1C5XB

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
248
structure length
248
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords PROTEIN (UROKINASE-TYPE PLASMINOGEN ACTIVATOR)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 248
sequence length 248
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5xB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5xB01
1KIGH 2VIOA 3HK3B 4XFQA 1OOKB 5C1UA 1O5CB 1UVOA 2FI4E 1GCTC 3LH1A 3LGUA 2PTNA 2QAAA 1GJBB 1T32A 2Q6DA 1F5KU 2Y80A 3T5FH 4CBOA 2W26A 2ZPSA 4XE4A 2ZHFH 5E2PA 5JB8S 3LIWA 2Z9KA 1W7XH 2KAIB 5GCHF 3SNAA 1AVGH 1MMJN 1SC8U 1Z1JA 1VJ9U 3RMLH 2R2MB 4DGJA 1A5HA 4Y0YE 2SNVA 1HAYB 5AHGH 2O8LA 2NU0E 1VZQH 2FYRA 3K2UA 2G4UA 3P8NA 1GBLA 3M35A 1GJ4H 2XW9A 3RP2A 1EOJA 2OC0A 2ZU3A 2GX4A 3URCA 3S9CA 2GMTB 1PPZA 2Y5GA 4FUJA 1QGFA 4NGAH 1WAYB 2QYIA 1K1NA 2VNTA 3M36A 1GJ5H 4X8VH 1F0UA 4ISLA 2BD7A 2G00A 2C8WB 1C1RA 2P59A 3A81A 3GY4A 3S0NA 4JZFH 3F6UH 3VXFH 1Z8GA 3SUDA 2HLCA 4CRBA 1L4ZA 3UREA 1EZUC 3RDZA 3A7YA 1O2KA 1AIXH 1BTYA 2BD3A 1RIWC 2F9UA 1DICA 1L1GA 1EZSC 3OTJE 4BAHB 2BOKA 4Z6AH 1HXFH 1BQYA 4CH2B 3UPEA 1E35B 4AG1A 3SU3A 2G52A 4KTSA 1O5FH 2ZFSA 1O3CA 5JB9S 3SORA 3SJ9A 2FMJA 4ABBA 1HDTH 1YC0A 1LQEA 1AMHA 1KXCA 3LU9B 5ABWA 1DANH 1EQ9A 1GMDG 2PLXA 3RXRA 1ZMNA 2ZPQA 1AUJA 1T4UH 5ETXA 2EI6A 4AFQA 4X6PA 1Z8RA 2ZU2A 3E6PH 2ZO3H 3IWMA 1A46H 2XC5A 4JZIA 1BHXF 3P8FA 3VB5A 2H9TH 2ZA5A 1SGEE 3BG4C 3M61U 1LKBA 1O2SA 2ZHDA 5GXPA 3ZZAA 3A83A 1QNJA 1SGFG 3RLWH 1GBKA 1P2NA 1SLUB 1GHVH 3RXQA 1O2TA 1GI6A 1FY5A 4ZUHA 2A5KA 1A1RA 3S69A 4BAOB 2ZDKA 3SBKA 1C5SA 3QTVH 3RXTA 5E2OA 1SHYA 2F9OA 3GDSA 4Q7YA 1UVUH 1GL0E 4D7GA 3ATWA 1LTOA 1O2VA 1LPKB 1JRSA 1VITH 3RXSA 1GMCF 2ODYB 1BZXE 3A87A 3RU4T 2A2XH 3ZV9A 3P8GA 1EPTB 3DT0H 1TGSZ 2OD3B 2D8WA 4ZKRU 2XCNA 1C5ZB 5F8XA 1QQ4A 3O8CA 2BLVA 2D26C 1GBTA 2C93B 2CGAA 1D4PB 1UVPA 3SU4A 1S6HA 1D6RA 4JK5A 5DP7A 1TMUH 1TX7A 1KXDA 2Y5HA 4ABFA 1AO5A 2V3OH 3URDA 4MTBA 1O2RA 1HUTH 1MAXA 1YF4A 2HOBA 5F8ZA 2ZTYA 1XUKA 3B23B 1AE8H 1DS2E 1P9UA 1Q2WA 1RXPA 2BB4A 3ZVGA 3HKIB 1GJ8B 1ANDA 2ANWA 3BEIB 4DURA 1G9IE 4AX9H 1XKBC 4XSKU 2HWLB 2J34A 2VVCA 3OY6U 2FS8A 3QTOH 1Y59T 2QGRA 1O3MA 2XWBI 9LPRA 1XUIA 2VWNA 2BDCA 4UEHH 5FBIA 3BV9B 1CGJE 5TJXA 5C1YA 4K3JA 1L0ZA 3IITA 3TJOA 3CS0A 3M3VA 1OWIA 3RXJA 2THFB 1DY8A 2ZCHP 1GJ9B 2F9PA 2JH5D 2ZC9H 4K1SA 5E0GA 6LPRA 2BLOA 1O2YA 1GBIA 1BTWA 1O5BB 3UWIA 4ZHAA 4O3TA 1ETSH 1V2LT 1WUNH 1IHTH 4I8KA 3U1JB 4DIHH 1MTNB 1WQVH 5FBEA 2FOFA 2BZ6H 3SOSA 2BQWB 1BTUA 1SQTA 2QF3A 1GI8B 4JZDH 1TLDA 2F91A 1IOEA 2ZFQH 8GCHF 1VITG 4IS5A 4QT8C 2IPHA 1OWKA 1TOCB 2XBWA 4OS2A 5T6FA 3RC6A 1EZQA 4BAQB 1MD8A 1O2WA 4MDSA 5H4IB 1CA0C 2FODA 1K1OA 4I8HA 2VWOA 1CHOF 2H2ZA 2ZKSA 2FOCA 2WYGA 4KTUA 2CN0H 4BAMB 1XUHA 1LVBA 2AFQB 5FXLA 2WPLS 4WVPE 1TYNA 3LH3A 1TPAE 1HPGA 4ABDA 2A4OA 3A8DA 4X1SU 2GVFA 4NA9H 3MH5A 3MH6A 1LQDB 2I6SA 2QV1A 1FNIA 5T3HA 1N8OB 1BB0B 4BAKB 1YPJH 1HJ8A 5GIBA 1JOUB 1CA8B 1BBRH 2GCTC 3OX7U 4D7FA 1A2CH 4DVAU 1HAVA 1MBQA 1FAXA 5TCAA 1KTSB 4ZKNU 1PPHE 4D8NA 2FI5E 3GDVA 1GHBG 4I8JA 3PMHB 1XXFA 1SBWA 3BTKE 1FDPA 4AFZA 2I6QA 4ABHA 1P2MA 3SQEE 1IQMA 2PGBB 2FOAA 1TBQH 1HAXB 3M5NA 2B0FA 3GY2A 1O2LA 5FPSA 3BSQA 2VVVA 3D62A 5F6MA 4WJG2 3SU6A 1C5UA 1YYY1 1VCPA 5C1XA 1UTPA 1SOZA 1N6YA 2ZHEH 7GCHF 3RXHA 7LPRA 5DK1A 1O2UA 1F5LA 3RXBA 4VGCB 3ZVFA 4X6NA 2AERH 2RCEA 3DHKH 1V2VT 3LT3A 2R0LA 1TNGA 1ESTA 4FUHA 5ESTE 3TH2H 4AORA 1GMHG 3A7XA 4BTIB 3BG8A 1SLXB 1YPHE 5CHAC 1GGDB 3D65E 4D9QA 4WF8A 3GCTG 1W2KH 2A4RA 2ZQ2A 2FX6A 4J1YA 1SG8B 2OC8A 1O3BA 1P02A 5A8ZA 1T8MA 4A5TS 1A0HB 2QXGA 3RC5A 2KAIA 2ZIQH 2OINA 2F83A 2JETB 3M37A 1J9CH 1GI1A 1O5DH 3QGNB 4YM9A 3ESTA 1GVZA 1QURH 2BDBA 1BBRK 3D23A 4UONA 1GHAG 2G8TA 4ABEA 1MAYA 2Z9GA 3RUOA 3QWCH 1FUJA 1KLTA 2HPQH 2FO9A 6CHAB 4ISNA 3PO1C 3A86A 1TRYA 3K9XB 1V2OT 4THNH 4BXSA 1ELEE 1UCYH 3KQBA 1YPMH 3SI3H 1O3EA 1KDQB 1OKXA 2CMYA 1Z1IA 2EI8A 3MI4A 3FAOA 2ZU1A 3W95A 3U8TH 3CENA 4H6TA 1BDAA 1PQAA 1O34A 3E8LA 4XBCA 1EJNA 3QLPH 1SOTA 2VIWA 1PYTD 1GI5A 1TA2A 5AFZH 1GJAB 5GJ4B 3KHVA 5AF9H 1C5TA 2J95A 4KELA 1YM0A 3Q77A 3M5MA 1VGCC 4ABGA 1LMWB 1UVSH 2JH6D 4Y6DA 1RS0A 3EE0B 1BRCE 2BYAX 2G81E 4K8YA 5G4BA 4YT7H 1ZGVA 3SU0A 1EKBB 4INLA 1G36A 2VGCB 1O5EH 4CHAC 1MQ6A 2VU8E 2ODQA 5SGAE 3PROA 1QFKH 4LOYH 4TYDA 3SNEA 1OYQA 1TGCA 2ZEBA 2A5AA 2PTCE 1C5XB 4XDEA 3UNRA 1H8DH 3U9AH 1TPSA 3NWUA 4B71A 2XCFA 2AMPA 2SGPE 2W3IA 3BEFB 3O8DA 3ODDA 4JYTA 3TPIZ 2FZZA 1QBOA 3UOPA 1YLDA 3LONA 4IBLH 3H5CB 3SUGA 3RXUA 1XUFA 3SHAH 2WPHS 6GCHG 3R0FA 2C90B 1RRKA 4IC5A 2HNTC 2O8MA 4Q2KA 1O2ZA 3TNTA 3UOUA 1QR3E 3MO6A 1NTPA 1EPTA 1KTTB 1W8BH 2ANMH 1UCYE 2BY9X 3Q76A 1AWFH 1LVMA 4OS7A 3LKWA 1GMHF 4NZLA 4PROA 1O3JA 3MNXA 1FY4A 1GI4A 2GTBA 1NFXA 1YBWA 5JBAS 2BY6X 1W13U 4FXGH 1P10A 1AFQC 1IQKA 3QN7A 1O2IA 1FIZA 4ZROA 3EA7A 3SU1A 1E34B 3C1KA 2GKVE 3A82A 1TABE 3GDUA 2UWOA 3ZZ4A 1UTOA 2UUFB 3F9HA 3T27A 1O33A 3BTQE 1OWEA 2ESTE 1GJCB 1YKTA 2Y7ZA 3SZNA 1SLWB 4B2AA 4IN1A 3RXVA 1GBEA 1QBNA 1TA6A 4OS1A 3U1IB 1WU1A 2FEQH 4U2WA 3TIUA 2TGDA 1FAKH 2W3KA 1F7ZA 3GISB 1PPFE 2OTVA 