3MA 2ZHQH 5EJLA 5FX5A 2AIPA 2G4UA 3M5LA 1P04A 4K8YA 1BIOA 1Y3XA 4JZIA 2GX4A 2P8OB 2TPIZ 1C2EA 4INLA 2AMDA 4YO9A 1Z6EA 1UK4A 5ABWA 5BPEA 4CRFA 1QL8A 1YPEH 4Y0YE 1SLWB 2I6QA 3FN8A 3SORA 3GISB 1C1TA 2Z7FE 1RD3B 3QTVH 1QQUA 4ESTE 2WUBA 1VITG 2QF0A 4TPIZ 3MO3A 4FVDA 1AVXA 1MAYA 4M7GA 1AZZA 3TH2H 4Y10E 4CRDA 4DT7B 1P9SA 1F5KU 1BT7A 2BQWB 2VH0A 4WMDA 4ZMAH 4TSFD 3HGPA 2VU8E 1T8MA 1ZRKA 3EA8A 3I29A 1QBOA 3DA9B 2J38A 2PSYA 1OX1A 2BB4A 1GBBA 1M9UA 3PLBA 3KCGH 4NIVA 1HJ8A 1EFRD 5FAHA 4F4OC 1MKWH 2NU1E 1NC6A 2KX4A 5HM9A 1CHOG 3EA7A 3OFND 3SZEA 1SLUB 1ELTA 3B23B 4F55A 1YLDA 2BOKA 4FVBA 1GHWH 1ARCA 1SLXB 5L30H 1LHFH 4UONA 3Q76A 1T4UH 3A8CA 4KELA 1OYQA 3LIWA 1GJDB 4E06H 4K1TA 2SGAA 1GJ9B 4LXBH 1HIAA 2D1JA 1AVWA 4BAQB 1HAZB 2ZDVH 1GJCB 4A6LA 1UTOA 1TYNA 4F49A 2L6OA 3T5FH 3VGCC 1NPMA 1BRAA 1AHTH 2ZFTA 1Z1IA 4INHA 1O31A 2TBSA 3LGTA 4XFQA 3STJA 3RXUA 1GHBG 1C5RA 4MPWA 2HNTE 2WV4A 2XBXA 3LJJA 2BDCA 1BZXE 1O36A 3UIRA 1KXDA 4K69A 1WQVH 1O3EA 1UCYK 2XRCA 1V2RT 3UNRA 1C2KA 2GCTC 4ZCNA 3D23A 2XWAA 5I25A 2UUYA 1EATA 3CENA 4AFUA 1YYY1 4Y8ZA 3RUOA 2ZI2H 1P3CA 3BTHE 1W0YH 4X1NU 1CQQA 1O5FH 5J4QA 1RJXB 3LGVA 1BUIA 3RP2A 2FPZA 3UR6A 5AFYH 5C0TA 8GCHG 3EQ0H 4YESB 1VGCB 5GCHF 3MO9A 1H8HD 5EQRA 3BTTE 1WOFA 5KGOA 2Z3DA 1MCTA 5LPRA 1CVWH 3A8DA 3S9CA 3OY5U 3U69H 2H6MA 3ELAH 2BQ6B 5L2ZH 1JXPA 2BVRH 2V7QD 1J16A 4NZQA 1EJMA 1KXCA 2ZU2A 1SGCA 3RC6A 1QNJA 2YOLA 3LC5A 3U28C 3GCTG 3SUDA 2FOBA 1W14U 2GCHG 4GUXA 5FHTA 5GWZA 3BTKE 5C94A 2HOBA 4GAWA 1FY3A 4BXSA 2HALA 4TWWA 1ZMNA 2EY4C 2BY8X 1FY4A 5T3HA 3A8BA 1YPLH 4Y11E 1SL3A 2OQUA 3VG8A 3TVJB 4X8UH 2AEIH 1V2UT 1HDTH 1F5RA 1E1RD 3MTYA 2LELA 1BRCE 1TNKA 1LHDH 3FP6E 2UWLA 1WBGB 2ANKH 3K6ZA 4ABHA 1GI7B 4Y76A 1KY9A 1Y3YA 1ZLRA 4TWYA 4JCNA 2F9BH 3T26A 1Q2WA 3LPRA 1O5CB 3V0XA 1SQOA 4X2VA 2CJIA 4NSVA 1DANH 2VGCB 4K60A 3TPIZ 1NFUA 2VIVA 4YLQH 1D3PB 1W3CA 1O2PA 2A5AA 1L4DA 1X7AC 1TRNA 1JWTA 1GL0E 4CRAA 1UVOA 1OOKB 1KTTB 1TX7A 3RXFA 3TGIE 3LGYA 3FZDA 1E1QD 2B9LA 1GI1A 4MPXA 1GDUA 2J98A 2IJOB 1AZ8A 3BSQA 3HGNA 1A7SA 4Q80A 4WY3A 5DP3A 4B2CA 2VVVA 1L1GA 1OPHB 3D62A 2QGRA 3PMHB 2GD4B 4I32A 1LCYA 1WUNH 3SN8A 1XUKA 2ZCHP 2ZA5A 5ETXA 5FL7D 2FESH 1H8DH 4X6NA 2XC5A 1O2TA 5A09A 1V2LT 4WXVA 3PB1E 1UTNA 4MTBA 3SU1A 1SOZA 4KKDA 4NA9H 1O5AB 1AUTC 3GY6A 4FUHA 1XUFA 3TNSA 2VWMA 4JZDH 3ZZ3A 3ATLA 5EXMA 4K1SA 1BTHH 4IW4E 3UNSA 4B2BA 4X8SH 5GJ4B 1QQ4A 1LHGH 1O3GA 2SGEE 3S9BA 1BBRH 4U2WA 3LOXA 1KLIH 4WMFA 1EB2A 1GBHA 3QDZB 1FJSA 2D8WA 1OWKA 5JB8S 1GL1A 2SGPE 2H1UA 3VB7A 2XCNA 3UY9A 1AE5A 1FAKH 3BTGE 1J9CH 2QN5T 5T6GA 2VWOA 3BN9A 1V2PT 4OS4A 5DO4H 2BM2A 2CXVA 4ZHAA 2Z9GA 3QZQA 1NBMD 4XRNA 1T8NA 1DM4B 1GI9B 1NS3A 3AW1A 3TGJE 1CA0B 1OSSA 1FX0B 2C8WB 4D8NA 4LZ1H 5EPNA 1LPZB 2VIOA 1FIZA 3N7DA 1S6LA 1GMDF 1GBDA 1S82A 2KR7A 2P3TB 3R0FA 1JRTA 1P8VC 1P9UA 1HAVA 1QJ1B 1A5HA 4B6FA 3O8RA 2CF8H 1ANCA 1KDQB 2WHXA 3ATMA 5GXPA 3F1SB 1YBWA 3EYDA 4CRBA 2A4RA 4CBOA 2W7SA 4NFEA 1VCQA 3K65B 1HGTH 1ESBA 1MKXK 2BLWA 4YOJA 1PPGE 3RM2H 1Y5UT 1N8OC 1ARBA 1HJ9A 2P3UB 4AC9A 2ZWLH 1GBAA 1GMHG 1O35A 1TPSA 4XBCA 2QXHA 2ZFRH 3TJNA 1MH0A 2V35A 2IN2A 1NFYA 2VB0A 2XBWA 3VB5A 4WVPE 3QK1A 5C3NA 4YT6H 1RTFB 3A89A 1VITF 2R3YA 3FZZA 4Y79A 3RXGA 3ESTA 3BG4B 1DLKB 4J2YB 1O2SA 3U1JB 2QV1A 5A8XA 3P70B 3T28A 3UWJH 1O3BA 3BTWE 3FO8D 3ZVDA 1ABIH 1MTWA 3VEQB 3UREA 1LKAA 1F0RA 1O3NA 1DICA 2Q1JA 2XNIA 4A1VA 1UVPA 1O3DA 3SU2A 1AB9C 1GGDC 2HVXA 3MH7A 1GJ6A 2CN0H 1DUEA 1QRXA 4MNWA 3NWUA 1Y59T 1A3BH 1CBWC 1D6WA 1KDQA 1KIGH 1HCGA 1ELFA 1ANBA 2Z9IA 3IITA 4YOGA 2EA3A 5FPTA 1TX6A 4IBLH 1V2JT 7ESTE 5EXNA 3ITIA 4B73A 2H5CA 2PFEA 1EKBB 1ELGA 4KTUA 4NWKA 3PWBA 1QCPA 4PROA 3MI4A 1P57B 2UWOA 3BIUH 1MBMA 1IHSH 1TGSZ 5EODA 3Q77A 1SGPE 1GBKA 2JDID 2QAAA 2G52A 3ZVBA 1ESAA 2CV3A 1LKBA 3U8RH 2WPDD 4AYVB 3RXDA 3SV2H 1O3IA 4RSPA 4X6MA 3FOAA 2F9PA 1SGFA 4I86A 1INCA 1DT2A 5C2ZA 1HAHH 1SOTA 1O2LA 1TWXB 3CS0A 3L3TA 2ZFFH 1AWFH 2J4IA 2L74A 2V3OH 3A87A 1KLTA 3VXEH 1FN8A 4NIWA 3A7WA 3NXPA 2AFQB 3KEEA 1ZHMA 2VVUA 2FLRH 