1C5XB

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
248
structure length
248
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (UROKINASE-TYPE PLASMINOGEN ACTIVATOR)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 54
structure length 248
sequence length 248
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5xB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5xB01
3SJ9A 1KDQB 3UWIA 2FYQA 3GDVA 2B0FA 1H8DH 2CGAA 1O35A 1GPZA 1Z8JB 1UTJA 1P09A 2VIWA 1HJAC 1O3GA 2ZU3A 2ANWA 1TOCB 1CGIE 2AIQA 8LPRA 2NU0E 1T8LA 4ZROA 2I6QA 4FXGH 4WH6A 2FOHA 1XMNB 3TJUA 1ELTA 1EQ9A 4IC6A 1O2VA 3TJOA 3RMLH 4HTCH 3TH4H 2F83A 3QGNB 1HAPH 1V2UT 3RXJA 4A92A 4X1RU 1C2GA 1TNJA 1WOFA 1UK4A 2AGGX 4PROA 1QR3E 1YP9A 4OGXA 3EAJA 3QUMP 1RD3B 5T6GA 1O2YA 2XC0A 2Z9KA 1GI8B 1TOMH 1BBRH 2XRCA 1ZR0A 2BDGA 1VGCC 1JBUH 2ZO3H 3KGPA 1GI1A 4DIHH 3RXBA 2VIOA 2G51A 1LVYA 4ABIA 1EJNA 1TGTA 1YPMH 1G32B 2GP9B 1QRZA 1OSSA 1ELGA 1C2LA 2DUCA 2ZGCA 3GCNA 2ZDAH 2BM2A 1C5XB 2R3UA 1Z8IB 1WV7H 1ESTA 1AWHB 3FVFB 3RMOH 3M5LA 1DITH 1DANH 3SHAH 1O2KA 1PJPA 1P9SA 1DDJA 3BG4B 1XKBC 1P03A 2R0LA 1C1QA 2C8ZB 3SW2B 1SVPA 3ZZAA 1FAKH 2W3IA 2CN0H 5DG6A 3SU0A 1XUHA 1D6WA 1NRSH 3V13A 2PGBB 3SU5A 2C90B 2HRVA 2H5CA 2ZHEH 5EPYA 1C9TA 2HNTF 1ELVA 3S9BA 3Q76A 1B0FA 2J94A 1AKSB 4UONA 1UK2A 2XTTB 2RCEA 1VJ9U 1T8NA 6LPRA 4GAWA 1O30A 3AASA 3A86A 1SGIB 4JK6A 1GI3A 2H9EH 2Z3DA 5FBIA 1UCYE 2BDIA 2F9NA 2XXLA 3M61U 1AZZA 1BJVA 5EXMA 1JXPA 3ZZCA 4H6TA 3ZVFA 5GIBA 3GCHB 1VZQH 4YTAA 3LGVA 1GDQA 3Q3YA 4MNXA 3ZVCA 1BDAA 1KTTB 1E0FD 1GBAA 1QFKH 3SU6A 4U30A 1OX1A 1Y3XA 2CXVA 3GY6A 1YPEH 1HUTH 1QA7A 5CHAB 4LZ4B 1MAXA 3TLOA 1FMGA 3QZQA 7GCHG 3O8CA 4Q80A 4RN6A 4BAKB 2UWOA 2ZQ2A 4ZHMU 3SUEA 3HPTB 7KMEH 1TQ7B 3BTWE 1P3EA 5I46H 5GDSH 3T5FH 1VJAU 4NA8A 1CHOG 1S84A 2WPMS 3P92A 1VCQA 2C8WB 2P8OB 2ZQ1A 2BDCA 2ZGXH 1MTNB 3SN8A 4BAQB 2FP7B 3PWCA 2BTCE 1V3XA 2FYRA 1Q3XA 3RXTA 1UVTH 4ZH8A 3BEUA 1H8IH 3MNXA 2FTLE 4QT8C 3S69A 4NIVA 5CHAC 5E0GA 1O5BB 5ESTE 2A2XH 3GY8A 2Y80A 3BF6H 4LXBH 3SNDA 1AN1E 4ZKSU 4ISOA 1QBVH 1OP2A 1A46H 1W3CA 2RDLA 3QDZB 1RRKA 2OQUA 1TBRH 1GGDB 2EC9H 2ZFTA 1EAUA 2TPIZ 1NC6A 4Z0KA 5DJ7A 3S0NA 2OC1A 4FU7A 2QN5T 3V12A 1EPTB 2BQ7B 1TNLA 3A7XA 1P04A 2J38A 3LU9B 3S9CA 2ZCLP 3M5MA 2IOTA 4ABAA 2QC2A 5FX6A 1P9UA 1EAXA 2GD4B 3DFLA 1C5VA 3ELAH 3QGJA 2Z7FE 2V0BA 1P2MA 2ZGBH 3T62A 3OTJE 1TMUH 1D3PB 4NIXA 2FMJA 4E7NA 2O9QA 4X1NU 1O2MA 2FXRA 1FONA 3MMGA 5DP9A 2PUQH 1ZYOA 1KY9A 4LK4A 2F9UA 3QN7A 1GG6C 1F0SA 2OBQA 4NA9H 1HAOH 4AFZA 1ZGIA 2BDAA 2R2MB 1P11E 4K8YA 1FIZA 2ANMH 1P3CA 2G55A 3LH1A 1GHWH 1KIGH 1SGFG 5IYTA 3TH3H 1AVGH 1O36A 1JOUB 3OSYA 2J34A 2Q6DA 1PPBH 3RM2H 2AEIH 1YF4A 3T26A 1PYTC 1HAZB 1D6RA 2Y81A 1LCYA 4INLA 4O9VA 1DT2A 4ZUHA 4B2BA 4K5ZA 2P3FH 1NU9A 4AN7A 1UTMA 5DP7A 1A5IA 3T28A 1DE7H 3K2UA 1G9IE 1C4V2 2P95A 3STJA 2AH4X 3RXRA 1O2UA 1RGQA 1B7XB 1SGDE 5I25A 2UUYA 2YNAA 1AVXA 1TAWA 1TPSA 4NCYA 2ZNKH 3UR6A 1EX3A 1WQVH 2Y5FA 4X0WU 2DE9A 1XX9A 2J92A 3P8GA 2BQWB 2BY9X 3MU5A 3RP2A 3TIUA 1MU8B 1YYY1 4ABGA 2SGDE 2GZ8A 5F8TA 2QXJA 4M7GA 2TGPZ 4OS7A 1DOJA 1O3KA 2XWAA 3GDSA 4CRBA 3D23A 1LHDH 1C2FA 1ZTJA 1P10A 2HOBA 1V2QT 1MQ6A 1HAXB 3FZDA 2FI3E 3KEEA 1TWXB 3ZVEA 6CHAC 1C2HA 2J4IA 1FDPA 7ESTE 2P93A 5FX5A 4CRDA 1SOZA 3I29A 3UFAA 5EXLA 1TB6H 2WUCA 2HWLB 1J17T 1TQ0B 1VITG 2Z3EA 1O39A 1G37A 2ZFSA 1IQFA 3E90B 3A8DA 4X8UH 1EB1H 2PGQB 1SG8B 4NSYA 4IN1A 2VVVA 5DP3A 1MZDA 3H7OA 2ZGHA 5DP8A 1AIXH 1RS0A 1ZPCA 2TGDA 1V2TT 2A31A 1PQ7A 1NO9H 4HI3A 3A87A 1AZ8A 2GV7A 1Y3WA 1K1MA 3GY5A 1RTLA 1OWIA 2O8MA 4UFEH 3VEQB 2NU1E 1T8OA 1AHTH 4YOGA 3RXOA 1P12E 1EOLA 3PB1E 3ENSB 2P3UB 1GI4A 1WTGH 4Z6AH 1XUGA 1GVKB 2FEQH 3P8FA 1W11U 3SZNA 4OS2A 1TX6A 1NFWA 1GHBF 1O2PA 3E8LA 1IOEA 1ACBE 1P06A 4BTIB 4OS5A 1WSSH 1S83A 3P8NA 2F91A 4Q7ZA 4Y7AA 4IS5A 3RXLA 4U01A 1NPMA 2OBOA 3ZZ7A 1HDTH 1F0RA 1HAHH 1V2VT 2GCHG 2A4RA 4WVPE 