4NIXA 1QJ7B 1LCYA 1O2QA 2BVXH 3PV4A 4LXBH 1DVAH 1DT2A 4D9RA 3QUMP 3S9BA 1V2JT 1Y3YA 1IQLA 1GBAA 3P17H 3O8RA 4SGBE 1AI8H 4H6SB 1V6DA 5JBCS 1BUIA 1KLJH 1RTLA 4KTCA 1ZJKA 2GMTC 1GG6B 1PJPA 4MVNA 3BEUA 1ESBA 1BMLA 2DUCA 1J16A 1FI8A 1O35A 1O30A 1V2QT 1O38A 4NWLA 4XOJA 5DP6A 3ZV8A 3Q00A 2C4FH 3ZZDA 5A09A 1C1QA 3BTME 1RJXB 1ZYOA 4X8TH 3TGIE 2QC2A 3SJIA 4DY7B 4AYYB 4B76A 1L1JA 1ZMLA 4UFFH 1C5WB 4OGYA 5AVDA 2QXJA 2ZDMA 1BHXB 1O3DA 1P2QA 2XYAA 1P3CA 1E37B 4E06H 5CE1A 4WY3A 5L30H 2HGTH 5C2ZA 4J2YB 1C5MD 3ATKA 2ASUB 3RXIA 1V2ST 1H9LB 2ZCKP 1AGJA 1P57B 2AIQA 3MNBA 2Q1JA 1ETTH 1CHGA 1XKAC 3ZVAA 1HB0B 4GHTA 2H9EH 1UMAH 2ZWLH 1RD3B 3MU5A 3S9AA 2P3TB 4WXIA 1DSTA 1GI9B 1LDTT 1ABJH 5K7RA 2H5CA 1D6WA 1KXAA 2FDAA 3BIUH 1N1LA 2HVXA 4FVDA 4NA8A 5BPEA 1XVMA 2ZFRH 2ZTXA 2FESH 1YPGH 3FANA 1Y3WA 3ENSB 3LJJA 1G2LA 2VH6A 3T28A 2WPJS 1SGNE 3ZYEA 1MUEB 1QL9A 2G55A 2SNWA 1LVOA 4IW4E 1GDQA 1GVLA 1V2MT 1KLIH 1ZRKA 1BA8B 5JYIA 1Z8JB 2Y5FA 2K1QA 3GYLB 4NIVA 1SFIA 2YNAA 2ALVA 4U32A 1S0QA 1YPLH 3T25A 1SB1H 1UK4A 4CR9A 2BLWA 4A7IB 1CE5A 2OUAA 3KQEA 1C1MA 3SQHE 3VPKA 3HKJB 1TX8A 1DY9A 1EPTC 2TRMA 1UTQA 2AMQA 1QHRB 1G37A 3ATIA 1LVYA 1T8OA 3E0NB 3MU1A 3RXCA 1OP8A 1QB9A 1Z8IB 3VEQB 2Y81A 1BIOA 4I33A 4K2YA 2XBYA 2NU4E 1G32B 3LJOA 1QIXB 1Y5BT 5DP3A 3ZZ8A 2CF9H 4ISHH 2BTCE 2FIRH 2Z3EA 2AGGX 4YESB 4AB8A 1BITA 1DE7H 1UK2A 1P0SH 5EXNA 1ZSJA 3V3MA 1AE5A 1LPZB 3ZZ3A 2D2DA 1AZZA 1SGIB 2TPIZ 2VINA 4AN7A 5B6OA 1YCPM 1O2NA 1BJVA 4Y8YA 2Y7XA 2BDGA 3A7WA 1ZPCA 1XX9A 1MH0A 4DG4A 2J38A 4YZUA 3KQDA 4U30A 5DG6A 3KQCA 1BTHH 2ZQ1A 4YLUA 1QQUA 3M3SA 3NUMA 1KDQA 1DX5M 1ZPZA 2FP7B 1LHGH 2RG3A 1G3EA 1A5IA 2ZNKH 2C8ZB 1J14A 4IMQA 1Y5UT 1W14U 4M7GA 1WTGH 1CVWH 1W3CA 4TPIZ 2V35A 2SGAA 4F49A 1EP5A 1TGBA 1QB1A 2UWLA 5LPRA 4NIYA 5DO4H 1C2KA 1M9UA 1MKXK 4ZKOU 3UNSA 4TY6A 3RMOH 1A61H 3T29A 2GT7A 4K5ZA 4MNWA 2HALA 1Y8TA 3ELAH 1MTNC 1IQHA 3FP6E 3MH7A 1BMMH 5C67A 2IN2A 3DD2H 2GGVB 1XM1A 3SU5A 3L3TA 1PQ8A 4O03A 4Y8XA 1TQ0B 3TGJE 1C2GA 5EXLA 1O3LA 1DWBH 5FX6A 3MTYA 1ESAA 2EEKA 3Q3XA 1TMBH 4FUBA 2FOEA 4YOGA 1ZPBA 3MNCA 4YTAA 2BD9A 2GCHG 5E0HA 3TH4H 2PKSB 2H1UA 3FFGA 4A1VA 1K9OE 1QBVH 1C5QA 1F2SE 1N6XA 1XMNB 1AVXA 2NU3E 3RXGA 4ESTE 1N8OC 1A5GH 1ELBA 2BMGB 4RKOB 2GZ9A 4AYVB 2V6NA 1EJAA 4CR5A 2OCVB 1H9HE 2O9QA 3ATLA 3GCNA 1SMFE 1EAXA 1D9IA 3OY5U 5IYTA 1GVKB 1CQQA 4GPGA 3UQOA 1O32A 4MPUA 3VGCB 4BTTB 1TX6A 1BRUP 4TWWA 1LPGB 1P8VC 4I32A 5L6NH 1OWJA 1TONA 3QGJA 1G30B 2CHAB 2BLQA 4NA7A 4Y71A 2YOLA 3F9EA 3QX5H 1GMDF 1P04A 5EG4A 3E0PB 1S85A 5FPYA 1NFYA 2OC1A 3LGIA 3TJVA 4BNRA 3BTWE 2ZFTA 1TFXA 4JCNA 4VGCC 1CGHA 1CBWB 1SHHB 1WSSH 1HJAB 4GSOA 1NRNH 1ORFA 1YGCH 1C2EA 1VCQA 4CH8B 1C1NA 1FY3A 1BOQA 1TRNA 2EI7A 1IQFA 2A7CA 2GZ7A 1CO7E 1GGDC 1PFXC 1BTXA 1SGTA 5DP4A 3SGQE 1AVWA 4Y0ZE 1V2WT 1C2HA 3F9FA 4JYVH 3W94A 1RTFB 3RXFA 3ZVBA 1S84A 3P70B 1F92A 3MU4A 2GV7A 3ZYDA 1S6FA 2ZZUH 4UFDH 2A4GA 2XRCA 3LGYA 1L2EA 1TNKA 3F1SB 2FOHA 1GBFA 1AZ8A 2JETC 4NWKA 1XXDA 1O5AB 3SJOA 1C5OH 3DUXH 2CV3A 2OQ5A 3KIDU 1GJ7B 2ZHQH 1MCVA 3V0XA 4HI3A 4UD9H 2Q6FA 1AU8A 3M5LA 1UTKA 1MD7A 4OS5A 1Z7KA 6CHAC 2OXSA 3KGPA 3MH4A 5J4QA 3U8OH 1QY6A 3PLKA 2A2QH 1PPCE 3V12A 1NY22 1UTNA 2FTLE 2UWPA 4WMEA 5GWZA 3IG6B 1P2IA 1P2JA 5I25A 1O37A 1K28D 1EXFA 1TE0A 3B9FH 1S83A 1DWEH 2FPZA 2VVUA 2ZP0H 1UTJA 1EJMA 2BY7X 1ZGIA 4X1PU 1O2PA 1FN8A 1TPOA 1C2MA 1BTZA 1DSUA 4FUCA 2O8WA 3LOXA 1EASA 2VIDA 4RSPA 1H1BA 5PTPA 1NFUA 2ZGHA 3KL6A 5EW2H 1Q3XA 4ZXYH 5FHTA 5J4SA 4TY7A 3PLBA 4Y11E 4CBNA 3RC4A 3A8BA 1DM4B 2VGCC 2P94A 3FZZA 1FONA 3ZZCA 8ESTE 2BQ7B 4GCHG 3PMAB 3SV9A 1ABIH 1H8IH 3MU0A 3SU2A 5JBTA 1BBRE 2FOMB 2D1JA 1E36B 3KEEA 2STAE 4ZXXH 1TALA 5EPYA 4WXVA 4YT6H 3LGWA 2AIPA 4TWYA 1YLCA 3F68H 4X1QU 1BTPA 4RKJB 1V2PT 2IJOB 4B74A 2B8OH 1CT0E 1HIAB 4JZEH 4WMFA 3MFJA 3STIA 1VITF 2P93A 4MPWA 3T26A 3F9GA 1NU7B 5EOKA 2G51A 1GI0A 1NT1A 3RU4E 2VIQA 3EQ0H 4GUXA 1V2KT 2Z3CA 3TK6A 1PQ7A 2B5TB 4Y76A 1WCZA 4WWYA 1TMTH 1QRZA 1YP9A 4I8GA 1ELDE 1HGTH 3VB7A 1UK3A 1G3CA 1MTUA 4I8LA 4CRGA 1ELAA 2A7JA 1TRMA 1C1SA 2ZGBH 2GDEH 1XUGA 3M7UA 4X1RU 2UUKB 1TOMH 1DWCH 1GBDA 3N7OA 2W7UA 3RMMH 3HK6B 1YPEH 1GHBF 4CRDA 1GJDB 1ZMJA 2AYWA 1NESE 4NSYA 4A1XA 1FPHH 1OS8A 2P8OB 1GI7B 1T8NA 3QDZB 3RXMA 2J2UA 1A0LA 3B8JA 3D49H 3PO1B 4R8TB 1LO6A 2PV9B 1SGCA 3KN2A 1O2OA 1C1WH 3P92A 1O5GH 3SV8A 1D3QB 5EQQA 1OXGA 1OP2A 1O3NA 5GDSH 1D3DB 2WUBA 3BTFE 1UHBB 4Y10E 2TGAA 5GCHG 3JZ2B 1O3KA 1NS3A 4KGAA 2GP9B 1ZOMA 3OU0A 4YLQH 1D3TB 2BD5A 3GCHB 1C2LA 1WOFA 3PTNA 1GI3A 1MU6B 3GOVB 1SGPE 3UFAA 3TU7H 2NWNA 3MO9A 3EAJA 1HAPH 2HNTE 2BOHB 1RFNA 1GDUA 1KXBA 1NROH 2CXVA 3NZIA 3GCTF 2B9LA 1FV9A 1C2IA 4DW2U 2VJ1A 1EAUA 3VB6A 2ZG0H 2Z7FE 1NZQH 1JMOH 4ABJA 1JIRA 1O3HA 2WYJA 1ANBA 2ZGXH 1RGQA 1AB9B 1ZSLA 3MNSA 2Z9JA 3BIVH 3ZVCA 3TNSA 3UR9A 3SJ8A 4DJZB 4FU7A 2PR3A 1GG6C 4BTUB 3NKKA 1ACBE 4UFGH 2LPRA 2W5EA 3RXKA 2ZI2H 3ODFA 1C9PA 4B2BA 1BRBE 2ZDVH 1O36A 1Y3XA 2QXHA 2R3YA 2H9HA 4K69A 4H4FA 3M7TA 1HBTH 2QIQA 3AW1A 1GHAF 3VB3A 4MPXA 5DGJA 1THPB 1Z6JH 5DP5A 2WPIS 4LZ1H 1B5GH 4B1TA 1GI2A 5FPTA 2OBOA 1QTFA 1GJ6A 1C4Y2 2BX3A 3P95A 4TPYA 