2F9NA

Crystal structure of the recombinant human alpha i tryptase mutant k192q/d216g in complex with leupeptin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha I tryptase
publication title X-ray Structures of Free and Leupeptin-complexed Human alpha I-Tryptase Mutants: Indication for an alpha to beta-Tryptase Transition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9nA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9nA01
1RFNA 3S7KB 1D3QB 3SI4H 4UFEH 5T3HA 1LHCH 3UREA 1P2KA 5ESTE 1OX1A 5HYOA 1PPHE 1IQEA 1KXEA 3QWCH 3ZZAA 3BG4C 1BBRK 2SGAA 1C5PA 1JWTA 2EI8A 3SU2A 1T8OA 1Y3UA 5A0BA 4I8GA 1YPLH 2A7CA 3T5FH 2NU1E 2VWOA 1O3BA 1GVLA 1TPOA 3BTHE 3ZZ6A 2Y5HA 2XC0A 1P3CA 5JB9S 2A4QA 3GISB 2CV3A 1AIXH 4GUXA 2G4TA 1HJAC 3U8TH 3T2NA 1GHBF 2TPIZ 1IQKA 3LGIA 3TGIE 1HB0B 3OSYA 4H42U 1QBOA 2ILNA 3OY6U 1YKTA 1C5VA 3P17H 3KQBA 2PKAA 2QF0A 1ZGIA 4K2YA 3GOVB 1EQ9A 1XVMA 1HFDA 1FN6A 1OKXA 4TYDA 5FHTA 5DGJA 2AYWA 3AW0A 3ZZ7A 1V2LT 4X6MA 3C1KA 3SO3A 4CRBA 2BDIA 3MI4A 4X0WU 4A7IB 1SFIA 1JRSA 1VZQH 3VXEH 2Y81A 3M5OA 2SNVA 4Y7AA 3FP8E 3TK6A 3RDZA 2WPHS 3Q3XA 1KXCA 3PLPA 1P2MA 1CA8B 1VGCB 2XBXA 3DUXH 2A4OA 3KGPA 1QTFA 4Y76A 2PSXA 3TJUA 1C2MA 2XC5A 3UR6A 3GCHB 3D62A 2BY6X 1RJXB 3U1IB 6ESTA 3TH2H 1GHVH 1FJSA 5E0HA 2Z3CA 5DP4A 1OOKB 3UTUH 1GBAA 2OD3B 5EPYA 1VCPA 1Z1JA 1WBGB 2VWLA 5EOKA 1H9HE 1F0TA 4YLQH 3MMGA 5TJXA 2GDDA 2YOLA 2QYIA 1K1OA 4X1PU 2W3KA 2SGPE 2CF9H 1FV9A 3PMJA 4MNVA 1VITG 5E0GA 3BTEE 5GWZA 1BRCE 2ZTYA 1ANCA 4B74A 4O3UA 3ELAH 1MKXH 2F9BH 3HK3B 5F8ZA 3LPRA 3AVZA 4RN6A 2VINA 1SLWB 3UNRA 1A5GH 4NIYA 1V2VT 4NFEA 5CHAC 1O30A 1AB9C 3UR9A 3BEFB 3SV2H 1HYLA 1GMCG 1LO6A 1SSXA 1HDTH 4JK5A 3QUMP 2WPMS 1KXAA 3ATWA 1C2GA 5E2PA 4AX9H 4YZUA 1CU1A 4AB8A 2P95A 1MKWH 4A1VA 2KAIA 1T8MA 5E8EH 3RMMH 4WY3A 3KNXA 2BX4A 2HPPH 4X1QU 1C1NA 1G2MA 1O2KA 2PTNA 3LC5A 2ALPA 3GY7A 5FXLA 2GV6A 3T62A 2STAE 1FAKH 3U69H 2ANWA 1AU8A 1MH0A 1KXDA 3SUDA 4A6LA 3RXDA 3ZVCA 2BXTH 1GCTC 2JETB 2DE8A 2H9EH 3MU0A 2NWNA 4MVNA 5CMXH 3GCTF 1QR3E 1GHZA 5J4QA 5K7RA 1TMTH 3TNSA 4GLYA 4B1TA 1VITF 2ANYA 1NN6A 4CRFA 3S9CA 4ISHH 8GCHG 2ZDVH 1SC8U 1GMHG 1XKBC 1O2RA 1Y3WA 2CMYA 4ABFA 2WUBA 6LPRA 2FXRA 2ZZUH 2H5CA 1W11U 4VGCB 3A84A 3BTFE 3Q77A 3H7OA 1W2KH 5F03A 1C9PA 1NRNH 1UTMA 1CVWH 2VIDA 4BAKB 1GMCF 1G30B 3TGKE 7KMEH 1YBWA 5TCAA 3S69A 1KLJH 1NC6A 2WV4A 2BXUH 3MFJA 5DP3A 2RDLA 1C2LA 3AAVA 1WQVH 3TITA 3WY8A 2RA0A 1O0DH 2A45B 3MO9A 4A1TA 1UO6A 1INCA 1UTPA 1C5LH 1IQLA 2P59A 3MOCA 4GCHG 4FUHA 3A8CA 3UUZA 1SGIB 2EI7A 1BDAA 4K69A 1YCPK 3S9AA 1ANBA 3PTNA 5LPFA 1KDQA 1THSH 2Y5GA 1E0FD 3LDXH 4ZKSU 2R2MB 3SNEA 1AWHB 1ELTA 4AYVB 1NT1A 3T27A 1OWEA 4YOGA 2UWOA 1GHAG 1P2NA 3ESTA 3SI3H 1ETRH 3RXIA 4ABDA 1O5FH 1GBEA 2VVVA 2EI6A 1UVTH 2GZ7A 4X1NU 1LTOA 2VIVA 4AG1A 3RMOH 3MNBA 1A3EH 1GMHF 2P8OC 2QF3A 2HWLB 3PWCA 1UVUH 4AB9A 1TGBA 4IGDA 2G55A 1GBHA 1DWDH 4CHAC 1FXYA 3LGUA 3E0NB 2Q6FA 3MWIU 1AQ7A 4ZXYH 1GBFA 1TNGA 1ZRBA 2GDEH 1C1QA 1AFQB 3S9BA 4FVDA 3SJ8A 1SR5C 2ZHDA 2ODYB 4IC5A 5EXLA 4AFZA 1C2KA 1DSTA 1GBTA 1QQ4A 1V2TT 1AGJA 1QB9A 3NKKA 4UDWH 9ESTA 4X6NA 2HPQH 4GCHF 1AZ8A 1GI2A 3QLPH 3SUEA 3EA7A 3P95A 4X2VA 3U9AH 1QB6A 1QFKH 4IMQA 3LH3A 4JYUH 1KLTA 1BT7A 1HAVB 1AY6H 1LHGH 4Q7ZA 3KQEA 3M36A 1KY9A 4RSPA 2ZU3A 1XM1A 1RTKA 1DPOA 1TYNA 1GHAF 3FVFB 4AGJA 5AFZH 1P09A 1L2EA 2OC7A 2A7HA 4AG2A 4KELA 1SGNE 5L2YH 2FI3E 2ODQA 3M3SA 4SGAE 1QJ6B 3GDSA 1O3CA 1A5IA 1Z6JH 3A89A 4FU8A 1SMFE 1ZSKA 1XXFA 2GKVE 5AHGH 1BTHH 1V2OT 4MTBA 3RP2A 1SPJA 3KIDU 4AFSA 1GJ6A 1ZHRA 2ASUB 5F8XA 1KDQB 5EW1H 3PO1B 3RC6A 3RM2H 1TLDA 1J17T 2YNAA 1GI6A 3SQEE 4QT8C 1RIWB 3K2UA 4BAOB 1O31A 1Y59T 2ZTZA 5DG6A 2BY7X 1K1NA 4UFFH 1ZYOA 2ZGJA 4DW2U 4HFPB 1KIGH 2FOFA 3TJVA 2BD8A 2UWPA 1GG6C 1CT0E 2K1QA 5JBCS 1C1PA 1AUJA 5C1XA 1FY5A 1O37A 1CGJE 4UFGH 4ZKOU 3ZZBA 1JIMA 2ZDKA 3PV4A 1ZSJA 2VIPA 1GVKB 5EXMA 1EOJA 1C9TA 1GBIA 1IQJA 4MDSA 2Z6BD 3RUOA 3STJA 1TOCB 2OCVB 1MZAA 1UMAH 3RC5A 1NRRH 1AKSA 2A4RA 1TGTA 1SGYE 1P03A 1ETSH 1SQTA 4Y0YE 2GZ9A 1RD3B 1NRQH 1O3JA 5I46H 4CRDA 2J34A 4ZROA 3BTDE 4XFQA 3SV8A 4AZ2B 2BYAX 8ESTE 1TB6H 3L6PA 5FPSA 3AAUA 1HNEE 1C5OH 1UK2A 4WMEA 2G8TA 1CBWC 1MAYA 1T7CA 2SNWA 1NFYA 2V3OH 3FP7E 3GY6A 2QXIA 4ABAA 2FS9A 2GCHG 2FDAA 1UTQA 3RXPA 1UHBA 4IBLH 1L1NA 3CS7A 5A8YA 1F0RA 3QGNB 1S5SA 2J9NA 4Q7YA 4CBNA 1P2QA 4DCDA 4I8KA 4Y6DA 3RXOA 2ZGCA 4TY6A 1VJAU 1HAPH 3SV7A 1HPGA 1NS3A 1EX3A 4Y8XA 3MNXA 2PUQH 2AMDA 1DWEH 2B0FA 3M5MA 2H9TH 2GV7A 4MQAA 4U2WA 1K9OE 3UNQA 3SN8A 1J9CH 4KP0A 1QIXB 2VIWA 1Y5BT 1S82A 2ZA5A 1YP9A 2J4IA 3TK5A 4WMFA 5AF9H 1DOJA 1SGPE 1EXFA 1W13U 3PMBB 1AO5A 3M3VA 3KF2A 2Z7FE 3LKWA 1O2MA 1UCYH 1EZUC 4CRGA 4OS4A 2BOHB 1BTWA 2ANKH 4ASHA 3SGAE 2NU4E 1RRKA 1ANEA 1K1LA 1N8OB 1C5UA 1A2CH 3TNTA 4OGYA 1DX5M 1TGNA 3L33A 4GAWA 2I6SA 1TX6A 1BMNH 4H6TA 3BG4B 1ACBE 4ZUHA 3I78A 3SJ9A 2QIQA 2H9HA 3P70B 3BIVH 3FZDA 3MO3A 1ELBA 2A1DB 4OS7A 3H7TA 2H1UA 1NTPA 2ZTXA 1TX8A 1BTPA 3AASA 2HOBA 1ELCA 2FZZA 4NA7A 5FPYA 5I25A 7GCHF 1ZLRA 2D2DA 4TY7A 1C5MD 3O8BA 1V2JT 1ZSLA 1BBRE 1FIZA 2FM2A 4J2YB 2G5VA 1UVSH 3A83A 1ARBA 1TE0A 4BXSA 3VB7A 