2VWLA 3RXDA 4DURA 3BIVH 3SV9A 1HCGA 1QQ4A 5FHTA 3NUMA 1O3LA 1P8VC 1G2LA 2ZDNA 3ZVAA 5DP6A 3MO3A 2ZHWH 1O3NA 4GLYA 1FY8E 2EEKA 4FUHA 2A7JA 4NZLA 1K1PA 3UOUA 1DY8A 1E35B 3A83A 3RC6A 1ELFA 1TMTH 4GUXA 3M3TA 3RXIA 2ODYB 3KCGH 1DLEA 1O2TA 3A7YA 1GI7B 4AFUA 2W7UA 2AERH 1C5TA 1A2CH 3LJOA 3SV2H 2BD8A 1SGCA 4ISHH 4CR5A 1GMDG 3A7ZA 3A89A 1KLTA 2XCFA 5JB8S 3QX5H 5FCRA 4A5TS 3GOVB 4CBOA 4X2YA 1O5FH 1W2KH 1TGCA 1GJDB 5L6NH 1IQJA 1NU7B 3PMJA 2NWNA 2HLCA 4Y76A 4X2VA 5E2PA 1S0RA 1DS2E 2GCTB 1XUJA 3TH2H 3SQHE 3ATLA 3ZYEA 1C2IA 3SUDA 1EOJA 2ZZUH 1BMNH 5A0AE 3MNCA 3TNTA 1HV7A 2EI6A 1F2SE 1UMAH 1VITH 2SGFE 2ZG0H 3KQDA 1TPAE 4KGAA 2BVXH 2SNWA 4GPGA 1O2IA 4AB9A 2AMPA 1AE5A 1BB0B 1H9IE 1NY22 2Y5GA 5GWZA 1OWEA 2FTMA 4D8NA 1TA2A 1IQLA 1DWEH 2QAAA 5EXNA 3EA7A 2BOHB 2ZC9H 1P2JA 5C1YA 4RKOB 3RC5A 1FJSA 3DUXH 3FP6E 2QF3A 1U6QA 3NKKA 1MTVA 4YO9A 3VGCB 2PLXA 2NU3E 4MDSA 4NGAH 1ZJKA 3ZYDA 2J95A 1Y5BT 1L1JA 4ZXYH 4ABEA 3RC4A 4CRFA 3F9EA 1GBDA 1F5RA 4FVDA 4D9RA 2LNCA 1T8MA 4ISIH 4CH8B 1HBTH 1DXWA 1P01A 3HGNA 3LC5A 1IQIA 1MD7A 1W14U 4BANB 4TY7A 1AFQB 1L1NA 2Q6FA 1TGNA 1PPCE 1EB2A 1ANDA 6GCHF 8GCHF 1ESBA 1NROH 2OP9A 3A7VA 1G3EA 1IQNA 1BBRK 4WMDA 1DLKB 2BD5A 1DUEA 1B0EA 1GBTA 1LHCH 1W8BH 3AVZA 4E06H 5E0JA 1C5NH 2FESH 1EZUC 2HPQH 1ANCA 1O3FA 2M5TA 3OY5U 4K2YA 1FLEE 3BIUH 3TJVA 4LZ1H 4R8TB 8GCHG 4VGCC 2BB4A 3PLKA 3FAOA 1K1JA 1UCYH 1P02A 2SGAA 1OP8A 2PTCE 1ZMLA 1MCVA 1RJXB 1V2OT 5CMXH 3I78A 1C1RA 1KLIH 2QXIA 2Z9LA 1VR1H 4ASHA 2XCNA 1CGJE 1KXBA 3A88A 1FPCH 1O5CB 4YZUA 5T6DA 3ZZ9A 1C5MD 4JZDH 4ZKNU 1ZPZA 2Y7ZA 1AQ7A 1AFQC 1SPJA 1E37B 3SO3A 5AFZH 4OS4A 4FUDA 1ESAA 5LH8A 1Z7KA 2Z9IA 3KHVA 2VH0A 2AMDA 1SFIA 3ITIA 2Y82A 3RU4T 3MH6A 1KTSB 4YM9A 1BITA 3HK6B 2ESTE 2KAIA 3ZZDA 5AFYH 1NM6A 5C67A 1HYLA 1EXFA 1QTFA 4K1SA 1GVZA 4K3JA 2FX4A 3O8BA 4TYDA 1BT7A 2BHGA 2PKAA 3M7QA 2FM2A 2VWNA 4UE7H 2OTVA 4B71A 1DX5M 2JETB 2GDEH 3R3GB 1DSTA 1FAXA 1HRTH 1YPHE 2W3KA 3JZ2B 4YESB 2F9PA 2PTNA 3P17H 3PTBA 1ELCA 1HB0B 1LTOA 1TIOA 2ZECA 3ZZBA 5EW1H 2AFQB 5E8EH 1RTFB 3MO6A 2ZWLH 1GHAG 1A1RA 1HLTH 1GCTB 4JZ1A 2CJIA 3NPSA 3UNRA 3IG6B 5C2ZA 1SGYE 1B5GH 1SGQE 3P70B 1HXFH 4ABJA 1D3TB 1RIWB 2ZDKA 2VNTA 4OS1A 3E1XB 4NG9H 5A2MH 1O3EA 2FI5E 3KF2A 1IQEA 1KXEA 1S6HA 2FPZA 2STAE 1UHBA 3LKWA 1OWDA 3F68H 2R2WU 3A8CA 1EAWA 1L1GA 3SJOA 1S82A 2IJOB 1K1LA 3S7HB 3BEFB 1G3DA 1WUNH 1YPHC 1QB1A 2TGTA 4XBBA 1ETTH 2OC0A 2GKVE 4BAHB 2ZIQH 4KKDA 2PUXB 1Z6EA 1E34B 2W5EA 1H9HE 1O33A 1V6DA 1BHXF 2WV5A 2A45B 3KQBA 2SNVA 2FZZA 4ZAEA 5JB9S 2ZI2H 1AVWA 3B9FH 1LVMA 4CH2B 2G5NA 4ZKRU 3M7TA 7GCHF 1BTPA 3FP8E 3V0XA 2A7HA 3MH4A 1SGFA 3O8RA 4FU8A 3MNSA 1JRTA 3UNQA 3RU4D 1N8OB 3BG4C 2ZDVH 5FXLA 1QHRB 3GCOA 1QRWA 4Y10E 3PMBB 1QGFA 1UO6A 5DK1A 5HM2A 3UPEA 1LHGH 1CHGA 3RXUA 1RXPA 3B23B 5GXPA 1SMFE 4B76A 4NWLA 1CHOF 2ZKSA 3ZV9A 5BRRE 4YT7H 1GI2A 1CT0E 4IMZA 1QB6A 2ZTYA 2C8YB 3RDZA 1TX8A 4BOHA 1GCDA 1THRH 1NZQH 1MQ5A 2D8WA 2ZTZA 3TITA 4BXWA 3E91A 2BD2A 1MBQA 2A1DB 4YLQH 2Z9JA 2ILNA 2F9VA 2FO9A 1V2PT 3EA8A 4K1TA 1V2KT 4MLFB 6ESTA 3GYMA 5DKMA 1ELDE 1O2SA 4MNWA 1O3MA 1KDQA 3GCHC 1NFYA 2F9BH 2B7DH 4MG3A 5ABWA 4WXVA 3ATIA 2CV3A 3UIRA 4IGDA 2BOKA 1YCPH 1XVOA 5DO4H 5HYOA 1BJUA 1D9IA 2NU4E 4BTUB 1FUJA 1CA8B 1GJ5H 4FUCA 4MPXA 3MU8A 1LMWB 1ZPBA 1BTWA 5EU8A 3PYHA 1SSXA 1Y3VA 1ZTKA 1P2QA 5A09A 1Z6JH 1HXEH 2H5DA 1GMHG 2BDBA 1K22H 4TY6A 1K1NA 1QRXA 1UTPA 4Y7BA 3UR9A 2ZCHP 5HXFA 1EZQA 2P8OC 1HAYB 3DT0H 3HKJB 4ZKOU 3NK8A 2C3SA 1LVOA 1MTNC 2WPKS 2YNBA 5L2YH 3HK3B 1UTKA 1ELAA 3ZVDA 1L4ZA 4BAMB 2WPLS 1YPKH 2STBE 2GZ7A 1FPHH 3RXAA 4MPVA 4X1SU 5TCAA 3R0FA 1O32A 1TLDA 3VXEH 3I77A 1IQMA 3RM0H 1C5WB 1Q2WA 1YLCA 2VH6A 2GZ9A 3SNAA 1A0LA 1DICA 2QIQA 3Q77A 4DG4A 1ELBA 1QCPA 2BZAA 1AB9B 2VWMA 2CHAB 1AWFH 3UTUH 1YPJH 1PPFE 5EG4A 1VCWA 4WMFA 3RXPA 4D76A 4AFSA 2AGIX 5BPEA 3M5NA 1PQ5A 1BMMH 1GGDC 4B73A 4A7IB 3UQOA 4DGJA 3D62A 2QGRA 2BY8X 4JZIA 1FXYA 4TPYA 