3RMNH 1P12E 2WV5A 4K1TA 2DE8A 3GY6A 4KKDA 1ETRH 4YOJA 1C5PA 4YO9A 2Y82A 3SUEA 4Y7AA 5DPAA 3A8AA 2SGDE 1G3DA 4AGKA 3A84A 1SQOA 5L2ZH 1QA7A 1ELTA 2FS9A 4AOQA 4DOQA 4X0WU 5I46H 1S82A 4MNYA 1DLKB 2FOGA 4OS4A 3MO3A 4FUEA 1BT7A 1SL3A 3RXAA 1C2JA 4ABAA 2FM2A 4NIWA 3UR6A 1DXPA 1W7GH 2ZTZA 1IAUA 1EX3A 1K1JA 1C5LH 3TK9A 2XC4A 1GBJA 3GY5A 5JBBS 1ZTKA 3NK8A 2AS9A 1GMCG 3Q3KA 3Q3YA 1BRAA 1AN1E 3QO6A 4MNXA 2CF8H 1BMNH 2TBSA 5HYOA 1QRXA 1QJ6B 2ZPRA 4ISIH 4YOIA 1QL8A 3VB4A 1FMGA 7KMEH 1S0RA 2XWAA 4CREA 4MQAA 1MKWK 1LKAA 3SHCH 1GHXH 1W11U 1B7XB 1J8AA 4FUIA 1WTHD 3ITIA 4ZH8A 1B0FA 3BTGE 3M7QA 1AFEH 5LPEA 3RXOA 1CGIE 4MG3A 3DA9B 2ZGJA 2FLBH 1C5NH 3A88A 2UUJB 6GCHF 1EB1H 3TJNA 1HAOH 1DPOA 1ARBA 8KME2 3AVZA 2C8XB 2BY8X 2QA9E 3HGPA 1DUAA 1IQIA 1ANCA 2F9BH 6ESTA 1EAWA 1HYLA 2BQ6B 2W7SA 4INHA 2CJIA 4SGAE 2BM2A 1KSNA 5IDKA 1J15A 2PGQB 2VB0A 3SO3A 4E7RG 2JH0D 1TPPA 3KCGH 1JWTA 3PTBA 1LHFH 2HNTF 4NZQA 2RA0A 3I78A 4ISOA 1Y3VA 1MKXH 2ZU5A 2IOTA 1DOJA 2R2WU 3STJA 3P8OA 1O2GH 3H7TA 1NRSH 5HM9A 5A2MH 1QJ1B 4JK6A 5BRRE 1EUFA 1THRH 2PFEA 3V7TA 1MU8B 3RU4D 1C1VH 4AFUA 1MQ5A 3BN9A 1GCTB 1QRWA 4ZAEA 2PKAB 4ZHLU 5EU8A 4B2CA 2ZFFH 3QZRA 2VIVA 1O3GA 5JPMH 2WPMS 1ELVA 1O3AA 1A7SA 1P2KA 1T8LA 4Z0KA 1ZRBA 3V13A 2TIOA 1NPMA 4HGCA 3O8BA 4GAWA 8GCHG 2F9VA 1C5RA 2XXLA 4NG9H 1AD8H 4BANB 2ANYA 1ZTJA 4E7NA 2R0KA 3EA8A 3K6YA 1GPZA 1CHOG 5HGGA 1FN6A 1ANEA 3E3TA 5ESBA 1P9SA 1MTVA 1RTKA 1NU9A 1V3XA 1GHYH 3E1XB 5A0CA 2Z3DA 2VWMA 4MPVA 1VJAU 2OC7A 2EA3A 2FX4A 2NU1E 4IN2A 4IMZA 1O2JA 2ZHWH 1XUJA 2BXTH 3MU8A 1DXWA 1C4U2 2O8UA 1DUEA 1GHWH 3NXPA 3MYWA 2P3FH 4AFSA 1PYTC 1HIAA 3L33A 2H5DA 1KY9A 1SSXA 4ZKSU 1EZXC 2PKSC 3GY7A 4Y8ZA 4X2WA 4K60A 3E91A 1RIWB 3PYHA 3ZZ6A 1HAHH 3K65B 3UIRA 5T6GA 2BX4A 3PB1E 1P01A 2BDAA 1VR1H 3GY3A 2OP9A 1LHCH 1O3OA 4MNVA 3H7OA 1NC6A 2GZ8A 5A8XA 2SGQE 2PWXA 1EB2A 3QZQA 3BTDE 4X8UH 3A7ZA 1P09A 4D76A 3NPSA 4UFEH 4HTCH 1SGQE 1JRTA 2A0QB 4X2XA 3BTEE 3ZZ5A 5HXFA 3VGCC 1CT2E 4DT7B 1HXEH 2ZDNA 3ZZ9A 7GCHG 2VIPA 1T4VH 1C1UH 3SNBA 2CHAC 1H4WA 3TJUA 1AKSB 2RA3A 1YCPH 5EQRA 3BG4B 1V2UT 3K6ZA 1F5RA 3A7TA 1C2FA 3AW0A 4INKA 2STBE 2A45B 1MTSA 3VXEH 1K1MA 4B73A 2ZU4A 1G2MA 1TGTA 1W0YH 3PLPA 3A8CA 1CBWC 1T7CA 2TGTA 4NFFA 1HJAC 1D3PB 2Y6TA 1T31A 4IGDA 4AZ2B 3ATMA 1QCPA 1JIMA 1QB6A 2R3UA 1IQEA 1HAIH 1UVTH 2AH4X 4FUFA 1P06A 1W0ZU 4WH6A 1UHBA 4DCDA 4Q7ZA 1F0RA 7ESTE 3U98H 2ODPA 1A4WH 4U01A 3EYDA 3RM0H 5EW1H 1EP6A 3OYPA 1HAGE 2F9NA 1TBZH 1XVOA 2A1DB 1FY8E 1JXPA 1PPGE 2R9PA 1P11E 3GCOA 1PPEE 4BOHA 3SV2H 1KYNA 2QXIA 3E16B 1GDNA 3NCLA 4IC6A 2ILNA 3ZVDA 3KF2A 2FLRH 3LDXH 1Q31A 2Z94A 2JKHA 2XBXA 1SGDE 4CRCA 1ZLRA 4JMYA 5EODA 2C3SA 1O0DH 1ZHPA 2BXUH 3A89A 1SPJA 1HCGA 2HRVA 2SFAA 3U69H 2BDYA 3M3TA 1C5VA 1TNHA 2ALPA 4DIIH 1SGYE 4RN6A 1DFPA 2FTMA 5GPIB 2V0BA 4O9VA 1HRTH 2PUQH 3M5OA 3QK1A 2GV6A 2VWLA 2A7HA 1YCPK 2BVSH 2QY0B 1TNIA 3SUFA 1O3PB 4FVBA 5K0HA 5E8EH 2LNCA 2OLGA 1F0SA 4X6OA 3UWJH 4CRAA 2P3UB 1O39A 1A0JA 4AB9A 1ELCA 4A1TA 1O31A 2EC9H 5T6DA 2BD8A 3L6PA 2RDLA 3U8RH 2PSYA 1OWDA 1GBHA 5FCRA 1IQJA 1C5YB 1MZAA 2WV4A 2QN5T 2Q6GA 1E38B 4LZ4B 4R0IA 3AASA 1P2OA 1SLVB 4JZ1A 5E0JA 2Z9LA 1WV7H 3FP7E 2AGEX 4UE7H 3TVJB 1WQSA 1GCDA 5C3NA 5C5NA 1S81A 2ZF0H 4E05H 2ZCLP 3ZVEA 4O3UA 3TH3H 3SGAE 3SN8A 2BD4A 3LC5A 4FU8A 4GVUA 4Y79A 1CA0B 1ZHMA 1DLEA 3PMBB 4OGXA 1YPKH 1TQ7B 1TWXB 3SJKA 1V2TT 1HFDA 2BDIA 3RM2H 5A0AE 3SV6A 1FY1A 2BZAA 3HPTB 5JDUB 1H9IE 3CS7A 1MBMA 1YPHC 1U6QA 1C4V2 1GBBA 4FU9A 1ELGA 2QF0A 4KP0A 1AHTH 2SGFE 1AQ7A 1L4DA 2FI3E 4HFPB 2J94A 2GCTB 1TAWA 4X1NU 2GCHF 3LGTA 1SGRE 3HGNA 2A4QA 2OQUA 1SFQB 1C1OA 3TLOA 3RXPA 3UY9A 5EGMA 3A85A 5A0BA 2XBVA 1GWAA 3HATH 1K1LA 1K2I1 1K1IA 1IQGA 2FYQA 5C5OA 1P05A 3FP8E 1WYKA 4Q80A 5A8YA 1ZJDA 3LGVA 1K21H 4OS6A 3SV7A 1IHSH 3MOCA 2UUYA 1TBRH 2GD4B 5DJ7A 2AMDA 4ASHA 4ZMAH 1P3EA 2DE9A 2WINI 2G5NA 3LC3A 2ZDLA 1Y5AT 1C1PA 1KXFA 2Z6BD 1UJ1A 4O97A 1OWHA 4XBDA 3TITA 5DP9A 3S7HB 5EXMA 1BCUH 2NU2E 2P8OC 1ZZZA 2GDDA 1EOLA 3TK5A 1C9TA 3PWCA 4FUGA 3C27B 4NSVA 1Z71A 1UTMA 2ZECA 2F3CE 3PWBA 1CSOE 3EGKH 4JYUH 3R3GB 5EPNA 2XTTB 2TGPZ 1TNJA 1SI5H 1TGNA 3MMGA 5CHAB 4X8SH 1J17T 3GCHC 3MHWU 2M5TA 4AGJA 2PKAA 3KNXA 5FCKA 3E90B 1O3IA 3OSYA 4X2YA 2J4IA 2C8YB 3EDXB 1HV7A 3S7KB 1DITH 3G01A 1FZZA 2GT8A 3GICB 3GY8A 2WPKS 4Y7BA 2BD2A 1ZTLA 8LPRA 2XNIA 5F03A 1GHZA 1DWDH 1O2MA 1GBCA 4WMDA 1AB9C 1NN6A 3SGBE 3I77A 1ZR0A 1SR5C 2PSXA 4GHQA 4H42U 2A5IA 1VCWA 2O8TA 2AGIX 2FXRA 2XC0A 2VH0A 1CU1A 1NFWA 1WBGB 1ARCA 1THSH 1OX1A 1AY6H 1K22H 3A80A 3DFLA 4NCYA 3FVFB 1V2RT 2WUCA 1W12U 3RXEA 2ZFPH 3FZDA 1SVPA 1ELFA 1K1PA 1O3FA 1V2NT 3A7VA 3ZZ7A 1C1TA 3AAUA 1NRQH 1HLTH 4K1EA 5FX5A 1P03A 2BDHA 1FLEE 3LPRA 4F4OC 3CP7A 1QA0A 2FWWA 2P16A 3VFEA 3UQVA 1VGCB 2BVRH 2ZGCA 1UCYK 1BMAA 1ID5H 1ZSKA 5F8TA 1TNLA 1UO6A 1MKWH 3T2NA 4CHAB 5LGOA 1A3BH 1EAIA 2OBQA 5LPFA 1LHEH 2BHGA 4A6LA 5HMAA 2G5VA 5TCCA 1SGFA 4CRFA 3SNDA 1NRRH 5HM2A 1X7AC 3GYMA 1O2XA 3SW2B 3I29A 1AKSA 3RXLA 3RXDA 1A3EH 1OPHB 4X6MA 2A31A 1FQ3A 1FXYA 2B7DH 4GCHF 4B75A 5AFYH 1IQNA 1OSSA 3P6ZB 1TIOA 4Q7XA 1PQ5A 1G3BA 2BY5X 1TB6H 3JZ1B 2AEIH 5DP8A 1AWHB 1QL7A 4GLYA 1MZDA 5DKMA 1ZHRA 4BXWA 5C20A 4AG2A 2ZDAH 3SI4H 3AAVA 2YNBA 1HNEE 1W10U 4X2VA 1PPBH 4XBBA 2PHBA 3SNCA 2H6MA 1DDJA 1Z6EA 2ULLA 1O2HA 4K8BA 1GBMA 3T62A 1HAVB 3ZZBA 3EA9A 4ABIA 2HPPH 3PM3A 1LHDH 1B0EA 1Y3UA 2PUXB 4A92A 2A32A 4I7YH 2J92A 2QCYA 5EQSA 2SGEE 2V3HH 4ZHMU 3UNQA 4MLFB 1F0TA 4UDWH 1EATA 5L2YH 1NO9H 1FPCH 3PMJA 3BTHE 2Z9IA 1FJSA 1BJUA 2P95A 9ESTA 4WH8A 1NM6A 2PW8H 4HZHA 3RLYH 4LK4A 1AFQB 3WY8A 3MWIU 1E0FD 2ANKH 1MCTA 1AUTC 1S5SA 5FAHA 1L1NA 5LH8A 1CT4E 1OP0A 2G4TA 1FIWA 2J9NA 2FOBA 3BF6H 1HAZB 3DFJA 1GL1A 1MTWA 1OYTH 1SQAA 3BTTE 1HJ9A 1JBUH 1NRPH 3UTUH 3UUZA 3TGKE 1INCA 4NFEA 5CMXH 4FUDA 1C2DA 1UTLM 4I31A 1KXEA
