2F9NA

Crystal structure of the recombinant human alpha i tryptase mutant k192q/d216g in complex with leupeptin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha I tryptase
publication title X-ray Structures of Free and Leupeptin-complexed Human alpha I-Tryptase Mutants: Indication for an alpha to beta-Tryptase Transition
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9nA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9nA01
1IHTH 3SU6A 3HKJB 3IWMA 2SNWA 4ZH8A 5TJXA 1T31A 3TK5A 4RN6A 1EOLA 3SJ9A 1SMFE 1K1MA 4WH8A 2DE9A 3LOXA 2ASUB 1C2DA 1IQLA 2XC0A 1WV7H 1UVSH 2W5EA 5EPYA 1Z6JH 2FOHA 1BBRE 3E1XB 4DW2U 4H4FA 1ID5H 2EA3A 1ZTLA 4AFSA 1D4PB 5GXPA 3RLYH 1IQGA 2H9TH 1LHFH 4E05H 2G55A 2RDLA 1O31A 4Z0KA 1F7ZA 5C5OA 1MQ6A 3VEQB 1C9PA 4LK4A 3OYPA 3RXLA 1PQ8A 2OD3B 2UUKB 3NXPA 2VIQA 2ZFPH 1EOJA 1MKXK 1BITA 3S9CA 2Z6BD 1NFUA 2QAAA 1BOQA 1M9UA 2GD4B 1B0EA 1ETRH 1DWEH 1MCVA 3TU7H 3FFGA 1FY5A 1O2HA 5SGAE 1O2RA 2J95A 3ZZ6A 2PUQH 2GV7A 1PYTC 1KXDA 3MH7A 3ZZBA 1TA2A 5T3HA 1HAYB 2ZHEH 1S81A 4BAQB 4DURA 2Q6FA 2FIRH 1NRSH 1C1QA 4XE4A 4FUIA 3RXMA 3UNSA 1ABJH 5J4QA 2HGTH 3GYLB 5L2ZH 5DG6A 3RXGA 1O2OA 1GBHA 2XXLA 2BX3A 1EJAA 2XCFA 4I33A 2W7UA 1BHXB 3IG6B 2BVRH 5T6FA 1LO6A 1J17T 2D8WA 5EG4A 1UJ1A 1HAXB 4AFZA 2VIDA 3UFAA 2QYIA 4JYVH 1C2IA 2AGIX 1KTSB 1IQNA 1NRNH 1UTOA 3A8AA 2ANKH 3GICB 2YNBA 1TYNA 3AVZA 2OC0A 4ZKNU 1A61H 2GKVE 2GP9B 1GPZA 1C2EA 2NU0E 3AAUA 2ANYA 3GY6A 5GCHG 2ILNA 1LMWB 2WPMS 1A3EH 1K1OA 4CHAC 4AB8A 2ZQ2A 1XUJA 2SGEE 2F91A 1GJ5H 1P57B 1XKBC 1MAXA 5C1XA 4X2VA 3BTDE 1YCPM 2UWPA 1LCYA 1GHXH 1QA7A 5DP8A 1XUIA 3UNRA 3MHWU 1BBRK 4IGDA 2HALA 1NFXA 1XXDA 3RXPA 1HJ9A 4ZKRU 1JOUB 1GDQA 2VGCC 1WQVH 1BMAA 1BZXE 1DXWA 2ZTXA 3MU4A 1UVTH 2ZDNA 1FY3A 1LKAA 1FUJA 2R9PA 4NFFA 4ZHAA 1QRWA 1O5FH 1YYY1 4B1TA 1EP5A 1GHAG 3TITA 1P2NA 6GCHG 5E2PA 3W94A 5EPNA 4E7NA 3NKKA 1Y5AT 3LGTA 3OSYA 2GT7A 1HUTH 4AN7A 2ZFTA 1NS3A 1AE8H 3PWBA 2GZ8A 1O3GA 4XBCA 4X1NU 2FO9A 1DDJA 1RXPA 2QF0A 1WQSA 1L1JA 2VH6A 2V0BA 1QRZA 3RC6A 1TQ0B 3SUGA 3TJNA 4CH8B 2QC2A 2THFB 1AKSB 2RG3A 5EXMA 2CGAA 4AOQA 1YPHC 3MO9A 1OYQA 1RTFB 1SGRE 3F68H 2GMTB 1WCZA 9LPRA 1ELBA 5K0HA 4ABBA 1OWIA 1ZZZA 5PTPA 1F5KU 2FOMB 1HAZB 1O34A 2Z3CA 4DIHH 2PR3A 1SGIB 2HVXA 4X2YA 2HNTF 1FPCH 3EE0B 4AFQA 1MZDA 3HKIB 3A8BA 2EI7A 1CA0C 3A82A 1AB9C 1RJXB 4X6OA 1UO6A 4ISLA 1DY9A 1L4ZA 2QIQA 4D7GA 1ZMJA 3AW0A 4OS5A 5GWZA 1C4V2 4Q7ZA 2KAIA 1NROH 4X1QU 3HATH 1ELVA 2ZQ1A 2FPZA 1KIGH 1A46H 1DOJA 1AWHB 1ELEE 2FDAA 4FVDA 1GHVH 3T28A 3ZVFA 5HYOA 1GDUA 2HLCA 3L3TA 2A31A 2ZDKA 1SQTA 1Q2WA 1PQ7A 2ULLA 1V2LT 3A85A 5B6OA 5FCKA 1GL0E 3SO3A 2XC5A 1O5CB 2HOBA 1DFPA 1GBKA 4ZMAH 1MD8A 1TALA 3KIDU 2BQ6B 4X6PA 5FAHA 2A5IA 1GI8B 2DUCA 3MO3A 3UWIA 2VIPA 2HPQH 1RTLA 1UVUH 1O2PA 1TGCA 1TNKA 2GZ7A 1Y3UA 3D62A 4YLUA 4RSPA 1GJ9B 3QDZB 1FN8A 2Z9LA 1K9OE 2O8MA 3E8LA 3C27B 3KF2A 1VR1H 2F9BH 3VXFH 3TPIZ 3MU0A 3SI4H 1TGSZ 2ZDMA 1TGTA 4A1TA 1FAXA 3EYDA 1TPSA 1OPHB 3NK8A 3U8RH 1DWDH 1K1IA 1F0UA 1V2MT 1JIMA 1HIAA 1A0LA 4ABFA 1JBUH 2BHGA 2PWXA 5A09A 1ZRBA 4HI3A 5IDKA 1GJ4H 5EGMA 3ZYDA 1GBTA 1JIRA 2VVUA 3F9GA 1HAOH 3PLBA 1YGCH 4NIVA 1PPFE 1Y5BT 1ZJKA 1YCPK 1X7AC 4JZFH 1MMJN 3LC3A 4CHAB 4NGAH 1GMHG 1T8OA 1EZXC 2SGAA 5C20A 1ZPBA 5A2MH 3U8TH 2BD4A 4JYTA 1ZHRA 2QXHA 1QJ1B 4NSYA 2EEKA 1HAIH 1GG6C 2OXSA 1GI5A 4CRDA 3SV2H 3U98H 1K21H 1N6XA 1V2RT 2HRVA 1MTUA 4X2WA 1WSSH 3GY7A 3A7XA 1C2HA 3JZ2B 4E7RG 3SV7A 1GBAA 2VGCB 3SU3A 2WUBA 2BXTH 2A2QH 2BDAA 3Q00A 3PO1C 3K2UA 1O2VA 1CVWH 4I8JA 3O8CA 1JWTA 4NFEA 4RKOB 4WH6A 2FI5E 6LPRA 5DO4H 4DGJA 1PQAA 3MU1A 4FUJA 4A1XA 1FIWA 2FLBH 1TRNA 2OBOA 4YM9A 2VJ1A 1PYTD 3SNEA 1MU6B 1O3DA 1O2KA 5GCHF 4E06H 1TQ7B 2LNCA 3MTYA 1O38A 2Z9KA 2W3KA 1FXYA 2A7JA 1J15A 2PTNA 1OOKB 1TRYA 5DP3A 4DJZB 4OS7A 2A4OA 1YPLH 3OY6U 1IQFA 1C1WH 2ODPA 2ZHQH 5C1YA 2VVCA 2QV1A 2BX4A 4IN1A 2P59A 1UHBB 1SGDE 2OC1A 2ODQA 1O3KA 1H9LB 3ZVCA 3KL6A 1AN1E 2ZU2A 2ANWA 1G37A 2ZFRH 2NU1E 1DUEA 1UK4A 1TGBA 2XRCA 4XBDA 1UTPA 1O0DH 4BAOB 4K1EA 2BDGA 1MUEB 1AVWA 1SBWA 3RU4D 4BAHB 1PJPA 4WMEA 3RXQA 4M7GA 3BTKE 1Z71A 4JZEH 4O03A 4CRGA 2ZEBA 1P12E 1EX3A 1GHAF 1P2JA 1HGTH 3QGJA 1KXBA 3BF6H 2SGFE 1NN6A 1SLWB 2G4TA 1O3BA 2H5DA 1AB9B 3ZVEA 1C5MD 1C1PA 2OLGA 2B9LA 1GI7B 1NM6A 3F9HA 1T4VH 1ZMLA 1O2WA 1D3TB 4NA7A 3VB5A 3M35A 3E0NB 5FXLA 1NY22 1IQKA 1SG8B 1C5VA 2XW9A 2BOKA 3SQEE 1BTHH 3MMGA 4X2XA 3RXAA 3SUDA 4XBBA 1TIOA 1GVLA 3KHVA 3RXRA 1IQMA 3SOSA 4K1SA 1VITH 3P8FA 1GJAB 1CQQA 1GJBB 3ODDA 3ZVAA 1SGFA 3Q3XA 4IN2A 1BMNH 1NESE 4UFFH 4I7YH 1FY4A 1HAHH 2EI8A 1W0ZU 1Z8RA 5G4BA 3AAVA 1GMCG 1SQAA 1ZLRA 3VGCB 2SNVA 3FVFB 9ESTA 1SHYA 1AQ7A 1BRAA 1HNEE 1SGQE 1MTSA 3I77A 1G32B 2WUCA 5FBEA 2RCEA 4JZ1A 2H2ZA 3UPEA 1GVZA 2AMQA 3LIWA 2JETB 4DY7B 1ZMNA 4TPIZ 1GJCB 1QJ7B 1VCQA 3TNSA 1AO5A 1O3LA 3TGJE 1YPHE 3RUOA 4JZDH 1UK2A 4ZAEA 2GDEH 5FX6A 1WBGB 5FCRA 3SN8A 4AYVB 1OSSA 1LPKB 4XFQA 4Y71A 3SQHE 3P8GA 4IC5A 2EI6A 2IJOB 1Z8JB 4X8TH 2P93A 1EJNA 1TE0A 3B9FH 3L6PA 1MTWA 5DP6A 1TPAE 1NU7B 3GY3A 2FOEA 1D6RA 1Q31A 2ZP0H 8LPRA 1AUJA 1KXCA 2AEIH 1D3DB 1BTYA 1WU1A 1V2ST 1P05A 2VIOA 1Z1IA 