1QBOA 1EPTC 2V6NA 1DM4B 1FI8A 1JMOH 1C5PA 2B5TB 1L2EA 2BZ6H 1UK3A 3ATMA 2Q6GA 1C2JA 3IWMA 1QJ1B 1PQ8A 2A32A 3E6PH 2XBWA 1L4DA 4FUFA 1DSUA 2J9NA 3C1KA 4XOJA 3AAUA 4A1TA 1UTOA 2ZU1A 2PV9B 4F49A 1TBZH 1M9UA 3RU4E 1AU8A 4DT7B 1AB9C 4AORA 4JZFH 1KXFA 2H6MA 3PO1B 5F6MA 4X6MA 3TK9A 3MI4A 1O2OA 1FY3A 3GY2A 4HGCA 1N1LA 2SGPE 1V2RT 1WTHD 1Z8GA 1NRPH 2H9TH 1GHVH 4Y6DA 3U98H 1QJ6B 2XBXA 2VVCA 5L30H 1G3BA 1X7AC 2G4UA 1UVPA 2AMQA 3BTGE 1QY6A 3BTHE 2PSYA 4MNYA 2QXGA 2BD4A 4X6PA 4FVBA 2B8OH 2J2UA 3TPIZ 1VITF 3MO9A 1V2JT 1C5RA 2JH5D 1AE8H 1VCPA 1D4PB 1SLXB 1P2NA 4MPUA 1F92A 1SQAA 3RXKA 3FP7E 4RKJB 1TRNA 2XBYA 5GPIB 3TGIE 3WY8A 2PFEA 3SGQE 1TPPA 3RXHA 1NESE 3SNBA 4WH8A 5FBEA 4CRGA 1ANBA 1BRBE 4FUBA 4X8SH 2FLBH 4WF8A 1C2MA 1DWCH 3G01A 1QQUA 5E2OA 2TBSA 2RA3A 1GJ9B 2FS8A 3D49H 1IQKA 1G3CA 1Y5AT 1Z1IA 2FOEA 3A81A 1O31A 1TRYA 2CMYA 4O3UA 4TPIZ 2BLVA 1T4VH 2BDYA 2ZFPH 2FOGA 1PPGE 3ATKA 3LT3A 4ABBA 1UVUH 4KP0A 5DPAA 5JBAS 5JDUB 5L2ZH 2VU8E 1GL0E 1A3EH 2VIPA 4UFDH 4Y0ZE 1C1OA 1O3JA 1CE5A 4INKA 3PLPA 1Y8TA 1EPTA 1L0ZA 1W0ZU 1O5DH 1LO6A 3MFJA 5J4SA 3P6ZB 3EA9A 1MTWA 1C5LH 2GCHF 4AG1A 5FPYA 3SNCA 1YLDA 1MUEB 1P57B 1TNGA 2C4FH 1GJAB 3SU1A 2XYAA 4BAOB 2FIRH 1Z71A 4E7RG 1DUAA 1GI0A 1S85A 3LGTA 3MU4A 4ZHLU 4MQAA 8ESTE 3CENA 1YCPM 2PWXA 2R9PA 1EATA 1SGPE 3KNXA 3GCTG 4NIWA 1TALA 2I6SA 3EDXB 1O5EH 1YPGH 4Q7YA 4DW2U 4AGKA 1HAGE 2FS9A 4UDWH 4I32A 1CA0B 1GBEA 1SHHB 1QURH 3KN2A 4NSVA 4Y71A 2A0QB 3ZZ3A 3TNSA 2VINA 2ZPRA 1ZRKA 1GMDF 3M37A 2ZDMA 1WAYB 1DXPA 1C1WH 2HPPH 4IMQA 1GWAA 1C1TA 1IQGA 2BLOA 1O3CA 3RMNH 1RFNA 3SQEE 3M5OA 4SGAE 5T6FA 1QNJA 1A5HA 4FUEA 1AUJA 1AGJA 2V3OH 5F8XA 4MPWA 1OYTH 4ZMAH 1A61H 1QL9A 1GMCG 1OS8A 1HJ8A 1ELEE 3UOPA 3RXCA 3STIA 1ORFA 3NZIA 1WQSA 2AGEX 4OS6A 4Q7XA 3QLPH 4I7YH 5SGAE 2WPHS 1GJ7B 1BIOA 1GBIA 2ZU5A 1S5SA 3U8TH 5PTPA 2PKAB 2RA0A 3TJNA 3BSQA 3RLWH 3URDA 1O3BA 3K9XB 4GCHF 1LQDB 3LIWA 2FOBA 2WUBA 4NFEA 3NXPA 1NRQH 2QXHA 1N6YA 2O8LA 1MCTA 1S81A 1E36B 4X2WA 4UFGH 2JH6D 3A82A 2GX4A 4I33A 1ZJDA 1TRMA 1C1UH 1CBWB 1EKBB 1FZZA 3LC3A 4GCHG 1SFQB 1Y3UA 1W7GH 1GHYH 1OYQA 1UCYK 3LGYA 3QTOH 4CRCA 2UUFB 1GBMA 4YOIA 1K9OE 3ATWA 3LGUA 1H4WA 3GYLB 4XFQA 3HGPA 1P2IA 1TNHA 1CVWH 3H7TA 1MTSA 4K60A 1TBQH 3BTFE 1GBCA 2ZFRH 4AOQA 1QIXB 3SU4A 1Y59T 2FDAA 1G30B 3V3MA 1XKAC 1UHBB 9LPRA 4GHTA 1EP5A 1OOKB 2GCTC 5GCHG 2A4GA 1F5KU 2ZPQA 2ODPA 3T29A 1C1SA 1UVSH 2XW9A 1W7XH 2BLQA 1GJ4H 1NRRH 3QZRA 4INHA 1YBWA 3DD2H 3U1JB 2BD3A 3UUZA 3KQCA 3VXFH 1J14A 1GBFA 4XBDA 3CS0A 4UD9H 1KXCA 4X6OA 1O3OA 3AW1A 3SGAE 1ETSH 1W10U 1SLUB 2O8TA 3ZVGA 4BTTB 3BTQE 3SGBE 2BD7A 4DY7B 1XUFA 3N7OA 1CSOE 1V2MT 1DY9A 1ZRBA 1OKXA 1FN8A 5EQSA 3VGCC 1MKWH 1GVLA 2EI8A 1ZMJA 1QL7A 4CBNA 5TJXA 1THSH 1A3BH 2VWOA 2BDHA 1HJAB 5EQRA 3PWBA 3SI4H 2H1UA 2FI4E 3TK5A 1SC8U 1BTHH 4LOYH 1PPZA 5LPFA 2AYWA 4MTBA 2XBVA 5K7RA 5C5OA 2ZP0H 1WYKA 3PLBA 4DJZB 2A5AA 1C5ZB 1NS3A 5DGJA 3EQ0H 2VIDA 3F9GA 1EUFA 1SHYA 1RTKA 2ZFQH 3PROA 1GL1A 1ZSLA 1CT2E 1H1BA 4I8GA 1DVAH 3BTDE 1ABIH 2O8WA 3M36A 2PSXA 1XUIA 2ZF0H 3F9FA 3GICB 1VGCB 2BX3A 1CGHA 3SBKA 3URCA 1EASA 4JCNA 1PPHE 2WINI 4GSOA 4IW4E 4MVNA 1C2EA 2D1JA 2P3TB 3KIDU 1HFDA 1K21H 2ZU4A 2B9LA 1LPKB 4U32A 1JWTA 1YKTA 3ZZ4A 2GDDA 4JYUH 3BTEE 3VB6A 2Y6TA 1ZOMA 3LDXH 2GT7A 3MOCA 2OXSA 3T27A 3SV6A 1BA8B 1GHAF 3MWIU 4K69A 2G8TA 2QCYA 1SI5H 2ZHFH 3Q3XA 1OP0A 1BRAA 1C5OH 1EP6A 1GBHA 1ARBA 4ESTE 1T7CA 1P2OA 1GHZA 1MKXH 4WMEA 3SOSA 4O03A 1A5GH 3M3VA 4JYTA 4ISNA 3ZZ5A 1EJMA 1ZSJA 4Y8YA 3TU7H 4X8TH 2SGQE 1FIWA 3A80A 2SGEE 1MU6B 1LVBA 4TWYA 1KYNA 1ZSKA 1O2LA 4NFFA 3GISB 3SU2A 1J16A 2R3YA 1QL8A 3VPKA 3SUFA 5AHGH 4X8VH 3KL6A 1O3DA 3L3TA 2P16A 3LGWA 1OWKA 1TGBA 1PYTD 2JETC 3U69H 2BX4A 3M35A 1GHXH 2V3HH 3V7TA 2K1QA 2GV6A 1BTZA 3ZZ6A 1DWBH 5C1XA 5EW2H 1Y3YA 1YCPK 4O97A 2QF0A 2GMTB 1HPGA 4JK5A 1GCTC 1SGRE 1EZSC 1HIAA 3RXEA 4X1QU 2ZPSA 1BMAA 2SFAA 1JIMA 4WWYA 1S6FA 1FQ3A 