chains in the Genus database with same CATH superfamily
1KIGH 2VIOA 3HK3B 4XFQA 1OOKB 5C1UA 1O5CB 1UVOA 2FI4E 1GCTC 3LH1A 3LGUA 2PTNA 2QAAA 1GJBB 1T32A 2Q6DA 1F5KU 2Y80A 3T5FH 4CBOA 2W26A 2ZPSA 4XE4A 2ZHFH 5E2PA 4ZCNA 5JB8S 3LIWA 2Z9KA 1W7XH 2KAIB 5GCHF 3SNAA 1AVGH 1MMJN 1SC8U 1Z1JA 1VJ9U 3RMLH 2R2MB 4DGJA 1A5HA 2YMSC 4Y0YE 2SNVA 1HAYB 5AHGH 2O8LA 5EJLA 2NU0E 1VZQH 2J98B 2FYRA 3K2UA 2G4UA 3P8NA 1GBLA 3M35A 1GJ4H 2XW9A 3RP2A 1EOJA 2OC0A 2ZU3A 2GX4A 3URCA 3S9CA 2GMTB 1PPZA 2Y5GA 4FUJA 1QGFA 4NGAH 1WAYB 2QYIA 1K1NA 2VNTA 3M36A 1GJ5H 4X8VH 1F0UA 4ISLA 2BD7A 2G00A 2C8WB 1C1RA 2P59A 3A81A 3GY4A 3S0NA 4JZFH 3F6UH 3VXFH 1Z8GA 3SUDA 2HLCA 3PV2A 4CRBA 1L4ZA 3UREA 5IK2D 1EZUC 2QE7D 3RDZA 3A7YA 4ACBA 1O2KA 1AIXH 1BTYA 2BD3A 1RIWC 2F9UA 1DICA 1L1GA 1EZSC 3OTJE 4BAHB 2BOKA 4Z6AH 1HXFH 1BQYA 4CH2B 2F43B 3UPEA 1E35B 4AG1A 3SU3A 2G52A 4KTSA 1O5FH 2ZFSA 1O3CA 5JB9S 3SORA 3SJ9A 3PV5A 2FMJA 4ABBA 1HDTH 1YC0A 1LQEA 1AMHA 1KXCA 3LU9B 5ABWA 1DANH 1EQ9A 1GMDG 2PLXA 3RXRA 1ZMNA 2ZPQA 1AUJA 1T4UH 5ETXA 2EI6A 4AFQA 4X6PA 1Z8RA 2ZU2A 3E6PH 4P00A 2ZO3H 3IWMA 1A46H 2XC5A 4JZIA 1BHXF 3P8FA 3VB5A 2H9TH 2ZA5A 4F55A 1SGEE 3BG4C 3M61U 1LKBA 1O2SA 2ZHDA 5GXPA 3ZZAA 3A83A 1QNJA 1SGFG 3RLWH 1GBKA 1P2NA 1SLUB 1GHVH 3RXQA 1O2TA 1GI6A 1FY5A 4ZUHA 2A5KA 1A1RA 3S69A 4BAOB 2ZDKA 3SBKA 1C5SA 3QTVH 3RXTA 5E2OA 1SHYA 2F9OA 3GDSA 4Q7YA 1UVUH 1GL0E 4D7GA 3ATWA 1LTOA 4XRNA 1O2VA 1LPKB 1JRSA 1VITH 3RXSA 1GMCF 2ODYB 1BZXE 3A87A 3RU4T 2A2XH 3ZV9A 3P8GA 1YY3A 1EPTB 3DT0H 1TGSZ 2OD3B 2D8WA 4ZKRU 3F2HA 2XCNA 1C5ZB 5F8XA 1QQ4A 3O8CA 2BLVA 2D26C 1GBTA 2C93B 2CGAA 1D4PB 1UVPA 3SU4A 1S6HA 1D6RA 3PRDA 4JK5A 5DP7A 1TMUH 1TX7A 1KXDA 2Y5HA 4ABFA 1AO5A 3FO8D 2V3OH 3URDA 4MTBA 1O2RA 1HUTH 1MAXA 1YF4A 2HOBA 2L74A 5F8ZA 2ZTYA 1XUKA 3B23B 1AE8H 1DS2E 1P9UA 1Q2WA 1RXPA 2BB4A 2XOKD 3ZVGA 3HKIB 1GJ8B 1ANDA 2ANWA 3BEIB 4DURA 2K0QA 1G9IE 4AX9H 1XKBC 4XSKU 2HWLB 2J34A 2VVCA 3OY6U 2FS8A 3QTOH 1Y59T 2QGRA 1O3MA 2XWBI 9LPRA 1XUIA 2VWNA 2BDCA 3OE7D 4UEHH 5FBIA 3BV9B 1CGJE 5TJXA 5C1YA 4K3JA 1L0ZA 3IITA 3TJOA 3CS0A 3M3VA 1OWIA 3RXJA 2THFB 1DY8A 2ZCHP 1GJ9B 2F9PA 2JH5D 2ZC9H 4K1SA 5E0GA 6LPRA 2BLOA 1O2YA 1BTWA 1GBIA 1O5BB 1UW7A 3UWIA 4ZHAA 4O3TA 1ETSH 1V2LT 1WUNH 1IHTH 2XNDD 4I8KA 3U1JB 1MTNB 1WQVH 5FBEA 2FOFA 2BZ6H 2J97A 3SOSA 4DIHH 5F53A 2BQWB 1BTUA 1SQTA 2QF3A 1GI8B 4JZDH 1TLDA 2F91A 1IOEA 2ZFQH 8GCHF 1VITG 4IS5A 4QT8C 2IPHA 1OWKA 1TOCB 2AHME 2XBWA 4OS2A 5T6FA 3RC6A 1EZQA 4BAQB 1MD8A 1O2WA 4MDSA 5H4IB 1CA0C 2FODA 1K1OA 4I8HA 2VWOA 1CHOF 2H2ZA 2ZKSA 2FOCA 2WYGA 4KTUA 2CN0H 4BAMB 1XUHA 1LVBA 2AFQB 5FXLA 2WPLS 4WVPE 1TYNA 3LH3A 1TPAE 1HPGA 4ABDA 2A4OA 3A8DA 4X1SU 2GVFA 4NA9H 3MH5A 3MH6A 3PRBA 1LQDB 2I6SA 2QV1A 1FNIA 5T3HA 1N8OB 1BB0B 4BAKB 1YPJH 1HJ8A 5GIBA 1JOUB 1CA8B 2WSSD 1BBRH 2GCTC 3OX7U 4D7FA 3F0OA 1A2CH 1S6LA 4DVAU 1HAVA 1MBQA 1FAXA 5TCAA 1KTSB 4ZKNU 1PPHE 4D8NA 1K0HA 2FI5E 3GDVA 1GHBG 4I8JA 3PMHB 1XXFA 1SBWA 3BTKE 1FDPA 4AFZA 2I6QA 4ABHA 1P2MA 5T1VA 3SQEE 1IQMA 1W0JD 2PGBB 2FOAA 1TBQH 1HAXB 3M5NA 2B0FA 3GY2A 1O2LA 5FPSA 3BSQA 2VVVA 3D62A 5F6MA 4WJG2 3SU6A 1C5UA 1YYY1 1VCPA 5C1XA 1UTPA 1SOZA 1N6YA 2ZHEH 7GCHF 3RXHA 7LPRA 5DK1A 1O2UA 1F5LA 3RXBA 4VGCB 3ZVFA 4X6NA 2AERH 3F2GA 2RCEA 3DHKH 1V2VT 3LT3A 2R0LA 1TNGA 1ESTA 4FUHA 5ESTE 3TH2H 4AORA 1GMHG 3A7XA 4BTIB 3BG8A 1SLXB 1YPHE 5CHAC 1GGDB 3D65E 4D9QA 4WF8A 3GCTG 1W2KH 2A4RA 2ZQ2A 2FX6A 4J1YA 1SG8B 2OC8A 1O3BA 1P02A 5A8ZA 1T8MA 4A5TS 1A0HB 2QXGA 3RC5A 2KAIA 2ZIQH 2OINA 2F83A 2JETB 3M37A 1J9CH 1GI1A 1O5DH 3QGNB 4YM9A 3ESTA 1GVZA 1QURH 2BDBA 4AC9A 1BBRK 3D23A 4UONA 1GHAG 2G8TA 4ABEA 1MAYA 2Z9GA 3RUOA 3QWCH 1FUJA 1KLTA 2HPQH 2FO9A 6CHAB 4ISNA 3PO1C 3A86A 1TRYA 3K9XB 1V2OT 4THNH 4BXSA 1ELEE 1UCYH 3KQBA 1YPMH 3SI3H 1O3EA 1KDQB 1OKXA 2CMYA 1Z1IA 2EI8A 3MI4A 3FAOA 2ZU1A 3W95A 3U8TH 3CENA 4H6TA 1BDAA 1PQAA 1O34A 3E8LA 4XBCA 1EJNA 3QLPH 1SOTA 2VIWA 1PYTD 4FOUC 1GI5A 1TA2A 1H8HD 5AFZH 1GJAB 5GJ4B 3KHVA 5AF9H 1C5TA 2J95A 4KELA 1YM0A 3Q77A 3M5MA 1VGCC 4ABGA 1LMWB 1UVSH 2JH6D 4Y6DA 1RS0A 3EE0B 1BRCE 2BYAX 2G81E 4K8YA 5G4BA 4YT7H 1ZGVA 3SU0A 1EKBB 4INLA 1G36A 2VGCB 1O5EH 4CHAC 1MQ6A 2VU8E 2ODQA 5SGAE 3PROA 1QFKH 2KFWA 4LOYH 4TYDA 2WV9A 3SNEA 1OYQA 1TGCA 2ZEBA 2A5AA 2PTCE 1C5XB 4XDEA 3UNRA 1H8DH 3U9AH 1TPSA 3NWUA 4B71A 2XCFA 2AMPA 2SGPE 2W3IA 3BEFB 3O8DA 3ODDA 4JYTA 3TPIZ 2FZZA 1QBOA 3UOPA 1YLDA 3LONA 4IBLH 2W6ID 3H5CB 3SUGA 