1GL1A 2F83A 2BVXH 2FODA 3H5CB 3MOCA 1FDPA 1SGPE 3PV4A 2ODYB 3A84A 5IYTA 5JPMH 5GJ4B 1C1RA 1DM4B 7GCHG 2P95A 2C93B 4A92A 1AFEH 2A2XH 3Q77A 4Q80A 3RXBA 2QXJA 3BTME 4X1PU 1O5GH 4I8HA 1GVKB 1QL7A 2BDHA 1G30B 1YLCA 3T62A 1EASA 4CRAA 3SU0A 1IHSH 5K7RA 2R3UA 4ZXYH 4F4OC 1RIWC 1MTNB 1A4WH 1C4U2 3P8NA 5C67A 2ZCKP 1O33A 4HZHA 3RMLH 1IOEA 3V7TA 2A4RA 1AGJA 3P95A 1PPBH 4YTAA 2D2DA 1A0JA 3A7TA 1KLJH 1GBEA 1L4DA 2FESH 4Y8XA 5LH8A 3F1SB 1ANCA 3P17H 3GDUA 4Y11E 4K69A 1GMHF 5GDSH 3BEUA 1DVAH 2JH5D 1ANDA 2STAE 1P9UA 2B5TB 1TA6A 1LVOA 1CBWC 1GI0A 4O9VA 3M5LA 5A8ZA 2FLRH 2TIOA 4BNRA 3ZZ8A 3NWUA 2ZHDA 1P2QA 2P3FH 2AERH 5T6DA 2CHAC 2FM2A 1YBWA 1YF4A 4ZHLU 1C5SA 1SFQB 3BIVH 3BTGE 1GI9B 1TMUH 4JYUH 4D9RA 5I25A 1RFNA 3SV6A 1ANEA 3T26A 3BN9A 3UQVA 8GCHG 1ETTH 1J8AA 2ZCLP 4CH2B 4IC6A 3O8BA 1RD3B 4KELA 1EAUA 4OS4A 3KN2A 1TNLA 1QBVH 3M3VA 1ESTA 2GX4A 1P2IA 2ZGCA 3ATIA 1S6HA 4JZIA 4A1VA 1LQEA 1A1RA 1BIOA 1V6DA 1QY6A 4I8KA 4NSVA 1BTPA 1AZ8A 1QNJA 1T32A 1UTNA 2A4QA 2VH0A 3ITIA 3ATMA 4O3UA 5EW1H 2ZGXH 3ZV9A 1BTXA 2BTCE 1BHXF 3MI4A 2PGQB 2R3YA 1C1OA 1OWEA 2OC8A 4OS2A 5JB9S 1FJSA 5EQQA 2XBYA 2XBVA 4FU9A 3H7TA 4ISIH 1KDQB 4K8YA 2VWNA 3W95A 4Y76A 3HGNA 3GCHB 1MD7A 4GVUA 2SGQE 1Y3VA 1BT7A 1YPKH 3DT0H 2AIQA 1QFKH 2B0FA 1OWJA 3A8DA 3SUFA 1ZR0A 1T8NA 2FX4A 3TNTA 2JH0D 2ZZUH 1MKWH 4GHTA 1PFXC 5A8XA 2TGAA 3TVJB 1GI6A 2WV4A 1GMDG 3UOPA 2ZTYA 3EA9A 1Y5UT 1SGYE 2VINA 1ESAA 2V35A 2Q1JA 3Q76A 5ETXA 1A3BH 3BTEE 1O2NA 1G3CA 4AG1A 1CT2E 4R0IA 1F92A 1FLEE 2Z9IA 1PPCE 1TPPA 2CJIA 4OS1A 2IPHA 2HWLB 1ZSLA 4AX9H 1O2JA 4CBOA 2BQWB 1ZHPA 3FAOA 2XYAA 2AMDA 2QF3A 4ISNA 1OX1A 3GCOA 4X8VH 1HV7A 2J4IA 1C5TA 1O2MA 3M61U 3QZRA 3VB6A 4FU7A 1HAGE 3ODFA 3QWCH 2H9EH 1IQHA 4UE7H 5GIBA 1ELGA 4B2CA 1SVPA 4AGJA 1BTUA 1K22H 1Z6EA 2O8WA 1HAVA 2CXVA 2ZU3A 1O5BB 1O2GH 1E37B 3URCA 1GMCF 2UUYA 2WPLS 1BUIA 1T8LA 1KSNA 1NRRH 3R3GB 5FPSA 1L1NA 3LH1A 1EPTA 1XVMA 2H6MA 4FXGH 2WPJS 3RXOA 4NZLA 3M7QA 1CGJE 1O3JA 1DE7H 1C1MA 2XWAA 3ZVDA 3R0FA 4NIXA 1RIWB 2Y82A 1D3PB 4UFGH 2BVSH 1EAWA 3OU0A 3SBKA 3MH5A 3KGPA 2V3HH 5E0HA 1YPEH 1YC0A 4DG4A 5C3NA 3MO6A 4O3TA 1IAUA 1ZHMA 3RXIA 3MU8A 3GCTG 1XM1A 1B0FA 1GCTC 8ESTE 1Y8TA 3ZZ3A 3STIA 3SGBE 1V2NT 1GBIA 5CMXH 1G3DA 4MLFB 1TGNA 4ABAA 1EZSC 1L1GA 5F8ZA 4MDSA 4HGCA 1P2KA 1VJ9U 1CBWB 2PKAA 2PUXB 3PMBB 1AUTC 4X8UH 1O2XA 3MWIU 1IQJA 1ZGVA 4AGKA 4WJG2 2AFQB 1OWKA 1LDTT 1PPZA 2Y5GA 2CHAB 1OP2A 1C2KA 1HDTH 1C4Y2 1BQYA 1XVOA 2A45B 4Y8YA 2H9HA 3DA9B 1TRMA 1IQIA 1FMGA 1F5LA 4B73A 3M5MA 3S69A 2R2WU 1K1PA 1H1BA 4AG2A 1P11E 1A5IA 1UCYH 4KTSA 1C5OH 5JDUB 2P94A 2Q6DA 1BTZA 1AMHA 1ELFA 4BXWA 1C5PA 4INLA 1GCDA 1CT0E 3VGCC 1N8OC 4I8LA 5FX5A 1LHGH 4LOYH 5GPIB 1MQ5A 3ZZ7A 3ZVGA 2GCTB 2F9NA 4NIYA 2SGDE 1TB6H 1DANH 1NC6A 2XTTB 3RXTA 1DLKB 1SFIA 1TBRH 2JETC 3ZV8A 4NIWA 3FP7E 4FUCA 2Y5HA 1BA8B 3ESTA 4D7FA 1AY6H 2ZHWH 2OP9A 1E0FD 4CREA 3KNXA 3HK3B 5JBTA 2VB0A 1DT2A 4K60A 1YCPH 1ZGIA 5C1UA 6ESTA 3A7YA 4OS6A 3KEEA 1O35A 1WTHD 3LGIA 1Z1JA 3SV8A 3WY8A 3RC4A 3A81A 2GVFA 1TABE 2K1QA 1AE5A 2ZFSA 2BDIA 1NFWA 2ZFQH 3SGQE 1E34B 3CENA 3U1IB 1BDAA 2QY0B 2O9QA 3SW2B 2F9UA 3U69H 1O2UA 3N7OA 2OQUA 3UR6A 1UVOA 1EJMA 3URDA 8GCHF 2FS9A 1C5WB 4ABJA 2AYWA 2G8TA 3NPSA 4GCHG 3SORA 3TIUA 2XBXA 4X6NA 3SU2A 2WV5A 3QUMP 4SGAE 3RXUA 8KME2 1QCPA 3QLPH 1EAIA 1O30A 1Y3YA 3SHCH 3DD2H 1SGCA 2FMJA 2PLXA 1O2IA 2WINI 2Y7ZA 4TWWA 5JB8S 5ESBA 4GLYA 2QA9E 1MTNC 3PROA 1O2TA 2J9NA 2P3UB 2ZF0H 4X1RU 2BD8A 1NPMA 2QGRA 5FPYA 4AB9A 1KLTA 3RMOH 1KXAA 4JMYA 2AMPA 4LZ1H 3AW1A 3ELAH 2AH4X 4KTCA 2A5AA 3TJOA 3RU4T 3SHAH 2B7DH 3VPKA 5A8YA 3FZZA 5C2ZA 5J4SA 3A8CA 4MNWA 1C2MA 1TX7A 4TWYA 1P9SA 4U30A 1AU8A 4CBNA 1GMDF 1EZUC 2FI4E 1QHRB 3BTFE 3GY2A 2PFEA 4Y0ZE 3NZIA 4INHA 5AVDA 1F0SA 2D1JA 1THSH 1L2EA 1DUAA 2WPHS 1W13U 4NA8A 3E90B 1WTGH 1KYNA 1W12U 1NTPA 2FOAA 1LPZB 1RS0A 3AASA 3GY8A 4R8TB 3SUEA 1TNJA 3RU4E 1V2OT 1NRQH 1DWCH 1P04A 5TCAA 1UTQA 3M36A 4AZ2B 1OS8A 2BDBA 1C1TA 1V2KT 1W0YH 6GCHF 1Y3WA 4CR9A 3O8DA 1A2CH 1GBDA 1YPGH 2AGEX 1SOTA 1GBJA 1THPB 3PMJA 2Z3DA 2BXUH 1GCTB 1WYKA 4AORA 3PB1E 1G36A 1MH0A 1SPJA 4ZROA 1C2FA 1JRSA 1O3FA 3KQEA 5F8TA 1MAYA 1O2YA 4K1TA 1V2QT 1TMTH 1FNIA 2HPPH 2QXGA 4VGCC 3RXSA 2BM2A 1C5ZB 2TGDA 4JCNA 1MCTA 4MVNA 1QIXB 4YOJA 4NWLA 1ZJDA 1O5EH 4KKDA 4B2AA 2P16A 1AKSA 2OQ5A 1TPOA 3GISB 3T25A 2A1DB 4TYDA 4WXIA 1WAYB 5LPEA 3GCHC 4Y7AA 4FVBA 1W11U 3GOVB 1W2KH 3LC5A 4TY7A 1V2PT 3MU5A 4YZUA 2BMGB 3E3TA 1W7XH 2Y6TA 3TK9A 1DSTA 1EQ9A 1O32A 1SGEE 3ATKA 1O3CA 1ZYOA 3BEFB 5ESTE 2VVVA 1C5LH 4FUBA 4IW4E 1V2JT 3BV9B 3TK6A 3SNBA 2GT8A 5I46H 4PROA 1NFYA 1N8OB 1LVYA 3RXEA 3PTBA 2ZWLH 1INCA 1QBOA 2C8ZB 4I31A 3UR9A 5A0AE 1LKBA 1TFXA 3GCTF 4Y10E 4U32A 1L0ZA 1GBMA 4MNXA 4A5TS 2BYAX 3A86A 1KTTB 3PWCA 2XWBI 1ZPZA 5F03A 4WXVA 4YLQH 2BY9X 1O5AB 1CGHA 1EPTB 2JH6D 3TH4H 1QBNA 1A0HB 3BTTE 3SZNA 3STJA 4CRBA 1JRTA 1Q3XA 2PGBB 1GGDC 3TH2H 4LXBH 1S5SA 3K9XB 1SGFG 1JMOH 3ENSB 4ABDA 1G2MA 2A5KA 1XMNB 4U2WA 3TLOA 4FUGA 1FY1A 1P03A 3OY5U 4Y79A 2CN0H 4D8NA 1YPJH 1NRPH 1NO9H 3B8JA 1TNGA 3K6ZA 3MFJA 4IMZA 1DX5M 2XBWA 4FU8A 2ALVA 4B74A 5JYIA 1G2LA 1S6FA 1VCWA 