1RIWC 1FY5A 1FNIA 4JZEH 3SUGA 1ABJH 3NWUA 1HAIH 3GY3A 3AW0A 1GI9B 4AX9H 5C20A 4K1EA 3FZZA 1C2KA 4FU9A 4FUIA 3OY6U 3Q3KA 1V2NT 5HGGA 3RXQA 1C1MA 1GI6A 3BTKE 4GVUA 2A2QH 2GTBA 4DCDA 1CT4E 1QJ7B 4KELA 3DFJA 2ALPA 1C5UA 4DVAU 5B6OA 2Q1JA 4AGJA 1HAVA 4H4FA 3T2NA 1SLVB 5A0BA 3U9AH 2OCVB 1MTUA 2GMTC 1NN6A 2HALA 2G4TA 3MU0A 1ZHMA 1H9LB 2PW8H 3DHKH 5FAHA 4FUGA 1MH0A 1ZHPA 2H9HA 2O8UA 5EODA 1UTNA 1AFEH 1O2ZA 1O2QA 5AF9H 5JYIA 1BQYA 1GI5A 4B2CA 1FY1A 1Q31A 1TE0A 4RSPA 3QWCH 1N8OC 3B8JA 1EZXC 5TCCA 1TA6A 1GMHF 1KXAA 4J2YB 4YOJA 2F3CE 2EI7A 2UUKB 1O2HA 3LONA 5JBTA 2OQ5A 2QA9E 4NA7A 1BBRE 3E16B 1TNKA 2A7CA 1MD8A 1ZMNA 4D7GA 5F8ZA 2WPIS 4KTCA 2OINA 1LHFH 3BEIB 3H5CB 3FANA 1SL3A 3BG8A 3AAVA 3E3TA 4Y8XA 1BMLA 4B75A 2ANYA 4IC5A 3TK6A 2BY5X 3LJJA 3U1IB 1AI8H 3SHCH 2R0KA 5HM9A 2Z3CA 4IBLH 1PFXC 1IAUA 1AD8H 1C4Y2 1A0JA 1JRSA 1HJ9A 3MHWU 3JZ1B 1QA0A 1S0QA 1GJBB 1NT1A 2G81E 2JKHA 4OGYA 5DP4A 1GG6B 5ETXA 3RLYH 4Y11E 4XDEA 1F7ZA 1INCA 4B1TA 2ANKH 1GBBA 4KTUA 4A1XA 4ABHA 3PMHB 1SBWA 4WY3A 2TRMA 1O38A 3E0PB 1DFPA 2GGVB 4NIYA 4B74A 4DOQA 3L6PA 1K1IA 4B2AA 3QK1A 5G4BA 1O2JA 5EQQA 3SORA 1YPLH 2VVUA 1LQEA 3F6UH 3VB5A 3O8DA 4Y0YE 1T32A 2THFB 2HGTH 1W13U 3VB3A 2FWWA 1T4UH 3ZV8A 1TPOA 3EGKH 2CF8H 1C1PA 4A6LA 2UWLA 2FLRH 1AY6H 3KQEA 1GJCB 4UFFH 3W95A 1C1VH 2OD3B 1THPB 1AKSA 2OUAA 3TVJB 3E0NB 3HKIB 3A84A 4AYYB 3RUOA 2OC8A 1CU1A 2A4QA 2QY0B 1YC0A 2UUJB 3P8OA 3RMMH 1O2RA 1UJ1A 2WPJS 4AB8A 1WU1A 4CHAB 1KLJH 2CHAC 1O3HA 2TIOA 2Z94A 1NFUA 4AYVB 5K0HA 1WBGB 5E0HA 1YGCH 3BTME 5A8XA 4YT6H 5LPRA 1QBNA 3A8AA 2ASUB 1GBJA 1TONA 1G2MA 6CHAB 1TMBH 3P95A 5HMAA 2BY6X 3F1SB 5EPNA 1W0YH 1BTUA 5DP5A 1LPZB 4WJG2 3VB7A 9ESTA 1ZHRA 3K6ZA 3RXMA 1NFXA 3MU1A 4FUJA 4AFQA 7LPRA 1Y5UT 1F0UA 3T25A 2FOCA 1O3IA 3VFEA 2OLGA 1NRNH 2FOFA 1O2XA 1O2WA 1BRUP 4Q2KA 1TNIA 1C5YB 5JBCS 4JYVH 3OU0A 1SR5C 3EYDA 3MH7A 2ZHQH 1ZGVA 1Z8RA 1IQHA 2ULLA 1ZTLA 4ZXXH 1GDNA 3GY7A 1BUIA 5AVDA 3SJ8A 2PR3A 4U2WA 5T3HA 4CHAC 3SI3H 4H42U 3IITA 4Y79A 3PO1C 4CRAA 2TGAA 5FPTA 2ZTXA 2ODQA 4BXSA 3FFGA 2AIPA 1HGTH 4J1YA 5C5NA 1DWDH 1BZXE 1PQAA 1XM1A 1BOQA 1O5AB 1HNEE 3A7TA 2ZDLA 1K28D 1TABE 5EGMA 1AUTC 1GDUA 3LPRA 1O37A 2FX6A 2JH0D 1SQOA 3Q00A 4R0IA 2ZA5A 5F03A 1C2DA 3PM3A 4NZQA 3ZZ8A 4D7FA 2BYAX 1UVOA 4I8JA 4I31A 5LPEA 2ALVA 2G52A 2PKSB 1OPHB 1AO5A 3GCTF 3ODFA 3ODDA 5H4IB 3TGJE 2FOAA 4MNVA 1C5QA 1GJ8B 1SGNE 2G00A 2PHBA 2CF9H 1LKAA 3M3SA 3MTYA 4XSKU 1F0TA 4UEHH 1MMJN 3RXSA 1LPGB 4NWKA 3U8OH 5JPMH 1GJ6A 2C8XB 2HNTE 4HZHA 4AG2A 1ANEA 4X1PU 1K1OA 2P94A 3VB4A 1SQTA 3UWJH 8KME2 2P59A 2UWPA 4ZHAA 4D9QA 3PTNA 5JBBS 2A5KA 4O3TA 1MZAA 1BHXB 2VIVA 3PV4A 1T31A 3NCLA 2Z6BD 3SNEA 1UTQA 3BN9A 3GY4A 3K65B 2FOMB 1J8AA 1GHBG 2G5VA 1CO7E 3LGIA 2NU2E 1GMCF 2PKSC 5CE1A 3CS7A 1XVMA 1V2WT 3TGKE 1BRCE 3ZVBA 5IDKA 1V2LT 2BD9A 2OC7A 1F5LA 5LGOA 1TYNA 5C1UA 1ETRH 3A85A 2ZU2A 3RXFA 3S9AA 2XC4A 3SJKA 2W7SA 4E05H 3LOXA 1E38B 3D65E 5J4QA 2KAIB 1OXGA 4YLUA 2HNTC 5A8ZA 5C3NA 3UNSA 2VGCB 2Z9GA 3UREA 1OWJA 2VIQA 1BCUH 3DA9B 2BLWA 3M7UA 4SGBE 1EAIA 3HATH 4WXIA 2VB0A 2BMGB 1SOTA 4BNRA 2BXUH 2A5IA 2ZCKP 1CA0C 1D3DB 2RG3A 1GBLA 3A7WA 1ZZZA 3F9HA 2XWBI 1P2KA 2WYGA 1QB9A 2GT8A 2D2DA 2AS9A 4DIIH 3LH3A 4TWWA 1MKWK 1C1NA 1O2GH 1V2ST 3BV9B 1YM0A 1C9PA 3SJIA 4GHQA 1PPEE 4CR9A 2YOLA 1Z1JA 2C93B 3EE0B 1D3QB 1A4WH 4JMYA 1MBMA 1BTXA 4XBCA 2A4OA 2HVXA 2Y7XA 4IN2A 3A8BA 5GCHF 2WV4A 1GBKA 3RXVA 2QYIA 4K8BA 1KXDA 2FODA 3MNBA 1O5GH 4CREA 1IHSH 2VGCC 2ZHDA 5A8YA 4ISLA 5FCKA 1KSNA 3SV7A 3MYWA 4I8KA 1IHTH 1N6XA 2VJ1A 1O0DH 1J9CH 2WYJA 1DPOA 2ZEBA 1A7SA 2IPHA 2D26C 3CP7A 1O3AA 1P05A 2BY7X 1JIRA 2BVRH 1OWHA 3K6YA 3S7KB 3QTVH 4H6SB 4X6NA 1TGSZ 2DE8A 1XUKA 1O2NA 4HFPB 1CQQA 5FPSA 3GDUA 2XC5A 4VGCB 3BTTE 1FV9A 1CBWC 1UTLM 1C5SA 1SB1H 1LKBA 1FY4A 1G36A 1XXFA 2LPRA 1SGEE 3L33A 4ABDA 1TX7A 2Y5HA 4THNH 4I8HA 3C27B 1HIAB 1TFXA 2BXTH 1C4U2 3ESTA 5ESBA 1ARCA 2QV1A 5A0CA 1J15A 2V35A 4F4OC 1LDTT 1LHEH 1AMHA 2ZFFH 5GJ4B 1K2I1 2IN2A 2H2ZA 4A1VA 1MKXK 3MH5A 3OYPA 4KTSA 1BTYA 3U8RH 1FN6A 4XE4A 1W12U 4X2XA 1O34A 1SGTA 1XXDA 3RXGA 2EA3A 1NTPA 1O3PB 1SLWB 2XNIA 1WCZA 3SU3A 3SV8A 3QO6A 3PMAB 3W94A 2BVSH 4Y8ZA 4AZ2B 2F9OA 4I8LA 6GCHG 3UY9A 1HAVB 1EJAA 1A0HB 2GVFA 2W26A 4ABFA 1ZLRA 1P0SH 1MAYA 5EOKA 1ID5H 2ZGJA 2BQ6B 3OX7U 3UQVA