3RXUA 1XUFA 3SHAH 2WPHS 4TSFD 6GCHG 3R0FA 3W1EA 2C90B 1RRKA 4IC5A 2HNTC 2O8MA 4Q2KA 1O2ZA 3TNTA 3UOUA 3WWFA 1QR3E 3MO6A 1NTPA 1EPTA 1KTTB 1W8BH 2ANMH 1UCYE 2BY9X 3Q76A 1AWFH 1LVMA 3EE7A 4OS7A 3LKWA 1GMHF 4NZLA 2PP6A 4PROA 1O3JA 3MNXA 1FY4A 1GI4A 2GTBA 1NFXA 1YBWA 5JBAS 2BY6X 1W13U 4FXGH 1P10A 1AFQC 1IQKA 3QN7A 1O2IA 1VKYA 1QZ8A 1FIZA 4ZROA 3EA7A 3SU1A 1E34B 3C1KA 2GKVE 3A82A 1TABE 3GDUA 2UWOA 3ZZ4A 1UTOA 2UUFB 3F9HA 3T27A 1O33A 3BTQE 1OWEA 2ESTE 1GJCB 1YKTA 2Y7ZA 3SZNA 1SLWB 4B2AA 4IN1A 3RXVA 1GBEA 4Q63A 1QBNA 1TA6A 1SKYE 4OS1A 3U1IB 4TT3D 1WU1A 2FEQH 4U2WA 3TIUA 2TGDA 1FAKH 2W3KA 1F7ZA 5KECA 3GISB 1PPFE 2OTVA 4NIXA 1QJ7B 1LCYA 1O2QA 2BVXH 3PV4A 1OHHD 4LXBH 1DVAH 1DT2A 4D9RA 1BMFD 3QUMP 3S9BA 1V2JT 1Y3YA 1IQLA 1GBAA 3P17H 3O8RA 4SGBE 1AI8H 4H6SB 1V6DA 5JBCS 1BUIA 1KLJH 1RTLA 4KTCA 1ZJKA 2GMTC 1GG6B 1PJPA 4MVNA 3BEUA 1ESBA 2EQNA 1BMLA 2DUCA 1J16A 1FI8A 1O35A 1O30A 1V2QT 1O38A 4NWLA 4XOJA 5DP6A 3ZV8A 3Q00A 2C4FH 3ZZDA 5A09A 1C1QA 3BTME 1RJXB 1ZYOA 4X8TH 3TGIE 2QC2A 3SJIA 4DY7B 4AYYB 4B76A 1L1JA 4Q4LA 1ZMLA 3N7DA 4UFFH 1C5WB 4OGYA 5AVDA 2QXJA 2ZDMA 1BHXB 1O3DA 2KX4A 1P2QA 2XYAA 1P3CA 1E37B 4E06H 5CE1A 1COWD 2JJ1D 5CHBA 4WY3A 5CDFE 2HGTH 5C2ZA 4YXWD 5L30H 4J2YB 1C5MD 3ATKA 2ASUB 3RXIA 4B6EA 1V2ST 1H9LB 2ZCKP 1AGJA 1P57B 2AIQA 3MNBA 2Q1JA 1ETTH 1CHGA 1XKAC 3ZVAA 1HB0B 4GHTA 2H9EH 1UMAH 2ZWLH 1RD3B 3MU5A 3S9AA 2P3TB 4WXIA 1DSTA 1GI9B 1LDTT 1ABJH 5K7RA 2H5CA 1D6WA 1KXAA 2FDAA 3BIUH 1N1LA 2HVXA 4FVDA 4NA8A 5BPEA 1XVMA 2ZFRH 2ZTXA 2FESH 1YPGH 3FANA 1Y3WA 3ENSB 3LJJA 1G2LA 2VH6A 3T28A 2WPJS 1SGNE 3ZYEA 1MUEB 1QL9A 2G55A 2SNWA 5HKKD 1LVOA 4IW4E 1GDQA 1GVLA 1V2MT 1KLIH 1ZRKA 1BA8B 5JYIA 1Z8JB 2Y5FA 2K1QA 2KCPA 3GYLB 4NIVA 1SFIA 2YNAA 2ALVA 4U32A 1S0QA 1YPLH 3T25A 1SB1H 1UK4A 4CR9A 2BLWA 4A7IB 1CE5A 2OUAA 3KQEA 1C1MA 3SQHE 3VPKA 3HKJB 2WZQA 1TX8A 1DY9A 1EPTC 2TRMA 1UTQA 2AMQA 1QHRB 3F0PA 1G37A 3ATIA 1LVYA 1T8OA 3E0NB 3MU1A 3RXCA 1OP8A 1QB9A 1Z8IB 3VEQB 2Y81A 1BIOA 4I33A 4K2YA 2XBYA 2NU4E 1G32B 3LJOA 2F4LA 2YMSB 1QIXB 1Y5BT 5DP3A 3ZZ8A 2CF9H 4ISHH 2BTCE 2FIRH 2Z3EA 2AGGX 4YESB 4AB8A 1BITA 1DE7H 1FX0B 1UK2A 1P0SH 5EXNA 1ZSJA 3V3MA 1AE5A 1LPZB 3ZZ3A 2D2DA 1AZZA 1SGIB 2TPIZ 2VINA 4AN7A 5B6OA 1YCPM 1O2NA 1BJVA 4Y8YA 2Y7XA 2BDGA 3A7WA 1ZPCA 1XX9A 1MH0A 4DG4A 2J38A 4YZUA 3KQDA 4U30A 5DG6A 3KQCA 1BTHH 2ZQ1A 4YLUA 1QQUA 3M3SA 3NUMA 1KDQA 4M9FA 1DX5M 1ZPZA 2JDID 2FP7B 1LHGH 1WXRA 2RG3A 1G3EA 1A5IA 2ZNKH 2C8ZB 1J14A 4IMQA 1Y5UT 1W14U 4M7GA 1WTGH 1CVWH 1W3CA 4TPIZ 2V35A 2SGAA 4F49A 1EP5A 1TGBA 1QB1A 2UWLA 5LPRA 4NIYA 5DO4H 1C2KA 1M9UA 1MKXK 4ZKOU 3UNSA 4TY6A 3RMOH 1A61H 3T29A 2GT7A 4K5ZA 4MNWA 2HALA 1Y8TA 3ELAH 1MTNC 1IQHA 3KYFA 3FP6E 3MH7A 1BMMH 5C67A 2IN2A 3DD2H 2GGVB 1XM1A 3SU5A 3L3TA 1PQ8A 4O03A 4Y8XA 1TQ0B 3TGJE 1C2GA 5EXLA 1O3LA 1DWBH 5FX6A 2EY4C 3MTYA 3AK5A 2KCOA 1ESAA 2EEKA 3Q3XA 1TMBH 4FUBA 2FOEA 4YOGA 3KQ5A 1ZPBA 3MNCA 4YTAA 2BD9A 2GCHG 5E0HA 3TH4H 2PKSB 2H1UA 3FFGA 4A1VA 1K9OE 1QBVH 1C5QA 1F2SE 1N6XA 1XMNB 1AVXA 2NU3E 3RXGA 4ESTE 2KCAA 1N8OC 1A5GH 1ELBA 2BMGB 4RKOB 2GZ9A 4AYVB 2V6NA 1EJAA 4CR5A 2OCVB 1H9HE 2O9QA 3ATLA 3GCNA 1SMFE 4RT0A 3FKSD 1E79D 1EAXA 3SYJA 1D9IA 5EIYA 3OY5U 3DSPA 5IYTA 5FL7D 1GVKB 1CQQA 4GPGA 3UQOA 1O32A 4MPUA 3VGCB 4BTTB 3WW7A 1TX6A 1BRUP 4TWWA 1LPGB 1P8VC 2RFKC 4I32A 5L6NH 1OWJA 1TONA 3QGJA 1G30B 2CHAB 2BLQA 4NA7A 4Y71A 2YOLA 3F9EA 3QX5H 1GMDF 1P04A 5EG4A 3E0PB 1S85A 5FPYA 1NFYA 5EJZA 2OC1A 3LGIA 3TJVA 3OEHD 4BNRA 3BTWE 2ZFTA 1TFXA 4JCNA 4VGCC 1CGHA 3FOAA 1CBWB 1SHHB 1WSSH 1HJAB 4GSOA 1NRNH 1ORFA 1YGCH 1C2EA 1VCQA 4CH8B 1C1NA 1FY3A 1BOQA 1TRNA 2EI7A 1IQFA 2A7CA 2GZ7A 1CO7E 1GGDC 1PFXC 1BTXA 1SGTA 5DP4A 3SGQE 1AVWA 4Y0ZE 1V2WT 1C2HA 2OK5A 3F9FA 4JYVH 3W94A 1RTFB 3RXFA 2KZ4A 3ZVBA 1S84A 3P70B 1F92A 3MU4A 2GV7A 3ZYDA 1S6FA 2ZZUH 4UFDH 2A4GA 2XRCA 3LGYA 1L2EA 1TNKA 3F1SB 2FOHA 1GBFA 1AZ8A 2JETC 4NWKA 1XXDA 1O5AB 3SJOA 1C5OH 3DUXH 2CV3A 2OQ5A 2YMSD 3KIDU 1GJ7B 2ZHQH 1MCVA 3V0XA 4HI3A 4UD9H 2Q6FA 1AU8A 3M5LA 1UTKA 1MD7A 4OS5A 1Z7KA 6CHAC 2OXSA 3KGPA 3MH4A 5J4QA 3U8OH 1QY6A 3PLKA 2A2QH 1PPCE 3V12A 1NY22 1UTNA 2FTLE 2UWPA 4WMEA 5GWZA 3IG6B 1P2IA 1P2JA 5I25A 1O37A 1K28D 1EXFA 1TE0A 3B9FH 1S83A 1DWEH 2FPZA 2VVUA 2ZP0H 1UTJA 1EJMA 2BY7X 2QF5A 1ZGIA 4X1PU 1O2PA 1FN8A 4ACAA 1TPOA 1C2MA 1BTZA 1DSUA 4FUCA 2O8WA 3LOXA 1EASA 2VIDA 4RSPA 1H1BA 5PTPA 1NFUA 2ZGHA 3KL6A 5EW2H 1Q3XA 4ZXYH 5FHTA 5J4SA 4TY7A 3PLBA 4Y11E 4CBNA 3RC4A 3A8BA 1DM4B 2VGCC 2P94A 3FZZA 1FONA 3UAIC 3ZZCA 8ESTE 2BQ7B 4GCHG 3PMAB 3SV9A 1ABIH 1H8IH 3MU0A 3SU2A 5JBTA 1BBRE 2FOMB 2D1JA 1E36B 3KEEA 2STAE 4ZXXH 1TALA 5EPYA 4WXVA 4YT6H 3LGWA 2AIPA 4TWYA 1YLCA 3F68H 4X1QU 1BTPA 3WWBA 4RKJB 1V2PT 2IJOB 4B74A 2B8OH 1CT0E 1HIAB 4JZEH 4WMFA 3MFJA 3STIA 1VITF 2P93A 4MPWA 3T26A 3F9GA 1NU7B 5EOKA 2G51A 1GI0A 1NT1A 3RU4E 2VIQA 3EQ0H 4GUXA 1V2KT 2Z3CA 3TK6A 1PQ7A 2B5TB 4Y76A 1WCZA 4WWYA 5DN6D 1TMTH 1QRZA 1YP9A 4I8GA 1ELDE 1HGTH 3VB7A 1UK3A 1G3CA 1MTUA 4I8LA 4CRGA 2W6JD 1ELAA 2A7JA 1TRMA 1C1SA 2ZGBH 2GDEH 1XUGA 3M7UA 4X1RU 2UUKB 1TOMH 1DWCH 1GBDA 3N7OA 2W7UA 3N7EA 3RMMH 