5DP7A 3VB4A 2J38A 4XDEA 2FS8A 3FZDA 5DJ7A 1O3NA 3A87A 1GJ7B 6CHAC 2PHBA 2KAIB 4B75A 3SJ8A 1TNIA 2OBQA 2FXRA 4WVPE 2FTLE 3RMMH 5EOKA 3BTWE 4ABEA 3SU1A 3QO6A 3S9BA 1DWBH 3NCLA 1BRUP 1KLIH 1SR5C 4MTBA 3HGPA 1MZAA 2BD3A 1ELCA 5E2OA 1PPEE 1A7SA 2AS9A 3B23B 3SU4A 2G81E 1GBLA 4O97A 3UUZA 1D6WA 1DS2E 1B7XB 2VWLA 4WWYA 2ZA5A 3TJUA 3DFJA 5AF9H 1AVXA 3HPTB 3VB7A 1SQOA 3LJJA 3A83A 1ABIH 1FN6A 1S84A 1BRCE 2C8XB 3UWJH 3M37A 3LKWA 1VITG 1Z8GA 1A5GH 5A0CA 1D9IA 3U8OH 3Q3YA 4GAWA 2FOCA 4ASHA 4MQAA 3OTJE 4QT8C 3EGKH 1EAXA 1J9CH 1UK3A 2UUJB 1MKXH 3P92A 5LPRA 3S9AA 1J16A 1QB9A 2BDYA 3KCGH 1GHZA 2HNTC 3M3TA 2NU4E 4GCHF 1ZOMA 2BY6X 1LPGB 2O8LA 4LZ4B 4IBLH 1HIAB 2BZAA 3UQOA 3RXCA 1GDNA 1SLUB 4K5ZA 2ZPRA 1C5UA 1UTLM 1F0TA 2O8UA 2GZ9A 3GY5A 4XOJA 1VZQH 1KXEA 2D26C 3VFEA 1UTMA 1GJDB 1P8VC 2PKSC 4XSKU 3BG8A 4I8GA 1ELDE 3G01A 3VB3A 1HPGA 1OKXA 4BANB 2BQ7B 1BJUA 4MPUA 1E38B 1BJVA 3H7OA 1TX6A 2OC7A 1F5RA 5TCCA 1K2I1 3KQDA 1THRH 3MNBA 2J94A 1U6QA 2NU2E 2ZIQH 1E36B 1GHBG 2GCTC 2WPKS 2W26A 5DP9A 2BLQA 3T2NA 5FBIA 2BD5A 3P6ZB 1QA0A 3CS7A 3F9EA 1H9HE 1HLTH 1LVMA 2CMYA 2YOLA 2C3SA 2FYQA 4VGCB 2PV9B 3V12A 1G9IE 1ANBA 2JKHA 4DVAU 1LVBA 3SU5A 1AI8H 2XCNA 3LJOA 5L2YH 2OUAA 2ALPA 3LU9B 3QK1A 1C5QA 3LPRA 2I6SA 4TY6A 7LPRA 1C1UH 4WY3A 3E0PB 1EB1H 1UHBA 2W7SA 3ATWA 2PSYA 5E0JA 1TOCB 4AFUA 1FONA 1HAPH 1W10U 1CSOE 3UIRA 1SL3A 2BD2A 1EATA 3RM0H 1MBMA 1ZTKA 1BBRH 1BMMH 4ISOA 1OYTH 1P3CA 5FHTA 2ZHFH 1HJAB 2VWMA 3GYMA 4F49A 3F9FA 2J2UA 3UNQA 1QRXA 5BPEA 3RLWH 1A5HA 1T8MA 5BRRE 4Y6DA 1C9TA 5LGOA 2J92A 3C1KA 4J2YB 1G3BA 4Q7YA 3BSQA 3TH3H 3MH6A 2FZZA 1XUFA 1QB1A 2FI3E 4NCYA 1AFQC 2GCHG 2FOGA 1VCPA 3SNCA 1XUKA 2TGPZ 3PYHA 1O3OA 3EAJA 4OGXA 2PTCE 2Z94A 1TNHA 4YT6H 2ZTZA 3I78A 1XX9A 3BEIB 3L33A 5DPAA 1C5XB 1GGDB 1XUHA 2ZC9H 1DPOA 3KQBA 4NA9H 1MKWK 1NZQH 3DUXH 2ZKSA 4FUDA 1AHTH 1S82A 3LGVA 2G5VA 2ZCHP 4FUHA 5DP4A 3ZYEA 1TWXB 2ZI2H 2BOHB 3LONA 1ZPCA 1T7CA 1ZTJA 1H8DH 1QJ6B 3S7KB 5EW2H 5F6MA 1O36A 5DK1A 3P70B 3QGNB 2BD7A 3QTOH 2BY8X 2FP7B 3T27A 1O3HA 1TOMH 4X6MA 2J34A 2ZNKH 4ABGA 2VIVA 4X1SU 2ZGHA 4K8BA 1BMLA 2BZ6H 1CHOG 2V3OH 1UCYE 2UWOA 6CHAB 4SGBE 1XUGA 4BOHA 4ESTE 1H4WA 1SHHB 1O3AA 4X0WU 1GI1A 1O3MA 1JXPA 4BTTB 4UD9H 1Y59T 1HJ8A 3RP2A 1HFDA 1VGCB 1G3EA 1SI5H 2SFAA 2ESTE 3CS0A 3LT3A 3V3MA 1V2UT 4A6LA 2XNIA 3I29A 1TONA 2BY5X 2R0KA 1CT4E 2M5TA 3BIUH 2WPIS 1NU9A 3LH3A 3M7TA 3MNCA 3PMHB 5AHGH 3UOUA 1CU1A 4HFPB 3SJOA 4HTCH 2G00A 1ORFA 1S0QA 1SGNE 3M5NA 3SJIA 3D23A 1GBCA 2V6NA 1F2SE 1AZZA 1K1NA 4DT7B 1UVPA 3BG4C 4YOIA 3LDXH 4ZHMU 5DP5A 4ISHH 4FUFA 2ZO3H 4MNYA 2BLOA 4IMQA 3JZ1B 4ZUHA 1V2VT 1B5GH 3D65E 2G4UA 2A0QB 4YESB 2R0LA 1QGFA 4ZKSU 1QR3E 3O8RA 1DXPA 2F9PA 2OINA 3A88A 5DKMA 1V3XA 2C90B 3FP8E 1W14U 1HCGA 2ZGBH 4D76A 4DIIH 2TPIZ 5FPTA 1LHDH 2CF9H 1FIZA 3EA7A 5CHAC 2A7HA 3UTUH 2GTBA 1ACBE 1GI3A 3FANA 3P8OA 3A89A 1FAKH 3SV9A 3TJVA 2YNAA 7GCHF 3K6YA 2ZPQA 3GDVA 2NU3E 2ZGJA 2O8TA 1CO7E 1TBZH 4WMDA 1RTKA 1HYLA 1K1JA 1RRKA 1GBFA 4I32A 1ESBA 1WUNH 3UY9A 3T5FH 1YP9A 2PKSB 1P01A 4OGYA 2ZG0H 3KQCA 1K1LA 2ZU5A 1O3IA 3ATLA 1YPMH 1LHCH 1ARCA 5JBBS 1TX8A 4H6TA 4BTIB 2VNTA 3SNDA 1P2OA 1K28D 2BLVA 1H9IE 1VITF 3TGIE 5HXFA 1DLEA 5EQRA 2RA0A 2Z9GA 4A7IB 1C2JA 3RXFA 4YT7H 5EU8A 2AIPA 4BXSA 2PW8H 2W3IA 4ABIA 1TBQH 5T6GA 1C5NH 1EPTC 4THNH 3E16B 2P8OC 1O39A 3Q3KA 1UCYK 1PQ5A 3A7ZA 1EUFA 3RMNH 3K65B 3QZQA 1LHEH 5H4IB 4YO9A 3NUMA 5ABWA 1T4UH 4RKJB 4Y7BA 1S83A 4X8SH 4MPWA 1AIXH 2VWOA 3RXDA 1GJ6A 4B76A 1DICA 2TGTA 1YLDA 4UFDH 1EB2A 1CE5A 1OXGA 5LPFA 1Z8IB 1ETSH 4GPGA 2DE8A 1ELAA 2UUFB 1C2GA 2G51A 3M5OA 1C2LA 3V13A 1QQ4A 2Y80A 4H42U 2PSXA 4FUEA 4B2BA 4Q7XA 2ZPSA 3PMAB 4GSOA 2C8YB 2STBE 3SJKA 1GHBF 1S0RA 1VJAU 1D3QB 2FOBA 2HNTE 1V2WT 1C5YB 1EXFA 1AFQB 2BD9A 1W3CA 1YM0A 4BTUB 2Z9JA 3E6PH 4JK5A 4BAKB 2GV6A 2H1UA 4Y0YE 3MNSA 3E91A 3VXEH 1QURH 3PM3A 3BTHE 1BRBE 4MG3A 1QQUA 5C5NA 3A7WA 1HXEH 4CRCA 2FOFA 2QCYA 4CR5A 1KDQA 2G52A 1P0SH 4CRFA 1QB6A 1OWDA 1NT1A 2NWNA 4UEHH 2LPRA 5E0GA 5EXNA 1SC8U 2IOTA 2ZFFH 1S85A 1F0RA 1GWAA 2ANMH 3LGWA 1N1LA 2GDDA 1DITH 1PPGE 2G5NA 3RXJA 3S7HB 2TRMA 3EQ0H 1V2TT 4NG9H 4BAMB 3RM2H 2WYJA 2QXIA 1XKAC 5DGJA 3SI3H 2Z7FE 1O2SA 3UREA 4H6SB 4IS5A 4ZKOU 1MU8B 3SNAA 3MNXA 2F9OA 5EQSA 4UONA 2GCHF 2BDCA 2QN5T 5CE1A 3U1JB 4GUXA 1FQ3A 1FPHH 4Q2KA 1O2ZA 3BG4B 1AWFH 2FEQH 4MNVA 1O3EA 2ZU1A 2VU8E 3ZZDA 3M3SA 1P09A 1Y3XA 3GY4A 4B71A 1BCUH 3U9AH 3RXKA 3RDZA 1UMAH 4WMFA 1ZSKA 1HBTH 3QN7A 4K2YA 2FWWA 5F8XA 3RXHA 2SGPE 1DSUA 1IQEA 1CHGA 1C5RA 4NWKA 1CA0B 4NZQA 5CHAB 1ZSJA 1MTVA 1CHOF 4TPYA 1WOFA 1EZQA 1Z7KA 2XC4A 4ABHA 1P06A 3ZZCA 7KMEH 2Q6GA 5L30H 1UTJA 1OP0A 1O2QA 3BTQE 4D9QA 1ARBA 2AGGX 2EC9H 3RXVA 5E8EH 1N6YA 1GBBA 5JBCS 3F6UH 2C8WB 3MYWA 2FYRA 3QX5H 1CGIE 1SSXA 2F9VA 1W8BH 1HJAC 4KGAA 1MBQA 1TMBH 1YKTA 2OCVB 2WYGA 1SGTA 3DHKH 3DFLA 2IN2A 4J1YA 3S0NA 1GI4A 2BLWA 2UWLA 2Y5FA 1C1VH 1GJ8B 3ZZAA 4AYYB 4INKA 2TBSA 4Z6AH 1HAVB 3PLKA 3MH4A 5L6NH 5A0BA 2ZDVH 1CA8B 1O3PB 2Y7XA 1P3EA 1O5DH 2ZDAH 1ELTA 3OX7U 5AFZH 2CV3A 1KXFA 1C1SA 4JK6A 1BB0B 1FI8A 3ZZ9A 5HM9A 1GHYH 5HM2A 4DCDA 1SOZA 1ZRKA 2FTMA 2P8OB 2Z3EA 2H5CA 3IITA 2ZECA 1LTOA 1OWHA 1P10A 1SLXB 3D49H 3V0XA 4KP0A 3ZZ4A 2Y81A 4Y8ZA 1QTFA 2FX6A 4U01A 4YOGA 5HMAA 2F3CE 3T29A 5JBAS 5AFYH 1QL8A 1GI2A 1RGQA 3EDXB 3A80A 3RC5A 2R2MB 3LGUA 3EA8A 1C1NA 5HGGA 1XXFA 4MPVA 3SGAE 1AVGH 1W7GH 1HB0B 1PPHE 3A7VA 4GHQA 2VIWA 3CP7A 1O37A 2P3TB 4K3JA 5EODA 1EP6A 2C4FH 1EKBB 3GDSA 2BB4A 1HXFH 5EXLA 1FV9A 1P02A 2I6QA 3QTVH 3LGYA 4ZXXH 3TGKE 4WF8A 3GCNA 1FZZA 2PKAB 2ZU4A 1BTWA 1H8IH 2CF8H 1TAWA 1UTKA 1VGCC 1OP8A 4MPXA 2ZDLA 3FP6E 2A32A 3HK6B 3ZZ5A 1DY8A 1HRTH 1TLDA 2BY7X 1FY8E 4UDWH 3PLPA 1QL9A 1GG6B 1O2LA 3M7UA 1J14A 1GHWH 2OTVA 1SLVB 3PTNA 7ESTE 2A4GA 4DOQA 4KTUA 1P2MA 4UFEH 2GMTC 3ZVBA 1LQDB 2B8OH 2GGVB 3PO1B 1KY9A 2RA3A 1E35B 2A7CA 1SB1H 1AD8H