3SU3A 2ZCLP 1C5SA 3KF2A 4D7GA 1ANEA 1TNHA 2PKAA 1SGYE 5DP5A 1O3FA 2HLDD 4XOJA 2PV9B 1ZTLA 1V2KT 1BHXF 7GCHF 4NGAH 3ZVFA 2FXRA 2HNTF 2SGQE 1RTLA 2HPPH 2G00A 3P8NA 3RXMA 1EPTA 1KXFA 4O9VA 1GVKB 4X6OA 1CT4E 1VZQH 4B76A 3F0OA 1G3DA 2A31A 3RXSA 1DY9A 3M3TA 3EA9A 5A8YA 1O2ZA 5ESBA 1XUGA 2C8ZB 3T29A 4CRGA 2F43B 3DD2H 7KMEH 5E0JA 4UFFH 1AN1E 4NSYA 3SUGA 3SU6A 1BJUA 2CHAB 1A0HB 2H9TH 2FEQH 1TPPA 1THRH 3SV6A 5B6LA 3OU0A 2TGPZ 1SGDE 1DSUA 1SFIA 3E0NB 2HGTH 3T27A 1TX8A 1YLNA 2NU3E 1PPHE 2PTCE 1W11U 1IQLA 1WTHD 3BF6H 3GOVB 1HRTH 1UK2A 5GIBA 4CREA 6CHAB 3ATKA 1AGJA 2Y6TA 1C1SA 1AKSB 3V13A 1DY8A 1EASA 3PV5A 3A7XA 2JH0D 1YLCA 3BV9B 1F0SA 1TE0A 4IMZA 1PPCE 1OWJA 4AB9A 3F0PA 3VB4A 2BY5X 1BBRE 1BOQA 2D26C 5EGMA 1YCPK 1JIMA 3UUZA 1DDJA 2ZDAH 1GMDG 1N8OB 2O8TA 2QCYA 1Z1JA 3TU7H 3AVZA 3K2UA 3FFGA 3MOCA 1A4WH 1O2YA 2KCYA 1TABE 1MAXA 3M3VA 3AK5A 1ZGVA 2BOHB 1SI5H 4X1RU 3M36A 3SGAE 1A3EH 2IJD1 1NU9A 3SNEA 3A80A 4DG4A 3Q3KA 3VPKA 1FDPA 1O3PB 4AFSA 1S6FA 2ZO3H 1CHGA 2AMQA 8KME2 2ILNA 1HAVB 3MU8A 4NIYA 1BB0B 5SGAE 1PPZA 2BX3A 3KQBA 2YMSC 2BDAA 2F4LA 2R2MB 1C5XB 2F9VA 2YMSD 3MO6A 3A82A 3QZRA 3MU5A 4JZFH 3F2HA 2PKSB 3NK8A 4Q7ZA 4FU9A 4O03A 1SKYE 1LMWB 4FUBA 4ZXYH 3RXPA 4ABBA 4INKA 2TGTA 5FBEA 3H09A 3UAIC 1ZPBA 5GPIB 1MU8B 5HKKD 3A81A 2ZFSA 5B6OA 4H6TA 3T25A 3ZV8A 2Y5GA 3ODFA 1V2WT 1RGQA 1DXWA 1NFWA 3AAUA 3Q00A 1CGIE 3DCLA 1BMNH 3M3SA 1TALA 2PLXA 5C5OA 1QY6A 5KECA 1GI3A 1O3CA 2O9QA 1D9IA 1P01A 3ODDA 3PLKA 1XVMA 2GT8A 3W95A 2O8WA 4O3UA 4D7FA 3SHCH 1Y8TA 1QFKH 1DE7H 3SUEA 3RLWH 3DSGA 3IG6B 1OHHD 4ISOA 4B2AA 3PMAB 1H8IH 4X2WA 1TBZH 1UCYE 4D76A 4OS1A 3JZ2B 3QTOH 3ZYEA 1C5UA 3HK3B 4K3JA 1V2ST 3TH4H 5CE1A 4FXGH 1GBIA 3IWMA 1VJ9U 1DXPA 1VCPA 3OAAD 1SGEE 2GV6A 2BXUH 1NRSH 2QF3A 4MDSA 2BD3A 3A83A 1FONA 5DP7A 3RXBA 2J98B 3O8BA 4Z6AH 3BEUA 1SG8B 1NRPH 3UFAA 2VIQA 3GCNA 2BQ7B 3KYFA 2EI6A 2A45B 2FZZA 2BD2A 1MTNC 2Z6BD 1EB1H 1O30A 2AGIX 4THNH 1P03A 5AVDA 1QA7A 3M37A 1MKXH 3SNDA 4LK4A 3DFLA 3DUXH 1YWUA 3U8TH 5H4IB 1TQ0B 1BITA 2XOKD 1EQ9A 2PUQH 3ZZBA 1ELEE 6GCHF 3D49H 3KQ5A 4A7IB 3U98H 2EQNA 1P05A 5DN6D 1AU8A 1ZPZA 2XWBI 2NU0E 1GHYH 1C1RA 1GPZA 1HLTH 4ISLA 2FOHA 4WWYA 2NU2E 3MNCA 2ZKSA 1DX5M 4RKJB 1O3HA 2F9OA 3V7TA 4YZUA 4ABAA 1PPBH 1HAGE 3TJVA 4CH2B 2CHAC 1C5NH 2VIDA 3SI3H 1NRRH 1MABB 2DE9A 1OWDA 2OC7A 3QGNB 1HB0B 1EXFA 4AZ2B 3RMNH 4GLYA 4NCYA 1GHAG 1GMHF 4FUEA 1O38A 4RN6A 3N7OA 3UB0A 1O34A 3UQVA 3MNXA 5T1VA 1TLDA 5A8ZA 1GI8B 3MU1A 1QBVH 4H4FA 2ZDNA 2G4TA
chains in the Genus database with same CATH topology
2J98A 2J98B 3EE7A 2J97A 1QZ8A 5HIYA 1UW7A 5HIZA 5C94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J98 A;  2J98 B;  3EE7 A;  2J97 A;  1QZ8 A;  5HIY A;  1UW7 A;  5HIZ A;  5C94 A; 
#chains in the Genus database with same CATH topology
 1O3O A;  3HK6 B;  1QZ8 A;  2FWW A;  2XC4 A;  2IPQ X;  3AAS A;  1O2R A;  1RXP A;  2PHB A;  2ZDM A;  3UR9 A;  1PJP A;  3ZZD A;  2GCT B;  4BAO B;  3VB6 A;  1UTM A;  4TY6 A;  2YNB A;  1ABJ H;  1E35 B;  2GV7 A;  1C1Q A;  2FTM A;  1ETT H;  5HXF A;  3DFJ A;  3RXH A;  5JBA S;  1GBT A;  1YKT A;  1C4Y 2;  1LVM A;  1UJ1 A;  2ULL A;  3BIV H;  2J94 A;  2H5D A;  1FUJ A;  1YGC H;  2RA0 A;  1UVT H;  2FS8 A;  2G5V A;  1H9I E;  2PP6 A;  1FIW A;  2BD5 A;  1MZD A;  2JH5 D;  1FV9 A;  2NWN A;  1SFQ B;  2KZ4 A;  1B5G H;  1S81 A;  1K0H A;  4BNR A;  1BHX B;  1J8A A;  2CF9 H;  3RML H;  1YPH E;  2QY0 B;  2OTV A;  1S5S A;  2FTL E;  2QC2 A;  3OX7 U;  3P17 H;  5AHG H;  2BYA X;  2JKH A;  3A86 A;  1W8B H;  2OC0 A;  4ZAE A;  4A5T S;  5LPF A;  2EI7 A;  2XTT B;  2PUX B;  1MZA A;  4X8T H;  3DHK H;  5IK2 D;  1KYN A;  3STI A;  1FQ3 A;  1ELV A;  1KLJ H;  2WZQ A;  4WH6 A;  2SGF E;  4FUC A;  1CA8 B;  2B5T B;  1O2M A;  2BVX H;  1OWE A;  4IC6 A;  5EJ1 A;  2YNA A;  1ORF A;  1HXE H;  2FS9 A;  3C1K A;  3LH1 A;  4Q4L A;  3SNA A;  1K1O A;  1RIW B;  4RI0 A;  2V6N A;  1QL7 A;  5DG6 A;  2FOG A;  4I8J A;  4Y0Z E;  2G8T A;  1EAI A;  1G2M A;  1LHC H;  3H7T A;  4FUI A;  1EZX