chains in the Genus database with same CATH superfamily
3SJ9A 1KDQB 4XD7D 3UWIA 2FYQA 3GDVA 2B0FA 1H8DH 2CGAA 1O35A 1GPZA 1Z8JB 1UTJA 1P09A 4I86A 2VIWA 1HJAC 1O3GA 2ZU3A 2ANWA 1TOCB 1CGIE 2AIQA 3FN8A 5HIYA 8LPRA 2NU0E 1T8LA 4ZROA 2I6QA 4FXGH 4WH6A 2FOHA 1XMNB 3TJUA 1ELTA 1EQ9A 4IC6A 1O2VA 3TJOA 3RMLH 4HTCH 3TH4H 2F83A 3QGNB 1HAPH 1V2UT 3RXJA 4A92A 4X1RU 1C2GA 1TNJA 1WOFA 1UK4A 2AGGX 4PROA 1QR3E 1YP9A 4OGXA 3EAJA 3QUMP 1RD3B 5T6GA 1O2YA 2XC0A 2Z9KA 1GI8B 1TOMH 1BBRH 2XRCA 1ZR0A 2BDGA 2EQNA 1VGCC 1JBUH 2ZO3H 3KGPA 1GI1A 4DIHH 3RXBA 2VIOA 2G51A 1LVYA 4ABIA 1EJNA 1TGTA 1YPMH 1G32B 2GP9B 1QRZA 1OSSA 5CHBA 1ELGA 1C2LA 3UAIC 2DUCA 2ZGCA 3GCNA 2ZDAH 2BM2A 1C5XB 2R3UA 1Z8IB 1WV7H 1ESTA 1AWHB 3FVFB 3RMOH 3M5LA 1DITH 1DANH 3SHAH 1O2KA 1PJPA 1P9SA 1YWUA 1DDJA 3BG4B 1XKBC 1P03A 2R0LA 1C1QA 2C8ZB 3SW2B 1SVPA 3ZZAA 1FAKH 2W3IA 2CN0H 5DG6A 3SU0A 1XUHA 1D6WA 2J98A 1NRSH 3V13A 2PGBB 3SU5A 2C90B 2HRVA 2H5CA 2ZHEH 5EPYA 1C9TA 2HNTF 1ELVA 3S9BA 3Q76A 1B0FA 2J94A 1AKSB 4UONA 1UK2A 2XTTB 2RCEA 1VJ9U 1T8NA 6LPRA 4GAWA 1O30A 3AASA 3A86A 1SGIB 4JK6A 1GI3A 2H9EH 2Z3DA 5FBIA 1UCYE 2BDIA 2F9NA 2XXLA 3M61U 1AZZA 1BJVA 5EXMA 1JXPA 3KQ5A 3ZZCA 4H6TA 3ZVFA 5GIBA 3GCHB 1VZQH 4YTAA 3LGVA 1GDQA 3Q3YA 4MNXA 3ZVCA 1BDAA 1KTTB 1E0FD 1GBAA 1QFKH 3SU6A 4U30A 1OX1A 1Y3XA 2CXVA 3GY6A 1YPEH 1HUTH 1QA7A 5CHAB 4LZ4B 1MAXA 3TLOA 1FMGA 3QZQA 7GCHG 3O8CA 4Q80A 3VG8A 4RN6A 4BAKB 2UWOA 2ZQ2A 4ZHMU 3SUEA 3HPTB 7KMEH 1TQ7B 3BTWE 1P3EA 5I46H 5GDSH 3T5FH 1VJAU 4NA8A 1CHOG 1S84A 2WPMS 2K0QA 3P92A 1VCQA 2C8WB 2JIZD 2P8OB 2ZQ1A 2BDCA 2ZGXH 1MTNB 3SN8A 4BAQB 2FP7B 3PWCA 5KECA 2BTCE 1V3XA 2FYRA 1Q3XA 3RXTA 1UVTH 4ZH8A 2WPDD 3BEUA 1H8IH 3MNXA 2FTLE 4QT8C 3S69A 4NIVA 5CHAC 3FOAA 5E0GA 1O5BB 5ESTE 2A2XH 3GY8A 2Y80A 3BF6H 4LXBH 3SNDA 1AN1E 4ZKSU 4ISOA 1QBVH 1OP2A 1A46H 1W3CA 2RDLA 3QDZB 1FX0B 1RRKA 2OQUA 1TBRH 1GGDB 2EC9H 2ZFTA 1EAUA 2TPIZ 1NC6A 4Z0KA 5DJ7A 3S0NA 2OC1A 4FU7A 2QN5T 3V12A 1EPTB 2BQ7B 1TNLA 3A7XA 1P04A 2J38A 3LU9B 3S9CA 3DSPA 2ZCLP 3M5MA 2IOTA 4ABAA 2QC2A 5FX6A 1P9UA 1EAXA 2GD4B 3DFLA 1C5VA 3ELAH 3QGJA 2Z7FE 2V0BA 1P2MA 3DSOA 2ZGBH 3T62A 3OTJE 1TMUH 1D3PB 4NIXA 2FMJA 4HG6A 4E7NA 2O9QA 4X1NU 1O2MA 2FXRA 1FONA 3MMGA 5DP9A 2PUQH 1ZYOA 1KY9A 4LK4A 2F9UA 3QN7A 1GG6C 1F0SA 2OBQA 4NA9H 1HAOH 4AFZA 1ZGIA 2BDAA 2R2MB 1P11E 4K8YA 1FIZA 2ANMH 1P3CA 2G55A 3LH1A 1GHWH 1KIGH 1SGFG 5IYTA 3TH3H 1AVGH 1O36A 1JOUB 3OSYA 2J34A 2Q6DA 1PPBH 3RM2H 2AEIH 1YF4A 3T26A 1PYTC 1HAZB 1D6RA 2Y81A 2KFWA 1LCYA 4INLA 4O9VA 1DT2A 4ZUHA 4B2BA 4K5ZA 2P3FH 3NRLA 1NU9A 4AN7A 1UTMA 5DP7A 1A5IA 3T28A 1DE7H 3K2UA 1G9IE 1C4V2 2P95A 3OEED 4RI0A 3STJA 2AH4X 3RXRA 1O2UA 1RGQA 1B7XB 1SGDE 5I25A 2UUYA 2YNAA 1AVXA 1TAWA 1TPSA 4NCYA 2ZNKH 3UR6A 1EX3A 1WQVH 2Y5FA 4X0WU 2DE9A 1XX9A 2J92A 3P8GA 2BQWB 2BY9X 3MU5A 3RP2A 2W6ID 3TIUA 1MU8B 1YYY1 4ABGA 2SGDE 2GZ8A 5F8TA 2QXJA 4M7GA 2TGPZ 4OS7A 1DOJA 1O3KA 2XWAA 3GDSA 4CRBA 3D23A 1LHDH 1C2FA 1ZTJA 1P10A 2HOBA 1V2QT 1MQ6A 1HAXB 3FZDA 2FI3E 3KEEA 1TWXB 3ZVEA 6CHAC 2RDEA 1C2HA 2J4IA 1FDPA 3F2HA 2P93A 5FX5A 4CRDA 1SOZA 3I29A 7ESTE 3UFAA 5EXLA 1TB6H 2WUCA 2HWLB 1J17T 1TQ0B 1VITG 2Z3EA 1O39A 1G37A 2ZFSA 1IQFA 3E90B 5C0UA 5EIYA 3A8DA 4X8UH 1EB1H 2PGQB 3DSGA 1SG8B 4NSYA 4IN1A 2VVVA 5DP3A 1MZDA 3H7OA 2ZGHA 5DP8A 1AIXH 1RS0A 1ZPCA 2TGDA 1V2TT 2A31A 1PQ7A 1NO9H 4HI3A 3A87A 1AZ8A 2GV7A 1Y3WA 1K1MA 3GY5A 1RTLA 1OWIA 2O8MA 4UFEH 3VEQB 2QF5A 2NU1E 1T8OA 1AHTH 4YOGA 3RXOA 1P12E 1EOLA 3PB1E 3ENSB 2P3UB 1GI4A 1WTGH 2JJ1D 4Z6AH 1XUGA 1GVKB 