chains in the Genus database with same CATH superfamily
1IHTH 3SU6A 3HKJB 3IWMA 2SNWA 4ZH8A 5TJXA 2VBCA 1T31A 3TK5A 4RN6A 1EOLA 3SJ9A 1SMFE 1K1MA 4WH8A 2DE9A 3LOXA 2ASUB 1C2DA 1IQLA 2XC0A 1WV7H 1UVSH 2W5EA 5EPYA 1Z6JH 2FOHA 1BBRE 3E1XB 4DW2U 4H4FA 1ID5H 2EA3A 1ZTLA 4AFSA 1D4PB 5GXPA 3RLYH 3UAIC 1IQGA 2H9TH 1LHFH 4E05H 2G55A 2RDLA 1O31A 4Z0KA 1F7ZA 5C5OA 1MQ6A 3VEQB 1C9PA 4LK4A 3OYPA 3RXLA 1PQ8A 2OD3B 2UUKB 3N7DA 3NXPA 2VIQA 2ZFPH 1EOJA 3FOAA 1MKXK 1BITA 3S9CA 2Z6BD 1NFUA 2QAAA 1BOQA 4P02A 1M9UA 4ACBA 2GD4B 1B0EA 1ETRH 1DWEH 1MCVA 3TU7H 3FFGA 1FY5A 1O2HA 5SGAE 1O2RA 2J95A 3ZZ6A 2PUQH 2GV7A 1PYTC 1KXDA 3MH7A 3ZZBA 1TA2A 5T3HA 1HAYB 2AHME 2ZHEH 1S81A 4BAQB 4DURA 2Q6FA 2FIRH 1NRSH 1C1QA 4XE4A 4FUIA 3RXMA 3UNSA 1ABJH 2L74A 2HGTH 3GYLB 5J4QA 5L2ZH 5DG6A 3RXGA 1O2OA 1GBHA 2XXLA 2BX3A 1EJAA 2XCFA 4I33A 2W7UA 1BHXB 3IG6B 2BVRH 5T6FA 1LO6A 1J17T 2D8WA 5EG4A 1UJ1A 1HAXB 4AFZA 2VIDA 3UFAA 2QYIA 4JYVH 1C2IA 2AGIX 1KTSB 1IQNA 1NRNH 2YMSD 1W0JD 1UTOA 3A8AA 2ANKH 1SQRA 3GICB 2YNBA 1TYNA 3AVZA 1OHHD 2OC0A 3OAAD 4ZKNU 1A61H 2GKVE 2GP9B 1GPZA 1C2EA 2NU0E 3AAUA 2ANYA 3GY6A 5GCHG 2ILNA 1LMWB 2WPMS 4ACAA 1A3EH 1K1OA 4CHAC 4AB8A 2ZQ2A 1XUJA 2SGEE 2F91A 1GJ5H 1P57B 1XKBC 1MAXA 5C1XA 4X2VA 3BTDE 1YCPM 2UWPA 1LCYA 3KYGA 1GHXH 1QA7A 5C94A 5DP8A 1XUIA 3UNRA 3MHWU 1BBRK 4IGDA 2HALA 1NFXA 1XXDA 3F3BA 3RXPA 1HJ9A 4ZKRU 1JOUB 1GDQA 2VGCC 1WQVH 1BMAA 1BZXE 1DXWA 1KMHB 2ZTXA 3MU4A 1UVTH 2ZDNA 1FY3A 1LKAA 1FUJA 2R9PA 4NFFA 4ZHAA 1K0HA 1QRWA 1O5FH 1YYY1 4B1TA 1EP5A 1GHAG 3TITA 1P2NA 6GCHG 5E2PA 3W94A 5EPNA 4E7NA 1EFRD 3NKKA 1Y5AT 3LGTA 3OSYA 2GT7A 1HUTH 4AN7A 2ZFTA 1NS3A 1AE8H 3PWBA 2GZ8A 1O3GA 4XBCA 4X1NU 2FO9A 1DDJA 1RXPA 2QF0A 1WQSA 1L1JA 2VH6A 1WXRA 2V0BA 1QRZA 4M9FA 3RC6A 1TQ0B 3SUGA 3TJNA 4CH8B 2QC2A 2THFB 2F43B 1AKSB 2RG3A 5EXMA 2QF4A 2CGAA 5CHBA 4AOQA 1YPHC 3MO9A 1OYQA 1RTFB 1BMFD 1SGRE 3F68H 2GMTB 1WCZA 9LPRA 1ELBA 5K0HA 4ABBA 1OWIA 1ZZZA 3F2GA 5PTPA 1F5KU 2W6ID 2FOMB 1HAZB 1O34A 2Z3CA 3OE7D 4DIHH 2PR3A 1SGIB 2HVXA 4X2YA 2HNTF 1FPCH 3EE0B 4AFQA 1MZDA 3HKIB 3A8BA 2EI7A 1CA0C 3FN8A 3A82A 1AB9C 1RJXB 4X6OA 1UO6A 5C17A 4ISLA 1DY9A 1L4ZA 2QIQA 5KECA 4D7GA 1ZMJA 3AW0A 4OS5A 5GWZA 1C4V2 4Q7ZA 2KAIA 1NROH 4X1QU 3HATH 1ELVA 2ZQ1A 3F0OA 2FPZA 1KIGH 1A46H 1DOJA 3PV5A 1AWHB 1ELEE 2FDAA 4FVDA 5HKKD 1GHVH 3T28A 3ZVFA 5HYOA 1GDUA 2HLCA 3L3TA 2A31A 2ZDKA 1SQTA 1Q2WA 1PQ7A 2ULLA 1V2LT 3A85A 5B6OA 5FCKA 1GL0E 3SO3A 2XC5A 1O5CB 2HOBA 1DFPA 1GBKA 4ZMAH 1MD8A 1TALA 3KIDU 2BQ6B 4X6PA 5FAHA 2A5IA 1GI8B 3AK5A 2DUCA 3MO3A 3UWIA 3NRLA 2VIPA 2HPQH 5CDFE 1RTLA 1UVUH 4DT4A 1O2PA 1TGCA 1TNKA 2GZ7A 1Y3UA 3D62A 4YLUA 4RSPA 1GJ9B 3QDZB 1FN8A 2Z9LA 1K9OE 2O8MA 3E8LA 3C27B 3KF2A 1VR1H 2F9BH 3VXFH 3TPIZ 3MU0A 3SI4H 1TGSZ 2ZDMA 1TGTA 4A1TA 1FAXA 3EYDA 1TPSA 1OPHB 3NK8A 3U8RH 1DWDH 1K1IA 1F0UA 1V2MT 1JIMA 1HIAA 1A0LA 4ABFA 1JBUH 2BHGA 2PWXA 5A09A 1ZRBA 4HI3A 5IDKA 1GJ4H 5EGMA 3ZYDA 1GBTA 1JIRA 2VVUA 3F9GA 1HAOH 3PLBA 1YGCH 4NIVA 1PPFE 1Y5BT 1ZJKA 1YCPK 1X7AC 4JZFH 1MMJN 3LC3A 4CHAB 4NGAH 1GMHG 1T8OA 1EZXC 2SGAA 5C20A 1ZPBA 5A2MH 3U8TH 2BD4A 4JYTA 1ZHRA 2QXHA 1QJ1B 4NSYA 2WV9A 2EEKA 1HAIH 1GG6C 2OXSA 1GI5A 3W1EA 4CRDA 3SV2H 3U98H 1K21H 4ASUD 1N6XA 1V2RT 2HRVA 1MTUA 4X2WA 1WSSH 3GY7A 3A7XA 1C2HA 2WSSD 3JZ2B 4E7RG 3SV7A 1GBAA 2VGCB 3SU3A 2WUBA 2BXTH 2A2QH 2BDAA 3Q00A 3FO8D 3PO1C 3K2UA 1O2VA 1CVWH 4I8JA 3O8CA 1JWTA 2YMSC 4NFEA 4RKOB 4WH6A 2FI5E 6LPRA 5DO4H 4DGJA 4B6FA 1PQAA 3MU1A 4FUJA 4A1XA 1FIWA 1MABB 2FLBH 1TRNA 2OBOA 4YM9A 2VJ1A 1PYTD 3DSOA 3SNEA 1MU6B 1O3DA 1O2KA 5GCHF 4E06H 1TQ7B 2LNCA 3MTYA 1O38A 5F53A 2Z9KA 2W3KA 1FXYA 3N99A 2A7JA 1J15A 2PTNA 1OOKB 1TRYA 5DP3A 4DJZB 4OS7A 2A4OA 1YPLH 3OY6U 1IQFA 1C1WH 2KR7A 2ODPA 2ZHQH 5C1YA 2VVCA 2QV1A 2BX4A 4IN1A 1UHBB 1SGDE 2OC1A 2P59A 5HIYA 2ODQA 1O3KA 1H9LB 3ZVCA 3KL6A 1AN1E 1YLNA 2ZU2A 2ANWA 1G37A 2ZFRH 2NU1E 1DUEA 1UK4A 1TGBA 2XRCA 4XBDA 1UTPA 1O0DH 4BAOB 4K1EA 2BDGA 1MUEB 1AVWA 1SBWA 3RU4D 4BAHB 1PJPA 4WMEA 3RXQA 4M7GA 3BTKE 1Z71A 4JZEH 4O03A 4CRGA 2ZEBA 1P12E 1EX3A 1GHAF 1P2JA 1HGTH 3QGJA 1KXBA 3BF6H 2SGFE 1NN6A 1SLWB 2G4TA 1O3BA 2H5DA 1AB9B 3ZVEA 1C5MD 1C1PA 2OLGA 2B9LA 1GI7B 1NM6A 3F9HA 1T4VH 1ZMLA 1O2WA 1D3TB 4NA7A 3VB5A 3OTPA 1VKYA 3M35A 3E0NB 5FXLA 1NY22 1IQKA 1SG8B 1C5VA 2XW9A 2BOKA 3SQEE 2XNDD 1BTHH 3MMGA 4X2XA 3RXAA 3SUDA 4XBBA 2J5UA 1TIOA 1GVLA 2V7QD 3KHVA 