C;  2ZZU H;  2GTB A;  2XBY A;  2FIR H;  1L0Z A;  4LOY H;  3MHW U;  4OGX A;  3E1X B;  2OC8 A;  1C5L H;  4ZKN U;  2Q6G A;  3U8O H;  1SSX A;  3SQH E;  2OXS A;  1S85 A;  2K0Q A;  3CNR A;  4OS5 A;  4E7N A;  1FPC H;  3D65 E;  1GHV H;  5FXL A;  4DOQ A;  2BZA A;  2OBQ A;  5E2O A;  3H5C B;  5PTP A;  1DPO A;  1GBC A;  2BY6 X;  1HBT H;  4I8G A;  1W7X H;  2W7U A;  3ZZ6 A;  1O2K A;  1GI4 A;  2AYW A;  1EX3 A;  3UPE A;  2TIO A;  4IS5 A;  2P8O C;  4IGD A;  4B75 A;  3F6U H;  2BZ6 H;  3SBK A;  4UEH H;  3S9A A;  3U9A H;  1QGF A;  4DII H;  1YY3 A;  2O8U A;  5DP8 A;  1HXF H;  1IHT H;  5T6F A;  1WXR A;  3QO6 A;  2C90 B;  1TGN A;  1NT1 A;  5EST E;  4FET A;  3PRB A;  3KHV A;  1TIO A;  1HV7 A;  4X0W U;  5EW2 H;  1JRS A;  1GBL A;  4Y71 A;  4Y8X A;  1A5G H;  2ZFP H;  4NG9 H;  4NWL A;  2K8I A;  1MU6 B;  1EZS C;  1EP6 A;  3SW2 B;  7GCH G;  4ASU D;  5F03 A;  2HRV A;  2VIW A;  4CR9 A;  3F68 H;  2BHG A;  4J1Y A;  1J14 A;  3B9F H;  2A32 A;  3FAO A;  2P95 A;  1QRW A;  3P95 A;  1TA2 A;  3NPS A;  4DCD A;  2GDD A;  3TK6 A;  1C5O H;  2TGA A;  1V6D A;  4GVU A;  2Q6D A;  1AFQ B;  4FU8 A;  1MMJ N;  2LNC A;  3M5O A;  1C2L A;  1O5D H;  5JDU B;  5A0C A;  1Y3U A;  1GMC G;  2JET C;  2QXI A;  4TT3 D;  1GBE A;  4IN2 A;  1ZJD A;  2ZU4 A;  4X8V H;  1CGH A;  3OTP A;  2F9N A;  3F9G A;  1YP9 A;  5E8E H;  1LQE A;  2ZP0 H;  3GCH C;  3SV8 A;  4AX9 H;  3RXA A;  2Z3E A;  2O8M A;  1WTG H;  4A92 A;  1SHY A;  1SGT A;  3A7Z A;  3AW0 A;  2PWX A;  3SNB A;  1RTK A;  1XKB C;  2ZEB A;  3LU9 B;  1F0U A;  4U01 A;  4MPU A;  3SU0 A;  2RDE A;  5G4B A;  2VJ1 A;  2WV9 A;  1DS2 E;  1MQ5 A;  1WU1 A;  2GT7 A;  2P3F H;  1SGF G;  1VR1 H;  1RS0 A;  4MLF B;  3GDV A;  1ELA A;  2THF B;  1DST A;  4AB8 A;  4ZKO U;  1Z8I B;  1FN6 A;  4MQA A;  1GG6 B;  1GBJ A;  1C1V H;  1DFP A;  1T8L A;  1O2W A;  3SI4 H;  1C5V A;  1NN6 A;  2BLV A;  4WJG 2;  3P92 A;  4UE7 H;  1K9O E;  3PTN A;  3OYP A;  3KID U;  1S0R A;  1QIX B;  3MNB A;  4JYU H;  2A0Q B;  1BRB E;  2FOD A;  2FX6 A;  3G01 A;  1TGB A;  5EU8 A;  3KYG A;  2UUJ B;  4BTT B;  1GJB B;  3OEH D;  1ZZZ A;  5HMA A;  5CMX H;  1UTJ A;  2ZTY A;  3RXL A;  1C1N A;  1LO6 A;  4GCH G;  3QN7 A;  4AFQ A;  2W3I A;  8EST E;  4RKO B;  3SV7 A;  2KAI A;  3SNC A;  3BTD E;  4KTS A;  1TMB H;  1C2D A;  3UNQ A;  8LPR A;  2CGA A;  1NTP A;  2A7J A;  1EOJ A;  1HNE E;  1K1M A;  1AFE H;  2IOT A;  3RU4 D;  1ZHR A;  3K6Y A;  2ANW A;  2QE7 D;  4XBD A;  4IMQ A;  1MKW K;  2JH6 D;  3HKJ B;  4U32 A;  2G5N A;  1SQA A;  1V2O T;  3LH3 A;  1SC8 U;  1ZOM A;  2C4F H;  2NU4 E;  1CA0 C;  3QX5 H;  2WPI S;  3SYJ A;  1O2N A;  1OWH A;  1H9H E;  1TNL A;  1XUH A;  3MU4 A;  5FCR A;  2GZ7 A;  3VB3 A;  4HFP B;  4RT0 A;  2BD8 A;  2XXL A;  3URC A;  1FI8 A;  4ZUH A;  1UTK A;  2GMT B;  1OP8 A;  4NA8 A;  4X1P U;  2F83 A;  3P6Z B;  5K0H A;  1DIT H;  4AYY B;  2XBV A;  3WWF A;  5JBT A;  1Q3X A;  4UFE H;  2GKV E;  1HJA B;  1XUI A;  2G81 E;  3M7Q A;  3OSY A;  1AFQ C;  2Z94 A;  2FDA A;  1AVG H;  1GWA A;  1GBF A;  1G9I E;  1UTP A;  1IQN A;  3UWI A;  1QHR B;  4I7Y H;  1K1N A;  1XM1 A;  3M61 U;  3I78 A;  4FUG A;  1YPH C;  1IQE A;  1TRM A;  1P2Q A;  1SGN E;  4RT1 A;  5F53 A;  3ZVC A;  2KM0 A;  2ZGX H;  2ZG0 H;  3E91 A;  1UHB A;  5BRR E;  2BDH A;  3LJO A;  3PO1 B;  4Z1M D;  1C5P A;  1FAX A;  3NZI A;  4D9R A;  1GCD A;  4YXW D;  1O2G H;  2B8O H;  3TIU A;  3GY4 A;  1V3X A;  1ELC A;  1W0K D;  2BDI A;  3BEF B;  4NZL A;  1ZRB A;  3ZV9 A;  1JOU B;  1GI0 A;  1TNG A;  1Y3V A;  3R3G B;  2AGE X;  1V2T T;  2ODQ A;  4ABF A;  3HAT H;  1P11 E;  4MNY A;  5EPY A;  5E0H A;  4FUF A;  1G36 A;  1CBW B;  1BCU H;  3FAN A;  5EQQ A;  5EW1 H;  1HIA B;  1P02 A;  5TCA A;  3GY3 A;  2G55 A;  2ZEC A;  4KP0 A;  1WV7 H;  2A4G A;  4B74 A;  4UDW H;  2ANY A;  4NFF A;  3ZIA D;  2BDG A;  2JJ1 D;  4NIX A;  1YCP M;  2BY7 X;  3LGI A;  5AFZ H;  1E34 B;  3ZZA A;  1YF4 A;  1TNI A;  2ZF0 H;  1GBM A;  2HVY B;  1W2K H;  5DSF A;  2UWP A;  1YM0 A;  1YCP H;  2A7H A;  2RG3 A;  