2FEQH 3P8FA 1W11U 3SZNA 4OS2A 1TX6A 1NFWA 1GHBF 1O2PA 3E8LA 2V7QD 1IOEA 1ACBE 1P06A 4BTIB 4OS5A 1WSSH 1S83A 3P8NA 2F91A 4Q7ZA 4Y7AA 4IS5A 3RXLA 4U01A 1NPMA 2OBOA 3ZZ7A 1HDTH 1F0RA 1HAHH 1V2VT 2GCHG 2A4RA 4WVPE 2VWLA 3RXDA 4DURA 3BIVH 3SV9A 1HCGA 1QQ4A 5FHTA 3NUMA 1O3LA 1P8VC 1G2LA 2ZDNA 3ZVAA 5DP6A 3MO3A 2ZHWH 1O3NA 4GLYA 1FY8E 2EEKA 4FUHA 2A7JA 4NZLA 1K1PA 3UOUA 1DY8A 1E35B 3A83A 3RC6A 1ELFA 1TMTH 4GUXA 3M3TA 3RXIA 2ODYB 3KCGH 1DLEA 1O2TA 3A7YA 1GI7B 4AFUA 2W7UA 2AERH 1C5TA 1A2CH 3LJOA 3SV2H 2BD8A 1SGCA 4ISHH 4CR5A 1GMDG 3A7ZA 3A89A 1KLTA 5HIZA 2XCFA 5JB8S 3QX5H 5FCRA 4A5TS 3GOVB 4CBOA 4X2YA 1O5FH 1W2KH 1EFRD 1TGCA 1GJDB 5L6NH 1IQJA 1NU7B 3PMJA 2NWNA 2V3MA 2HLCA 4Y76A 4X2VA 5E2PA 1S0RA 1DS2E 2GCTB 1XUJA 3TH2H 3SQHE 3ATLA 3ZYEA 1C2IA 3SUDA 1EOJA 4ASUD 2L6OA 1BMNH 2ZZUH 5A0AE 3WWFA 3MNCA 3TNTA 1HV7A 2EI6A 4RT1A 1F2SE 1UMAH 1VITH 2SGFE 2ZG0H 3KQDA 1TPAE 4KGAA 2BVXH 2SNWA 4GPGA 1O2IA 4AB9A 2AMPA 1AE5A 1BB0B 1H9IE 1NY22 2Y5GA 5GWZA 1OWEA 2FTMA 4D8NA 1TA2A 1IQLA 1DWEH 2QAAA 2QF4A 5EXNA 5C0TA 3EA7A 2BOHB 2ZC9H 1P2JA 5C1YA 4RKOB 3RC5A 1FJSA 3DUXH 3FP6E 2QF3A 1U6QA 3NKKA 1MTVA 4YO9A 3VGCB 2PLXA 2HVYB 2NU3E 4MDSA 4NGAH 1ZJKA 3ZYDA 2J95A 1Y5BT 1L1JA 4ZXYH 2J98B 4ABEA 3RC4A 4CRFA 3F9EA 1GBDA 1F5RA 4FVDA 4D9RA 2LNCA 1T8MA 4ISIH 4CH8B 1HBTH 1DXWA 1P01A 3HGNA 3LC5A 3FO8D 1IQIA 1MD7A 1W14U 1K0HA 4BANB 4TY7A 1AFQB 1L1NA 2Q6FA 2RFKC 1TGNA 1PPCE 1EB2A 1ANDA 6GCHF 8GCHF 1ESBA 1E1QD 1NROH 2OP9A 3A7VA 1G3EA 1IQNA 1BBRK 3PV5A 1QZ8A 4WMDA 1DLKB 2BD5A 1DUEA 1B0EA 1COWD 1GBTA 1LHCH 1W8BH 3AVZA 4E06H 5E0JA 5C17A 1C5NH 2FESH 1EZUC 2HPQH 1ANCA 1O3FA 2M5TA 3OY5U 4K2YA 1FLEE 3BIUH 3TJVA 4LZ1H 4R8TB 8GCHG 4VGCC 2BB4A 3PLKA 3FAOA 1K1JA 1UCYH 4P02A 1P02A 2SGAA 1OP8A 2PTCE 1ZMLA 1MCVA 1RJXB 1V2OT 5CMXH 3I78A 1C1RA 1KLIH 2QXIA 2Z9LA 1SKYE 1VR1H 4ASHA 2XCNA 1CGJE 1KXBA 3A88A 1FPCH 1O5CB 4YZUA 5T6DA 3ZZ9A 1C5MD 4JZDH 4ZKNU 1ZPZA 2F43B 2Y7ZA 1AQ7A 1AFQC 1SPJA 1E37B 3SO3A 5AFZH 4OS4A 4FUDA 1ESAA 5LH8A 1Z7KA 2Z9IA 3KHVA 2VH0A 2AMDA 1SFIA 3ITIA 2Y82A 4Z1MD 3RU4T 3MH6A 1KTSB 4YM9A 1BITA 3HK6B 2ESTE 2KAIA 3ZZDA 5AFYH 1NM6A 5C67A 1HYLA 1EXFA 1QTFA 4K1SA 1GVZA 4K3JA 2FX4A 3O8BA 4TYDA 1BT7A 2BHGA 2PKAA 3M7QA 2FM2A 2VWNA 4UE7H 2OTVA 4B71A 1DX5M 2JETB 2GDEH 2F4LA 3R3GB 1DSTA 1FAXA 1HRTH 1YPHE 2W3KA 3JZ2B 2KX4A 4YESB 2F9PA 2PTNA 3P17H 3PTBA 3OEHD 1ELCA 1HB0B 1LTOA 1TIOA 2ZECA 3ZZBA 5EW1H 2AFQB 5E8EH 1RTFB 3MO6A 2ZWLH 1GHAG 1A1RA 1HLTH 1GCTB 4JZ1A 2CJIA 3NPSA 4Q63A 5F53A 3UNRA 3IG6B 5C2ZA 1SGYE 1B5GH 1SGQE 3P70B 1HXFH 4ABJA 1D3TB 2GJGA 1RIWB 2ZDKA 2VNTA 4OS1A 3E1XB 4NG9H 5A2MH 1O3EA 2FI5E 3KF2A 1IQEA 1KXEA 1S6HA 2FPZA 2STAE 1UHBA 3LKWA 1OWDA 3F68H 2R2WU 3A8CA 1EAWA 1L1GA 3SJOA 1S82A 2IJOB 1K1LA 3S7HB 3BEFB 1G3DA 1WUNH 1YPHC 1QB1A 2TGTA 4XBBA 1ETTH 2OC0A 2GKVE 4BAHB 2ZIQH 4KKDA 2PUXB 1Z6EA 1E34B 2W5EA 1H9HE 1O33A 1V6DA 1BHXF 2WV5A 2A45B 3KQBA 2SNVA 2FZZA 4ZAEA 5JB9S 2YMSD 1AVWA 2ZI2H 3B9FH 1LVMA 4CH2B 2G5NA 4ZKRU 3M7TA 3ZIAD 7GCHF 1BTPA 3FP8E 3V0XA 2A7HA 3MH4A 1SGFA 3O8RA 3N7DA 4FU8A 3MNSA 1JRTA 3UNQA 3RU4D 1N8OB 3BG4C 2ZDVH 5FXLA 1QHRB 3GCOA 1QRWA 4Y10E 3PMBB 1QGFA 1UO6A 5DK1A 3PV2A 5HM2A 3UPEA 1LHGH 1CHGA 3RXUA 1RXPA 3B23B 5GXPA 1SMFE 4B76A 4NWLA 1CHOF 2ZKSA 3ZV9A 5BRRE 4YT7H 1GI2A 1CT0E 4IMZA 1QB6A 2ZTYA 2C8YB 3RDZA 1TX8A 4BOHA 1GCDA 3KYFA 1THRH 5CDFE 1NZQH 1MQ5A 2D8WA 2ZTZA 3TITA 4BXWA 3E91A 2BD2A 1MBQA 2A1DB 4YLQH 2Z9JA 2ILNA 2F9VA 2FO9A 2JDID 1V2PT 3EA8A 4K1TA 1V2KT 4MLFB 6ESTA 3F0PA 3GYMA 5DKMA 1ELDE 1O2SA 4MNWA 1O3MA 1KDQA 3GCHC 1NFYA 2F9BH 2B7DH 4MG3A 5ABWA 4WXVA 3ATIA 2CV3A 3UIRA 4IGDA 2BOKA 1YCPH 1XVOA 5DO4H 3OE7D 5HYOA 1BJUA 1D9IA 2NU4E 1W0KD 4BTUB 1FUJA 1CA8B 1GJ5H 4FUCA 4MPXA 3MU8A 1LMWB 1ZPBA 1BTWA 5EU8A 3PYHA 1SSXA 1Y3VA 1ZTKA 1P2QA 5A09A 1Z6JH 1HXEH 2H5DA 1GMHG 2BDBA 1K22H 4TY6A 1K1NA 1QRXA 1UTPA 4Y7BA 3UR9A 2ZCHP 5HXFA 1EZQA 2P8OC 1HAYB 3DT0H 