3RXRA 1IQMA 3SOSA 4K1SA 1VITH 3P8FA 2WPDD 1GJAB 1CQQA 1GJBB 3DSPA 3ODDA 3ZVAA 1SGFA 5EJLA 3Q3XA 4IN2A 1BMNH 1NESE 4UFFH 4I7YH 1FY4A 1HAHH 2EI8A 1W0ZU 1Z8RA 5G4BA 3AAVA 1GMCG 1SQAA 1ZLRA 3VGCB 2SNVA 3FVFB 9ESTA 1SHYA 1AQ7A 1BRAA 1HNEE 1SGQE 1MTSA 3I77A 1G32B 2WUCA 5FBEA 2RCEA 4JZ1A 2H2ZA 3UPEA 1GVZA 2AMQA 3LIWA 2JETB 4DY7B 1ZMNA 4TPIZ 1GJCB 1QJ7B 1VCQA 3TNSA 1AO5A 1O3LA 3TGJE 1YPHE 3RUOA 4JZDH 1UK2A 4ZAEA 2GDEH 5FX6A 1WBGB 5FCRA 3SN8A 4AYVB 1OSSA 1LPKB 4XFQA 4Y71A 3SQHE 3P8GA 4IC5A 2EI6A 2IJOB 1Z8JB 4X8TH 2P93A 1EJNA 1TE0A 3KQ5A 3B9FH 3L6PA 1MTWA 3OFND 1TPAE 1NU7B 3GY3A 5DP6A 2FOEA 1D6RA 1Q31A 2ZP0H 8LPRA 1AUJA 1KXCA 2AEIH 1D3DB 1BTYA 1WU1A 1V2ST 1P05A 2VIOA 1Z1IA 1GL1A 2F83A 2BVXH 2FODA 3H5CB 3MOCA 1FDPA 1SGPE 3PV4A 2ODYB 3A84A 5IYTA 5JPMH 5GJ4B 1C1RA 1DM4B 2KCPA 3VG8A 7GCHG 2P95A 2C93B 4A92A 1AFEH 2A2XH 3Q77A 4Q80A 3RXBA 2QXJA 3BTME 4X1PU 1O5GH 4I8HA 1GVKB 1QL7A 2BDHA 1G30B 1YLCA 3T62A 2YMSB 1EASA 4CRAA 3SU0A 1IHSH 5K7RA 2R3UA 4ZXYH 3SZEA 4F4OC 1RIWC 1MTNB 1A4WH 1C4U2 3P8NA 5C67A 2ZCKP 1O33A 4HZHA 3RMLH 1IOEA 3V7TA 2A4RA 1AGJA 3P95A 1PPBH 4YTAA 2D2DA 1A0JA 3A7TA 1KLJH 1GBEA 1L4DA 2FESH 4Y8XA 5LH8A 3F1SB 1ANCA 3P17H 3GDUA 4Y11E 4K69A 1GMHF 5GDSH 3BEUA 1DVAH 2JH5D 1ANDA 2STAE 1P9UA 2B5TB 1TA6A 1LVOA 1CBWC 1GI0A 4O9VA 3M5LA 2KFWA 5A8ZA 2FLRH 2TIOA 4BNRA 3ZZ8A 3NWUA 2ZHDA 1P2QA 2P3FH 2AERH 5T6DA 2CHAC 2FM2A 3EE7A 1YBWA 1YF4A 3WW7A 4TT3D 4ZHLU 1C5SA 1SFQB 3BIVH 3BTGE 1GI9B 1H8HD 1TMUH 4JYUH 4D9RA 1RFNA 5I25A 5KEDA 3SV6A 1ANEA 3T26A 3BN9A 3UQVA 8GCHG 1ETTH 1J8AA 2ZCLP 4CH2B 4IC6A 3O8BA 1RD3B 4KELA 1EAUA 4OS4A 3KN2A 2JJ2D 1TNLA 1YWUA 1QBVH 3M3VA 1ESTA 2GX4A 1P2IA 2ZGCA 3ATIA 1S6HA 4JZIA 4A1VA 1LQEA 1A1RA 1BIOA 1V6DA 1QY6A 2KCOA 4I8KA 4NSVA 1BTPA 1AZ8A 1QNJA 1T32A 1UTNA 3PRDA 2A4QA 2VH0A 3ITIA 3ATMA 4O3UA 5EW1H 2RFKC 2ZGXH 3ZV9A 1BTXA 2BTCE 1BHXF 3MI4A 2PGQB 2R3YA 5HIZA 1C1OA 1OWEA 2OC8A 4OS2A 5JB9S 1FJSA 5EQQA 2XBYA 2XBVA 2J98A 4FU9A 3H7TA 4ISIH 1KDQB 4K8YA 2VWNA 3W95A 4Y76A 3HGNA 3GCHB 1MD7A 4GVUA 2SGQE 1Y3VA 1BT7A 1YPKH 3DT0H 2AIQA 1QFKH 2B0FA 1OWJA 3A8DA 3SUFA 1ZR0A 1T8NA 2FX4A 3TNTA 2JH0D 2ZZUH 1MKWH 4GHTA 1PFXC 5A8XA 2TGAA 4Q63A 3TVJB 1GI6A 2WV4A 1GMDG 3UOPA 2ZTYA 3EA9A 1Y5UT 1SGYE 2VINA 1ESAA 2V35A 2Q1JA 3Q76A 5ETXA 1A3BH 3BTEE 1O2NA 1G3CA 4AG1A 1CT2E 4R0IA 1F92A 1FLEE 2Z9IA 1PPCE 1TPPA 2CJIA 4OS1A 2IPHA 2HWLB 2EQNA 1ZSLA 4AX9H 1O2JA 4CBOA 2BQWB 1ZHPA 3FAOA 2XYAA 2AMDA 2LELA 2QF3A 3WWBA 1UW7A 4ISNA 1NBMD 1OX1A 3GCOA 4X8VH 1HV7A 2J4IA 1C5TA 1O2MA 3M61U 3QZRA 3VB6A 4FU7A 1HAGE 3ODFA 3QWCH 2H9EH 1IQHA 4UE7H 5GIBA 1ELGA 4B2CA 1SVPA 4AGJA 1BTUA 1K22H 1Z6EA 2O8WA 1HAVA 2CXVA 2ZU3A 1O5BB 1O2GH 1E37B 3URCA 1GMCF 4FETA 2UUYA 2WPLS 1BUIA 1T8LA 1KSNA 1NRRH 3SYJA 3R3GB 2WZQA 5FPSA 1L1NA 3LH1A 1EPTA 1XVMA 2H6MA 4FXGH 2WPJS 3RXOA 4NZLA 3M7QA 1CGJE 1O3JA 1DE7H 3OEHD 1C1MA 2XWAA 1FX0B 3ZVDA 3R0FA 4NIXA 1RIWB 2Y82A 1D3PB 4UFGH 2BVSH 1EAWA 3OU0A 3SBKA 3MH5A 3KGPA 2J97A 2V3HH 5E0HA 1YPEH 1YC0A 4DG4A 5C3NA 3MO6A 4O3TA 1IAUA 1ZHMA 3RXIA 3MU8A 3GCTG 1XM1A 1B0FA 1GCTC 8ESTE 1Y8TA 3ZZ3A 3STIA 4B6EA 3SGBE 1V2NT 1GBIA 5CMXH 1G3DA 4MLFB 1TGNA 4ABAA 1EZSC 2KCAA 1L1GA 3H09A 5F8ZA 4MDSA 4HGCA 1P2KA 1VJ9U 1CBWB 2PKAA 2PUXB 3PMBB 1AUTC 4X8UH 1O2XA 3MWIU 1IQJA 1ZGVA 4AGKA 4WJG2 2AFQB 1OWKA 1LDTT 1PPZA 2Y5GA 2CHAB 1OP2A 1C2KA 1HDTH 1C4Y2 1BQYA 1XVOA 2A45B 4TSFD 4Y8YA 2H9HA 3DA9B 1TRMA 1IQIA 1FMGA 1F5LA 4B73A 3M5MA 3S69A 2R2WU 1K1PA 1H1BA 4AG2A 1P11E 1A5IA 1UCYH 4KTSA 1C5OH 2IJD1 5JDUB 2P94A 2Q6DA 1BTZA 1AMHA 1ELFA 4BXWA 1C5PA 4INLA 2HLDD 1GCDA 1CT0E 3VGCC 1N8OC 4I8LA 5FX5A 1LHGH 4LOYH 5GPIB 1MQ5A 3ZZ7A 3ZVGA 2GCTB 2F9NA 4NIYA 2SGDE 1TB6H 1DANH 1NC6A 2XTTB 3RXTA 1DLKB 1SFIA 1TBRH 2JETC 3ZV8A 4NIWA 3FP7E 4FUCA 2Y5HA 1BA8B 3ESTA 4D7FA 1AY6H 2ZHWH 2OP9A 1E0FD 4CREA 3KNXA 4RI0A 3HK3B 5JBTA 2VB0A 1DT2A 4K60A 1YCPH 1ZGIA 5C1UA 6ESTA 3A7YA 4OS6A 3KEEA 1O35A 1WTHD 3LGIA 1Z1JA 3SV8A 1H8ED 2EY4C 3WY8A 3RC4A 3A81A 3KYFA 2GVFA 1TABE 2K1QA 1AE5A 2ZFSA 2BDIA 1NFWA 2ZFQH 3SGQE 1E34B 3CENA 3F2FA 3U1IB 1BDAA 2QY0B 2O9QA 3SW2B 2F9UA 3U69H 1O2UA 3N7OA 2OQUA 3UR6A 1UVOA 1EJMA 3URDA 8GCHF 2KM0A 2FS9A 1C5WB 4ABJA 2AYWA 2G8TA 3NPSA 4GCHG 3SORA 3TIUA 2XBXA 4X6NA 3WWFA 1WDIA 3SU2A 2WV5A 3QUMP 4SGAE 2V3MA 3RXUA 8KME2 1QCPA 3QLPH 1EAIA 1O30A 1Y3YA 3SHCH 3DD2H 1SGCA 2FMJA 2PLXA 1O2IA 2WINI 2Y7ZA 4TWWA 5JB8S 5ESBA 4GLYA 2CK3D 2QA9E 1MTNC 3PROA 1O2TA 2J9NA 2P3UB 2ZF0H 4X1RU 2BD8A 1NPMA 2QGRA 5FPYA 4RT0A 4AB9A 1KLTA 3RMOH 1KXAA 4JMYA 2AMPA 4LZ1H 3AW1A 3ELAH 2AH4X 4KTCA 2A5AA 3TJOA 3RU4T 3SHAH 2B7DH 3VPKA 5A8YA 3FZZA 5C2ZA 1QZ8A 5J4SA 3A8CA 2LP6A 4MNWA 1C2MA 1TX7A 4TWYA 1P9SA 4U30A 1AU8A 4CBNA 2QE7D 1GMDF 1EZUC 2FI4E 1QHRB 3BTFE 3GY2A 2PFEA 4Y0ZE 3NZIA 4INHA 5AVDA 3DCLA 1F0SA 2D1JA 1THSH 1L2EA 1DUAA 2WPHS 1W13U 4NA8A 3E90B 1WTGH 1KYNA 1W12U 1NTPA 2FOAA 1LPZB 1RS0A 3AASA 3GY8A 4R8TB 3SUEA 1TNJA 3RU4E 1V2OT 1NRQH 1DWCH 1P04A 5TCAA 1UTQA 3M36A 4AZ2B 1OS8A 2BDBA 1C1TA 1V2KT 1W0YH 6GCHF 1Y3WA 4CR9A 3O8DA 1A2CH 1GBDA 1YPGH 2AGEX 1SOTA 1GBJA 1THPB 3PMJA 2Z3DA 2BXUH 1GCTB 1WYKA 4AORA 3PB1E 