3LC3 A;  4X1Q U;  2VH6 A;  2VIP A;  1MTU A;  3UOU A;  1TGT A;  1OYT H;  1PYT D;  2IPH A;  1P2O A;  1DWC H;  1UVS H;  4CR5 A;  2ZU1 A;  2AGG X;  4ZRO A;  3RXK A;  1ZYO A;  4DW2 U;  2WYG A;  1AY6 H;  2AS9 A;  2OC1 A;  1QRZ A;  3KNX A;  3MFJ A;  3P8G A;  2C3S A;  1UO6 A;  1EUF A;  3L6P A;  1C2H A;  4ZHL U;  2F3C E;  1TFX A;  2JJ2 D;  2HNT C;  1EAU A;  2W6I D;  1DWD H;  2FI3 E;  4E7R G;  1EOL A;  2J2U A;  3W94 A;  2OCV B;  7LPR A;  1C1U H;  1C4V 2;  2W3K A;  1CE5 A;  3GDU A;  1XMN B;  1V2V T;  2G51 A;  1UCY H;  5IYT A;  5A0B A;  2ZGH A;  3RXQ A;  2A4Q A;  1MD7 A;  2SFA A;  4B6E A;  3MQK C;  2YMS B;  3OE7 D;  3TH3 H;  3GY8 A;  2R2W U;  6LPR A;  1K2I 1;  1COW D;  4Q7Y A;  3ENS B;  3BEI B;  6EST A;  3ZVE A;  3F9E A;  1HAY B;  1L4Z A;  6GCH G;  1YPJ H;  2AHM E;  1C4U 2;  3PM3 A;  3SQE E;  4MNV A;  2JET B;  3UOP A;  1NRO H;  3RXC A;  3S0N A;  1GG6 C;  5IDK A;  4AFZ A;  3NKK A;  3RU4 E;  3SJ8 A;  1VIT H;  5EG4 A;  3URD A;  3EDX B;  1QUR H;  1PPE E;  1OWI A;  3SV9 A;  3TLO A;  1YC0 A;  1TRY A;  1O37 A;  1GDN A;  3A7T A;  1VKY A;  4YM9 A;  5A0A E;  4ZH8 A;  4ABG A;  1BML A;  4CHA B;  2RDL A;  3F2F A;  1BTW A;  3ATW A;  1NRQ H;  2SNV A;  3PYH A;  1QBN A;  2PKS C;  1Y5B T;  2I6S A;  1KSN A;  3PRO A;  4ZKR U;  1BTX A;  4WXI A;  4A1X A;  3E3T A;  1AI8 H;  3SJI A;  2BX4 A;  1FXY A;  2P93 A;  1SGI B;  4ZKS U;  1KXE A;  1PQ5 A;  1AB9 B;  1HAX B;  1VGC C;  5HIY A;  4MNX A;  1E38 B;  3A88 A;  2STA E;  2WPL S;  2V0B A;  2ZPR A;  1O2O A;  1D3D B;  3EGK H;  9LPR A;  2A5I A;  5J4S A;  3SJK A;  4AG2 A;  1LVB A;  2OK5 A;  2FI5 E;  2BD4 A;  4M9F A;  2SNW A;  4TY7 A;  3C27 B;  4BAN B;  3T2N A;  2M2A A;  1S0Q A;  3O8D A;  4Q7X A;  1PQA A;  3KQD A;  1PYT C;  1QB1 A;  5FPY A;  1LTO A;  3E8L A;  4O97 A;  2Y81 A;  3UTU H;  1BA8 B;  4HG6 A;  1EPT C;  1J15 A;  3AAV A;  2RA3 A;  2C8Y B;  1ZMJ A;  1P2J A;  2Z9K A;  2QXG A;  4BAH B;  2FOF A;  2ALV A;  2FOC A;  1VCW A;  4AGJ A;  5FBI A;  1Y3W A;  2ZQ2 A;  2OIN A;  2BMG B;  4Y8Y A;  3F9F A;  1ZSL A;  1EZU C;  4UD9 H;  1K28 D;  1C9P A;  1O3A A;  2PGQ B;  1CGJ E;  2ZPS A;  2STB E;  1O39 A;  1Y5A T;  1J17 T;  1IQK A;  1FPH H;  1TGC A;  4YTA A;  3RXI A;  4B71 A;  5CDF E;  2W6J D;  1W10 U;  1OP2 A;  1QJ7 B;  1HJA C;  4Y7B A;  3K9X B;  5AF9 H;  4AG1 A;  2XW9 A;  4GSO A;  2VWN A;  1V2Q T;  1N6X A;  1NES E;  1ZR0 A;  1BTZ A;  3SUF A;  2K1Q A;  3UQO A;  1QJ6 B;  4D9Q A;  4UFG H;  3LDX H;  1G3C A;  3E6P H;  2VBC A;  4JYV H;  3Q3X A;  1GCT B;  3M35 A;  1F2S E;  1P2M A;  4O3T A;  3S7H B;  1XXD A;  1ZTJ A;  1TBQ H;  1YPK H;  2DE8 A;  4NA7 A;  1AWH B;  1QTF A;  4ISN A;  2HLC A;  1L2E A;  1O32 A;  2M5T A;  3RXT A;  1K21 H;  1S83 A;  5HGG A;  2J95 A;  1K22 H;  2VNT A;  1GI5 A;  4I31 A;  3B8J A;  1A2C H;  1EST A;  4JK6 A;  4DGJ A;  2ZQ1 A;  1IOE A;  2QF4 A;  2KAI B;  1AD8 H;  1TAW A;  3GY7 A;  4JK5 A;  2A2X H;  2OUA A;  2ZU5 A;  3DSP A;  1C5Z B;  1C1W H;  1CT0 E;  2FX4 A;  1EZQ A;  1T4V H;  3GIC B;  4XBB A;  1N6Y A;  5E0G A;  1TPA E;  2UUF B;  4X1S U;  1C5M D;  1G3E A;  1B0E A;  1C5W B;  1S6H A;  4JZE H;  2QIQ A;  1G32 B;  4BTI B;  1AIX H;  5FCK A;  1PFX C;  2H9E H;  1XVO A;  2VIN A;  4AOR A;  5LGO A;  1AMH A;  4GCH F;  3PO1 C;  3H7O A;  2PW8 H;  2H2Z A;  1Z71 A;  3FP8 E;  1FNI A;  3PTB A;  3MH4 A;  1HYL A;  1F5L A;  1W0Z U;  2WYJ A;  1FY5 A;  3SJ9 A;  5FPS A;  1IQM A;  5DP6 A;  1QB9 A;  2J34 A;  1BBR K;  1F0T A;  1LDT T;  4Q2K A;  1ZJK A;  3LGU A;  4ACB A;  4BXW A;  5DK1 A;  2QXJ A;  2OLG A;  1SB1 H;  1GJ8 B;  5F6M A;  3BTM E;  1NFX A;  3GCO A;  2VVC A;  1IQG A;  1KXA A;  2CK3 D;  3GY2 A;  4OM9 A;  3TJU A;  1YPG H;  2ZNK H;  3PMJ A;  3NUM A;  3FP7 E;  1ZGI A;  4MVN A;  1EJA A;  3V3M A;  1S84 A;  4FU7 A;  5C0U A;  5C67 A;  2ZPQ A;  1SGQ E;  2Z3C A;  3QUM P;  4U30 A;  2R3U A;  3GS9 A;  4HI3 A;  1CT2 E;  5C1X A;  5KED A;  1QB6 A;  4IN1 A;  1O3K A;  1EPT B;  1WYK A;  4DY7 B;  2J5U A;  3BTF E;  1T8O A;  4E05 H;  4ISI H;  3ZVA