1DUEA 5G4BA 3BTQE 3QO6A 4JCNA 1C1RA 1F5RA 5LGOA 1XXDA 1O5CB 1O2VA 1THRH 3SNAA 1GCDA 1W3CA 2J92A 3A80A 1MCTA 1SGCA 2XNIA 3ATLA 4MG3A 3UIRA 1L1JA 1S0QA 1AZZA 1DXPA 2ZHEH 1QRWA 5L30H 1ANDA 8LPRA 3M61U 1KXFA 3R3GB 2RA3A 1V2UT 2Y80A 2W26A 4YLUA 1C4U2 1KXBA 3VGCB 1S6HA 1P0SH 1BTZA 5HGGA 2FOBA 3ZYEA 4DJZB 2EA3A 2HRVA 4AFQA 4WMDA 3TJNA 4K8BA 2OTVA 2LNCA 3SW2B 1JIRA 1LMWB 1SVPA 1F0SA 1BMLA 1GHBG 1O38A 1E37B 3SQHE 1GI9B 5FCKA 1FLEE 3ZVBA 4UONA 4D7GA 2HNTC 4BNRA 3FZZA 3ZV9A 3PYHA 4X8TH 2FO9A 2P3TB 1MBQA 1S85A 2F91A 5A8XA 2NU0E 1MD8A 2GCTB 4K1TA 4WWYA 1FAXA 2TGAA 1G2LA 1V2NT 1T8NA 4I32A 2XWBI 1MD7A 4FVBA 5A8ZA 3KHVA 1ZHPA 1IQNA 1W10U 3DA9B 3BSQA 2FTMA 2VH0A 1JOUB 4IW4E 9LPRA 1VITH 4DVAU 2BVXH 1SQAA 3SNBA 4ABEA 2BLWA 2ZU2A 4KGAA 4ZKRU 1SBWA 2BLOA 3TH3H 2R2WU 3RMLH 5JBAS 1XX9A 3A81A 3P92A 2SGEE 3MH7A 4I31A 1MKXK 3UFAA 2PGBB 2YNBA 1C5ZB 1O32A 3RXLA 3PB1E 2C8ZB 1BHXF 1GMDG 4NZQA 4E7RG 4R0IA 1CGIE 3F1SB 1WTHD 1OYQA 4MPWA 3MU5A 1G36A 3N7OA 5HXFA 1CA0C 1FI8A 2BQWB 4A1XA 1CSOE 2ZFSA 3HK6B 4ZXXH 2O9QA 3D49H 3UOUA 1QL7A 2A5IA 1WTGH 3FAOA 1WCZA 2AIPA 1MTVA 1FNIA 2TBSA 2BQ6B 2BOKA 1LVOA 1C2HA 2G5NA 1RGQA 1EP5A 2WV5A 3Q76A 1O3IA 1RTLA 1Z1IA 2SGDE 3RXVA 2CJIA 4FUIA 4NGAH 4Y71A 1K21H 4NG9H 1IOEA 2ANMH 3G01A 1PQ8A 1KYNA 2UUJB 3SZNA 1QRXA 5FPTA 3NWUA 2BHGA 1W7XH 1LKBA 3DFLA 4JZ1A 4B75A 1ZOMA 3HPTB 4MNXA 1EPTA 5HM2A 2C8XB 1TNKA 2B5TB 3ZZ9A 3A8DA 1LHFH 1C1TA 1MQ5A 5C3NA 4X1RU 3JZ2B 1PPEE 1C5WB 1GMDF 3TLOA 2OQUA 1DSUA 2AERH 4FXGH 2ZFFH 1HXFH 1P57B 3LGVA 1ZR0A 2GGVB 4DT7B 2VH6A 3GCTG 5FBEA 2HGTH 1AVXA 2FEQH 3L3TA 4FUDA 1P02A 1WAYB 3EAJA 2A32A 4B73A 2ZEBA 1O2XA 3LONA 3VEQB 3RXJA 3E8LA 2P8OB 3A8AA 3OU0A 3CENA 1TNIA 3ODFA 1DICA 3NCLA 3LIWA 5CE1A 2B9LA 2XRCA 1H8IH 5EQRA 1BTUA 1YCPM 1W12U 1ZJDA 5ESBA 3V3MA 2CF8H 1JRTA 2OBQA 2XWAA 3RXBA 1GHYH 5H4IB 1LHDH 1A4WH 4E7NA 1C1OA 1SG8B 1TX7A 1A7SA 4ZAEA 2PKAB 1GI4A 4H6SB 4RKJB 1GBBA 1FY8E 5LPEA 1AVWA 1BHXB 4OS2A 4BTTB 3BEUA 3KCGH 3ZZ4A 3S7HB 3LGTA 2XYAA 1CT4E 1UVPA 1C2IA 3SNCA 2VB0A 2FODA 1O2UA 2RG3A 5HM9A 1LHEH 3BEIB 1O39A 5JPMH 1KSNA 1M9UA 1LVBA 1GBLA 2UWLA 3A86A 1BB0B 1GGDB 3MNSA 1UVOA 2VJ1A 4ISOA 4CH8B 1C4V2 4WH8A 1VJ9U 1O2SA 1CE5A 3BTKE 1A1RA 1K2I1 3LJOA 2P3FH 2J95A 3QN7A 2PW8H 3Q3KA 1L0ZA 2IJOB 2VIQA 4X8VH 1AFEH 4KTCA 1ZMNA 4Z6AH 2C90B 4XOJA 1N6YA 1BMAA 3O8RA 2ZFTA 2FOEA 3GDVA 1ZTLA 2GTBA 1J8AA 3A87A 1QL9A 4NIVA 3RU4T 1B0FA 2PHBA 1OWDA 1Y3YA 1ZHMA 5EPNA 2QXJA 2PKSB 1P06A 1QURH 5JYIA 1C5QA 4XBBA 1VGCC 1WYKA 4ZKNU 1NO9H 5DP5A 3F9EA 1PPFE 1DXWA 3UWIA 1OWKA 4I7YH 3GCHC 1TGSZ 1AE8H 3MO6A 1LVYA 3ZVFA 1IQIA 3A85A 3LGYA 2ZFPH 5JBBS 1EATA 3M7QA 3ZVAA 1NU9A 1QGFA 2KAIB 4F4OC 1ZMJA 4NWKA 2WUCA 1P8VC 2VWNA 3BIUH 4IS5A 1TAWA 1YPJH 1E36B 3MU1A 1G3DA 1C5XB 2ZU5A 1GHWH 2ZCLP 1UCYE 1XUJA 3KL6A 5E0JA 3I77A 1P01A 1VR1H 2PFEA 3IWMA 1GDQA 1TPPA 2FI4E 1CBWB 5GCHG 2FYQA 4U32A 3BV9B 3F6UH 3SUGA 2QCYA 1MTNB 1ZPZA 1D6RA 1V2MT 3ENSB 1P05A 3F68H 4CREA 4WH6A 3E6PH 3R0FA 4MPXA 3K9XB 4ZHLU 4ZHAA 2A4GA 3EYDA 1TPSA 1C5SA 1QJ1B 4WXIA 3B9FH 2SGQE 4NSYA 1Z8RA 1O2NA 1KTTB 3QX5H 1C4Y2 4I33A 4WXVA 4BTUB 1WQSA 1LVMA 2FX6A 1QY6A 1DVAH 1EPTC 1F0UA 2JETC 4FU9A 1W8BH 4ZH8A 3VB3A 1DY9A 1FN8A 1O2LA 2HNTF 5C1YA 1HBTH 1PPGE 2QAAA 4E05H 2D8WA 4WJG2 1F2SE 4UEHH 4INKA 1BJUA 1EAIA 2DUCA 2PGQB 2JKHA 5B6OA 1FPHH 1HGTH 3SV6A 1SB1H 1LPKB 4D9RA 2BY5X 4JYVH 1YC0A 2OINA 5EW2H 1EJNA 2VGCB 1BRUP 1MU6B 3BTTE 2FP7B 1RTFB 1Q2WA 5GCHF 2OC1A 1HRTH 1QHRB 1SGFA 2A31A 1H8DH 3QGJA 2AH4X 3T29A 2F9PA 2C4FH 4B2CA 5J4SA 5EQSA 3F9GA 5F8TA 1GL1A 1UTOA 1ELAA 4YTAA 2R3YA 3RXQA 1ZPCA 1HV7A 2WINI 1O3GA 1TMUH 3RXFA 1UCYK 4KTSA 6CHAC 4Y0ZE 4K60A 1XUKA 1QL8A 3KEEA 1GJDB 4U01A 1SFQB 2ZP0H 3SORA 2G81E 1GJBB 4YM9A 1ESBA 1MBMA 1FY4A 1SGQE 1TNJA 4FUEA 5DPAA 4ESTE 1TONA 1QA7A 3GYLB 1O2TA 1OXGA 4U30A 4PROA 4XBDA 2OBOA 5LH8A 3MH6A 2H6MA 1S6FA 3M5LA 4LZ4B 3QZRA 1HJ9A 1SQOA 1OPHB 1OSSA 1F7ZA 1BMMH 7LPRA 2FTLE 2FLRH 1DITH 4HGCA 2P93A 1T31A 5A0CA 4IN2A 3M5NA 2A2QH 4MNYA 1C5YB 2BM2A 2VIOA 1GJ7B 3EDXB 1NRSH 1YGCH 2BDCA 3T26A 1GI3A 1AFQC 1K1PA 4K1SA 2F9VA 3DHKH 1SI5H 1ZRKA 1TRMA 1K1IA 2V3HH 1WSSH 2BB4A 4NFFA 4XE4A 4D7FA 2ULLA 1SLVB 1W0YH 1C2JA 5E2OA 1P11E 1FMGA 1OP8A 1GDUA 3MU4A 3RC4A 3TGJE 1Z6EA 3RM0H 1A3BH 1AN1E 1OWIA 2NU2E 1HAZB 1O33A 1HXEH 3K6YA 1C2EA 2A7JA 1NRPH 4GSOA 4WF8A 1B7XB 1ELEE 4XSKU 5GPIB 2XXLA 2ZHQH 7GCHG 3E90B 3GY4A 1AE5A 4D9QA 1SLXB 3LJJA 2B8OH 3ZZ3A 1UTNA 2Y5FA 4Y79A 1K1JA 3RXHA 3U8OH 3ZVGA 4B2BA 2GMTC 5EU8A 2OC0A 2TGDA 4Z0KA 1AHTH 2ZHWH 3RU4E 4WVPE 1BOQA 2OUAA 4K5ZA 2IN2A 4K3JA 4IN1A 2CHAB 3URDA 2W7SA 4XBCA 1C1SA 1D9IA 4Y8YA 3RLWH 2ZGHA 3U1JB 1G3EA 2BDBA 5C2ZA 1OP2A 2CGAA 1T8LA 8KME2 1BTYA 1B0EA 3FP6E 4BAMB 1AKSB 2JH6D 4BOHA 1NROH 2H5DA 3M7TA 4JZDH 7ESTE 1RIWC 1C1MA 3NZIA 2ZO3H 1MU8B 1B5GH 2FOCA 2J38A 4CR5A 1NZQH 1JBUH 1NESE 4GHTA 2ZPSA 1FY3A 5FX5A 1DWBH 1T4VH 1SGRE 4AFUA 3SOSA 5DO4H 5JDUB 1PFXC 4JZEH 1QJ7B 1HJAB 3KQCA 3QTOH 3EA9A 2P16A 1CA0B 3BN9A 2SGFE 1TALA 1LQEA 5GJ4B 5FAHA 3D23A 1MTSA 1PYTC 2V35A 3SU5A 5IYTA 2AEIH 1NU7B 5AVDA 1WOFA 1UHBB 1PJPA 4INLA 2WPIS 1SL3A 3MH5A 1HIAA 4O3TA 