1G36A 1MH0A 1SPJA 4ZROA 1C2FA 1JRSA 1O3FA 3KQEA 5F8TA 5IK2D 1MAYA 1O2YA 4K1TA 1V2QT 1TMTH 1FNIA 2HPPH 2QXGA 4VGCC 3RXSA 2BM2A 1C5ZB 2TGDA 4JCNA 1MCTA 4MVNA 1QIXB 4YOJA 4NWLA 1ZJDA 1O5EH 4KKDA 4B2AA 2P16A 3U28C 1AKSA 2OQ5A 1TPOA 3GISB 3T25A 2A1DB 4TYDA 4WXIA 1WAYB 5LPEA 3GCHC 4Y7AA 4FVBA 1W11U 3GOVB 1W2KH 3LC5A 4TY7A 1V2PT 3MU5A 4YZUA 2BMGB 3E3TA 1W7XH 2Y6TA 3TK9A 1DSTA 1EQ9A 1O32A 1SGEE 3ATKA 3DSGA 1O3CA 1ZYOA 3BEFB 5ESTE 2VVVA 1C5LH 4FUBA 2KX4A 4IW4E 1V2JT 3BV9B 3TK6A 3SNBA 2GT8A 5I46H 4PROA 1NFYA 1N8OB 1LVYA 3RXEA 3PTBA 2ZWLH 1INCA 1QBOA 2C8ZB 4I31A 3UR9A 5A0AE 1LKBA 1TFXA 3GCTF 4Y10E 4U32A 1L0ZA 1GBMA 4MNXA 4YXWD 4A5TS 2BYAX 3A86A 1KTTB 3PWCA 2XWBI 1ZPZA 5F03A 4WXVA 4YLQH 2BY9X 1O5AB 1CGHA 1EPTB 2JH6D 3TH4H 1QBNA 1A0HB 3BTTE 3SZNA 3STJA 3ZIAD 4CRBA 1JRTA 1Q3XA 2PGBB 1GGDC 3TH2H 4LXBH 1S5SA 3K9XB 1SGFG 1JMOH 3ENSB 4ZCNA 4ABDA 1G2MA 2A5KA 1XMNB 4U2WA 3TLOA 4FUGA 1FY1A 1P03A 3OY5U 4Y79A 2CN0H 4D8NA 1YPJH 1NRPH 1NO9H 3B8JA 1TNGA 3K6ZA 3MFJA 4IMZA 1DX5M 2XBWA 4FU8A 2ALVA 4B74A 5JYIA 1G2LA 1S6FA 1VCWA 2JIZD 5DP7A 2J38A 4XDEA 3VB4A 2FS8A 3FZDA 5DJ7A 1O3NA 3A87A 1GJ7B 6CHAC 2PHBA 2KAIB 4B75A 3SJ8A 1TNIA 2OBQA 2FXRA 4WVPE 2FTLE 3RMMH 5EOKA 3BTWE 4ABEA 3SU1A 3QO6A 3PRBA 3S9BA 1DWBH 3NCLA 1BRUP 1KLIH 1SR5C 2RDEA 3HGPA 4MTBA 4XRNA 1MZAA 2BD3A 1ELCA 5E2OA 1PPEE 1A7SA 2AS9A 3B23B 3SU4A 2G81E 1GBLA 4O97A 3UUZA 1D6WA 1DS2E 1B7XB 2VWLA 2M2AA 4HG6A 4WWYA 2ZA5A 3TJUA 4Z1MD 3DFJA 5AF9H 1AVXA 3HPTB 3VB7A 1SQOA 3LJJA 3A83A 1ABIH 1FN6A 1S84A 1BRCE 2C8XB 3UWJH 4F48B 3M37A 3LKWA 1VITG 1Z8GA 1A5GH 5A0CA 1D9IA 3U8OH 3Q3YA 4GAWA 2FOCA 4ASHA 4MQAA 3OTJE 4QT8C 3EGKH 1EAXA 1J9CH 1UK3A 2UUJB 1MKXH 3P92A 5LPRA 3S9AA 1J16A 1QB9A 2BDYA 3KCGH 5C0UA 1GHZA 2HNTC 3M3TA 2NU4E 4GCHF 1ZOMA 2BY6X 1LPGB 2O8LA 3GS9A 4LZ4B 4IBLH 1HIAB 2BZAA 4I86A 3UQOA 3RXCA 1GDNA 1SLUB 4K5ZA 2ZPRA 1C5UA 1UTLM 1F0TA 2O8UA 2GZ9A 3GY5A 4XOJA 1VZQH 1KXEA 2D26C 3VFEA 1E1RD 3CNRA 1UTMA 1GJDB 1P8VC 2PKSC 4XSKU 3BG8A 4I8GA 1ELDE 3G01A 3VB3A 1HPGA 1OKXA 4BANB 2BQ7B 1BJUA 4MPUA 1E38B 1BJVA 3H7OA 1TX6A 2OC7A 1F5RA 5TCCA 1K2I1 5EJ1A 3KQDA 1THRH 3MNBA 2J94A 1U6QA 2NU2E 2ZIQH 1E36B 1GHBG 2GCTC 2WPKS 2W26A 5DP9A 2BLQA 3T2NA 5FBIA 2BD5A 3P6ZB 1QA0A 3CS7A 3F9EA 1H9HE 4AC9A 1HLTH 1LVMA 2CMYA 2YOLA 2C3SA 2FYQA 4VGCB 2PV9B 3V12A 1G9IE 1ANBA 2JKHA 1E79D 4DVAU 1LVBA 3SU5A 1AI8H 2XCNA 3LJOA 5L2YH 3PV2A 2ALPA 2OUAA 3LU9B 3QK1A 1C5QA 3LPRA 2I6SA 4TY6A 7LPRA 1C1UH 4WY3A 3E0PB 1EB1H 1UHBA 2W7SA 5DN6D 3ATWA 2PSYA 5E0JA 1TOCB 4AFUA 3F2HA 1FONA 1HAPH 1W10U 1CSOE 3UIRA 1SL3A 2BD2A 1EATA 3RM0H 1MBMA 1ZTKA 1BBRH 1BMMH 4ISOA 1OYTH 1P3CA 5FHTA 2ZHFH 1HJAB 2VWMA 3GYMA 4F49A 3F9FA 2J2UA 3UNQA 1QRXA 5BPEA 3RLWH 1A5HA 4FOUC 1T8MA 5BRRE 4Y6DA 3MQKC 1C9TA 5LGOA 2J92A 3C1KA 4J2YB 1G3BA 4Q7YA 3BSQA 3TH3H 3MH6A 2FZZA 1XUFA 2HVYB 1QB1A 2FI3E 4NCYA 1AFQC 2GCHG 2FOGA 1VCPA 3SNCA 1XUKA 4XD7D 2TGPZ 3PYHA 1O3OA 3EAJA 4OGXA 2PTCE 2IPQX 2Z94A 1TNHA 4YT6H 2ZTZA 3I78A 1XX9A 3BEIB 3L33A 5DPAA 1C5XB 1GGDB 1XUHA 2ZC9H 1DPOA 3KQBA 4NA9H 1MKWK 1NBME 2L6OA 1NZQH 3DUXH 2ZKSA 4FUDA 1AHTH 3UB0A 1S82A 3LGVA 2G5VA 2ZCHP 4FUHA 4Q4LA 5DP4A 3ZYEA 1TWXB 2ZI2H 2BOHB 3LONA 1ZPCA 1T7CA 1ZTJA 1H8DH 1QJ6B 3S7KB 5EW2H 5F6MA 1O36A 5DK1A 3P70B 3QGNB 2BD7A 3QTOH 2BY8X 2FP7B 3T27A 1O3HA 1TOMH 4X6MA 2J34A 2ZNKH 4ABGA 2VIVA 4X1SU 2ZGHA 4K8BA 1BMLA 2BZ6H 1CHOG 2V3OH 1UCYE 2UWOA 6CHAB 4SGBE 1XUGA 4BOHA 4ESTE 1H4WA 1SHHB 1O3AA 4X0WU 1GI1A 1O3MA 1JXPA 4BTTB 4UD9H 1Y59T 1HJ8A 3RP2A 1HFDA 1VGCB 1G3EA 1SI5H 2SFAA 2ESTE 3CS0A 3LT3A 3V3MA 1V2UT 4A6LA 2XNIA 3I29A 1TONA 2BY5X 2R0KA 1CT4E 2M5TA 3BIUH 2WPIS 1NU9A 3LH3A 3M7TA 3MNCA 3PMHB 5AHGH 3UOUA 1CU1A 4HFPB 2QF5A 3SJOA 4HTCH 2W6JD 2G00A 1ORFA 1S0QA 1SGNE 3M5NA 3SJIA 3D23A 1GBCA 2V6NA 1F2SE 1AZZA 1K1NA 4DT7B 1UVPA 3BG4C 4YOIA 3LDXH 4ZHMU 5DP5A 4ISHH 4FUFA 2ZO3H 4MNYA 2BLOA 4IMQA 3JZ1B 4ZUHA 1V2VT 1B5GH 3D65E 2G4UA 2A0QB 4YESB 2R0LA 1QGFA 4ZKSU 1QR3E 3O8RA 1DXPA 2F9PA 2OINA 3A88A 5DKMA 2PP6A 1V3XA 2C90B 3FP8E 1W14U 1HCGA 2ZGBH 4D76A 4DIIH 2TPIZ 5FPTA 1LHDH 2CF9H 1FIZA 3EA7A 5CHAC 2A7HA 2JDID 3UTUH 2GTBA 1ACBE 1GI3A 3FANA 3P8OA 3A89A 1FAKH 3SV9A 3TJVA 2YNAA 7GCHF 3K6YA 2ZPQA 3GDVA 2NU3E 2ZGJA 2O8TA 1CO7E 1TBZH 4WMDA 1RTKA 1HYLA 1K1JA 1COWD 1RRKA 1GBFA 4I32A 1ESBA 1WUNH 3UY9A 3T5FH 1YP9A 2PKSB 1P01A 4OGYA 2ZG0H 3KQCA 1K1LA 1SKYE 1O3IA 2XOKD 1YPMH 1LHCH 1ARCA 2ZU5A 3ATLA 5JBBS 1TX8A 4H6TA 4BTIB 2VNTA 3SNDA 1P2OA 1K28D 2BLVA 1H9IE 1VITF 3TGIE 2GJGA 5HXFA 1DLEA 5EQRA 2RA0A 2Z9GA 4A7IB 1C2JA 3RXFA 4YT7H 5EU8A 2AIPA 4BXSA 2PW8H 2W3IA 4ABIA 1TBQH 5T6GA 1C5NH 1E1QD 1EPTC 4THNH 3E16B 2P8OC 1O39A 3Q3KA 1UCYK 1PQ5A 3A7ZA 1EUFA 3RMNH 3K65B 3QZQA 1LHEH 5H4IB 4YO9A 3NUMA 5ABWA 1T4UH 4RKJB 4Y7BA 1S83A 4X8SH 4MPWA 1AIXH 2VWOA 3RXDA 1GJ6A 2K8IA 4B76A 1DICA 3OEED 2TGTA 1YLDA 4UFDH 1EB2A 1CE5A 1OXGA 5LPFA 1Z8IB 1ETSH 4GPGA 2DE8A 1ELAA 2UUFB 1C2GA 2G51A 3M5OA 1C2LA 2KZ4A 3V13A 1QQ4A 2Y80A 4H42U 2PSXA 4FUEA 4B2BA 4Q7XA 2ZPSA 3PMAB 4GSOA 2C8YB 2STBE 3SJKA 1W0KD 1GHBF 1S0RA 1VJAU 1D3QB 2FOBA 2HNTE 1V2WT 1C5YB 1EXFA 1AFQB 2BD9A 1W3CA 1YM0A 