A;  4K2Y A;  2ZIQ H;  3PMB B;  3L33 A;  1C2F A;  3KN2 A;  2KCA A;  1K1P A;  3VGC B;  3BG4 C;  4I8H A;  3ZZ8 A;  2A4O A;  4OS6 A;  2VGC C;  4YLU A;  1NU7 B;  8GCH F;  3SOS A;  1A5I A;  1XKA C;  3TK5 A;  2XC0 A;  2FOM B;  3SU5 A;  1OXG A;  3F9H A;  1AQ7 A;  2HPQ H;  1LPG B;  1SR5 C;  3M7T A;  2P94 A;  5DP4 A;  2R9P A;  5DP9 A;  1K1I A;  5L6N H;  3M7U A;  1HAO H;  3RLY H;  2GGV B;  1FY1 A;  2GZ9 A;  2TGD A;  5C1U A;  3U1I B;  3MH6 A;  3MU0 A;  1ZHP A;  1N1L A;  4DT4 A;  2SGD E;  2DUC A;  4SGA E;  4I8L A;  5C17 A;  1GI6 A;  2FP7 B;  3GYM A;  1TNJ A;  2P59 A;  4FOU C;  1WCZ A;  9EST A;  3OTJ E;  1ACB E;  4HGC A;  1ZSJ A;  3RMM H;  2XYA A;  1C9T A;  2GP9 B;  2WPH S;  2Y7Z A;  1PQ8 A;  4ASH A;  1Z6J H;  3A7V A;  3RXO A;  3BTQ E;  1O3M A;  3A7Y A;  4DVA U;  1AE8 H;  1VJA U;  2RCE A;  3A85 A;  3RDZ A;  1TPO A;  3FVF B;  4P02 A;  1BQY A;  1P06 A;  3LGW A;  3F3B A;  2ZGB H;  3NCL A;  1MTN B;  2ZGJ A;  1FZZ A;  2J92 A;  2TRM A;  1O2H A;  1C1P A;  1A0J A;  1NBM E;  1O2Q A;  3M5N A;  5F8T A;  2KCO A;  4FUJ A;  2OP9 A;  2FO9 A;  3RMO H;  2XND D;  2A5K A;  1EAX A;  1UK3 A;  2WUC A;  1IQF A;  4VGC B;  4CH8 B;  1TB6 H;  5CHA C;  2UUK B;  5FX6 A;  1BRU P;  3SO3 A;  1RIW C;  5HIZ A;  1A0L A;  3EE7 A;  1C2J A;  2AMP A;  5LH8 A;  1TMT H;  1PQ7 A;  4MG3 A;  1JMO H;  2P16 A;  1BTP A;  2C93 B;  1FY8 E;  1BDA A;  4JZ1 A;  1LVY A;  3W1E A;  2FOE A;  3BG8 A;  3SJO A;  1TQ7 B;  2EST E;  1GCT C;  4TPY A;  3RU4 T;  4GPG A;  1O33 A;  1Z8J B;  3KL6 A;  1SVP A;  1P2K A;  2ZHF H;  2VWL A;  1CU1 A;  1BMA A;  3RXJ A;  3TGK E;  3KGP A;  2QF5 A;  4BOH A;  2WPK S;  3N7E A;  1YPM H;  1O0D H;  1P2N A;  2ZTZ A;  4R8T B;  3O8C A;  1SBW A;  1UHB B;  2BD9 A;  5C1Y A;  2PR3 A;  3ZZ5 A;  5EXL A;  1C2G A;  1ZML A;  1FMG A;  4ABJ A;  1C5Q A;  3HPT B;  1IQJ A;  1MTV A;  4XD7 D;  3A84 A;  1SPJ A;  2ASU B;  1FLE E;  1V2N T;  4FUD A;  3OEE D;  5TCC A;  3OY6 U;  3TNT A;  2D2D A;  2J97 A;  1NRN H;  1H1B A;  4OS7 A;  4Q63 A;  1CO7 E;  1K1L A;  1DUA A;  1EJN A;  2JIZ D;  5GND A;  1UVU H;  1JBU H;  3FKS D;  4ABD A;  4I33 A;  1F92 A;  1SGR E;  6CHA C;  2Y80 A;  1D3Q B;  1ELB A;  4DUR A;  2V3H H;  3A8A A;  1Z8R A;  5CHB A;  4OGY A;  3TK9 A;  4CRC A;  1UTQ A;  3S7K B;  2WPJ S;  4K5Z A;  5DJ7 A;  1O5G H;  1GHX H;  1ID5 H;  3ZYD A;  2ODP A;  1O2I A;  2F91 A;  1JIR A;  1BJV A;  1D3T B;  1BMF D;  2ZHW H;  1O2X A;  3N99 A;  5F8X A;  3RC4 A;  1KMH B;  2WSS D;  3EE0 B;  1G37 A;  3EAJ A;  3CP7 A;  5JYI A;  2A1D B;  1ELD E;  2QYI A;  3QWC H;  3F2G A;  3RXV A;  1P10 A;  1NO9 H;  2ALP A;  2R0K A;  3GCH B;  1CHO F;  2GDE H;  2PTN A;  5DPA A;  1KXB A;  3RC5 A;  3DT0 H;  2LP6 A;  4X2Y A;  1C5T A;  1WAY B;  4HZH A;  1O5B B;  4GHT A;  4JMY A;  2PGB B;  3SGB E;  3WY8 A;  3NRL A;  4XDE A;  3LON A;  1B0F A;  1Z7K A;  1PPF E;  2XCF A;  4ABI A;  1OKX A;  4AGK A;  4OS2 A;  4KGA A;  3TJO A;  1C1O A;  4K1E A;  3S69 A;  1WQS A;  1DWE H;  4WH8 A;  2OBO A;  3ZZ9 A;  4LZ4 B;  4XE4 A;  3RXR A;  1GHZ A;  2QA9 E;  3E90 B;  1BMM H;  4BAK B;  1HPG A;  2ZDL A;  1MUE B;  1H9L B;  1GVZ A;  4B1T A;  1GHA F;  4Y6D A;  2EI8 A;  3ZZC A;  2AIQ A;  1GI2 A;  4HTC H;  1G3B A;  3GY5 A;  1C1M A;  2AH4 X;  2EEK A;  5JBB S;  1AND A;  3SU4 A;  1SMF E;  1QR3 E;  2B7D H;  2CMY A;  2J9N A;  3VFE A;  3V12 A;  2BDB A;  4ZHM U;  2ZU3 A;  4H6S B;  1XUJ A;  4TYD A;  1MBQ A;  1D6R A;  5GDS H;  1Q31 A;  1DOJ A;  4ABE A;  4KTC A;  5EIY A;  2BDY A;  2Z9J A;  1OP0 A;  1GGD B;  2ZC9 H;  3PV4 A;  3KQE A;  1GHB F;  1XX9 A;  5GCH G;  1TA6 A;  4P00 A;  3PLP A;  4AOQ A;  3TIT A;  5E2P A;  4AN7 A;  2RFK C;  4F48 B;  1THS H;  1QA0 A;  2Y5F A;  5EQS A;  2Y5H A;  1TOM H;  2R0L A;  1T31 A;  1C2I A;  2B0F A;  1ZSK A;  1IQI A;  2AER H;  4YOI A;  2BVS H;  4UFD H;  1G30 B;  1DVA H;  4JYT A;  4K8B A;  2GCH F;  2BLQ A;  3E16 B;  1E37 B;  2A2Q H;  2H9H A;  3QGJ A;  3BTE E;  3WWB A;  1ETR H;  1XXF A;  1LVO A;  4XSK U;  3M5M A;  1SHH B;  5CHA B;  5C20 A;  