4KKDA 2Q6DA 3ZYDA 4E06H 2G52A 3V13A 2TGPZ 1IQHA 1LQDB 3SJKA 1GDNA 1L4ZA 3SHAH 1GJCB 1O5EH 1XUGA 2AMQA 1A61H 2HALA 2W7UA 3PM3A 5DP9A 1F5LA 2WYJA 1LDTT 4BAHB 1HCGA 2HLCA 5DP8A 6GCHG 3RXGA 1DY8A 4I8HA 3VB5A 1Y5AT 1C5RA 2TGTA 4HZHA 5HMAA 3W94A 2H2ZA 3B8JA 1TABE 1HAIH 1YPMH 1ORFA 2R9PA 2BLQA 2R0LA 2D1JA 2OC8A 4DIIH 1EAXA 3BTGE 1ZGVA 1MMJN 1HAYB 2ZC9H 2M5TA 1NFWA 1D3DB 1BQYA 5LPRA 2C8YB 1WU1A 4YT7H 3NXPA 2FPZA 2XC4A 3BTWE 2CN0H 2Z3DA 2ZQ1A 4CBOA 2ZKSA 2QXHA 3F9FA 1C1WH 3CS0A 3M7UA 5L2ZH 1SHHB 1GBCA 5T6DA 5C67A 3DT0H 5F6MA 3QDZB 4MLFB 1SGDE 1Y3VA 4YT6H 3LOXA 3ZZ8A 5CHAB 1AB9B 3LT3A 3RLYH 3TK9A 3UQVA 1O2ZA 3KQDA 1TIOA 2AIQA 2C8WB 2ZGXH 4DY7B 1QNJA 4FUFA 2W5EA 1CQQA 1PYTD 4ABIA 6GCHF 1G37A 1O2JA 1GJ5H 3F9HA 5EG4A 1DANH 2PR3A 1GBDA 1O5BB 1BUIA 3M37A 2PUXB 3DFJA 1IAUA 1N8OC 4BAQB 3A7TA 5C20A 3ATMA 3T25A 1W7GH 4O97A 1FIWA 2FMJA 1D4PB 4CRAA 1ZZZA 1HIAB 3A7WA 1AMHA 4ABJA 1GCTB 1P10A 4AYYB 3GY8A 1AD8H 2PLXA 2ZQ2A 3MHWU 1DM4B 1KLIH 1QBVH 4K1EA 4ABHA 4RKOB 1HJ8A 3M35A 1MKWK 4ABBA 3GY5A 3O8DA 1BRBE 3AW1A 1YPKH 1O2PA 5PTPA 2OLGA 1QBNA 2HVXA 1T4UH 2LPRA 4UD9H 1D3TB 4Y11E 1CHOG 2XBVA 1TFXA 4YOJA 2BD4A 5SGAE 3RMNH 4AGKA 1ELVA 3LU9B 1O3LA 4ZMAH 1GI8B 1K22H 2ZDMA 1FDPA 1O3OA 2BDHA 5EXNA 3LGWA 3SU3A 1LPZB 1OS8A 3UWJH 3SGBE 5EGMA 1DE7H 2FWWA 2AMPA 5DKMA 1OYTH 4NCYA 3SU1A 2NU3E 3E3TA 5GIBA 1AVGH 1RS0A 1ABJH 2GVFA 3SU6A 1TRNA 1O3EA 2FOAA 2A5KA 3KN2A 4Q80A 3VB6A 1O3NA 1QA0A 1NFXA 1H9IE 3E16B 3K65B 4I8JA 2W3IA 3S0NA 1PQ5A 4X2WA 2F3CE 1PQ7A 2ZPRA 3RXKA 1DS2E 3VGCC 1F5KU 2BTCE 2UUYA 3VPKA 1GWAA 1TBZH 5ETXA 2G4UA 2ZECA 2Y7ZA 3UQOA 2QGRA 1BJVA 1HAXB 1EKBB 1FQ3A 2A0QB 1TNLA 1GI1A 4NSVA 1A46H 3RXUA 1GJ8B 1CHOF 1GI5A 1YLCA 1O35A 1SOZA 3VFEA 1ZTKA 4CHAB 3QK1A 1BBRH 2GCTC 1T32A 2BD7A 1DDJA 3URCA 2GZ8A 1ELGA 2ZI2H 1Y8TA 2C93B 1AI8H 3GY3A 4AOQA 4BANB 1K1MA 3SNDA 1S84A 1MCVA 1O36A 2O8MA 3PLBA 2ALVA 2P94A 1GHXH 2BY8X 1CHGA 2O8WA 2V0BA 2Q6GA 1EZQA 5DP6A 2Y82A 2JH0D 3FFGA 3M3TA 3ZZ5A 5ABWA 1GPZA 3K6ZA 2ZDAH 2Z9LA 1FY1A 2AGEX 1MTWA 3RXRA 1D3PB 1NPMA 2ZHFH 1LCYA 4IMZA 2BQ7B 4X8UH 1O3KA 1UK3A 1O2QA 1G3CA 4O03A 1OWHA 4JYTA 1DFPA 3V0XA 3PLKA 4JZFH 1N6XA 1C1UH 3A88A 1EJMA 1O5GH 1EPTB 3UOPA 1BCUH 3ZZDA 1G3BA 2BX3A 3ZVEA 1YPGH 5DP7A 3NPSA 1Y5UT 5IDKA 1CO7E 1C5TA 1X7AC 4X2YA 4A92A 1BRAA 1YM0A 1PPCE 1W14U 4O9VA 1QB1A 1HAVA 1AUTC 1XUIA 2QXGA 3P8OA 1TNHA 5BRRE 2G51A 1D6WA 2FLBH 4NWLA 1A0LA 2GT8A 3TIUA 1P2OA 1J16A 2ZDLA 3MNCA 5EQQA 4TPYA 3A7ZA 1IQFA 1E34B 1C2DA 1JMOH 2PSYA 1P9UA 3E0PB 3TU7H 2GT7A 1GG6B 1O3MA 1Q31A 4X2XA 1O3HA 3SJOA 3P8FA 1CGHA 1H9LB 3SV9A 3EGKH 3OX7U 1BZXE 2O8UA 3SU0A 6CHAB 2ZGBH 2UUKB 2BD2A 2P3UB 3HGNA 4NIWA 4D8NA 4XDEA 2EC9H 4DG4A 3EE0B 4ZHMU 1CT2E 1O2OA 3QZQA 3T28A 2Y6TA 3HATH 2IPHA 1EOLA 1GVZA 1ZTJA 1SGTA 1SGFG 2BVSH 2XBWA 2BZAA 1TPAE 3E91A 1O3DA 4NZLA 1MAXA 1UTLM 3P6ZB 1O2YA 3ATIA 4OS1A 2BD3A 2DE9A 8GCHF 4DGJA 1YPHE 3MYWA 1LKAA 2ZU4A 1IQMA 2ZG0H 2BY9X 2AFQB 1HAHH 5C5NA 2QC2A 1C5NH 1EB1H 2VNTA 2VVCA 4FUJA 1W0ZU 3CP7A 2IOTA 2TIOA 1P9SA 2BD9A 1QQUA 4UFDH 1C2FA 2F9OA 2WPKS 4ISLA 4FU7A 2PTCE 2I6QA 2Y7XA 4B71A 3ITIA 2WPLS 4X8SH 1GBMA 2ODPA 3EQ0H 3RXMA 5T6GA 3V12A 3PROA 1V3XA 1V2ST 3I29A 3Q00A 4FUCA 2F9NA 3MTYA 1O3FA 5AFYH 2Z9JA 1V2KT 1ZJKA 1XUFA 3IG6B 2ESTE 1YPHC 2WYGA 3RXEA 5T6FA 1S81A 1THPB 1V2WT 3RXSA 1TBRH 2SFAA 1GGDC 2GMTB 1GBJA 3C27B 2F9UA 4VGCC 4Y7BA 2BD5A 3A7VA 3RXAA 2AS9A 3P8NA 2R3UA 4NIXA 1HAGE 1U6QA 1UTKA 1GI0A 1YCPH 4OS6A 1ELDE 1TA6A 1QRZA 2AGIX 3V7TA 1P2JA 5A2MH 2ZF0H 1SLUB 1EAWA 1LPGB 4YOIA 3IITA 1EJAA 1Z71A 3MU8A 2FYRA 1EB2A 2XBYA 1ZMLA 3RXTA 4NA8A 2O8LA 1A5HA 2FS8A 1ID5H 1O2IA 1ELFA 3ATKA 3ZV8A 2FOHA 3NUMA 1PPBH 3A7XA 2BDYA 4OS5A 2PKSC 4X6PA 1GL0E 1EUFA 4AORA 1WUNH 4MNWA 4H4FA 1DT2A 3GDUA 5BPEA 3OTJE 1XKAC 1EASA 5DK1A 3TPIZ 2OQ5A 2QA9E 3GY2A 3DD2H 3GCNA 3VB4A 1PQAA 2FOGA 4ISIH 4YESB 1IQGA 4B2AA 1H4WA 1BITA 1EZSC 1FPCH 1WV7H 3HGPA 1XVOA 3U98H 1S83A 1Z7KA 1HAOH 4HTCH 2ZIQH 4DURA 4FUBA 3SU4A 1K28D 1IHSH 4INHA 2JH5D 4GHQA 1UK4A 1V2RT 4GVUA 2QN5T 1O34A 2STBE 1IHTH 2QY0B 1DLEA 1Z8JB 4UE7H 2BDGA 3MH4A 2Q1JA 3FANA 1EP6A 2FIRH 1UTJA 4Q7XA 5A09A 1BTXA 3E1XB 1V6DA 1ZPBA 4CRCA 3NK8A 1O3PB 4BTIB 1XUHA 1MTNC 4JMYA 1E35B 2CXVA 3PMHB 4LK4A 3PWBA 1OWJA 1TOMH 2PV9B 3GCOA 4LXBH 1NFUA 1BIOA 2XCFA 1MZDA 2GD4B 2VWMA 2A2XH 2Z9KA 4JK6A 3SBKA 3UY9A 3PTBA 4SGBE 2J94A 1ARCA 3STIA 1J14A 1SGEE 4AN7A 3U8RH 1ABIH 1TRYA 5EODA 4B76A 1SOTA 1QCPA 1O5AB 2THFB 2BZ6H 1A0JA 1O5DH 4TWYA 3LH1A 2QV1A 1Z8IB 3TH4H 5C5OA 1GBKA 2BVRH 1NY22 4ABGA 3O8CA 1GI7B 4R8TB 1SHYA 2B7DH 1UJ1A 1TQ7B 1DUAA 3ODDA 4MPVA 2C3SA 3PO1C 1L1GA 2XTTB 1TMBH 1VCWA 2AGGX 3Q3YA 1BA8B 2G00A 2A5AA 1NM6A 3SJIA 4CH2B 1EAUA 2VGCC 4DOQA 3PMAB 4I8LA 1FUJA 4K8YA 1FZZA 4D76A 3ZZCA 1GJ9B 5C1UA 3RXCA 2GCHF 1Z8GA 2BDAA 1TBQH 1O2GH 1S0RA 3P8GA 3LC3A 2XW9A 4ISNA 5TCCA 2Z94A 4M7GA 1GJ4H 1EZXC 3OY5U 1GJAB 4HI3A 1DWCH 1G32B 4BXWA 1HLTH 4IC6A 1ESTA 3BG8A 3H5CB 4MPUA 2FX4A 3UPEA 1N1LA 1O2WA 1YF4A 3SGQE 1XMNB 3BTME 3W95A 1TQ0B 2TRMA 3A82A 2VU8E 1YLDA 5GXPA 4J1YA 1MTUA 5JBTA 2ZWLH 4DIHH 1DLKB 2ZU1A 2EEKA 1V2QT 1F92A 2GP9B 1Q3XA 1P2IA 3A8BA 1VCQA 1AWFH 1P12E 2BMGB 2ZCKP 1A0HB 1KTSB 4YO9A 2VVUA 5FX6A 2O8TA 3JZ1B 2HNTE 1G9IE 2Z9GA 1V2PT 4Y8ZA 3HKJB 5FCRA 3OYPA 3VXFH 5JB8S 5GDSH 1P04A 5FBIA 2ZDNA 3UNSA 4TWWA 2PWXA 2XCNA 4Y10E 1ESAA 3A7YA 2OXSA 4GPGA 4FUGA 1TA2A 4JZIA 2J2UA 2Z3EA 1PPZA 1O3AA 1P3EA 2WPJS 3D65E 3ZVDA 4NA9H 1E38B 2FI5E 1J15A 3SHCH 1H1BA 1MQ6A 4CR9A 2ZFRH 4KTUA 4F49A 1OP0A 2ZNKH 2RCEA 3BF6H 2BLVA 4Q2KA 5A0AE 1TGCA 2FOMB 1O2HA 1JXPA 3HKIB 4LZ1H 1L4DA 5DJ7A 1ETTH 1YYY1 2OP9A 1YPEH 2F83A 2V6NA 5L6NH 1HUTH 2FESH 1FONA 2R0KA 4THNH 3SUFA 3TVJB 3QTVH 4OGXA 1MUEB 2Z9IA 2ZCHP 3RU4D 4X6OA 3B23B 3GYMA 4TPIZ 2UUFB 4X1SU 1Y3XA 3TJOA 2GX4A 2D26C 2CHAC 4LOYH 1TWXB 3GICB 3EA8A 1RXPA 1C1VH 2ZFQH 5K0HA 4A5TS 2ZPQA