3HKJB 4ZKOU 3NK8A 2C3SA 1LVOA 1MTNC 2WPKS 2YNBA 5L2YH 3MQKC 3HK3B 1UTKA 4B6FA 1ELAA 3ZVDA 1L4ZA 4BAMB 2WPLS 1YPKH 2STBE 2GZ7A 1FPHH 3RXAA 3KYGA 4MPVA 4X1SU 5TCAA 3R0FA 1O32A 1SQRA 1TLDA 3VXEH 3I77A 3SYJA 1IQMA 3RM0H 1C5WB 1Q2WA 1YLCA 2VH6A 2GZ9A 3SNAA 1A0LA 1DICA 2QIQA 3Q77A 4DG4A 1ELBA 1QCPA 2BZAA 1AB9B 2VWMA 2CHAB 1AWFH 3UTUH 1YPJH 1PPFE 5EG4A 1VCWA 4WMFA 3RXPA 4D76A 4AFSA 2WZQA 2AGIX 5BPEA 3M5NA 1PQ5A 1BMMH 1GGDC 4B73A 4A7IB 3UQOA 4DGJA 3D62A 2QGRA 2BY8X 4JZIA 3DCLA 1FXYA 4TPYA 1QBOA 1EPTC 2V6NA 1DM4B 1FI8A 1JMOH 1C5PA 2B5TB 1L2EA 2BZ6H 1UK3A 3ATMA 2Q6GA 1C2JA 2YMSB 3IWMA 1QJ1B 1PQ8A 2A32A 3E6PH 2XBWA 1L4DA 4FUFA 1DSUA 2J9NA 3C1KA 4XOJA 3AAUA 4A1TA 1UTOA 2ZU1A 2PV9B 4F49A 1TBZH 1M9UA 3RU4E 1AU8A 4DT7B 1AB9C 4AORA 4JZFH 1KXFA 2H6MA 3PO1B 5F6MA 2QE7D 4X6MA 3TK9A 3MI4A 1O2OA 1FY3A 3GY2A 4HGCA 1N1LA 2SGPE 1V2RT 1WTHD 1Z8GA 1NRPH 2H9TH 1GHVH 4Y6DA 3U98H 1QJ6B 2XBXA 2VVCA 5L30H 1G3BA 1X7AC 2G4UA 1UVPA 5DN6D 2AMQA 3BTGE 1QY6A 3BTHE 2PSYA 4MNYA 2QXGA 2BD4A 4X6PA 4FVBA 2B8OH 2J2UA 3TPIZ 1VITF 4ACAA 3MO9A 1V2JT 1C5RA 2JH5D 2KCYA 1AE8H 1VCPA 1D4PB 1SLXB 1P2NA 4MPUA 1F92A 1SQAA 3RXKA 3FP7E 4RKJB 1TRNA 2XBYA 5GPIB 3TGIE 3WY8A 2PFEA 3SGQE 1TPPA 3RXHA 1NESE 3SNBA 4WH8A 5FBEA 4CRGA 1ANBA 1BRBE 4FUBA 4X8SH 2FLBH 4WF8A 1C2MA 1DWCH 3G01A 1QQUA 5E2OA 4TSFD 2TBSA 2RA3A 1GJ9B 2FS8A 3D49H 1IQKA 1G3CA 1Y5AT 1Z1IA 2FOEA 4FOUC 3A81A 1O31A 1TRYA 2CMYA 4O3UA 1W0JD 4TPIZ 2BLVA 1T4VH 2BDYA 2ZFPH 2FOGA 1PPGE 3ATKA 3LT3A 4ABBA 1UVUH 4KP0A 5DPAA 4FETA 5JBAS 5JDUB 5L2ZH 2VU8E 1GL0E 1A3EH 2VIPA 4M9FA 4UFDH 4Y0ZE 1C1OA 1O3JA 1CE5A 4INKA 3PLPA 1Y8TA 1EPTA 1H8HD 1L0ZA 1W0ZU 1O5DH 1LO6A 3MFJA 5J4SA 3P6ZB 3EA9A 1OHHD 1MTWA 1C5LH 2GCHF 4AG1A 5FPYA 3SNCA 5HKKD 1YLDA 1MUEB 1P57B 1TNGA 2C4FH 1GJAB 3SU1A 2XYAA 4BAOB 2FIRH 1Z71A 4E7RG 1DUAA 1GI0A 1S85A 3LGTA 3MU4A 4ZHLU 4MQAA 8ESTE 3CENA 1YCPM 2PWXA 2R9PA 3FKSD 1EATA 1SGPE 3KNXA 3GCTG 4NIWA 1TALA 2I6SA 3EDXB 2JJ2D 2J5UA 3W1EA 1O5EH 1YPGH 4Q7YA 4DW2U 4AGKA 1HAGE 2FS9A 4UDWH 4I32A 1CA0B 1GBEA 1SHHB 1QURH 3KN2A 4NSVA 4Y71A 2A0QB 3ZZ3A 3TNSA 2VINA 2ZPRA 1ZRKA 1GMDF 3M37A 2ZDMA 1WAYB 1DXPA 1C1WH 2HPPH 3N99A 4IMQA 1GWAA 1C1TA 1IQGA 2BLOA 1O3CA 3RMNH 1RFNA 3SQEE 3M5OA 4SGAE 5T6FA 1QNJA 1A5HA 4FUEA 1AUJA 1AGJA 2PP6A 2V3OH 5F8XA 4MPWA 1OYTH 4ZMAH 1A61H 4TT3D 1QL9A 1GMCG 1OS8A 1HJ8A 1ELEE 3UOPA 3RXCA 3STIA 1ORFA 3NZIA 1WQSA 2AGEX 4OS6A 4Q7XA 3QLPH 4I7YH 5SGAE 2WPHS 1GJ7B 1BIOA 1GBIA 3U28C 2ZU5A 1S5SA 3U8TH 3N7EA 5PTPA 2PKAB 2RA0A 3TJNA 3BSQA 3RLWH 3URDA 1O3BA 3K9XB 4GCHF 1LQDB 3LIWA 2FOBA 2WUBA 4NFEA 3WWBA 3NXPA 1NRQH 2QXHA 1N6YA 2O8LA 1MCTA 1S81A 1E36B 4X2WA 4UFGH 2JH6D 3A82A 2WSSD 2GX4A 4I33A 1ZJDA 1TRMA 1C1UH 1CBWB 1EKBB 1FZZA 3LC3A 4GCHG 1SFQB 1Y3UA 1W7GH 1GHYH 1OYQA 1UCYK 3LGYA 3QTOH 4CRCA 2UUFB 1GBMA 4YOIA 1K9OE 3ATWA 3LGUA 1H4WA 3GYLB 4XFQA 3HGPA 1P2IA 1TNHA 1CVWH 3H7TA 1MTSA 4K60A 1TBQH 3BTFE 3SZEA 1GBCA 2ZFRH 4AOQA 1QIXB 3SU4A 1Y59T 2FDAA 2KCPA 1G30B 3V3MA 1XKAC 1UHBB 9LPRA 4GHTA 1EP5A 1OOKB 2GCTC 5GCHG 2A4GA 1F5KU 2ZPQA 2ODPA 3T29A 1C1SA 1UVSH 2XW9A 1W7XH 2BLQA 1GJ4H 4YXWD 1NRRH 3QZRA 4INHA 1YBWA 3DD2H 3U1JB 2BD3A 3UUZA 3KQCA 3VXFH 1J14A 1GBFA 4XBDA 3CS0A 4UD9H 1KXCA 4X6OA 1O3OA 3AW1A 3SGAE 1ETSH 1W10U 1SLUB 3F0OA 2O8TA 3ZVGA 4BTTB 3BTQE 3SGBE 2BD7A 4DY7B 3EE7A 1XUFA 3N7OA 1CSOE 1V2MT 1DY9A 1ZRBA 1OKXA 1FN8A 5EQSA 1WXRA 3VGCC 1MKWH 1GVLA 2EI8A 1ZMJA 1QL7A 4CBNA 2KCAA 5TJXA 1THSH 1A3BH 2VWOA 2BDHA 1HJAB 5EQRA 5KEDA 3PWBA 3SI4H 2H1UA 2FI4E 3TK5A 1SC8U 1BTHH 4LOYH 1PPZA 5LPFA 2AYWA 4MTBA 2XBVA 5K7RA 5C5OA 2ZP0H 1WYKA 3PLBA 4DJZB 2A5AA 1C5ZB 1NS3A 1NBMD 5DGJA 3EQ0H 2VIDA 2KM0A 3F9GA 1EUFA 1SHYA 1RTKA 2ZFQH 3F2GA 3PROA 1GL1A 1ZSLA 1MABB 1CT2E 1H1BA 4I8GA 1DVAH 3BTDE 1ABIH 2O8WA 4ACBA 3M36A 2PSXA 1XUIA 2ZF0H 3F9FA 3GICB 1VGCB 2BX3A 1CGHA 3SBKA 3URCA 1EASA 4JCNA 1PPHE 2WINI 4GSOA 4IW4E 4MVNA 1C2EA 2D1JA 