3HK6B 1YPEH 3F3BA 1GHBF 4CRDA 1GJDB 1ZMJA 2AYWA 2LELA 1NESE 4NSYA 4A1XA 1FPHH 1E1RD 1OS8A 2P8OB 1GI7B 1T8NA 3DCLA 3QDZB 3RXMA 2J2UA 1A0LA 3B8JA 3D49H 3PO1B 4R8TB 5C94A 1LO6A 2PV9B 1SGCA 3KN2A 1O2OA 1C1WH 3P92A 1O5GH 3SV8A 1D3QB 5EQQA 1OXGA 1OP2A 1O3NA 5GDSH 1D3DB 2WUBA 3BTFE 1UHBB 4Y10E 2TGAA 5GCHG 3JZ2B 1O3KA 1NS3A 4KGAA 2GP9B 1ZOMA 3OU0A 3KYGA 4YLQH 1D3TB 2BD5A 3GCHB 1C2LA 1WOFA 3PTNA 1GI3A 1MU6B 5DSFA 3GOVB 1SGPE 1WDIA 3UFAA 1YWUA 3TU7H 2NWNA 3MO9A 3OAAD 3EAJA 1HAPH 2HNTE 2BOHB 1RFNA 1GDUA 1KXBA 1NROH 2CXVA 3NZIA 3GCTF 2B9LA 1FV9A 1C2IA 4DW2U 2VJ1A 1EAUA 3VB6A 2ZG0H 2Z7FE 1NZQH 1JMOH 4ABJA 1JIRA 1O3HA 2WYJA 1ANBA 2ZGXH 1RGQA 1AB9B 1ZSLA 3MNSA 2Z9JA 5GNDA 3BIVH 3ZVCA 3TNSA 3UR9A 3N99A 3SJ8A 4DJZB 4FU7A 2PR3A 1GG6C 4BTUB 3NKKA 1ACBE 4UFGH 2LPRA 2W5EA 3RXKA 2ZI2H 3ODFA 1C9PA 4B2BA 1BRBE 2ZDVH 1O36A 1Y3XA 2QXHA 2R3YA 2H9HA 4K69A 4H4FA 3M7TA 1HBTH 2QIQA 3AW1A 1GHAF 3FN8A 3VB3A 4MPXA 5DGJA 1THPB 1Z6JH 1SQRA 5DP5A 2WPIS 4LZ1H 1B5GH 4B1TA 1GI2A 3DSGA 5FPTA 2OBOA 1QTFA 4FETA 1GJ6A 1C4Y2 2BX3A 3P95A 4TPYA 3RMNH 1P12E 2WV5A 1W0KD 4K1TA 2DE8A 3GY6A 4KKDA 1ETRH 4YOJA 1C5PA 4YO9A 2Y82A 3SUEA 4Y7AA 5DPAA 3A8AA 2SGDE 1G3DA 4AGKA 3A84A 1SQOA 5L2ZH 1QA7A 1ELTA 2FS9A 4AOQA 4DOQA 4X0WU 5I46H 1S82A 4MNYA 1DLKB 2FOGA 4OS4A 3MO3A 4FUEA 1BT7A 1SL3A 3RXAA 1C2JA 2WHXA 4ABAA 2FM2A 4NIWA 3UR6A 1DXPA 1W7GH 2ZTZA 1IAUA 3SZEA 1EX3A 1K1JA 1C5LH 3TK9A 2XC4A 1GBJA 3GY5A 5JBBS 1ZTKA 3NK8A 2AS9A 1GMCG 3Q3KA 3Q3YA 1BRAA 1AN1E 3QO6A 4MNXA 2CF8H 1BMNH 2TBSA 5HYOA 1QRXA 1QJ6B 2ZPRA 4ISIH 4YOIA 1QL8A 3VB4A 1FMGA 7KMEH 1S0RA 2XWAA 4CREA 4MQAA 1MKWK 1LKAA 3SHCH 1GHXH 4OM9A 1W11U 1B7XB 1J8AA 4FUIA 1WTHD 3ITIA 4ZH8A 1B0FA 3BTGE 3M7QA 1AFEH 5LPEA 3RXOA 1CGIE 4MG3A 3DA9B 2ZGJA 2FLBH 1C5NH 3A88A 2UUJB 6GCHF 1EB1H 3TJNA 1HAOH 1DPOA 1ARBA 8KME2 3AVZA 2C8XB 2BY8X 2QA9E 3HGPA 1DUAA 2IPQX 1IQIA 1ANCA 2F9BH 6ESTA 1EAWA 1HYLA 2BQ6B 2W7SA 4INHA 2CJIA 1MABB 4SGAE 2BM2A 1KSNA 5IDKA 1J15A 2PGQB 2VB0A 3SO3A 4E7RG 3OEED 2JH0D 1TPPA 3KCGH 1JWTA 3PTBA 1LHFH 2HNTF 4NZQA 2RA0A 3I78A 4ISOA 1Y3VA 1MKXH 2ZU5A 2IOTA 1DOJA 2R2WU 3STJA 3P8OA 1O2GH 3H7TA 1NRSH 2JIZD 5HM9A 5A2MH 1QJ1B 4JK6A 5BRRE 1EUFA 1THRH 2PFEA 3V7TA 1MU8B 4DT4A 3RU4D 1C1VH 4AFUA 1MQ5A 3BN9A 1GCTB 1QRWA 4ZAEA 2PKAB 3ZIAD 4ZHLU 2J5UA 5EU8A 4B2CA 2ZFFH 3QZRA 2VIVA 1O3GA 5JPMH 2WPMS 1ELVA 1O3AA 1A7SA 1P2KA 1T8LA 4Z0KA 1ZRBA 3V13A 2TIOA 1NPMA 4HGCA 3O8BA 4GAWA 8GCHG 2F9VA 1C5RA 2XXLA 3UB0A 4NG9H 1AD8H 4BANB 2ANYA 1ZTJA 4E7NA 2R0KA 3EA8A 3K6YA 1GPZA 1CHOG 5HGGA 1FN6A 1ANEA 3E3TA 5ESBA 1P9SA 1MTVA 3NRLA 1RTKA 1NU9A 1V3XA 1GHYH 3E1XB 5A0CA 2Z3DA 2VWMA 4MPVA 1VJAU 2OC7A 2EA3A 2FX4A 2NU1E 4IN2A 4IMZA 1O2JA 2ZHWH 1XUJA 2BXTH 3MU8A 1DXWA 1C4U2 2O8UA 1DUEA 1GHWH 3NXPA 3MYWA 2P3FH 5B6LA 4AFSA 1PYTC 1HIAA 3L33A 2H5DA 1KY9A 1SSXA 4ZKSU 1EZXC 2PKSC 3GY7A 4Y8ZA 4X2WA 2WPDD 4K60A 3E91A 1RIWB 3PYHA 3ZZ6A 1HAHH 3K65B 3UIRA 5T6GA 2BX4A 3PB1E 1P01A 2BDAA 1VR1H 3GY3A 2OP9A 1LHCH 1O3OA 4MNVA 3H7OA 1NC6A 2GZ8A 5A8XA 2SGQE 2PWXA 1EB2A 3QZQA 3BTDE 4X8UH 3A7ZA 1P09A 4D76A 3NPSA 4UFEH 4HTCH 1SGQE 1JRTA 2A0QB 4X2XA 3BTEE 2KM0A 3ZZ5A 5HXFA 3VGCC 1CT2E 4DT7B 1HXEH 2ZDNA 3ZZ9A 7GCHG 2VIPA 1T4VH 1C1UH 3SNBA 2CHAC 1H4WA 2K8IA 1AKSB 3TJUA 2RA3A 1YCPH 5EQRA 3BG4B 1V2UT 4P02A 3K6ZA 1F5RA 3A7TA 1C2FA 3AW0A 4INKA 2STBE 2A45B 1MTSA 2LP6A 3VXEH 1K1MA 4B73A 2ZU4A 3MQKC 1G2MA 1TGTA 1W0YH 3PLPA 5KEDA 3A8CA 2GJGA 1CBWC 1T7CA 2TGTA 4NFFA 1HJAC 1D3PB 2Y6TA 1T31A 4IGDA 4AZ2B 3ATMA 1QCPA 1JIMA 1QB6A 2R3UA 1IQEA 1HAIH 1UVTH 2AH4X 4FUFA 1P06A 1W0ZU 4WH6A 1KMHB 1UHBA 4DCDA 4Q7ZA 1F0RA 7ESTE 3U98H 2ODPA 1A4WH 4XD7D 4U01A 3EYDA 3RM0H 5EW1H 1EP6A 3OYPA 1HAGE 2F9NA 1TBZH 1XVOA 2A1DB 1FY8E 1JXPA 1PPGE 2R9PA 1NBME 1P11E 3GCOA 1PPEE 5HIYA 4BOHA 3SV2H 1KYNA 2QXIA 3E16B 1GDNA 3NCLA 4IC6A 2ILNA 3ZVDA 3KF2A 1H8ED 2FLRH 3LDXH 1Q31A 2Z94A 2JKHA 2XBXA 1SGDE 4CRCA 1ZLRA 4JMYA 5EODA 5EJ1A 2C3SA 1O0DH 4ASUD 1ZHPA 2BXUH 3A89A 1SPJA 1HCGA 2HRVA 2SFAA 3U69H 2BDYA 3DSOA 3M3TA 1C5VA 1TNHA 2ALPA 4DIIH 1SGYE 4RN6A 1DFPA 2FTMA 5GPIB 2V0BA 4O9VA 1HRTH 2PUQH 3OFND 3M5OA 3QK1A 2GV6A 2VWLA 2L6OA 2A7HA 1YCPK 2BVSH 2QY0B 1TNIA 3SUFA 1O3PB 4FVBA 5K0HA 5E8EH 2LNCA 2OLGA 1F0SA 4X6OA 3UWJH 4CRAA 2P3UB 1O39A 1A0JA 4AB9A 1ELCA 4A1TA 1O31A 2EC9H 5T6DA 2BD8A 3L6PA 2RDLA 3U8RH 2PSYA 1OWDA 1GBHA 5FCRA 1IQJA 1C5YB 1MZAA 3VG8A 5HIZA 2WV4A 2QN5T 2Q6GA 3F2FA 1E38B 4LZ4B 4R0IA 3AASA 1P2OA 1SLVB 5C17A 4JZ1A 5E0JA 2Z9LA 1WV7H 3FP7E 2AGEX 4UE7H 3TVJB 1WQSA 1GCDA 5C3NA 5C5NA 1S81A 2ZF0H 4E05H 2ZCLP 3ZVEA 4O3UA 3TH3H 3SGAE 3SN8A 2BD4A 3LC5A 4FU8A 4GVUA 4Y79A 1CA0B 1ZHMA 1DLEA 3PMBB 4OGXA 1YPKH 1TQ7B 1TWXB 3SJKA 1V2TT 1HFDA 2BDIA 3RM2H 5A0AE 3SV6A 1FY1A 2BZAA 3HPTB 4HG6A 5JDUB 1H9IE 3CS7A 1MBMA 1YPHC 1U6QA 1C4V2 1GBBA 4FU9A 1ELGA 2QF0A 4KP0A 1AHTH 4RI0A 2SGFE 1AQ7A 1L4DA 2FI3E 4HFPB 2J94A 2GCTB 1TAWA 4X1NU 3OTPA 2GCHF 3LGTA 1SGRE 3HGNA 2A4QA 2OQUA 1SFQB 1C1OA 4RT1A 3TLOA 3RXPA 3UY9A 5EGMA 3A85A 5A0BA 2XBVA 1GWAA 3HATH 1K1LA 1K2I1 1K1IA 2V3MA 1IQGA 2FYQA 5C5OA 1P05A 3FP8E 1WYKA 1YLNA 4Q80A 5C0UA 5A8YA 1ZJDA 3LGVA 