chains in the Genus database with same CATH superfamily
1RFNA 3S7KB 1D3QB 3SI4H 4UFEH 5T3HA 1LHCH 3UREA 1P2KA 5ESTE 1OX1A 5HYOA 1PPHE 1IQEA 1KXEA 3QWCH 3ZZAA 3BG4C 1BBRK 2SGAA 1C5PA 1JWTA 2EI8A 3SU2A 1T8OA 1Y3UA 5A0BA 4I8GA 1YPLH 2A7CA 3T5FH 2NU1E 2VWOA 1O3BA 1GVLA 1TPOA 3BTHE 3ZZ6A 2Y5HA 2XC0A 3PRDA 1P3CA 5JB9S 2A4QA 3GISB 2CV3A 1AIXH 4GUXA 2G4TA 1HJAC 3U8TH 3T2NA 1GHBF 2TPIZ 1IQKA 3LGIA 3KQ5A 3TGIE 1HB0B 3OSYA 4H42U 1QBOA 2ILNA 2YMSD 3OY6U 1YKTA 1C5VA 3P17H 3KQBA 2PKAA 2QF0A 1ZGIA 4K2YA 3GOVB 1EQ9A 1XVMA 1HFDA 1FN6A 3OFND 1OKXA 4TYDA 5FHTA 5DGJA 2AYWA 3AW0A 3ZZ7A 1V2LT 4X6MA 3C1KA 3SO3A 4CRBA 2BDIA 3MI4A 4X0WU 4A7IB 1SFIA 1JRSA 1VZQH 3VXEH 2Y81A 3M5OA 2SNVA 4Y7AA 3FP8E 3TK6A 3RDZA 2WPHS 3Q3XA 1KXCA 3PLPA 1P2MA 1CA8B 1VGCB 2XBXA 3DUXH 2A4OA 3F0OA 3KGPA 1QTFA 4Y76A 2PSXA 3TJUA 1C2MA 2XC5A 3UR6A 3GCHB 3D62A 2BY6X 1RJXB 3U1IB 6ESTA 1YWUA 3TH2H 1GHVH 2LELA 1EFRD 1FJSA 5E0HA 2Z3CA 5DP4A 1OOKB 3UTUH 1GBAA 2OD3B 5EPYA 3F3BA 1VCPA 1Z1JA 1WBGB 2VWLA 5EOKA 1H9HE 1F0TA 3F2HA 3MMGA 4YLQH 5TJXA 2GDDA 2YOLA 2QYIA 1K1OA 4X1PU 2W3KA 2SGPE 2CF9H 1FV9A 3PMJA 4MNVA 1VITG 5E0GA 3BTEE 5GWZA 1BRCE 2ZTYA 1ANCA 4B74A 4O3UA 3ELAH 1MKXH 2F9BH 3HK3B 5F8ZA 3LPRA 3AVZA 4RN6A 1S6LA 2VINA 1SLWB 3UNRA 1A5GH 4NIYA 1V2VT 4NFEA 5CHAC 1O30A 1AB9C 3UR9A 3BEFB 3SV2H 1HYLA 1GMCG 1LO6A 1SSXA 1HDTH 4JK5A 3QUMP 2WPMS 1KXAA 2OK5A 3ATWA 1C2GA 5E2PA 4AX9H 4YZUA 1CU1A 4AB8A 2P95A 1MKWH 2W6ID 4A1VA 2KAIA 1T8MA 3PV2A 5E8EH 3RMMH 4WY3A 3KNXA 2BX4A 2HPPH 4X1QU 1C1NA 1G2MA 1O2KA 2PTNA 3LC5A 2ALPA 3GY7A 5FXLA 2GV6A 3T62A 2STAE 1FAKH 3U69H 2ANWA 1AU8A 1MH0A 1KXDA 3SUDA 2PP6A 4A6LA 3RXDA 3ZVCA 2BXTH 1GCTC 2JETB 2DE8A 2H9EH 3MU0A 2NWNA 4MVNA 3F2GA 5CMXH 3GCTF 1QR3E 1GHZA 5J4QA 4RT0A 1TMTH 5K7RA 5EJZA 4GLYA 3TNSA 4B1TA 1VITF 2ANYA 1NN6A 4CRFA 3S9CA 4ISHH 8GCHG 2ZDVH 1SC8U 3F2FA 1GMHG 1XKBC 1O2RA 1Y3WA 2CMYA 4ABFA 2WUBA 6LPRA 2FXRA 2ZZUH 2H5CA 1W11U 4VGCB 3A84A 3BTFE 3Q77A 3H7OA 1W2KH 5F03A 1C9PA 1NRNH 1UTMA 1CVWH 2VIDA 4BAKB 1GMCF 1G30B 3TGKE 7KMEH 1YBWA 5TCAA 2V7QD 2AHME 3S69A 1KLJH 1NC6A 2WV4A 2BXUH 3MFJA 5DP3A 2RDLA 1C2LA 3AAVA 1WQVH 3TITA 3WY8A 2RA0A 1O0DH 2A45B 3MO9A 4A1TA 1UO6A 1INCA 1UTPA 1C5LH 1IQLA 2P59A 3MOCA 4GCHG 4FUHA 3A8CA 3UUZA 1SGIB 2EI7A 1BDAA 3OEED 4K69A 1YCPK 3S9AA 1ANBA 3PTNA 5LPFA 1KDQA 1BMFD 1THSH 2Y5GA 1E0FD 3LDXH 4ZKSU 2R2MB 3SNEA 1AWHB 1ELTA 4AYVB 1NT1A 3T27A 2JIZD 1OWEA 2V3MA 4YOGA 2UWOA 1GHAG 1P2NA 3ESTA 3FN8A 1ETRH 3SI3H 3RXIA 4ABDA 1O5FH 1GBEA 2VVVA 2EI6A 1UVTH 2GZ7A 3OAAD 4X1NU 1LTOA 2VIVA 4AG1A 3RMOH 3MNBA 1A3EH 1GMHF 2P8OC 2QF3A 2HWLB 3PWCA 1UVUH 4AB9A 1TGBA 4IGDA 2G55A 1GBHA 1DWDH 4CHAC 1FXYA 3LGUA 3E0NB 2Q6FA 3MWIU 1AQ7A 4ZXYH 3FOAA 1GBFA 1TNGA 1ZRBA 2GDEH 1C1QA 1AFQB 3S9BA 4FVDA 3SJ8A 1SR5C 2ZHDA 2ODYB 4IC5A 5EXLA 4AFZA 1C2KA 1DSTA 1GBTA 1QQ4A 1V2TT 1AGJA 2IPQX 2L74A 1QB9A 3NKKA 4UDWH 9ESTA 4X6NA 2HPQH 4GCHF 1AZ8A 1GI2A 3QLPH 3SUEA 3DSGA 3EA7A 3P95A 4X2VA 3U9AH 1QB6A 1QFKH 4IMQA 3LH3A 4JYUH 2QE7D 1KLTA 1BT7A 1HAVB 1AY6H 1LHGH 4Q7ZA 3KQEA 2JDID 3M36A 1KY9A 4RSPA 2ZU3A 1XM1A 1RTKA 1DPOA 1TYNA 1GHAF 3FVFB 4AGJA 5AFZH 1P09A 1L2EA 2OC7A 2A7HA 4XD7D 4AG2A 3EE7A 4KELA 1SGNE 3PV5A 5L2YH 2FI3E 2ODQA 3M3SA 4SGAE 1QJ6B 3GDSA 1O3CA 1A5IA 1Z6JH 2KCOA 3A89A 4FU8A 1SMFE 1ZSKA 1XXFA 2GKVE 5AHGH 1BTHH 1V2OT 4MTBA 3RP2A 1SPJA 3KIDU 4AFSA 1GJ6A 1ZHRA 2ASUB 5F8XA 1KDQB 5EW1H 3PO1B 3RC6A 3RM2H 1TLDA 1J17T 2YNAA 1GI6A 3SQEE 4FETA 4QT8C 1RIWB 3K2UA 4BAOB 1O31A 1Y59T 2ZTZA 5DG6A 2BY7X 1K1NA 4UFFH 1ZYOA 2ZGJA 4DW2U 4HFPB 1KIGH 2FOFA 3TJVA 2BD8A 4AC9A 2UWPA 1GG6C 1CT0E 2K1QA 5JBCS 1C1PA 1AUJA 5C1XA 1FY5A 1O37A 1CGJE 4UFGH 5KECA 5IK2D 4ZKOU 3ZZBA 1JIMA 2ZDKA 3PV4A 1E1RD 4OM9A 1ZSJA 2VIPA 1GVKB 5EXMA 1EOJA 1C9TA 1GBIA 1IQJA 4MDSA 2Z6BD 3RUOA 3STJA 1TOCB 2OCVB 1MZAA 1UMAH 3RC5A 1NRRH 1AKSA 2A4RA 1TGTA 1SGYE 1P03A 1ETSH 1SQTA 4Y0YE 2GZ9A 2RDEA 1RD3B 1NRQH 1O3JA 5I46H 4CRDA 2J34A 4ZROA 3BTDE 4XFQA 3SV8A 4AZ2B 2BYAX 8ESTE 1TB6H 3L6PA 5FPSA 3AAUA 5C94A 1HNEE 1C5OH 1UK2A 2EQNA 2G8TA 4WMEA 1CBWC 1MAYA 1T7CA 2SNWA 1NFYA 2V3OH 3FP7E 3GY6A 2QXIA 5EJLA 2FS9A 2GCHG 4ABAA 2FDAA 4ACBA 1UTQA 3RXPA 1UHBA 4IBLH 1L1NA 3CS7A 5A8YA 1F0RA 3QGNB 1S5SA 2J9NA 2YMSB 4Q7YA 4CBNA 4F55A 1P2QA 4DCDA 4I8KA 4Y6DA 3RXOA 2ZGCA 4TY6A 1VJAU 1HAPH 3SV7A 1HPGA 1NS3A 1EX3A 4Y8XA 3MNXA 2PUQH 2AMDA 3KYFA 1DWEH 2B0FA 3M5MA 5FL7D 2H9TH 