1P12 E;  1RFN A;  2FOA A;  2O8L A;  1RRK A;  2FLB H;  3ZZ4 A;  1HUT H;  2KCP A;  1W13 U;  2ZFQ H;  1NZQ H;  1KTS B;  2ZTX A;  5DKM A;  4GHQ A;  1P09 A;  2FYR A;  3SHA H;  1K1J A;  1A46 H;  2Y7X A;  4SGB E;  1IAU A;  3RM0 H;  1HFD A;  2Q6F A;  3GCT F;  2KFW A;  3T62 A;  1T7C A;  1D4P B;  4R0I A;  1V2M T;  2OD3 B;  1U6Q A;  5F8Z A;  1L1J A;  1E36 B;  1G2L A;  2ZHD A;  1SQR A;  5EOK A;  5DGJ A;  1LHE H;  2BXT H;  1UW7 A;  1MTS A;  4CBN A;  3I77 A;  3PV2 A;  4VGC C;  1GJ4 H;  3ZVG A;  1GJ5 H;  2ZGC A;  2BY9 X;  5C5N A;  1O2U A;  3MMG A;  2ZDK A;  1DWB H;  1HAI H;  2EC9 H;  1C5Y B;  4X2X A;  5TJX A;  1GVL A;  5LPE A;  2LPR A;  1W7G H;  5JB9 S;  1NM6 A;  3LT3 A;  2GVF A;  1B7X B;  1AO5 A;  1A1R A;  1LQD B;  4QT8 C;  4ACA A;  2WIN I;  4Z0K A;  1E79 D;  5HYO A;  2GJG A;  3MH5 A;  4DJZ B;  2FM2 A;  1WDI A;  2Z9L A;  1EP5 A;  4H42 U;  3PRD A;  2WV5 A;  3Q3Y A;  3QLP H;  2FYQ A;  2W5E A;  2ODY B;  2BLO A;  1MQ6 A;  2GZ8 A;  1TMU H;  1T32 A;  2ZHE H;  1O2V A;  1BTU A;  3CS7 A;  1OS8 A;  1P0S H;  1UTL M;  3PWC A;  1P2I A;  4WME A;  3MWI U;  3ZZ7 A;  1P3E A;  4CHA C;  2WPM S;  4YT7 H;  5L2Y H;  1QL9 A;  2BTC E;  3KQC A;  1EAW A;  1SQT A;  2OQ5 A;  3HKI B;  5HM2 A;  4ISH H;  1GDQ A;  1F7Z A;  1GJA B;  3P8O A;  3ATI A;  2HWL B;  1TON A;  3SGQ E;  1IQH A;  1L1N A;  1O5E H;  3MNS A;  4Y7A A;  1AKS A;  3P8F A;  5A2M H;  1O3J A;  1TOC B;  1CSO E;  1THP B;  1W12 U;  1SLV B;  5T6D A;  3WW7 A;  3MYW A;  1W0J D;  2A7C A;  4WF8 A;  2FMJ A;  1H8E D;  3E0P B;  2Y82 A;  4BAM B;  4ZXX H;  1NY2 2;  1O3L A;  1WSS H;  2PKA B;  4I8K A;  1GMC F;  1MD8 A;  1GJ7 B;  1MCV A;  5JBC S;  1DLE A;  1UMA H;  5K7R A;  2PSX A;  1O2J A;  3RXE A;  1E0F D;  2GMT C;  4A1T A;  4X6P A;  1Z8G A;  1LPK B;  3VXF H;  5I46 H;  4IC5 A;  2FI4 E;  1C2M A;  2F9U A;  1AUJ A;  3GYL B;  1ETS H;  1HAP H;  2ZCK P;  1BTY A;  3LKW A;  3DSO A;  2W26 A;  4BTU B;  2BD7 A;  1H4W A;  1ZPC A;  3GDS A;  2ANM H;  2C8X B;  5JPM H;  1A61 H;  4DIH H;  3JZ1 B;  1ZTK A;  3SZN A;  4MPV A;  5EJZ A;  1TBR H;  2V3M A;  2ZHQ H;  5EJL A;  5FX5 A;  2AIP A;  2G4U A;  3M5L A;  1P04 A;  4K8Y A;  1BIO A;  1Y3X A;  4JZI A;  2GX4 A;  2P8O B;  2TPI Z;  1C2E A;  4INL A;  2AMD A;  4YO9 A;  1Z6E A;  1UK4 A;  5ABW A;  5BPE A;  4CRF A;  1QL8 A;  1YPE H;  4Y0Y E;  1SLW B;  2I6Q A;  3FN8 A;  3SOR A;  3GIS B;  1C1T A;  2Z7F E;  1RD3 B;  3QTV H;  1QQU A;  4EST E;  2WUB A;  1VIT G;  2QF0 A;  4TPI Z;  3MO3 A;  4FVD A;  1AVX A;  1MAY A;  4M7G A;  1AZZ A;  3TH2 H;  4Y10 E;  4CRD A;  4DT7 B;  1P9S A;  1F5K U;  1BT7 A;  2BQW B;  2VH0 A;  4WMD A;  4ZMA H;  4TSF D;  3HGP A;  2VU8 E;  1T8M A;  1ZRK A;  3EA8 A;  3I29 A;  1QBO A;  3DA9 B;  2J38 A;  2PSY A;  1OX1 A;  2BB4 A;  1GBB A;  1M9U A;  3PLB A;  3KCG H;  4NIV A;  1HJ8 A;  1EFR D;  5FAH A;  4F4O C;  1MKW H;  2NU1 E;  1NC6 A;  2KX4 A;  5HM9 A;  1CHO G;  3EA7 A;  3OFN D;  3SZE A;  1SLU B;  1ELT A;  3B23 B;  4F55 A;  1YLD A;  2BOK A;  4FVB A;  1GHW H;  1ARC A;  1SLX B;  5L30 H;  1LHF H;  4UON A;  3Q76 A;  1T4U H;  3A8C A;  4KEL A;  1OYQ A;  3LIW A;  1GJD B;  4E06 H;  4K1T A;  2SGA A;  1GJ9 B;  4LXB H;  1HIA A;  2D1J A;  1AVW A;  4BAQ B;  1HAZ B;  2ZDV H;  1GJC B;  4A6L A;  1UTO A;  1TYN A;  4F49 A;  2L6O A;  3T5F H;  3VGC C;  1NPM A;  1BRA A;  1AHT H;  2ZFT A;  1Z1I A;  4INH A;  1O31 A;  2TBS A;  3LGT A;  4XFQ A;  3STJ A;  3RXU A;  1GHB G;  1C5R A;  4MPW A;  2HNT E;  2WV4 A;  2XBX A;  3LJJ A;  2BDC A;  1BZX E;  1O36 A;  3UIR A;  1KXD A;  4K69 A;  1WQV H;  1O3E A;  1UCY K;  2XRC A;  1V2R T;  3UNR A;  1C2K A;  2GCT C;  4ZCN A;  3D23 A;  2XWA A;  5I25 A;  2UUY A;  1EAT A;  3CEN A;  4AFU A;  1YYY 1;  4Y8Z A;  3RUO A;  2ZI2 H;  1P3C A;  3BTH E;  1W0Y H;  4X1N U;  1CQQ A;  1O5F H;  5J4Q A;  1RJX B;  3LGV A;  1BUI A;  3RP2 A;  2FPZ A;  3UR6 A;  5AFY H;  5C0T A;  8GCH G;  3EQ0 H;  4YES B;  1VGC B;  5GCH F;  3MO9 A;  1H8H D;  5EQR A;  3BTT E;  1WOF A;  5KGO A;  2Z3D A;  1MCT A;  5LPR