1K21H 4OS6A 3SV7A 1IHSH 2IJD1 3MOCA 2UUYA 2QF4A 1TBRH 2GD4B 5DJ7A 2AMDA 4ASHA 4ZMAH 1P3EA 2DE9A 2WINI 2G5NA 3LC3A 2ZDLA 1Y5AT 1C1PA 2J98A 5C0TA 1KXFA 2Z6BD 1UJ1A 4O97A 1OWHA 4XBDA 3TITA 5DP9A 3S7HB 5EXMA 1BCUH 2NU2E 2P8OC 1ZZZA 2GDDA 2JJ2D 1EOLA 3TK5A 1C9TA 3PWCA 4FUGA 3C27B 4NSVA 1Z71A 1UTMA 2ZECA 2F3CE 3PWBA 3H09A 2VBCA 1CSOE 3EGKH 4JYUH 3R3GB 5EPNA 2XTTB 2TGPZ 1TNJA 1SI5H 1TGNA 3MMGA 5CHAB 4X8SH 1J17T 3GCHC 3MHWU 2M5TA 4AGJA 2PKAA 3KNXA 5FCKA 3E90B 1O3IA 3OSYA 4X2YA 2J4IA 2C8YB 3EDXB 1HV7A 4I86A 3S7KB 1DITH 3G01A 4B6FA 1FZZA 2GT8A 3GICB 3GY8A 2WPKS 4Y7BA 2BD2A 1ZTLA 8LPRA 2XNIA 5F03A 1GHZA 1DWDH 1O2MA 1GBCA 4WMDA 1AB9C 1NN6A 3SGBE 3I77A 1ZR0A 1SR5C 2PSXA 4GHQA 4H42U 2A5IA 1VCWA 2O8TA 2AGIX 2V7QD 2KCYA 2FXRA 2XC0A 2VH0A 2M2AA 1CU1A 1NFWA 1WBGB 1ARCA 1THSH 1OX1A 1AY6H 1K22H 3A80A 3DFLA 4NCYA 3FVFB 1V2RT 2WUCA 1W12U 3RXEA 3U28C 2ZFPH 3FZDA 1SVPA 1ELFA 1K1PA 1O3FA 1V2NT 3A7VA 3ZZ7A 1C1TA 3AAUA 1NRQH 1HLTH 4K1EA 5FX5A 1P03A 2BDHA 1FLEE 3LPRA 4F4OC 3CP7A 1QA0A 2FWWA 2RDEA 2P16A 3VFEA 3UQVA 1VGCB 2BVRH 2ZGCA 1UCYK 4Z1MD 1BMAA 1ID5H 1ZSKA 5F8TA 1TNLA 1UO6A 1MKWH 3T2NA 4CHAB 5LGOA 1A3BH 1EAIA 2OBQA 5LPFA 1LHEH 2BHGA 4A6LA 5HMAA 2G5VA 1NBMD 5TCCA 2CK3D 1SGFA 4CRFA 3SNDA 1NRRH 5HM2A 1X7AC 3GYMA 1O2XA 3SW2B 3I29A 1AKSA 3RXLA 3RXDA 1A3EH 1OPHB 4X6MA 2A31A 1FQ3A 1FXYA 2B7DH 4GCHF 4B75A 5AFYH 1IQNA 1OSSA 3P6ZB 1TIOA 4Q7XA 1PQ5A 1G3BA 2BY5X 1TB6H 3JZ1B 2AEIH 5DP8A 1AWHB 1QL7A 4GLYA 1MZDA 5DKMA 1ZHRA 4BXWA 5C20A 4AG2A 2ZDAH 3SI4H 3AAVA 2YNBA 1HNEE 1W10U 4X2VA 1EFRD 1PPBH 4XBBA 5KGOA 2PHBA 3SNCA 2H6MA 1DDJA 1Z6EA 2ULLA 1O2HA 4K8BA 1GBMA 3T62A 1HAVB 3ZZBA 3EA9A 4ABIA 2HPPH 3PM3A 1LHDH 1B0EA 1Y3UA 3CNRA 2PUXB 4A92A 1E1QD 2HVYB 2A32A 4I7YH 2J92A 2QCYA 5EQSA 2SGEE 2V3HH 4ZHMU 3UNQA 4MLFB 1F0TA 4UDWH 1EATA 5L2YH 1NO9H 1FPCH 3PMJA 3BTHE 2Z9IA 4F48B 1FJSA 1BJUA 2P95A 9ESTA 4WH8A 1NM6A 2PW8H 4HZHA 3RLYH 4LK4A 1AFQB 3WY8A 3MWIU 1E0FD 2ANKH 1MCTA 1AUTC 1S5SA 2KR7A 5FAHA 1L1NA 5LH8A 1CT4E 1OP0A 2G4TA 1FIWA 2J9NA 2FOBA 3BF6H 3GS9A 1HAZB 3DFJA 1GL1A 1MTWA 1OYTH 1SQAA 3BTTE 1HJ9A 1JBUH 1NRPH 3UTUH 3UUZA 3TGKE 1INCA 4NFEA 5CMXH 4FUDA 1C2DA 1UTLM 4I31A 1KXEA 2HLDD
chains in the Genus database with same CATH topology
1KIGH 2VIOA 3HK3B 4XFQA 1OOKB 5C1UA 1O5CB 1UVOA 2FI4E 1GCTC 3LH1A 3LGUA 2PTNA 2QAAA 1GJBB 1T32A 2Q6DA 1F5KU 2Y80A 3T5FH 4CBOA 2W26A 2ZPSA 4XE4A 2ZHFH 5E2PA 5JB8S 3LIWA 2Z9KA 1W7XH 2KAIB 5GCHF 3SNAA 1AVGH 1MMJN 1SC8U 1Z1JA 1VJ9U 3RMLH 2R2MB 4DGJA 1A5HA 4Y0YE 2SNVA 1HAYB 5AHGH 2O8LA 2NU0E 1VZQH 2FYRA 3K2UA 2G4UA 3P8NA 1GBLA 3M35A 1GJ4H 2XW9A 3RP2A 1EOJA 2OC0A 2ZU3A 2GX4A 3URCA 3S9CA 2GMTB 1PPZA 2Y5GA 4FUJA 1QGFA 4NGAH 1WAYB 2QYIA 1K1NA 2VNTA 3M36A 1GJ5H 4X8VH 1F0UA 4ISLA 2BD7A 2G00A 2C8WB 1C1RA 2P59A 3A81A 3GY4A 3S0NA 4JZFH 3F6UH 3VXFH 1Z8GA 3SUDA 2HLCA 4CRBA 1L4ZA 3UREA 1EZUC 3RDZA 3A7YA 1O2KA 1AIXH 1BTYA 2BD3A 1RIWC 2F9UA 1DICA 1L1GA 1EZSC 3OTJE 4BAHB 2BOKA 4Z6AH 1HXFH 1BQYA 4CH2B 3UPEA 1E35B 4AG1A 3SU3A 2G52A 4KTSA 1O5FH 2ZFSA 1O3CA 5JB9S 3SORA 3SJ9A 2FMJA 4ABBA 1HDTH 1YC0A 1LQEA 1AMHA 1KXCA 3LU9B 5ABWA 1DANH 1EQ9A 1GMDG 2PLXA 3RXRA 1ZMNA 2ZPQA 1AUJA 1T4UH 5ETXA 2EI6A 4AFQA 4X6PA 1Z8RA 2ZU2A 3E6PH 2ZO3H 3IWMA 1A46H 2XC5A 4JZIA 1BHXF 3P8FA 3VB5A 2H9TH 2ZA5A 1SGEE 3BG4C 3M61U 1LKBA 1O2SA 2ZHDA 5GXPA 3ZZAA 3A83A 1QNJA 1SGFG 3RLWH 1GBKA 1P2NA 1SLUB 1GHVH 3RXQA 1O2TA 1GI6A 1FY5A 4ZUHA 2A5KA 1A1RA 3S69A 4BAOB 2ZDKA 3SBKA 1C5SA 3QTVH 3RXTA 5E2OA 1SHYA 2F9OA 3GDSA 4Q7YA 1UVUH 1GL0E 4D7GA 3ATWA 1LTOA 1O2VA 1LPKB 1JRSA 1VITH 3RXSA 1GMCF 2ODYB 1BZXE 3A87A 3RU4T 2A2XH 3ZV9A 3P8GA 1EPTB 3DT0H 1TGSZ 2OD3B 2D8WA 4ZKRU 2XCNA 1C5ZB 5F8XA 1QQ4A 3O8CA 2BLVA 2D26C 1GBTA 2C93B 2CGAA 1D4PB 1UVPA 3SU4A 1S6HA 1D6RA 4JK5A 5DP7A 1TMUH 1TX7A 1KXDA 2Y5HA 4ABFA 1AO5A 2V3OH 3URDA 4MTBA 1O2RA 1HUTH 1MAXA 1YF4A 2HOBA 5F8ZA 2ZTYA 1XUKA 3B23B 1AE8H 1DS2E 1P9UA 1Q2WA 1RXPA 2BB4A 3ZVGA 3HKIB 1GJ8B 1ANDA 2ANWA 3BEIB 4DURA 1G9IE 4AX9H 1XKBC 4XSKU 2HWLB 2J34A 2VVCA 3OY6U 2FS8A 3QTOH 1Y59T 2QGRA 1O3MA 2XWBI 9LPRA 1XUIA 2VWNA 2BDCA 4UEHH 5FBIA 3BV9B 1CGJE 5TJXA 5C1YA 4K3JA 1L0ZA 3IITA 3TJOA 3CS0A 3M3VA 1OWIA 3RXJA 2THFB 1DY8A 2ZCHP 1GJ9B 2F9PA 2JH5D 2ZC9H 4K1SA 5E0GA 6LPRA 2BLOA 1O2YA 1GBIA 1BTWA 1O5BB 3UWIA 4ZHAA 4O3TA 1ETSH 1V2LT 1WUNH 1IHTH 4I8KA 3U1JB 4DIHH 1MTNB 1WQVH 5FBEA 2FOFA 2BZ6H 3SOSA 2BQWB 1BTUA 1SQTA 2QF3A 1GI8B 4JZDH 1TLDA 2F91A 1IOEA 2ZFQH 8GCHF 1VITG 4IS5A 4QT8C 2IPHA 1OWKA 1TOCB 2XBWA 4OS2A 5T6FA 3RC6A 1EZQA 4BAQB 1MD8A 1O2WA 4MDSA 5H4IB 1CA0C 2FODA 1K1OA 4I8HA 2VWOA 1CHOF 2H2ZA 2ZKSA 2FOCA 2WYGA 4KTUA 2CN0H 4BAMB 1XUHA 1LVBA 2AFQB 5FXLA 2WPLS 4WVPE 1TYNA 3LH3A 1TPAE 1HPGA 4ABDA 2A4OA 3A8DA 4X1SU 2GVFA 4NA9H 3MH5A 3MH6A 1LQDB 2I6SA 2QV1A 1FNIA 5T3HA 1N8OB 1BB0B 4BAKB 1YPJH 1HJ8A 5GIBA 1JOUB 1CA8B 1BBRH 2GCTC 3OX7U 4D7FA 1A2CH 4DVAU 1HAVA 1MBQA 1FAXA 5TCAA 1KTSB 4ZKNU 1PPHE 4D8NA 2FI5E 3GDVA 1GHBG 4I8JA 3PMHB 1XXFA 1SBWA 3BTKE 1FDPA 4AFZA 2I6QA 4ABHA 1P2MA 3SQEE 1IQMA 2PGBB 2FOAA 1TBQH 1HAXB 3M5NA 2B0FA 3GY2A 1O2LA 5FPSA 3BSQA 2VVVA 3D62A 5F6MA 4WJG2 3SU6A 