2GV7A 4MQAA 4U2WA 1K9OE 3UNQA 3SN8A 4ACAA 1J9CH 4KP0A 1QIXB 2VIWA 1Y5BT 1S82A 2ZA5A 1YP9A 2J4IA 3TK5A 4WMFA 5AF9H 1DOJA 1SGPE 1EXFA 1W13U 3PMBB 1AO5A 3M3VA 3KF2A 2Z7FE 3LKWA 1O2MA 1UCYH 1EZUC 4CRGA 4OS4A 2BOHB 1BTWA 2ANKH 4ASHA 3SGAE 2NU4E 1RRKA 1ANEA 1K1LA 1N8OB 1C5UA 1A2CH 3TNTA 4OGYA 1DX5M 1TGNA 3L33A 4GAWA 2I6SA 1TX6A 1BMNH 4H6TA 3BG4B 1ACBE 4ZUHA 5CHBA 1H8ED 3I78A 3SJ9A 2QIQA 2H9HA 3P70B 3BIVH 3FZDA 3MO3A 1ELBA 2A1DB 4OS7A 3H7TA 2H1UA 1NTPA 2ZTXA 1TX8A 1BTPA 3AASA 2HOBA 1ELCA 2FZZA 4NA7A 5FPYA 5I25A 7GCHF 1ZLRA 2D2DA 4TY7A 1C5MD 3O8BA 3SZEA 1V2JT 1ZSLA 1BBRE 1FIZA 2FM2A 4J2YB 2G5VA 1UVSH 3A83A 1ARBA 1TE0A 4BXSA 3VB7A 1DUEA 5G4BA 3BTQE 3QO6A 4JCNA 1C1RA 1F5RA 5LGOA 2JJ1D 1XXDA 2M2AA 1O5CB 1O2VA 1THRH 3SNAA 1GCDA 1W3CA 2J92A 3A80A 1MCTA 1SGCA 2XNIA 3ATLA 4MG3A 3UIRA 1L1JA 1S0QA 1AZZA 1DXPA 2ZHEH 1QRWA 5L30H 1ANDA 8LPRA 3M61U 1KXFA 3R3GB 2RA3A 1V2UT 2Y80A 2W26A 5F53A 4YLUA 1C4U2 1KXBA 3VGCB 2VBCA 1S6HA 1P0SH 1BTZA 5HGGA 2FOBA 3ZYEA 4DJZB 2EA3A 2HRVA 4AFQA 4WMDA 3TJNA 2J5UA 4K8BA 2OTVA 2LNCA 3SW2B 2KM0A 4F48B 1JIRA 1LMWB 1SVPA 1F0SA 1BMLA 1GHBG 1O38A 1E37B 4M9FA 1GI9B 3SQHE 1FLEE 3ZVBA 4UONA 5FCKA 4D7GA 2HNTC 4BNRA 3FZZA 3ZV9A 3PYHA 4X8TH 2FO9A 2P3TB 1MBQA 1S85A 2F91A 5A8XA 2NU0E 1MD8A 2GCTB 4K1TA 4WWYA 1FAXA 2TGAA 1G2LA 1V2NT 1T8NA 4I32A 2XWBI 1MD7A 4FVBA 5C17A 5A8ZA 1K0HA 3KHVA 1ZHPA 1IQNA 1W10U 3DA9B 3BSQA 2FTMA 2VH0A 1JOUB 4IW4E 9LPRA 1VITH 4DVAU 2BVXH 1SQAA 3SNBA 4ABEA 2BLWA 2ZU2A 4KGAA 4ZKRU 1SBWA 2BLOA 3TH3H 2R2WU 3RMLH 5JBAS 1XX9A 3A81A 3P92A 2SGEE 3MH7A 4I31A 5C0UA 1MKXK 3UFAA 2PGBB 2YNBA 1C5ZB 1O32A 1UW7A 3RXLA 3PB1E 2C8ZB 1BHXF 1GMDG 4NZQA 5HIZA 4E7RG 4R0IA 4XRNA 1CGIE 3F1SB 1WTHD 1OYQA 4MPWA 3MU5A 1G36A 3N7OA 5HXFA 1CA0C 1FI8A 2BQWB 4A1XA 1CSOE 2ZFSA 3HK6B 4ZXXH 2O9QA 3D49H 3UOUA 1QL7A 2A5IA 1WTGH 3FAOA 1WCZA 2AIPA 1MTVA 1FNIA 2TBSA 2BQ6B 2BOKA 1LVOA 1C2HA 2G5NA 1RGQA 1EP5A 2WV5A 3Q76A 1O3IA 3GS9A 1RTLA 1Z1IA 2SGDE 3RXVA 2CJIA 4FUIA 4NGAH 4Y71A 1K21H 4NG9H 1IOEA 2ANMH 3G01A 1PQ8A 5T1VA 1KYNA 2UUJB 3SZNA 1QRXA 5FPTA 3NWUA 2BHGA 1W7XH 1LKBA 3DFLA 4JZ1A 4B75A 1ZOMA 3HPTB 4MNXA 1EPTA 5HM2A 2C8XB 1TNKA 2B5TB 3ZZ9A 3A8DA 1LHFH 1C1TA 1MQ5A 5C3NA 4X1RU 3JZ2B 2QF5A 1PPEE 1C5WB 1GMDF 3TLOA 2OQUA 1DSUA 2AERH 4FXGH 2ZFFH 1HXFH 1P57B 3LGVA 1ZR0A 2GGVB 4DT7B 2VH6A 3GCTG 5FBEA 2HGTH 1AVXA 2FEQH 3L3TA 4FUDA 1P02A 1WAYB 3EAJA 2A32A 4B73A 2ZEBA 1O2XA 3LONA 3VEQB 3RXJA 3E8LA 2P8OB 3A8AA 3OU0A 3CENA 4P00A 1TNIA 3ODFA 1DICA 3NCLA 3LIWA 5CE1A 2B9LA 2XRCA 1H8IH 5EQRA 1BTUA 1YCPM 1W12U 1ZJDA 5ESBA 3V3MA 2CF8H 1JRTA 2OBQA 2XWAA 3RXBA 1GHYH 5H4IB 1LHDH 1A4WH 4E7NA 1C1OA 1SG8B 1TX7A 1A7SA 2F43B 4ZAEA 2PKAB 1GI4A 4H6SB 4RKJB 1GBBA 1FY8E 5LPEA 1AVWA 1BHXB 4OS2A 4BTTB 3BEUA 3KCGH 3ZZ4A 3S7HB 3LGTA 2XYAA 4YXWD 1CT4E 1UVPA 1C2IA 3SNCA 2VB0A 2FODA 1O2UA 2RG3A 5HM9A 1LHEH 3BEIB 1O39A 5JPMH 1KSNA 1M9UA 1LVBA 1GBLA 2UWLA 3A86A 1BB0B 1GGDB 3MNSA 1UVOA 5KGOA 5KEDA 2VJ1A 4ISOA 4CH8B 1C4V2 4WH8A 1VJ9U 1O2SA 1CE5A 3BTKE 1A1RA 3DCLA 1K2I1 3LJOA 2P3FH 2J95A 3QN7A 2PW8H 3Q3KA 1L0ZA 2IJOB 2VIQA 4X8VH 1AFEH 4KTCA 1ZMNA 4Z6AH 2C90B 4XOJA 1N6YA 2XOKD 1BMAA 3O8RA 2ZFTA 2FOEA 3GDVA 1ZTLA 2GTBA 1J8AA 3A87A 1QL9A 4NIVA 3RU4T 1B0FA 2PHBA 1OWDA 1Y3YA 1ZHMA 5EPNA 2QXJA 2PKSB 1P06A 1QURH 5JYIA 1C5QA 4XBBA 1VGCC 5HIYA 1WYKA 4ZKNU 1NO9H 5DP5A 3F9EA 1PPFE 1DXWA 3UWIA 1OWKA 4I7YH 3GCHC 1TGSZ 1AE8H 3MO6A 1LVYA 3ZVFA 1IQIA 3A85A 2KCPA 3LGYA 2ZFPH 5JBBS 1EATA 3M7QA 3ZVAA 1NU9A 1QGFA 2KAIB 2WHXA 4F4OC 1ZMJA 2WZQA 2WUCA 1P8VC 4NWKA 2VWNA 3BIUH 4IS5A 4B6FA 1TAWA 1YPJH 1E36B 3MU1A 1G3DA 1C5XB 2ZU5A 5C0TA 1GHWH 2ZCLP 1UCYE 1XUJA 3KL6A 3N7DA 5E0JA 3I77A 1P01A 1VR1H 2PFEA 3IWMA 1GDQA 1TPPA 2FI4E 1CBWB 5GCHG 4RI0A 1SKYE 2FYQA 4U32A 3BV9B 3F6UH 3SUGA 2QCYA 1MTNB 1ZPZA 1D6RA 1V2MT 3ENSB 1P05A 3F68H 4CREA 4WH6A 3E6PH 3R0FA 4MPXA 3K9XB 4ZHLU 4ZHAA 2A4GA 3EYDA 1TPSA 1C5SA 1QJ1B 4WXIA 3B9FH 2SGQE 4NSYA 1Z8RA 1O2NA 1KTTB 3QX5H 1C4Y2 4I33A 2KCYA 4WXVA 4BTUB 1WQSA 1LVMA 2FX6A 1QY6A 1DVAH 1EPTC 1F0UA 2JETC 4FU9A 1W8BH 4ZH8A 3VB3A 1DY9A 1FN8A 1O2LA 2HNTF 5C1YA 1HBTH 1PPGE 2QAAA 4I86A 4E05H 2D8WA 4WJG2 1F2SE 4UEHH 4INKA 1BJUA 1EAIA 2DUCA 2PGQB 2JKHA 5B6OA 1FPHH 1HGTH 3SV6A 1SB1H 1LPKB 4D9RA 2BY5X 4JYVH 1YC0A 2OINA 5EW2H 1EJNA 2VGCB 1BRUP 1MU6B 3BTTE 2FP7B 1RTFB 1Q2WA 5GCHF 2OC1A 1HRTH 1QHRB 1SGFA 2A31A 1H8DH 3QGJA 2AH4X 3T29A 2F9PA 2C4FH 4B2CA 5J4SA 5EQSA 3F9GA 5F8TA 1GL1A 1UTOA 4ZCNA 1ELAA 4YTAA 2R3YA 3RXQA 1ZPCA 1HV7A 2WINI 1O3GA 1TMUH 1NBME 3RXFA 3ZIAD 5HKKD 3N99A 1UCYK 4KTSA 6CHAC 4Y0ZE 4K60A 1XUKA 1QL8A 3KEEA 1GJDB 4U01A 1SFQB 2ZP0H 3SORA 2G81E 1GJBB 4YM9A 1ESBA 1MBMA 1FY4A 1SGQE 1TNJA 4FUEA 5DPAA 4ESTE 1TONA 1QA7A 3GYLB 1O2TA 1OXGA 4U30A 4PROA 4XBDA 2OBOA 5LH8A 3MH6A 2H6MA 1S6FA 3M5LA 4LZ4B 3QZRA 1HJ9A 1SQOA 1OPHB 1OSSA 1F7ZA 1BMMH 7LPRA 2FTLE 2FLRH 1DITH 4HGCA 2P93A 1T31A 5A0CA 4IN2A 3M5NA 4ASUD 2A2QH 4MNYA 1C5YB 2BM2A 2VIOA 1GJ7B 3EDXB 1NRSH 1YGCH 2BDCA 3T26A 1GI3A 1AFQC 1K1PA 4K1SA 2F9VA 3DHKH 1SI5H 1ZRKA 1TRMA 1K1IA 2V3HH 1WSSH 2BB4A 4NFFA 4XE4A 4D7FA 2ULLA 1SLVB 1W0YH 1C2JA 