A;  1CVW H;  3A8D A;  3S9C A;  3OY5 U;  3U69 H;  2H6M A;  3ELA H;  2BQ6 B;  5L2Z H;  1JXP A;  2BVR H;  2V7Q D;  1J16 A;  4NZQ A;  1EJM A;  1KXC A;  2ZU2 A;  1SGC A;  3RC6 A;  1QNJ A;  2YOL A;  3LC5 A;  3U28 C;  3GCT G;  3SUD A;  2FOB A;  1W14 U;  2GCH G;  4GUX A;  5FHT A;  5GWZ A;  3BTK E;  5C94 A;  2HOB A;  4GAW A;  1FY3 A;  4BXS A;  2HAL A;  4TWW A;  1ZMN A;  2EY4 C;  2BY8 X;  1FY4 A;  5T3H A;  3A8B A;  1YPL H;  4Y11 E;  1SL3 A;  2OQU A;  3VG8 A;  3TVJ B;  4X8U H;  2AEI H;  1V2U T;  1HDT H;  1F5R A;  1E1R D;  3MTY A;  2LEL A;  1BRC E;  1TNK A;  1LHD H;  3FP6 E;  2UWL A;  1WBG B;  2ANK H;  3K6Z A;  4ABH A;  1GI7 B;  4Y76 A;  1KY9 A;  1Y3Y A;  1ZLR A;  4TWY A;  4JCN A;  2F9B H;  3T26 A;  1Q2W A;  3LPR A;  1O5C B;  3V0X A;  1SQO A;  4X2V A;  2CJI A;  4NSV A;  1DAN H;  2VGC B;  4K60 A;  3TPI Z;  1NFU A;  2VIV A;  4YLQ H;  1D3P B;  1W3C A;  1O2P A;  2A5A A;  1L4D A;  1X7A C;  1TRN A;  1JWT A;  1GL0 E;  4CRA A;  1UVO A;  1OOK B;  1KTT B;  1TX7 A;  3RXF A;  3TGI E;  3LGY A;  3FZD A;  1E1Q D;  2B9L A;  1GI1 A;  4MPX A;  1GDU A;  2J98 A;  2IJO B;  1AZ8 A;  3BSQ A;  3HGN A;  1A7S A;  4Q80 A;  4WY3 A;  5DP3 A;  4B2C A;  2VVV A;  1L1G A;  1OPH B;  3D62 A;  2QGR A;  3PMH B;  2GD4 B;  4I32 A;  1LCY A;  1WUN H;  3SN8 A;  1XUK A;  2ZCH P;  2ZA5 A;  5ETX A;  5FL7 D;  2FES H;  1H8D H;  4X6N A;  2XC5 A;  1O2T A;  5A09 A;  1V2L T;  4WXV A;  3PB1 E;  1UTN A;  4MTB A;  3SU1 A;  1SOZ A;  4KKD A;  4NA9 H;  1O5A B;  1AUT C;  3GY6 A;  4FUH A;  1XUF A;  3TNS A;  2VWM A;  4JZD H;  3ZZ3 A;  3ATL A;  5EXM A;  4K1S A;  1BTH H;  4IW4 E;  3UNS A;  4B2B A;  4X8S H;  5GJ4 B;  1QQ4 A;  1LHG H;  1O3G A;  2SGE E;  3S9B A;  1BBR H;  4U2W A;  3LOX A;  1KLI H;  4WMF A;  1EB2 A;  1GBH A;  3QDZ B;  1FJS A;  2D8W A;  1OWK A;  5JB8 S;  1GL1 A;  2SGP E;  2H1U A;  3VB7 A;  2XCN A;  3UY9 A;  1AE5 A;  1FAK H;  3BTG E;  1J9C H;  2QN5 T;  5T6G A;  2VWO A;  3BN9 A;  1V2P T;  4OS4 A;  5DO4 H;  2BM2 A;  2CXV A;  4ZHA A;  2Z9G A;  3QZQ A;  1NBM D;  4XRN A;  1T8N A;  1DM4 B;  1GI9 B;  1NS3 A;  3AW1 A;  3TGJ E;  1CA0 B;  1OSS A;  1FX0 B;  2C8W B;  4D8N A;  4LZ1 H;  5EPN A;  1LPZ B;  2VIO A;  1FIZ A;  3N7D A;  1S6L A;  1GMD F;  1GBD A;  1S82 A;  2KR7 A;  2P3T B;  3R0F A;  1JRT A;  1P8V C;  1P9U A;  1HAV A;  1QJ1 B;  1A5H A;  4B6F A;  3O8R A;  2CF8 H;  1ANC A;  1KDQ B;  2WHX A;  3ATM A;  5GXP A;  3F1S B;  1YBW A;  3EYD A;  4CRB A;  2A4R A;  4CBO A;  2W7S A;  4NFE A;  1VCQ A;  3K65 B;  1HGT H;  1ESB A;  1MKX K;  2BLW A;  4YOJ A;  1PPG E;  3RM2 H;  1Y5U T;  1N8O C;  1ARB A;  1HJ9 A;  2P3U B;  4AC9 A;  2ZWL H;  1GBA A;  1GMH G;  1O35 A;  1TPS A;  4XBC A;  2QXH A;  2ZFR H;  3TJN A;  1MH0 A;  2V35 A;  2IN2 A;  1NFY A;  2VB0 A;  2XBW A;  3VB5 A;  4WVP E;  3QK1 A;  5C3N A;  4YT6 H;  1RTF B;  3A89 A;  1VIT F;  2R3Y A;  3FZZ A;  4Y79 A;  3RXG A;  3EST A;  3BG4 B;  1DLK B;  4J2Y B;  1O2S A;  3U1J B;  2QV1 A;  5A8X A;  3P70 B;  3T28 A;  3UWJ H;  1O3B A;  3BTW E;  3FO8 D;  3ZVD A;  1ABI H;  1MTW A;  3VEQ B;  3URE A;  1LKA A;  1F0R A;  1O3N A;  1DIC A;  2Q1J A;  2XNI A;  4A1V A;  1UVP A;  1O3D A;  3SU2 A;  1AB9 C;  1GGD C;  2HVX A;  3MH7 A;  1GJ6 A;  2CN0 H;  1DUE A;  1QRX A;  4MNW A;  3NWU A;  1Y59 T;  1A3B H;  1CBW C;  1D6W A;  1KDQ A;  1KIG H;  1HCG A;  1ELF A;  1ANB A;  2Z9I A;  3IIT A;  4YOG A;  2EA3 A;  5FPT A;  1TX6 A;  4IBL H;  1V2J T;  7EST E;  5EXN A;  3ITI A;  4B73 A;  2H5C A;  2PFE A;  1EKB B;  1ELG A;  4KTU A;  4NWK A;  3PWB A;  1QCP A;  4PRO A;  3MI4 A;  1P57 B;  2UWO A;  3BIU H;  1MBM A;  1IHS H;  1TGS Z;  5EOD A;  3Q77 A;  1SGP E;  1GBK A;  2JDI D;  2QAA A;  2G52 A;  3ZVB A;  1ESA A;  2CV3 A;  1LKB A;  3U8R H;  2WPD D;  4AYV B;  3RXD A;  3SV2 H;  1O3I A;  4RSP A;  4X6M A;  3FOA A;  2F9P A;  1SGF A;  4I86 A;  1INC A;  1DT2 A;  5C2Z A;  1HAH H;  1SOT A;  1O2L A;  1TWX B;  3CS0 A;  3L3T A;  2ZFF H;  1AWF H;  2J4I A;  2L74 A;  2V3O H;  3A87 A;  1KLT A;  3VXE H;  1FN8 A;  