1C5UA 1YYY1 1VCPA 5C1XA 1UTPA 1SOZA 1N6YA 2ZHEH 7GCHF 3RXHA 7LPRA 5DK1A 1O2UA 1F5LA 3RXBA 4VGCB 3ZVFA 4X6NA 2AERH 2RCEA 3DHKH 1V2VT 3LT3A 2R0LA 1TNGA 1ESTA 4FUHA 5ESTE 3TH2H 4AORA 1GMHG 3A7XA 4BTIB 3BG8A 1SLXB 1YPHE 5CHAC 1GGDB 3D65E 4D9QA 4WF8A 3GCTG 1W2KH 2A4RA 2ZQ2A 2FX6A 4J1YA 1SG8B 2OC8A 1O3BA 1P02A 5A8ZA 1T8MA 4A5TS 1A0HB 2QXGA 3RC5A 2KAIA 2ZIQH 2OINA 2F83A 2JETB 3M37A 1J9CH 1GI1A 1O5DH 3QGNB 4YM9A 3ESTA 1GVZA 1QURH 2BDBA 1BBRK 3D23A 4UONA 1GHAG 2G8TA 4ABEA 1MAYA 2Z9GA 3RUOA 3QWCH 1FUJA 1KLTA 2HPQH 2FO9A 6CHAB 4ISNA 3PO1C 3A86A 1TRYA 3K9XB 1V2OT 4THNH 4BXSA 1ELEE 1UCYH 3KQBA 1YPMH 3SI3H 1O3EA 1KDQB 1OKXA 2CMYA 1Z1IA 2EI8A 3MI4A 3FAOA 2ZU1A 3W95A 3U8TH 3CENA 4H6TA 1BDAA 1PQAA 1O34A 3E8LA 4XBCA 1EJNA 3QLPH 1SOTA 2VIWA 1PYTD 1GI5A 1TA2A 5AFZH 1GJAB 5GJ4B 3KHVA 5AF9H 1C5TA 2J95A 4KELA 1YM0A 3Q77A 3M5MA 1VGCC 4ABGA 1LMWB 1UVSH 2JH6D 4Y6DA 1RS0A 3EE0B 1BRCE 2BYAX 2G81E 4K8YA 5G4BA 4YT7H 1ZGVA 3SU0A 1EKBB 4INLA 1G36A 2VGCB 1O5EH 4CHAC 1MQ6A 2VU8E 2ODQA 5SGAE 3PROA 1QFKH 4LOYH 4TYDA 3SNEA 1OYQA 1TGCA 2ZEBA 2A5AA 2PTCE 1C5XB 4XDEA 3UNRA 1H8DH 3U9AH 1TPSA 3NWUA 4B71A 2XCFA 2AMPA 2SGPE 2W3IA 3BEFB 3O8DA 3ODDA 4JYTA 3TPIZ 2FZZA 1QBOA 3UOPA 1YLDA 3LONA 4IBLH 3H5CB 3SUGA 3RXUA 1XUFA 3SHAH 2WPHS 6GCHG 3R0FA 2C90B 1RRKA 4IC5A 2HNTC 2O8MA 4Q2KA 1O2ZA 3TNTA 3UOUA 1QR3E 3MO6A 1NTPA 1EPTA 1KTTB 1W8BH 2ANMH 1UCYE 2BY9X 3Q76A 1AWFH 1LVMA 4OS7A 3LKWA 1GMHF 4NZLA 4PROA 1O3JA 3MNXA 1FY4A 1GI4A 2GTBA 1NFXA 1YBWA 5JBAS 2BY6X 1W13U 4FXGH 1P10A 1AFQC 1IQKA 3QN7A 1O2IA 1FIZA 4ZROA 3EA7A 3SU1A 1E34B 3C1KA 2GKVE 3A82A 1TABE 3GDUA 2UWOA 3ZZ4A 1UTOA 2UUFB 3F9HA 3T27A 1O33A 3BTQE 1OWEA 2ESTE 1GJCB 1YKTA 2Y7ZA 3SZNA 1SLWB 4B2AA 4IN1A 3RXVA 1GBEA 1QBNA 1TA6A 4OS1A 3U1IB 1WU1A 2FEQH 4U2WA 3TIUA 2TGDA 1FAKH 2W3KA 1F7ZA 3GISB 1PPFE 2OTVA 4NIXA 1QJ7B 1LCYA 1O2QA 2BVXH 3PV4A 4LXBH 1DVAH 1DT2A 4D9RA 3QUMP 3S9BA 1V2JT 1Y3YA 1IQLA 1GBAA 3P17H 3O8RA 4SGBE 1AI8H 4H6SB 1V6DA 5JBCS 1BUIA 1KLJH 1RTLA 4KTCA 1ZJKA 2GMTC 1GG6B 1PJPA 4MVNA 3BEUA 1ESBA 1BMLA 2DUCA 1J16A 1FI8A 1O35A 1O30A 1V2QT 1O38A 4NWLA 4XOJA 5DP6A 3ZV8A 3Q00A 2C4FH 3ZZDA 5A09A 1C1QA 3BTME 1RJXB 1ZYOA 4X8TH 3TGIE 2QC2A 3SJIA 4DY7B 4AYYB 4B76A 1L1JA 1ZMLA 4UFFH 1C5WB 4OGYA 5AVDA 2QXJA 2ZDMA 1BHXB 1O3DA 1P2QA 2XYAA 1P3CA 1E37B 4E06H 5CE1A 4WY3A 5L30H 2HGTH 5C2ZA 4J2YB 1C5MD 3ATKA 2ASUB 3RXIA 1V2ST 1H9LB 2ZCKP 1AGJA 1P57B 2AIQA 3MNBA 2Q1JA 1ETTH 1CHGA 1XKAC 3ZVAA 1HB0B 4GHTA 2H9EH 1UMAH 2ZWLH 1RD3B 3MU5A 3S9AA 2P3TB 4WXIA 1DSTA 1GI9B 1LDTT 1ABJH 5K7RA 2H5CA 1D6WA 1KXAA 2FDAA 3BIUH 1N1LA 2HVXA 4FVDA 4NA8A 5BPEA 1XVMA 2ZFRH 2ZTXA 2FESH 1YPGH 3FANA 1Y3WA 3ENSB 3LJJA 1G2LA 2VH6A 3T28A 2WPJS 1SGNE 3ZYEA 1MUEB 1QL9A 2G55A 2SNWA 1LVOA 4IW4E 1GDQA 1GVLA 1V2MT 1KLIH 1ZRKA 1BA8B 5JYIA 1Z8JB 2Y5FA 2K1QA 3GYLB 4NIVA 1SFIA 2YNAA 2ALVA 4U32A 1S0QA 1YPLH 3T25A 1SB1H 1UK4A 4CR9A 2BLWA 4A7IB 1CE5A 2OUAA 3KQEA 1C1MA 3SQHE 3VPKA 3HKJB 1TX8A 1DY9A 1EPTC 2TRMA 1UTQA 2AMQA 1QHRB 1G37A 3ATIA 1LVYA 1T8OA 3E0NB 3MU1A 3RXCA 1OP8A 1QB9A 1Z8IB 3VEQB 2Y81A 1BIOA 4I33A 4K2YA 2XBYA 2NU4E 1G32B 3LJOA 1QIXB 1Y5BT 5DP3A 3ZZ8A 2CF9H 4ISHH 2BTCE 2FIRH 2Z3EA 2AGGX 4YESB 4AB8A 1BITA 1DE7H 1UK2A 1P0SH 5EXNA 1ZSJA 3V3MA 1AE5A 1LPZB 3ZZ3A 2D2DA 1AZZA 1SGIB 2TPIZ 2VINA 4AN7A 5B6OA 1YCPM 1O2NA 1BJVA 4Y8YA 2Y7XA 2BDGA 3A7WA 1ZPCA 1XX9A 1MH0A 4DG4A 2J38A 4YZUA 3KQDA 4U30A 5DG6A 3KQCA 1BTHH 2ZQ1A 4YLUA 1QQUA 3M3SA 3NUMA 1KDQA 1DX5M 1ZPZA 2FP7B 1LHGH 2RG3A 1G3EA 1A5IA 2ZNKH 2C8ZB 1J14A 4IMQA 1Y5UT 1W14U 4M7GA 1WTGH 1CVWH 1W3CA 4TPIZ 2V35A 2SGAA 4F49A 1EP5A 1TGBA 1QB1A 2UWLA 5LPRA 4NIYA 5DO4H 1C2KA 1M9UA 1MKXK 4ZKOU 3UNSA 4TY6A 3RMOH 1A61H 3T29A 2GT7A 4K5ZA 4MNWA 2HALA 1Y8TA 3ELAH 1MTNC 1IQHA 3FP6E 3MH7A 1BMMH 5C67A 2IN2A 3DD2H 2GGVB 1XM1A 3SU5A 3L3TA 1PQ8A 4O03A 4Y8XA 1TQ0B 3TGJE 1C2GA 5EXLA 1O3LA 1DWBH 5FX6A 3MTYA 1ESAA 2EEKA 3Q3XA 1TMBH 4FUBA 2FOEA 4YOGA 1ZPBA 3MNCA 4YTAA 2BD9A 2GCHG 5E0HA 3TH4H 2PKSB 2H1UA 3FFGA 4A1VA 1K9OE 1QBVH 1C5QA 1F2SE 1N6XA 1XMNB 1AVXA 2NU3E 3RXGA 4ESTE 1N8OC 1A5GH 1ELBA 2BMGB 4RKOB 2GZ9A 4AYVB 2V6NA 1EJAA 4CR5A 2OCVB 1H9HE 2O9QA 3ATLA 3GCNA 1SMFE 1EAXA 1D9IA 3OY5U 5IYTA 1GVKB 1CQQA 4GPGA 3UQOA 1O32A 4MPUA 3VGCB 4BTTB 1TX6A 1BRUP 4TWWA 1LPGB 1P8VC 4I32A 5L6NH 1OWJA 1TONA 3QGJA 1G30B 2CHAB 2BLQA 4NA7A 4Y71A 2YOLA 3F9EA 3QX5H 1GMDF 1P04A 5EG4A 3E0PB 1S85A 5FPYA 1NFYA 2OC1A 3LGIA 3TJVA 4BNRA 3BTWE 2ZFTA 1TFXA 4JCNA 4VGCC 1CGHA 1CBWB 1SHHB 1WSSH 1HJAB 4GSOA 1NRNH 1ORFA 1YGCH 1C2EA 1VCQA 4CH8B 1C1NA 1FY3A 1BOQA 1TRNA 2EI7A 1IQFA 2A7CA 2GZ7A 1CO7E 1GGDC 1PFXC 1BTXA 1SGTA 5DP4A 3SGQE 1AVWA 4Y0ZE 1V2WT 1C2HA 3F9FA 4JYVH 3W94A 1RTFB 3RXFA 3ZVBA 1S84A 3P70B 1F92A 3MU4A 2GV7A 3ZYDA 1S6FA 2ZZUH 4UFDH 2A4GA 2XRCA 3LGYA 1L2EA 1TNKA 3F1SB 2FOHA 1GBFA 1AZ8A 2JETC 4NWKA 1XXDA 1O5AB 3SJOA 1C5OH 3DUXH 2CV3A 2OQ5A 3KIDU 1GJ7B 2ZHQH 1MCVA 3V0XA 4HI3A 4UD9H 2Q6FA 1AU8A 3M5LA 1UTKA 1MD7A 4OS5A 1Z7KA 6CHAC 2OXSA 3KGPA 3MH4A 5J4QA 3U8OH 1QY6A 3PLKA 2A2QH 1PPCE 3V12A 1NY22 1UTNA 2FTLE 2UWPA 4WMEA 5GWZA 3IG6B 1P2IA 1P2JA 5I25A 1O37A 1K28D