5E2OA 1P11E 1FMGA 1OP8A 1GDUA 3MU4A 3RC4A 3TGJE 1Z6EA 3RM0H 1A3BH 1AN1E 1OWIA 2NU2E 1HAZB 1O33A 1HXEH 3K6YA 1C2EA 2A7JA 1NRPH 4GSOA 4WF8A 1B7XB 1ELEE 4XSKU 5GPIB 2XXLA 2ZHQH 7GCHG 3E90B 3GY4A 1AE5A 4D9QA 1SLXB 3LJJA 2B8OH 3ZZ3A 1UTNA 2Y5FA 4Y79A 1K1JA 3RXHA 3U8OH 3ZVGA 2J97A 5CDFE 4B2BA 2GMTC 5EU8A 2OC0A 2TGDA 4Z0KA 1AHTH 2ZHWH 3RU4E 4WVPE 1BOQA 1FX0B 2OUAA 4K5ZA 2IN2A 4K3JA 4IN1A 2J98A 2CHAB 3URDA 2W7SA 4XBCA 1C1SA 1D9IA 4Y8YA 3RLWH 2ZGHA 3U1JB 1G3EA 2BDBA 5C2ZA 1OP2A 2CGAA 1T8LA 8KME2 1BTYA 3KYGA 1B0EA 3FP6E 4BAMB 1AKSB 2JH6D 4BOHA 1NROH 2H5DA 3M7TA 4JZDH 7ESTE 1RIWC 1C1MA 3NZIA 2ZO3H 3U28C 1MU8B 2RFKC 1B5GH 2FOCA 3WWFA 2J38A 4CR5A 1NZQH 1JBUH 1NESE 4GHTA 2ZPSA 1FY3A 5FX5A 1DWBH 1T4VH 4RT1A 1SGRE 4AFUA 3SOSA 5DO4H 5JDUB 1PFXC 4JZEH 1QJ7B 1HJAB 3KQCA 3QTOH 3EA9A 2P16A 1CA0B 3BN9A 2SGFE 1TALA 3DSPA 1LQEA 5GJ4B 3PRBA 5FAHA 3D23A 1MTSA 1PYTC 2V35A 3SU5A 5IYTA 2AEIH 1NU7B 5AVDA 1WOFA 1UHBB 3OE7D 1PJPA 4INLA 2WPIS 1SL3A 3MH5A 1HIAA 4O3TA 4KKDA 2Q6DA 3ZYDA 4E06H 2G52A 2F4LA 3V13A 2TGPZ 1IQHA 1LQDB 3SJKA 1GDNA 1L4ZA 4TSFD 3SHAH 1GJCB 1O5EH 1XUGA 2AMQA 1A61H 2HALA 2W7UA 3F0PA 3PM3A 5DP9A 1F5LA 2WYJA 3H09A 1LDTT 4BAHB 1HCGA 2HLCA 4FOUC 5DP8A 6GCHG 3RXGA 1DY8A 4I8HA 3VB5A 1Y5AT 1C5RA 2TGTA 4HZHA 5HMAA 3W94A 2H2ZA 3B8JA 1TABE 1HAIH 1YPMH 1ORFA 2R9PA 3W1EA 2BLQA 2R0LA 2D1JA 2OC8A 4DIIH 1EAXA 3BTGE 1ZGVA 1MMJN 1HAYB 2ZC9H 2M5TA 1NFWA 1D3DB 3DSOA 1BQYA 5LPRA 2C8YB 1WU1A 4YT7H 3NXPA 2FPZA 2XC4A 3BTWE 2CN0H 2Z3DA 2ZQ1A 4CBOA 2ZKSA 2QXHA 3F9FA 1C1WH 3CS0A 3M7UA 5L2ZH 1SHHB 1GBCA 5T6DA 5C67A 3DT0H 5F6MA 3QDZB 4MLFB 1SGDE 1Y3VA 4YT6H 3LOXA 3ZZ8A 5CHAB 2IJD1 1AB9B 3LT3A 3RLYH 3TK9A 1W0JD 3UQVA 1O2ZA 4B6EA 3KQDA 1TIOA 2AIQA 2C8WB 2ZGXH 4DY7B 1QNJA 4FUFA 2W5EA 1CQQA 1YY3A 1PYTD 4ABIA 6GCHF 1G37A 1O2JA 1GJ5H 3F9HA 5EG4A 1DANH 2PR3A 1GBDA 1O5BB 1BUIA 3M37A 2PUXB 3DFJA 1IAUA 1N8OC 4BAQB 3A7TA 5C20A 3ATMA 3T25A 5EJ1A 1W7GH 4O97A 1FIWA 2FMJA 1D4PB 4Q63A 4CRAA 1ZZZA 1HIAB 3A7WA 1AMHA 4ABJA 1GCTB 1P10A 4AYYB 3GY8A 1AD8H 2PLXA 2ZQ2A 3MHWU 1DM4B 1KLIH 1QBVH 4K1EA 4ABHA 4RKOB 1HJ8A 3M35A 1MKWK 4ABBA 3GY5A 3O8DA 1BRBE 3AW1A 1YPKH 1O2PA 5PTPA 2OLGA 1QBNA 2HVXA 3FO8D 1T4UH 2LPRA 4UD9H 1D3TB 2WSSD 4Y11E 1CHOG 2XBVA 1TFXA 4YOJA 2BD4A 5SGAE 3RMNH 4AGKA 1ELVA 3LU9B 1O3LA 4ZMAH 1GI8B 1K22H 2ZDMA 1FDPA 1O3OA 2BDHA 5EXNA 3LGWA 3SU3A 1LPZB 1OS8A 3UWJH 3SGBE 1E79D 5EGMA 1DE7H 2FWWA 2AMPA 2KZ4A 5DKMA 1OYTH 3N7EA 4NCYA 2NU3E 3E3TA 3SU1A 5GIBA 1AVGH 1RS0A 1ABJH 2GVFA 3SU6A 1TRNA 1O3EA 2FOAA 2A5KA 3KN2A 4Q80A 3VB6A 1O3NA 1QA0A 1NFXA 1H9IE 3E16B 3K65B 1QZ8A 4I8JA 2W3IA 3S0NA 1PQ5A 4X2WA 2F3CE 1PQ7A 2ZPRA 3RXKA 1DS2E 3VGCC 1F5KU 2BTCE 2UUYA 3VPKA 1GWAA 1TBZH 2LP6A 5ETXA 2G4UA 2ZECA 2Y7ZA 3UQOA 2QGRA 1BJVA 1HAXB 2GJGA 1EKBB 1FQ3A 2A0QB 1TNLA 1GI1A 4NSVA 1A46H 3RXUA 1GJ8B 1CHOF 1GI5A 1YLCA 1O35A 1SOZA 3VFEA 1ZTKA 4CHAB 3QK1A 1BBRH 2GCTC 1T32A 2BD7A 2WPDD 1DDJA 3URCA 2GZ8A 1ELGA 2ZI2H 1Y8TA 2C93B 1AI8H 3GY3A 4AOQA 4BANB 1K1MA 3SNDA 1S84A 1MCVA 1O36A 2O8MA 3PLBA 2ALVA 2P94A 1GHXH 2BY8X 1CHGA 2O8WA 2V0BA 2Q6GA 1OHHD 1EZQA 5DP6A 2Y82A 2JH0D 3FFGA 3M3TA 3ZZ5A 5ABWA 1GPZA 3K6ZA 2ZDAH 2Z9LA 1FY1A 2AGEX 1MTWA 3RXRA 1D3PB 1NPMA 2ZHFH 1LCYA 4IMZA 2BQ7B 4X8UH 1O3KA 1UK3A 1O2QA 1G3CA 4O03A 1OWHA 4JYTA 1DFPA 3V0XA 3AK5A 3PLKA 4JZFH 1N6XA 1C1UH 3A88A 1EJMA 2EY4C 1O5GH 1EPTB 3UOPA 1BCUH 3ZZDA 1G3BA 2BX3A 3ZVEA 1YPGH 5DP7A 3NPSA 1Y5UT 5IDKA 1CO7E 1C5TA 1X7AC 4X2YA 4A92A 1BRAA 1YM0A 1PPCE 1W14U 4O9VA 1QB1A 1HAVA 1AUTC 1XUIA 2QXGA 3P8OA 1TNHA 5BRRE 2G51A 1D6WA 2FLBH 4NWLA 1A0LA 2GT8A 3TIUA 1P2OA 1J16A 2ZDLA 3MNCA 5EQQA 4TPYA 3A7ZA 1IQFA 1E34B 1C2DA 1JMOH 2PSYA 1P9UA 3E0PB 3TU7H 2GT7A 1GG6B 1O3MA 1Q31A 4X2XA 5EIYA 1O3HA 3SJOA 3P8FA 5GNDA 1CGHA 1H9LB 3SV9A 3EGKH 3OX7U 1BZXE 2O8UA 3SU0A 6CHAB 2ZGBH 2UUKB 2BD2A 2P3UB 3HGNA 4NIWA 4D8NA 4XDEA 2EC9H 4DG4A 3EE0B 4ZHMU 1CT2E 1O2OA 1WDIA 3QZQA 3T28A 2Y6TA 3HATH 2IPHA 3VG8A 1EOLA 1GVZA 1ZTJA 1SGTA 1SGFG 2BVSH 2XBWA 2BZAA 1TPAE 3E91A 1O3DA 4NZLA 1MAXA 1UTLM 3P6ZB 1O2YA 3ATIA 4OS1A 2BD3A 2DE9A 8GCHF 4DGJA 1YPHE 3MYWA 1LKAA 2ZU4A 1IQMA 3CNRA 2KX4A 2ZG0H 2BY9X 3OEHD 2AFQB 1HAHH 5C5NA 2QC2A 1C5NH 1EB1H 3WWBA 2VNTA 2KCAA 2VVCA 4FUJA 1W0ZU 3CP7A 2IOTA 2TIOA 1P9SA 2BD9A 1QQUA 1WXRA 4UFDH 3FKSD 1C2FA 2F9OA 2WPKS 4ISLA 4FU7A 2PTCE 2I6QA 2Y7XA 4B71A 2KFWA 3ITIA 2WPLS 4X8SH 1GBMA 2ODPA 3EQ0H 3RXMA 5T6GA 3V12A 3PROA 1V3XA 1V2ST 3I29A 3Q00A 3NRLA 4FUCA 2F9NA 3MTYA 1O3FA 5B6LA 5AFYH 2Z9JA 1V2KT 1ZJKA 1XUFA 3IG6B 2ESTE 1YPHC 2WYGA 3RXEA 5T6FA 1S81A 1THPB 1V2WT 3RXSA 1TBRH 2SFAA 1GGDC 2GMTB 1GBJA 3UAIC 3C27B 2F9UA 4VGCC 4Y7BA 2BD5A 3A7VA 3RXAA 2AS9A 3P8NA 2R3UA 4NIXA 3UB0A 1HAGE 1U6QA 1UTKA 1GI0A 1YCPH 4OS6A 1ELDE 1TA6A 3MQKC 1QRZA 2AGIX 3V7TA 1P2JA 5A2MH 5DN6D 2ZF0H 1SLUB 1EAWA 1LPGB 4YOIA 3IITA 1EJAA 1Z71A 3MU8A 1MABB 2FYRA 1EB2A 2XBYA 1ZMLA 2HVYB 3RXTA 4NA8A 2O8LA 1A5HA 2FS8A 1ID5H 1O2IA 1ELFA 2XNDD 3ATKA 3ZV8A 4DT4A 2FOHA 3NUMA 1PPBH 3A7XA 2BDYA 4OS5A 2PKSC 4X6PA 1GL0E 1EUFA 4AORA 1WUNH 4MNWA 4H4FA 1DT2A 3GDUA 5BPEA 3OTJE 1XKAC 1EASA 5DK1A 3TPIZ 2OQ5A 2QA9E 