4NIW A;  3A7W A;  3NXP A;  2AFQ B;  3KEE A;  1ZHM A;  2VVU A;  2FLR H;  3SU3 A;  2ZCL P;  1C5S A;  3KF2 A;  4D7G A;  1ANE A;  1TNH A;  2PKA A;  1SGY E;  5DP5 A;  1O3F A;  2HLD D;  4XOJ A;  2PV9 B;  1ZTL A;  1V2K T;  1BHX F;  7GCH F;  4NGA H;  3ZVF A;  2FXR A;  2HNT F;  2SGQ E;  1RTL A;  2HPP H;  2G00 A;  3P8N A;  3RXM A;  1EPT A;  1KXF A;  4O9V A;  1GVK B;  4X6O A;  1CT4 E;  1VZQ H;  4B76 A;  3F0O A;  1G3D A;  2A31 A;  3RXS A;  1DY9 A;  3M3T A;  3EA9 A;  5A8Y A;  1O2Z A;  5ESB A;  1XUG A;  2C8Z B;  3T29 A;  4CRG A;  2F43 B;  3DD2 H;  7KME H;  5E0J A;  4UFF H;  1AN1 E;  4NSY A;  3SUG A;  3SU6 A;  1BJU A;  2CHA B;  1A0H B;  2H9T H;  2FEQ H;  1TPP A;  1THR H;  3SV6 A;  5B6L A;  3OU0 A;  2TGP Z;  1SGD E;  1DSU A;  1SFI A;  3E0N B;  2HGT H;  3T27 A;  1TX8 A;  1YLN A;  2NU3 E;  1PPH E;  2PTC E;  1W11 U;  1IQL A;  1WTH D;  3BF6 H;  3GOV B;  1HRT H;  1UK2 A;  5GIB A;  4CRE A;  6CHA B;  3ATK A;  1AGJ A;  2Y6T A;  1C1S A;  1AKS B;  3V13 A;  1DY8 A;  1EAS A;  3PV5 A;  3A7X A;  2JH0 D;  1YLC A;  3BV9 B;  1F0S A;  1TE0 A;  4IMZ A;  1PPC E;  1OWJ A;  4AB9 A;  3F0P A;  3VB4 A;  2BY5 X;  1BBR E;  1BOQ A;  2D26 C;  5EGM A;  1YCP K;  1JIM A;  3UUZ A;  1DDJ A;  2ZDA H;  1GMD G;  1N8O B;  2O8T A;  2QCY A;  1Z1J A;  3TU7 H;  3AVZ A;  3K2U A;  3FFG A;  3MOC A;  1A4W H;  1O2Y A;  2KCY A;  1TAB E;  1MAX A;  3M3V A;  3AK5 A;  1ZGV A;  2BOH B;  1SI5 H;  4X1R U;  3M36 A;  3SGA E;  1A3E H;  2IJD 1;  1NU9 A;  3SNE A;  3A80 A;  4DG4 A;  3Q3K A;  3VPK A;  1FDP A;  1O3P B;  4AFS A;  1S6F A;  2ZO3 H;  1CHG A;  2AMQ A;  8KME 2;  2ILN A;  1HAV B;  3MU8 A;  4NIY A;  1BB0 B;  5SGA E;  1PPZ A;  2BX3 A;  3KQB A;  2YMS C;  2BDA A;  2F4L A;  2R2M B;  1C5X B;  2F9V A;  2YMS D;  3MO6 A;  3A82 A;  3QZR A;  3MU5 A;  4JZF H;  3F2H A;  2PKS B;  3NK8 A;  4Q7Z A;  4FU9 A;  4O03 A;  1SKY E;  1LMW B;  4FUB A;  4ZXY H;  3RXP A;  4ABB A;  4INK A;  2TGT A;  5FBE A;  3H09 A;  3UAI C;  1ZPB A;  5GPI B;  1MU8 B;  5HKK D;  3A81 A;  2ZFS A;  5B6O A;  4H6T A;  3T25 A;  3ZV8 A;  2Y5G A;  3ODF A;  1V2W T;  1RGQ A;  1DXW A;  1NFW A;  3AAU A;  3Q00 A;  1CGI E;  3DCL A;  1BMN H;  3M3S A;  1TAL A;  2PLX A;  5C5O A;  1QY6 A;  5KEC A;  1GI3 A;  1O3C A;  2O9Q A;  1D9I A;  1P01 A;  3ODD A;  3PLK A;  1XVM A;  2GT8 A;  3W95 A;  2O8W A;  4O3U A;  4D7F A;  3SHC H;  1Y8T A;  1QFK H;  1DE7 H;  3SUE A;  3RLW H;  3DSG A;  3IG6 B;  1OHH D;  4ISO A;  4B2A A;  3PMA B;  1H8I H;  4X2W A;  1TBZ H;  1UCY E;  4D76 A;  4OS1 A;  3JZ2 B;  3QTO H;  3ZYE A;  1C5U A;  3HK3 B;  4K3J A;  1V2S T;  3TH4 H;  5CE1 A;  4FXG H;  1GBI A;  3IWM A;  1VJ9 U;  1DXP A;  1VCP A;  3OAA D;  1SGE E;  2GV6 A;  2BXU H;  1NRS H;  2QF3 A;  4MDS A;  2BD3 A;  3A83 A;  1FON A;  5DP7 A;  3RXB A;  2J98 B;  3O8B A;  4Z6A H;  3BEU A;  1SG8 B;  1NRP H;  3UFA A;  2VIQ A;  3GCN A;  2BQ7 B;  3KYF A;  2EI6 A;  2A45 B;  2FZZ A;  2BD2 A;  1MTN C;  2Z6B D;  1EB1 H;  1O30 A;  2AGI X;  4THN H;  1P03 A;  5AVD A;  1QA7 A;  3M37 A;  1MKX H;  3SND A;  4LK4 A;  3DFL A;  3DUX H;  1YWU A;  3U8T H;  5H4I B;  1TQ0 B;  1BIT A;  2XOK D;  1EQ9 A;  2PUQ H;  3ZZB A;  1ELE E;  6GCH F;  3D49 H;  3KQ5 A;  4A7I B;  3U98 H;  2EQN A;  1P05 A;  5DN6 D;  1AU8 A;  1ZPZ A;  2XWB I;  2NU0 E;  1GHY H;  1C1R A;  1GPZ A;  1HLT H;  4ISL A;  2FOH A;  4WWY A;  2NU2 E;  3MNC A;  2ZKS A;  1DX5 M;  4RKJ B;  1O3H A;  2F9O A;  3V7T A;  4YZU A;  4ABA A;  1PPB H;  1HAG E;  3TJV A;  4CH2 B;  2CHA C;  1C5N H;  2VID A;  3SI3 H;  1NRR H;  1MAB B;  2DE9 A;  1OWD A;  2OC7 A;  3QGN B;  1HB0 B;  1EXF A;  4AZ2 B;  3RMN H;  4GLY A;  4NCY A;  1GHA G;  1GMH F;  4FUE A;  1O38 A;  4RN6 A;  3N7O A;  3UB0 A;  1O34 A;  3UQV A;  3MNX A;  5T1V A;  1TLD A;  5A8Z A;  1GI8 B;  3MU1 A;  1QBV H;  4H4F A;  2ZDN A;  2G4T A; 
#chains in the Genus database with same CATH homology
 2J98 A;  2J98 B;  3EE7 A;  2J97 A;  1QZ8 A;  5HIY A;  1UW7 A;  5HIZ A;  5C94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...