4BTUB 2Z9JA 3E6PH 4JK5A 4BAKB 2GV6A 2H1UA 4Y0YE 1YY3A 2F4LA 1S6LA 3MNSA 3E91A 3VXEH 1QURH 3PM3A 3BTHE 1BRBE 4MG3A 1QQUA 5C5NA 4F55A 3A7WA 1HXEH 4CRCA 2FOFA 2QCYA 4CR5A 1KDQA 2G52A 1P0SH 4CRFA 1QB6A 1OWDA 1NT1A 2NWNA 4UEHH 2LPRA 5E0GA 5EXNA 1SC8U 2IOTA 2ZFFH 1S85A 1F0RA 1GWAA 2ANMH 3LGWA 1N1LA 4OM9A 2GDDA 1DITH 1PPGE 5C0TA 2G5NA 3RXJA 3S7HB 2TRMA 3EQ0H 1V2TT 4NG9H 4BAMB 3RM2H 2WYJA 2QXIA 1XKAC 5DGJA 3SI3H 2K0QA 2Z7FE 1O2SA 3UREA 4H6SB 4IS5A 4ZKOU 1MU8B 3SNAA 3MNXA 2F9OA 5EQSA 2KCYA 4UONA 2GCHF 2BDCA 2QN5T 5CE1A 3U1JB 2J98B 4GUXA 1FQ3A 3N7EA 1FPHH 4Q2KA 1O2ZA 3BG4B 1AWFH 2FEQH 4MNVA 1O3EA 2ZU1A 2VU8E 3ZZDA 3M3SA 1P09A 1Y3XA 3GY4A 2JJ1D 4B71A 1BCUH 3U9AH 3RXKA 3RDZA 1UMAH 4WMFA 1ZSKA 1HBTH 3QN7A 4K2YA 2FWWA 5F8XA 3RXHA 2SGPE 1DSUA 1IQEA 1CHGA 2WHXA 1C5RA 4NWKA 1CA0B 4NZQA 5CHAB 1ZSJA 2OK5A 1MTVA 1CHOF 4TPYA 1WOFA 1EZQA 1Z7KA 2XC4A 4ABHA 1P06A 3ZZCA 7KMEH 2Q6GA 5L30H 1UTJA 4P00A 1OP0A 1O2QA 3BTQE 4D9QA 1ARBA 2AGGX 2EC9H 3RXVA 5E8EH 1N6YA 1GBBA 5EJZA 5T1VA 3F0PA 5JBCS 3F6UH 2C8WB 3MYWA 2FYRA 3QX5H 1CGIE 1SSXA 2F9VA 1W8BH 1HJAC 4KGAA 1MBQA 1TMBH 1YKTA 2OCVB 2WYGA 1SGTA 3DHKH 3DFLA 2IN2A 4J1YA 3S0NA 1GI4A 2BLWA 2UWLA 2Y5FA 1C1VH 1GJ8B 3ZZAA 4AYYB 4INKA 2TBSA 4Z6AH 1HAVB 3PLKA 3MH4A 5L6NH 5A0BA 2ZDVH 1CA8B 1O3PB 2Y7XA 1P3EA 1O5DH 2ZDAH 1ELTA 3OX7U 5AFZH 3FKSD 2CV3A 1KXFA 1C1SA 4JK6A 1BB0B 1FI8A 3ZZ9A 5HM9A 1GHYH 5HM2A 4DCDA 1SOZA 1ZRKA 2FTMA 2P8OB 2Z3EA 5DSFA 2H5CA 3IITA 2ZECA 1LTOA 1OWHA 1P10A 1SLXB 3D49H 4RT1A 3V0XA 4KP0A 3ZZ4A 2Y81A 4Y8ZA 1QTFA 2FX6A 4U01A 4YOGA 5HMAA 2F3CE 3T29A 5JBAS 5AFYH 1QL8A 1GI2A 1RGQA 3EDXB 3A80A 3RC5A 2R2MB 3LGUA 3EA8A 1C1NA 5HGGA 1XXFA 4MPVA 3SGAE 1AVGH 1W7GH 1HB0B 1PPHE 3A7VA 4GHQA 2VIWA 3CP7A 1O37A 2P3TB 4K3JA 5EODA 1EP6A 2C4FH 1EKBB 3GDSA 2BB4A 5B6LA 1HXFH 5KGOA 5EXLA 1FV9A 1P02A 2I6QA 3QTVH 3LGYA 4ZXXH 3TGKE 4WF8A 5EIYA 3GCNA 1FZZA 5FL7D 2PKAB 2ZU4A 1BTWA 1H8IH 2CF8H 1TAWA 1UTKA 1VGCC 1OP8A 4MPXA 2ZDLA 5GNDA 3FP6E 2A32A 3HK6B 3ZZ5A 1DY8A 1HRTH 1TLDA 2BY7X 1FY8E 4UDWH 3PLPA 1QL9A 1GG6B 1O2LA 3M7UA 1J14A 1GHWH 1SLVB 2OTVA 3PTNA 7ESTE 2A4GA 4DOQA 4KTUA 1P2MA 4UFEH 2GMTC 3ZVBA 1LQDB 2B8OH 2GGVB 3PO1B 1KY9A 2RA3A 1E35B 2A7CA 1SB1H 1AD8H
chains in the Genus database with same CATH topology
1IHTH 3SU6A 3HKJB 3IWMA 2SNWA 4ZH8A 5TJXA 1T31A 3TK5A 4RN6A 1EOLA 3SJ9A 1SMFE 1K1MA 4WH8A 2DE9A 3LOXA 2ASUB 1C2DA 1IQLA 2XC0A 1WV7H 1UVSH 2W5EA 5EPYA 1Z6JH 2FOHA 1BBRE 3E1XB 4DW2U 4H4FA 1ID5H 2EA3A 1ZTLA 4AFSA 1D4PB 5GXPA 3RLYH 1IQGA 2H9TH 1LHFH 4E05H 2G55A 2RDLA 1O31A 4Z0KA 1F7ZA 5C5OA 1MQ6A 3VEQB 1C9PA 4LK4A 3OYPA 3RXLA 1PQ8A 2OD3B 2UUKB 3NXPA 2VIQA 2ZFPH 1EOJA 1MKXK 1BITA 3S9CA 2Z6BD 1NFUA 2QAAA 1BOQA 1M9UA 2GD4B 1B0EA 1ETRH 1DWEH 1MCVA 3TU7H 3FFGA 1FY5A 1O2HA 5SGAE 1O2RA 2J95A 3ZZ6A 2PUQH 2GV7A 1PYTC 1KXDA 3MH7A 3ZZBA 1TA2A 5T3HA 1HAYB 2ZHEH 1S81A 4BAQB 4DURA 2Q6FA 2FIRH 1NRSH 1C1QA 4XE4A 4FUIA 3RXMA 3UNSA 1ABJH 5J4QA 2HGTH 3GYLB 5L2ZH 5DG6A 3RXGA 1O2OA 1GBHA 2XXLA 2BX3A 1EJAA 2XCFA 4I33A 2W7UA 1BHXB 3IG6B 2BVRH 5T6FA 1LO6A 1J17T 2D8WA 5EG4A 1UJ1A 1HAXB 4AFZA 2VIDA 3UFAA 2QYIA 4JYVH 1C2IA 2AGIX 1KTSB 1IQNA 1NRNH 1UTOA 3A8AA 2ANKH 3GICB 2YNBA 1TYNA 3AVZA 2OC0A 4ZKNU 1A61H 2GKVE 2GP9B 1GPZA 1C2EA 2NU0E 3AAUA 2ANYA 3GY6A 5GCHG 2ILNA 1LMWB 2WPMS 1A3EH 1K1OA 4CHAC 4AB8A 2ZQ2A 1XUJA 2SGEE 2F91A 1GJ5H 1P57B 1XKBC 1MAXA 5C1XA 4X2VA 3BTDE 1YCPM 2UWPA 1LCYA 1GHXH 1QA7A 5DP8A 1XUIA 3UNRA 3MHWU 1BBRK 4IGDA 2HALA 1NFXA 1XXDA 3RXPA 1HJ9A 4ZKRU 1JOUB 1GDQA 2VGCC 1WQVH 1BMAA 1BZXE 1DXWA 2ZTXA 3MU4A 1UVTH 2ZDNA 1FY3A 1LKAA 1FUJA 2R9PA 4NFFA 4ZHAA 1QRWA 1O5FH 1YYY1 4B1TA 1EP5A 1GHAG 3TITA 1P2NA 6GCHG 5E2PA 3W94A 5EPNA 4E7NA 3NKKA 1Y5AT 3LGTA 3OSYA 2GT7A 1HUTH 4AN7A 2ZFTA 1NS3A 1AE8H 3PWBA 2GZ8A 1O3GA 4XBCA 4X1NU 2FO9A 1DDJA 1RXPA 2QF0A 1WQSA 1L1JA 2VH6A 2V0BA 1QRZA 3RC6A 1TQ0B 3SUGA 3TJNA 4CH8B 2QC2A 2THFB 1AKSB 2RG3A 5EXMA 2CGAA 4AOQA 1YPHC 3MO9A 1OYQA 1RTFB 1SGRE 3F68H 2GMTB 1WCZA 9LPRA 1ELBA 5K0HA 4ABBA 1OWIA 1ZZZA 5PTPA 1F5KU 2FOMB 1HAZB 1O34A 2Z3CA 4DIHH 2PR3A 1SGIB 2HVXA 4X2YA 2HNTF 1FPCH 3EE0B 4AFQA 1MZDA 3HKIB 3A8BA 2EI7A 1CA0C 3A82A 1AB9C 1RJXB 4X6OA 1UO6A 4ISLA 1DY9A 1L4ZA 2QIQA 4D7GA 1ZMJA 3AW0A 4OS5A 5GWZA 1C4V2 4Q7ZA 2KAIA 1NROH 4X1QU 3HATH 1ELVA 2ZQ1A 2FPZA 1KIGH 1A46H 1DOJA 1AWHB 1ELEE 2FDAA 4FVDA 1GHVH 3T28A 3ZVFA 5HYOA 1GDUA 2HLCA 3L3TA 2A31A 2ZDKA 1SQTA 1Q2WA 1PQ7A 2ULLA 1V2LT 3A85A 5B6OA 5FCKA 1GL0E 3SO3A 2XC5A 1O5CB 2HOBA 1DFPA 1GBKA 4ZMAH 1MD8A 1TALA 3KIDU 2BQ6B 4X6PA 5FAHA 2A5IA 1GI8B 2DUCA 3MO3A 3UWIA 2VIPA 2HPQH 1RTLA 1UVUH 1O2PA 1TGCA 1TNKA 2GZ7A 1Y3UA 3D62A 4YLUA 4RSPA 1GJ9B 3QDZB 1FN8A 2Z9LA 1K9OE 2O8MA 3E8LA 3C27B 3KF2A 1VR1H 2F9BH 3VXFH 3TPIZ 3MU0A 3SI4H 1TGSZ 2ZDMA 1TGTA 4A1TA 1FAXA 3EYDA 1TPSA 1OPHB 3NK8A 3U8RH 1DWDH 1K1IA 1F0UA 1V2MT 1JIMA 1HIAA 1A0LA 4ABFA 1JBUH 2BHGA 2PWXA 5A09A 1ZRBA 4HI3A 5IDKA 1GJ4H 5EGMA 3ZYDA 1GBTA 1JIRA 2VVUA 3F9GA 1HAOH 3PLBA 1YGCH 4NIVA 1PPFE 1Y5BT 1ZJKA 1YCPK 1X7AC 4JZFH 1MMJN 3LC3A 4CHAB 4NGAH 1GMHG 1T8OA 1EZXC 2SGAA 5C20A 1ZPBA 5A2MH 3U8TH 2BD4A 4JYTA 1ZHRA 2QXHA 1QJ1B 