3GY2A 3DD2H 3GCNA 3VB4A 1PQAA 2FOGA 4ISIH 4YESB 1IQGA 4B2AA 1H4WA 1BITA 1EZSC 1FPCH 1WV7H 3HGPA 1XVOA 3U98H 1S83A 1Z7KA 1HAOH 4HTCH 2ZIQH 4DURA 4FUBA 3SU4A 1K28D 1IHSH 4INHA 2JH5D 4GHQA 1UK4A 1V2RT 4GVUA 2QN5T 3WW7A 1O34A 2STBE 1IHTH 2QY0B 1DLEA 1Z8JB 4UE7H 2BDGA 3MH4A 2Q1JA 3FANA 1EP6A 2FIRH 1UTJA 4Q7XA 5A09A 1BTXA 3E1XB 1V6DA 1ZPBA 1KMHB 4CRCA 3NK8A 1O3PB 4BTIB 1XUHA 1MTNC 4JMYA 1E35B 2CXVA 2CK3D 3PMHB 4LK4A 3PWBA 1OWJA 1TOMH 2PV9B 3GCOA 4LXBH 1NFUA 1BIOA 2XCFA 1MZDA 2GD4B 2VWMA 2A2XH 2Z9KA 4JK6A 3SBKA 3UY9A 3PTBA 4SGBE 2J94A 1ARCA 3STIA 1J14A 1SGEE 4AN7A 3U8RH 1ABIH 1TRYA 5EODA 4B76A 1SOTA 1QCPA 2K8IA 2L6OA 1O5AB 2THFB 2BZ6H 1A0JA 1O5DH 3OTPA 4TWYA 3LH1A 2QV1A 1Z8IB 3TH4H 5C5OA 1GBKA 2BVRH 1NY22 4ABGA 3O8CA 1GI7B 4R8TB 1SHYA 2B7DH 2K0QA 1UJ1A 5DSFA 1TQ7B 1DUAA 3ODDA 4MPVA 2C3SA 3PO1C 1L1GA 2XTTB 1TMBH 1VCWA 2AGGX 3Q3YA 1BA8B 2G00A 2A5AA 1NM6A 3SJIA 4CH2B 1EAUA 2VGCC 4DOQA 3PMAB 4I8LA 1FUJA 4K8YA 1FZZA 4D76A 3ZZCA 1GJ9B 5C1UA 3RXCA 2GCHF 1Z8GA 2BDAA 1TBQH 1O2GH 1S0RA 3P8GA 3LC3A 2XW9A 4ISNA 5TCCA 2Z94A 4M7GA 1GJ4H 1EZXC 3OY5U 1GJAB 4HI3A 1DWCH 1G32B 1NBMD 4Z1MD 4BXWA 1HLTH 4IC6A 1ESTA 3BG8A 3H5CB 4MPUA 2W6JD 2FX4A 3UPEA 1N1LA 1W0KD 1O2WA 1YF4A 3SGQE 1XMNB 2QF4A 3BTME 3W95A 1TQ0B 2TRMA 3A82A 2KR7A 2VU8E 1YLDA 5GXPA 4J1YA 1MTUA 5JBTA 2ZWLH 4DIHH 1DLKB 2ZU1A 2EEKA 1V2QT 1F92A 2GP9B 1Q3XA 1P2IA 3A8BA 1VCQA 1AWFH 1P12E 2BMGB 2ZCKP 1A0HB 1H8HD 1KTSB 4YO9A 4Q4LA 2VVUA 5FX6A 2O8TA 1YLNA 2HNTE 1G9IE 2Z9GA 3JZ1B 1V2PT 4Y8ZA 4HG6A 1VKYA 3HKJB 5FCRA 3OYPA 3VXFH 4P02A 5JB8S 5GDSH 1P04A 5FBIA 2ZDNA 3UNSA 4TWWA 2PWXA 2XCNA 2JJ2D 4Y10E 1ESAA 3A7YA 2OXSA 4GPGA 2HLDD 1COWD 4FUGA 1TA2A 2YMSC 1E1QD 4JZIA 2J2UA 2J98B 2Z3EA 1PPZA 1O3AA 1P3EA 2WPJS 3D65E 3ZVDA 4NA9H 1E38B 2FI5E 1J15A 3SHCH 1H1BA 1MQ6A 4CR9A 2ZFRH 4KTUA 1SQRA 4F49A 1OP0A 2ZNKH 2RCEA 3BF6H 2BLVA 4Q2KA 5A0AE 1TGCA 2FOMB 1O2HA 1JXPA 3HKIB 4LZ1H 1L4DA 5DJ7A 1ETTH 1YYY1 2OP9A 1YPEH 2F83A 2V6NA 5L6NH 1HUTH 2FESH 1FONA 2R0KA 4THNH 3SUFA 3TVJB 4TT3D 3QTVH 4OGXA 1MUEB 2Z9IA 2ZCHP 3RU4D 4X6OA 3B23B 3GYMA 4TPIZ 2UUFB 3SYJA 4X1SU 1Y3XA 3TJOA 2GX4A 2D26C 2CHAC 4LOYH 1TWXB 3GICB 3EA8A 1RXPA 1C1VH 2ZFQH 5K0HA 4A5TS 2WV9A 2ZPQA
chains in the Genus database with same CATH topology
1RFNA 3S7KB 1D3QB 3SI4H 4UFEH 5T3HA 1LHCH 3UREA 1P2KA 5ESTE 1OX1A 5HYOA 1PPHE 1IQEA 1KXEA 3QWCH 3ZZAA 3BG4C 1BBRK 2SGAA 1C5PA 1JWTA 2EI8A 3SU2A 1T8OA 1Y3UA 5A0BA 4I8GA 1YPLH 2A7CA 3T5FH 2NU1E 2VWOA 1O3BA 1GVLA 1TPOA 3BTHE 3ZZ6A 2Y5HA 2XC0A 1P3CA 5JB9S 2A4QA 3GISB 2CV3A 1AIXH 4GUXA 2G4TA 1HJAC 3U8TH 3T2NA 1GHBF 2TPIZ 1IQKA 3LGIA 3TGIE 1HB0B 3OSYA 4H42U 1QBOA 2ILNA 3OY6U 1YKTA 1C5VA 3P17H 3KQBA 2PKAA 2QF0A 1ZGIA 4K2YA 3GOVB 1EQ9A 1XVMA 1HFDA 1FN6A 1OKXA 4TYDA 5FHTA 5DGJA 2AYWA 3AW0A 3ZZ7A 1V2LT 4X6MA 3C1KA 3SO3A 4CRBA 2BDIA 3MI4A 4X0WU 4A7IB 1SFIA 1JRSA 1VZQH 3VXEH 2Y81A 3M5OA 2SNVA 4Y7AA 3FP8E 3TK6A 3RDZA 2WPHS 3Q3XA 1KXCA 3PLPA 1P2MA 1CA8B 1VGCB 2XBXA 3DUXH 2A4OA 3KGPA 1QTFA 4Y76A 2PSXA 3TJUA 1C2MA 2XC5A 3UR6A 3GCHB 3D62A 2BY6X 1RJXB 3U1IB 6ESTA 3TH2H 1GHVH 1FJSA 5E0HA 2Z3CA 5DP4A 1OOKB 3UTUH 1GBAA 2OD3B 5EPYA 1VCPA 1Z1JA 1WBGB 2VWLA 5EOKA 1H9HE 1F0TA 4YLQH 3MMGA 5TJXA 2GDDA 2YOLA 2QYIA 1K1OA 4X1PU 2W3KA 2SGPE 2CF9H 1FV9A 3PMJA 4MNVA 1VITG 5E0GA 3BTEE 5GWZA 1BRCE 2ZTYA 1ANCA 4B74A 4O3UA 3ELAH 1MKXH 2F9BH 3HK3B 5F8ZA 3LPRA 3AVZA 4RN6A 2VINA 1SLWB 3UNRA 1A5GH 4NIYA 1V2VT 4NFEA 5CHAC 1O30A 1AB9C 3UR9A 3BEFB 3SV2H 1HYLA 1GMCG 1LO6A 1SSXA 1HDTH 4JK5A 3QUMP 2WPMS 1KXAA 3ATWA 1C2GA 5E2PA 4AX9H 4YZUA 1CU1A 4AB8A 2P95A 1MKWH 4A1VA 2KAIA 1T8MA 5E8EH 3RMMH 4WY3A 3KNXA 2BX4A 2HPPH 4X1QU 1C1NA 1G2MA 1O2KA 2PTNA 3LC5A 2ALPA 3GY7A 5FXLA 2GV6A 3T62A 2STAE 1FAKH 3U69H 2ANWA 1AU8A 1MH0A 1KXDA 3SUDA 4A6LA 3RXDA 3ZVCA 2BXTH 1GCTC 2JETB 2DE8A 2H9EH 3MU0A 2NWNA 4MVNA 5CMXH 3GCTF 1QR3E 1GHZA 5J4QA 5K7RA 1TMTH 3TNSA 4GLYA 4B1TA 1VITF 2ANYA 1NN6A 4CRFA 3S9CA 4ISHH 8GCHG 2ZDVH 1SC8U 1GMHG 1XKBC 1O2RA 1Y3WA 2CMYA 4ABFA 2WUBA 6LPRA 2FXRA 2ZZUH 2H5CA 1W11U 4VGCB 3A84A 3BTFE 3Q77A 3H7OA 1W2KH 5F03A 1C9PA 1NRNH 1UTMA 1CVWH 2VIDA 4BAKB 1GMCF 1G30B 3TGKE 7KMEH 1YBWA 5TCAA 3S69A 1KLJH 1NC6A 2WV4A 2BXUH 3MFJA 5DP3A 2RDLA 1C2LA 3AAVA 1WQVH 3TITA 3WY8A 2RA0A 1O0DH 2A45B 3MO9A 4A1TA 1UO6A 1INCA 1UTPA 1C5LH 1IQLA 2P59A 3MOCA 4GCHG 4FUHA 3A8CA 3UUZA 1SGIB 2EI7A 1BDAA 4K69A 1YCPK 3S9AA 1ANBA 3PTNA 5LPFA 1KDQA 1THSH 2Y5GA 1E0FD 3LDXH 4ZKSU 2R2MB 3SNEA 1AWHB 1ELTA 4AYVB 1NT1A 3T27A 1OWEA 4YOGA 2UWOA 1GHAG 1P2NA 3ESTA 3SI3H 1ETRH 3RXIA 4ABDA 1O5FH 1GBEA 2VVVA 2EI6A 1UVTH 2GZ7A 4X1NU 1LTOA 2VIVA 4AG1A 3RMOH 3MNBA 1A3EH 1GMHF 2P8OC 2QF3A 2HWLB 3PWCA 1UVUH 4AB9A 1TGBA 4IGDA 2G55A 1GBHA 1DWDH 4CHAC 1FXYA 3LGUA 3E0NB 2Q6FA 3MWIU 1AQ7A 4ZXYH 1GBFA 1TNGA 1ZRBA 2GDEH 1C1QA 1AFQB 3S9BA 4FVDA 3SJ8A 1SR5C 2ZHDA 2ODYB 4IC5A 5EXLA 4AFZA 1C2KA 1DSTA 1GBTA 1QQ4A 1V2TT 1AGJA 1QB9A 3NKKA 4UDWH 9ESTA 4X6NA 2HPQH 4GCHF 1AZ8A 1GI2A 3QLPH 3SUEA 3EA7A 3P95A 4X2VA 3U9AH 1QB6A 1QFKH 4IMQA 3LH3A 4JYUH 1KLTA 1BT7A 1HAVB 1AY6H 1LHGH 4Q7ZA 3KQEA 3M36A 1KY9A 4RSPA 2ZU3A 1XM1A 1RTKA 1DPOA 1TYNA 1GHAF 3FVFB 4AGJA 5AFZH 1P09A 1L2EA 2OC7A 2A7HA 4AG2A 4KELA 1SGNE 5L2YH 2FI3E 2ODQA 3M3SA 4SGAE 1QJ6B 3GDSA 1O3CA 1A5IA 1Z6JH 3A89A 4FU8A 1SMFE 1ZSKA 1XXFA 2GKVE 5AHGH 1BTHH 1V2OT 4MTBA 3RP2A 1SPJA 3KIDU 4AFSA 1GJ6A 1ZHRA 2ASUB 5F8XA 1KDQB 5EW1H 3PO1B 3RC6A 3RM2H 1TLDA 1J17T 2YNAA 1GI6A 3SQEE 4QT8C 1RIWB 3K2UA 4BAOB 1O31A 1Y59T 2ZTZA 5DG6A 2BY7X 1K1NA 4UFFH 1ZYOA 2ZGJA 4DW2U 4HFPB 1KIGH 2FOFA 3TJVA 2BD8A 2UWPA 1GG6C 1CT0E 2K1QA 5JBCS 1C1PA 1AUJA 5C1XA 1FY5A 1O37A 1CGJE 4UFGH 4ZKOU 3ZZBA 1JIMA 2ZDKA 3PV4A 1ZSJA 2VIPA 1GVKB 5EXMA 1EOJA 1C9TA 1GBIA 1IQJA 4MDSA 2Z6BD 3RUOA 3STJA 1TOCB 2OCVB 1MZAA 1UMAH 3RC5A 1NRRH 1AKSA 2A4RA 1TGTA 1SGYE 1P03A 1ETSH 1SQTA 4Y0YE 2GZ9A 1RD3B 1NRQH 1O3JA 5I46H 4CRDA 2J34A 4ZROA 3BTDE 4XFQA 3SV8A 4AZ2B 2BYAX 8ESTE 1TB6H 3L6PA 5FPSA 3AAUA 1HNEE 1C5OH 1UK2A 4WMEA 2G8TA 1CBWC 1MAYA 1T7CA 2SNWA 1NFYA 2V3OH 3FP7E 3GY6A 2QXIA 4ABAA 2FS9A 2GCHG 2FDAA 1UTQA 3RXPA 1UHBA 4IBLH 1L1NA 3CS7A 5A8YA 1F0RA 3QGNB 1S5SA 2J9NA 4Q7YA 4CBNA 1P2QA 4DCDA 4I8KA 4Y6DA 3RXOA 2ZGCA 4TY6A 1VJAU 1HAPH 3SV7A 1HPGA 1NS3A 1EX3A 4Y8XA 3MNXA 2PUQH 2AMDA 1DWEH 2B0FA 3M5MA 2H9TH 2GV7A 4MQAA 4U2WA 1K9OE 3UNQA 3SN8A 1J9CH 4KP0A 1QIXB 2VIWA 1Y5BT 1S82A 2ZA5A 1YP9A 2J4IA 3TK5A 4WMFA 5AF9H 1DOJA 1SGPE 1EXFA 1W13U 3PMBB 1AO5A 3M3VA 3KF2A 2Z7FE 3LKWA 1O2MA 1UCYH 1EZUC 4CRGA 4OS4A 2BOHB 1BTWA 2ANKH 4ASHA 3SGAE 2NU4E 1RRKA 1ANEA 1K1LA 1N8OB 1C5UA 1A2CH 3TNTA 4OGYA 1DX5M 1TGNA 3L33A 4GAWA 2I6SA 1TX6A 1BMNH 4H6TA 3BG4B 1ACBE 4ZUHA 3I78A 3SJ9A 2QIQA 2H9HA 3P70B 3BIVH 3FZDA 3MO3A 1ELBA 2A1DB 4OS7A 3H7TA 2H1UA 1NTPA 2ZTXA 1TX8A 1BTPA 3AASA 2HOBA 1ELCA 2FZZA 4NA7A 5FPYA 5I25A 7GCHF 1ZLRA 2D2DA 4TY7A 1C5MD 3O8BA 1V2JT 1ZSLA 1BBRE 1FIZA 2FM2A 4J2YB 2G5VA 1UVSH 3A83A 1ARBA 1TE0A 4BXSA 3VB7A 1DUEA 5G4BA 3BTQE 3QO6A 4JCNA 1C1RA 1F5RA 5LGOA 1XXDA 1O5CB 1O2VA 1THRH 3SNAA 1GCDA 1W3CA 2J92A 3A80A 1MCTA 1SGCA 2XNIA 3ATLA 4MG3A 3UIRA 1L1JA 1S0QA 1AZZA 1DXPA 2ZHEH 1QRWA 5L30H 1ANDA 8LPRA 3M61U 1KXFA 3R3GB 2RA3A 1V2UT 2Y80A 2W26A 4YLUA 1C4U2 1KXBA 3VGCB 1S6HA 1P0SH 1BTZA 5HGGA 2FOBA 3ZYEA 4DJZB 2EA3A 2HRVA 4AFQA 4WMDA 3TJNA 4K8BA 2OTVA 2LNCA 3SW2B 1JIRA 1LMWB 1SVPA 1F0SA 1BMLA 1GHBG 1O38A 1E37B 3SQHE 1GI9B 5FCKA 1FLEE 3ZVBA 4UONA 4D7GA 2HNTC 4BNRA 3FZZA 3ZV9A 3PYHA 4X8TH 2FO9A 2P3TB 1MBQA 1S85A 2F91A 5A8XA 2NU0E 1MD8A 2GCTB 4K1TA 4WWYA 1FAXA 2TGAA 1G2LA 1V2NT 1T8NA 4I32A 2XWBI 1MD7A 4FVBA 5A8ZA 3KHVA 1ZHPA 1IQNA 1W10U 3DA9B 3BSQA 2FTMA 2VH0A 1JOUB 4IW4E 9LPRA 1VITH 4DVAU 2BVXH 1SQAA 3SNBA 4ABEA 2BLWA 2ZU2A 4KGAA 4ZKRU 1SBWA 2BLOA 3TH3H 2R2WU 3RMLH 5JBAS 1XX9A 3A81A 3P92A 2SGEE 3MH7A 4I31A 1MKXK 3UFAA 2PGBB 2YNBA 1C5ZB 1O32A 3RXLA 3PB1E 2C8ZB 1BHXF 1GMDG 4NZQA 4E7RG 4R0IA 1CGIE 3F1SB 1WTHD 1OYQA 4MPWA 3MU5A 1G36A 3N7OA 5HXFA 1CA0C 1FI8A 2BQWB 4A1XA 1CSOE 2ZFSA 3HK6B 4ZXXH 2O9QA 3D49H 3UOUA 1QL7A 2A5IA 1WTGH 3FAOA 1WCZA 2AIPA 1MTVA 1FNIA 2TBSA 2BQ6B 2BOKA 1LVOA 1C2HA 2G5NA 1RGQA 1EP5A 2WV5A 3Q76A 1O3IA 1RTLA 1Z1IA 2SGDE 3RXVA 2CJIA 4FUIA 4NGAH 4Y71A 1K21H 4NG9H 1IOEA 2ANMH 3G01A 1PQ8A 1KYNA 2UUJB 3SZNA 1QRXA 5FPTA 3NWUA 2BHGA 1W7XH 1LKBA 3DFLA 4JZ1A 4B75A 1ZOMA 3HPTB 4MNXA 1EPTA 5HM2A 2C8XB 1TNKA 2B5TB 3ZZ9A 3A8DA 1LHFH 1C1TA 1MQ5A 5C3NA 4X1RU 3JZ2B 1PPEE 1C5WB 1GMDF 3TLOA 2OQUA 1DSUA 2AERH 4FXGH 2ZFFH 1HXFH 1P57B 3LGVA 1ZR0A 2GGVB 4DT7B 2VH6A 3GCTG 5FBEA 2HGTH 1AVXA 2FEQH 3L3TA 4FUDA 1P02A 1WAYB 3EAJA 2A32A 4B73A 2ZEBA 1O2XA 3LONA 3VEQB 3RXJA 3E8LA 2P8OB 3A8AA 3OU0A 3CENA 1TNIA 3ODFA 1DICA 3NCLA 3LIWA 5CE1A 2B9LA 2XRCA 1H8IH 5EQRA 1BTUA 1YCPM 1W12U 1ZJDA 5ESBA 3V3MA 2CF8H 1JRTA 2OBQA 2XWAA 3RXBA 1GHYH 5H4IB 1LHDH 1A4WH 4E7NA 1C1OA 1SG8B 1TX7A 1A7SA 4ZAEA 2PKAB 1GI4A 4H6SB 4RKJB 1GBBA 1FY8E 5LPEA 1AVWA 1BHXB 4OS2A 4BTTB 3BEUA 3KCGH 3ZZ4A 3S7HB 3LGTA 2XYAA 1CT4E 1UVPA 1C2IA 3SNCA 2VB0A 2FODA 1O2UA 2RG3A 5HM9A 1LHEH 3BEIB 1O39A 5JPMH 1KSNA 1M9UA 1LVBA 1GBLA 2UWLA 3A86A 1BB0B 1GGDB 3MNSA 1UVOA 2VJ1A 4ISOA 4CH8B 1C4V2 4WH8A 1VJ9U 1O2SA 1CE5A 3BTKE 1A1RA 1K2I1 3LJOA 2P3FH 2J95A 3QN7A 2PW8H 3Q3KA 1L0ZA 2IJOB 2VIQA 4X8VH 1AFEH 4KTCA 1ZMNA 4Z6AH 2C90B 4XOJA 1N6YA 1BMAA 3O8RA 2ZFTA 2FOEA 3GDVA 1ZTLA 2GTBA 1J8AA 3A87A 1QL9A 4NIVA 3RU4T 1B0FA 2PHBA 1OWDA 1Y3YA 1ZHMA 5EPNA 2QXJA 2PKSB 1P06A 1QURH 5JYIA 1C5QA 4XBBA 1VGCC 1WYKA 4ZKNU 1NO9H 5DP5A 3F9EA 1PPFE 1DXWA 3UWIA 1OWKA 4I7YH 3GCHC 1TGSZ 1AE8H 3MO6A 1LVYA 3ZVFA 1IQIA 3A85A 3LGYA 2ZFPH 5JBBS 1EATA 3M7QA 3ZVAA 1NU9A 1QGFA 2KAIB 4F4OC 1ZMJA 4NWKA 2WUCA 1P8VC 2VWNA 3BIUH 4IS5A 1TAWA 1YPJH 1E36B 3MU1A 1G3DA 1C5XB 2ZU5A 1GHWH 2ZCLP 1UCYE 1XUJA 3KL6A 5E0JA 3I77A 1P01A 1VR1H 2PFEA 3IWMA 1GDQA 1TPPA 2FI4E 1CBWB 5GCHG 2FYQA 4U32A 3BV9B 3F6UH 3SUGA 2QCYA 1MTNB 1ZPZA 1D6RA 1V2MT 3ENSB 1P05A 3F68H 4CREA 4WH6A 3E6PH 3R0FA 4MPXA 3K9XB 4ZHLU 4ZHAA 2A4GA 3EYDA 1TPSA 1C5SA 1QJ1B 4WXIA 3B9FH 2SGQE 4NSYA 1Z8RA 1O2NA 1KTTB 3QX5H 1C4Y2 4I33A 4WXVA 4BTUB 1WQSA 1LVMA 2FX6A 1QY6A 1DVAH 1EPTC 1F0UA 2JETC 4FU9A 1W8BH 4ZH8A 3VB3A 1DY9A 1FN8A 1O2LA 2HNTF 5C1YA 1HBTH 1PPGE 2QAAA 4E05H 2D8WA 4WJG2 1F2SE 4UEHH 4INKA 1BJUA 1EAIA 2DUCA 2PGQB