4NSYA 2EEKA 1HAIH 1GG6C 2OXSA 1GI5A 4CRDA 3SV2H 3U98H 1K21H 1N6XA 1V2RT 2HRVA 1MTUA 4X2WA 1WSSH 3GY7A 3A7XA 1C2HA 3JZ2B 4E7RG 3SV7A 1GBAA 2VGCB 3SU3A 2WUBA 2BXTH 2A2QH 2BDAA 3Q00A 3PO1C 3K2UA 1O2VA 1CVWH 4I8JA 3O8CA 1JWTA 4NFEA 4RKOB 4WH6A 2FI5E 6LPRA 5DO4H 4DGJA 1PQAA 3MU1A 4FUJA 4A1XA 1FIWA 2FLBH 1TRNA 2OBOA 4YM9A 2VJ1A 1PYTD 3SNEA 1MU6B 1O3DA 1O2KA 5GCHF 4E06H 1TQ7B 2LNCA 3MTYA 1O38A 2Z9KA 2W3KA 1FXYA 2A7JA 1J15A 2PTNA 1OOKB 1TRYA 5DP3A 4DJZB 4OS7A 2A4OA 1YPLH 3OY6U 1IQFA 1C1WH 2ODPA 2ZHQH 5C1YA 2VVCA 2QV1A 2BX4A 4IN1A 2P59A 1UHBB 1SGDE 2OC1A 2ODQA 1O3KA 1H9LB 3ZVCA 3KL6A 1AN1E 2ZU2A 2ANWA 1G37A 2ZFRH 2NU1E 1DUEA 1UK4A 1TGBA 2XRCA 4XBDA 1UTPA 1O0DH 4BAOB 4K1EA 2BDGA 1MUEB 1AVWA 1SBWA 3RU4D 4BAHB 1PJPA 4WMEA 3RXQA 4M7GA 3BTKE 1Z71A 4JZEH 4O03A 4CRGA 2ZEBA 1P12E 1EX3A 1GHAF 1P2JA 1HGTH 3QGJA 1KXBA 3BF6H 2SGFE 1NN6A 1SLWB 2G4TA 1O3BA 2H5DA 1AB9B 3ZVEA 1C5MD 1C1PA 2OLGA 2B9LA 1GI7B 1NM6A 3F9HA 1T4VH 1ZMLA 1O2WA 1D3TB 4NA7A 3VB5A 3M35A 3E0NB 5FXLA 1NY22 1IQKA 1SG8B 1C5VA 2XW9A 2BOKA 3SQEE 1BTHH 3MMGA 4X2XA 3RXAA 3SUDA 4XBBA 1TIOA 1GVLA 3KHVA 3RXRA 1IQMA 3SOSA 4K1SA 1VITH 3P8FA 1GJAB 1CQQA 1GJBB 3ODDA 3ZVAA 1SGFA 3Q3XA 4IN2A 1BMNH 1NESE 4UFFH 4I7YH 1FY4A 1HAHH 2EI8A 1W0ZU 1Z8RA 5G4BA 3AAVA 1GMCG 1SQAA 1ZLRA 3VGCB 2SNVA 3FVFB 9ESTA 1SHYA 1AQ7A 1BRAA 1HNEE 1SGQE 1MTSA 3I77A 1G32B 2WUCA 5FBEA 2RCEA 4JZ1A 2H2ZA 3UPEA 1GVZA 2AMQA 3LIWA 2JETB 4DY7B 1ZMNA 4TPIZ 1GJCB 1QJ7B 1VCQA 3TNSA 1AO5A 1O3LA 3TGJE 1YPHE 3RUOA 4JZDH 1UK2A 4ZAEA 2GDEH 5FX6A 1WBGB 5FCRA 3SN8A 4AYVB 1OSSA 1LPKB 4XFQA 4Y71A 3SQHE 3P8GA 4IC5A 2EI6A 2IJOB 1Z8JB 4X8TH 2P93A 1EJNA 1TE0A 3B9FH 3L6PA 1MTWA 5DP6A 1TPAE 1NU7B 3GY3A 2FOEA 1D6RA 1Q31A 2ZP0H 8LPRA 1AUJA 1KXCA 2AEIH 1D3DB 1BTYA 1WU1A 1V2ST 1P05A 2VIOA 1Z1IA 1GL1A 2F83A 2BVXH 2FODA 3H5CB 3MOCA 1FDPA 1SGPE 3PV4A 2ODYB 3A84A 5IYTA 5JPMH 5GJ4B 1C1RA 1DM4B 7GCHG 2P95A 2C93B 4A92A 1AFEH 2A2XH 3Q77A 4Q80A 3RXBA 2QXJA 3BTME 4X1PU 1O5GH 4I8HA 1GVKB 1QL7A 2BDHA 1G30B 1YLCA 3T62A 1EASA 4CRAA 3SU0A 1IHSH 5K7RA 2R3UA 4ZXYH 4F4OC 1RIWC 1MTNB 1A4WH 1C4U2 3P8NA 5C67A 2ZCKP 1O33A 4HZHA 3RMLH 1IOEA 3V7TA 2A4RA 1AGJA 3P95A 1PPBH 4YTAA 2D2DA 1A0JA 3A7TA 1KLJH 1GBEA 1L4DA 2FESH 4Y8XA 5LH8A 3F1SB 1ANCA 3P17H 3GDUA 4Y11E 4K69A 1GMHF 5GDSH 3BEUA 1DVAH 2JH5D 1ANDA 2STAE 1P9UA 2B5TB 1TA6A 1LVOA 1CBWC 1GI0A 4O9VA 3M5LA 5A8ZA 2FLRH 2TIOA 4BNRA 3ZZ8A 3NWUA 2ZHDA 1P2QA 2P3FH 2AERH 5T6DA 2CHAC 2FM2A 1YBWA 1YF4A 4ZHLU 1C5SA 1SFQB 3BIVH 3BTGE 1GI9B 1TMUH 4JYUH 4D9RA 5I25A 1RFNA 3SV6A 1ANEA 3T26A 3BN9A 3UQVA 8GCHG 1ETTH 1J8AA 2ZCLP 4CH2B 4IC6A 3O8BA 1RD3B 4KELA 1EAUA 4OS4A 3KN2A 1TNLA 1QBVH 3M3VA 1ESTA 2GX4A 1P2IA 2ZGCA 3ATIA 1S6HA 4JZIA 4A1VA 1LQEA 1A1RA 1BIOA 1V6DA 1QY6A 4I8KA 4NSVA 1BTPA 1AZ8A 1QNJA 1T32A 1UTNA 2A4QA 2VH0A 3ITIA 3ATMA 4O3UA 5EW1H 2ZGXH 3ZV9A 1BTXA 2BTCE 1BHXF 3MI4A 2PGQB 2R3YA 1C1OA 1OWEA 2OC8A 4OS2A 5JB9S 1FJSA 5EQQA 2XBYA 2XBVA 4FU9A 3H7TA 4ISIH 1KDQB 4K8YA 2VWNA 3W95A 4Y76A 3HGNA 3GCHB 1MD7A 4GVUA 2SGQE 1Y3VA 1BT7A 1YPKH 3DT0H 2AIQA 1QFKH 2B0FA 1OWJA 3A8DA 3SUFA 1ZR0A 1T8NA 2FX4A 3TNTA 2JH0D 2ZZUH 1MKWH 4GHTA 1PFXC 5A8XA 2TGAA 3TVJB 1GI6A 2WV4A 1GMDG 3UOPA 2ZTYA 3EA9A 1Y5UT 1SGYE 2VINA 1ESAA 2V35A 2Q1JA 3Q76A 5ETXA 1A3BH 3BTEE 1O2NA 1G3CA 4AG1A 1CT2E 4R0IA 1F92A 1FLEE 2Z9IA 1PPCE 1TPPA 2CJIA 4OS1A 2IPHA 2HWLB 1ZSLA 4AX9H 1O2JA 4CBOA 2BQWB 1ZHPA 3FAOA 2XYAA 2AMDA 2QF3A 4ISNA 1OX1A 3GCOA 4X8VH 1HV7A 2J4IA 1C5TA 1O2MA 3M61U 3QZRA 3VB6A 4FU7A 1HAGE 3ODFA 3QWCH 2H9EH 1IQHA 4UE7H 5GIBA 1ELGA 4B2CA 1SVPA 4AGJA 1BTUA 1K22H 1Z6EA 2O8WA 1HAVA 2CXVA 2ZU3A 1O5BB 1O2GH 1E37B 3URCA 1GMCF 2UUYA 2WPLS 1BUIA 1T8LA 1KSNA 1NRRH 3R3GB 5FPSA 1L1NA 3LH1A 1EPTA 1XVMA 2H6MA 4FXGH 2WPJS 3RXOA 4NZLA 3M7QA 1CGJE 1O3JA 1DE7H 1C1MA 2XWAA 3ZVDA 3R0FA 4NIXA 1RIWB 2Y82A 1D3PB 4UFGH 2BVSH 1EAWA 3OU0A 3SBKA 3MH5A 3KGPA 2V3HH 5E0HA 1YPEH 1YC0A 4DG4A 5C3NA 3MO6A 4O3TA 1IAUA 1ZHMA 3RXIA 3MU8A 3GCTG 1XM1A 1B0FA 1GCTC 8ESTE 1Y8TA 3ZZ3A 3STIA 3SGBE 1V2NT 1GBIA 5CMXH 1G3DA 4MLFB 1TGNA 4ABAA 1EZSC 1L1GA 5F8ZA 4MDSA 4HGCA 1P2KA 1VJ9U 1CBWB 2PKAA 2PUXB 3PMBB 1AUTC 4X8UH 1O2XA 3MWIU 1IQJA 1ZGVA 4AGKA 4WJG2 2AFQB 1OWKA 1LDTT 1PPZA 2Y5GA 2CHAB 1OP2A 1C2KA 1HDTH 1C4Y2 1BQYA 1XVOA 2A45B 4Y8YA 2H9HA 3DA9B 1TRMA 1IQIA 1FMGA 1F5LA 4B73A 3M5MA 3S69A 2R2WU 1K1PA 1H1BA 4AG2A 1P11E 1A5IA 1UCYH 4KTSA 1C5OH 5JDUB 2P94A 2Q6DA 1BTZA 1AMHA 1ELFA 4BXWA 1C5PA 4INLA 1GCDA 1CT0E 3VGCC 1N8OC 4I8LA 5FX5A 1LHGH 4LOYH 5GPIB 1MQ5A 3ZZ7A 3ZVGA 2GCTB 2F9NA 4NIYA 2SGDE 1TB6H 1DANH 1NC6A 2XTTB 3RXTA 1DLKB 1SFIA 1TBRH 2JETC 3ZV8A 4NIWA 3FP7E 4FUCA 2Y5HA 1BA8B 3ESTA 4D7FA 1AY6H 2ZHWH 2OP9A 1E0FD 4CREA 3KNXA 3HK3B 5JBTA 2VB0A 1DT2A 4K60A 1YCPH 1ZGIA 5C1UA 6ESTA 3A7YA 4OS6A 3KEEA 1O35A 1WTHD 3LGIA 1Z1JA 3SV8A 3WY8A 3RC4A 3A81A 2GVFA 1TABE 2K1QA 1AE5A 2ZFSA 2BDIA 1NFWA 2ZFQH 3SGQE 1E34B 3CENA 3U1IB 1BDAA 2QY0B 2O9QA 3SW2B 2F9UA 3U69H 1O2UA 3N7OA 2OQUA 3UR6A 1UVOA 1EJMA 3URDA 8GCHF 2FS9A 1C5WB 4ABJA 2AYWA 2G8TA 3NPSA 4GCHG 3SORA 3TIUA 2XBXA 4X6NA 3SU2A 2WV5A 3QUMP 4SGAE 3RXUA 8KME2 1QCPA 3QLPH