2P3TB 3KIDU 1HFDA 1K21H 2ZU4A 2B9LA 1LPKB 4U32A 1JWTA 1YKTA 3ZZ4A 2GDDA 4JYUH 3BTEE 3VB6A 2Y6TA 1ZOMA 3LDXH 2GT7A 3MOCA 2OXSA 3T27A 3SV6A 3AK5A 1BA8B 1GHAF 3MWIU 4K69A 2G8TA 2QCYA 1SI5H 2ZHFH 3Q3XA 1OP0A 1BRAA 1C5OH 1EP6A 1GBHA 1ARBA 4ESTE 1T7CA 1P2OA 1GHZA 1MKXH 1BMFD 4WMEA 3SOSA 4O03A 1A5GH 3M3VA 4JYTA 4ISNA 3ZZ5A 1EJMA 1ZSJA 4Y8YA 3TU7H 4X8TH 2SGQE 1FIWA 3A80A 2SGEE 1MU6B 2KR7A 1LVBA 4TWYA 1KYNA 1ZSKA 1O2LA 4NFFA 3GISB 3SU2A 1J16A 2R3YA 1QL8A 3VPKA 3SUFA 5AHGH 4X8VH 3KL6A 1O3DA 3L3TA 2P16A 3LGWA 2XNDD 1OWKA 1TGBA 1PYTD 2JETC 3U69H 2BX4A 2M2AA 3M35A 1GHXH 2V3HH 3V7TA 2K1QA 2GV6A 1BTZA 3ZZ6A 1DWBH 5C1XA 3UB0A 5EW2H 1Y3YA 5B6LA 4F48B 1YCPK 3CNRA 4O97A 2QF0A 2GMTB 1HPGA 4JK5A 1GCTC 1SGRE 4AC9A 4P00A 1EZSC 1HIAA 3RXEA 4X1QU 2ZPSA 1BMAA 2SFAA 1JIMA 4WWYA 1S6FA 1FQ3A 1RIWC 1FY5A 1FNIA 4JZEH 2XOKD 3SUGA 1ABJH 3NWUA 1HAIH 3GY3A 3AW0A 1GI9B 4AX9H 5C20A 4K1EA 3FZZA 1C2KA 4FU9A 4FUIA 3OY6U 3Q3KA 1V2NT 5HGGA 3RXQA 1C1MA 1GI6A 3BTKE 4GVUA 2A2QH 2EY4C 2GTBA 4DCDA 1CT4E 1QJ7B 4KELA 2OK5A 3DFJA 2ALPA 1C5UA 4DVAU 5B6OA 5EJ1A 2Q1JA 4AGJA 1HAVA 4H4FA 3T2NA 1SLVB 5A0BA 3U9AH 1NBME 2OCVB 1MTUA 2GMTC 3GS9A 1NN6A 2HALA 2G4TA 3MU0A 1ZHMA 1H9LB 2PW8H 3DHKH 5FAHA 4FUGA 1MH0A 2CK3D 1ZHPA 2H9HA 2O8UA 5EODA 1S6LA 1UTNA 2L74A 1AFEH 1O2ZA 1O2QA 4DT4A 5AF9H 5JYIA 1BQYA 1GI5A 4B2CA 1FY1A 1Q31A 1TE0A 4RSPA 3QWCH 1N8OC 3B8JA 1EZXC 5TCCA 1TA6A 1GMHF 1KXAA 4J2YB 4YOJA 2F3CE 2EI7A 2UUKB 1O2HA 3LONA 5JBTA 2OQ5A 2QA9E 2IPQX 1BBRE 4NA7A 4XRNA 3E16B 1TNKA 2A7CA 1MD8A 1ZMNA 4D7GA 5F8ZA 2WPIS 4KTCA 2OINA 1LHFH 4RT0A 3BEIB 3H5CB 3FANA 1SL3A 3BG8A 1E1RD 3AAVA 3E3TA 4Y8XA 1BMLA 4B75A 1UW7A 2ANYA 2IJD1 4IC5A 2WV9A 3TK6A 2BY5X 3LJJA 3U1IB 1AI8H 4F55A 2LELA 3SHCH 2R0KA 5HM9A 2Z3CA 4IBLH 1PFXC 1IAUA 1AD8H 1C4Y2 1A0JA 1JRSA 1HJ9A 3MHWU 3JZ1B 1QA0A 1S0QA 1GJBB 1NT1A 2G81E 2JKHA 4OGYA 5DP4A 1GG6B 5ETXA 3RLYH 4Y11E 1YY3A 4XDEA 1F7ZA 1INCA 4B1TA 2ANKH 1GBBA 4KTUA 4A1XA 4ABHA 3PMHB 1SBWA 4WY3A 2KCOA 2TRMA 1O38A 3E0PB 1DFPA 2GGVB 4NIYA 4B74A 4DOQA 3L6PA 1K1IA 4B2AA 3QK1A 5G4BA 1O2JA 5EQQA 3SORA 5EJLA 2K8IA 1YPLH 2VVUA 1LQEA 3F6UH 3VB5A 3O8DA 4Y0YE 1T32A 2THFB 2HGTH 3PRBA 1W13U 3VB3A 2FWWA 1T4UH 3ZV8A 1TPOA 3EGKH 2CF8H 1C1PA 4A6LA 2UWLA 2FLRH 1AY6H 3KQEA 1GJCB 4UFFH 3W95A 1C1VH 2OD3B 1THPB 1AKSA 2OUAA 5DSFA 3TVJB 3E0NB 3HKIB 2J97A 3A84A 4AYYB 3RUOA 2OC8A 1CU1A 2A4QA 2QY0B 1YC0A 2UUJB 3P8OA 3RMMH 1O2RA 1UJ1A 2WPJS 4AB8A 1WU1A 4CHAB 1KLJH 2CHAC 1O3HA 2TIOA 2Z94A 1NFUA 4AYVB 5K0HA 1WBGB 5E0HA 1YGCH 3BTME 5C94A 5A8XA 4YT6H 5LPRA 1QBNA 3A8AA 4OM9A 2ASUB 1GBJA 1TONA 1G2MA 6CHAB 1TMBH 3P95A 5HMAA 2VBCA 5GNDA 2BY6X 3F1SB 5EPNA 1W0YH 1BTUA 5DP5A 1LPZB 4WJG2 3VB7A 9ESTA 1ZHRA 3K6ZA 3RXMA 1NFXA 3MU1A 4FUJA 4AFQA 7LPRA 1Y5UT 1F0UA 3T25A 2FOCA 5EJZA 1O3IA 3VFEA 2YMSC 2OLGA 1NRNH 2FOFA 2WHXA 1O2XA 1O2WA 1BRUP 4Q2KA 1TNIA 1VKYA 1C5YB 5JBCS 4JYVH 3OU0A 1SR5C 3EYDA 3MH7A 2ZHQH 1ZGVA 2AHME 1Z8RA 1IQHA 2ULLA 3OAAD 1ZTLA 4ZXXH 1GDNA 3GY7A 1BUIA 5AVDA 3SJ8A 2PR3A 4U2WA 5T3HA 4CHAC 3SI3H 4H42U 3IITA 4Y79A 3PO1C 4CRAA 2TGAA 5FPTA 2ZTXA 2ODQA 4BXSA 3FFGA 2AIPA 1HGTH 4J1YA 5C5NA 1DWDH 1BZXE 1PQAA 1XM1A 1BOQA 1O5AB 1HNEE 3A7TA 2ZDLA 1K28D 1TABE 5EGMA 1AUTC 1GDUA 3LPRA 1O37A 2FX6A 3H09A 2JH0D 1SQOA 3Q00A 4R0IA 2ZA5A 5F03A 1C2DA 3PM3A 4NZQA 3ZZ8A 4D7FA 2BYAX 1UVOA 4I8JA 4I31A 5LPEA 2ALVA 2G52A 2PKSB 1OPHB 1AO5A 3GCTF 3ODFA 3ODDA 5H4IB 5KGOA 3TGJE 2FOAA 4MNVA 1C5QA 1GJ8B 1SGNE 2G00A 2PHBA 5IK2D 2CF9H 1LKAA 1H8ED 3M3SA 3MTYA 1F0TA 4UEHH 1MMJN 4XSKU 1LPGB 4NWKA 3RXSA 3U8OH 5JPMH 1GJ6A 2C8XB 2HNTE 4HZHA 4AG2A 2HLDD 1ANEA 4X1PU 1K1OA 2P94A 3VB4A 1SQTA 3UWJH 8KME2 2P59A 2UWPA 4ZHAA 4D9QA 4B6EA 3PTNA 5JBBS 2A5KA 4O3TA 1MZAA 1BHXB 2VIVA 3PV4A 1T31A 3NCLA 2Z6BD 3SNEA 1UTQA 3BN9A 3GY4A 3K65B 2FOMB 1J8AA 1GHBG 3OFND 2G5VA 1CO7E 3LGIA 2NU2E 1GMCF 2PKSC 5CE1A 3CS7A 1XVMA 1V2WT 3TGKE 1BRCE 3ZVBA 5IDKA 1V2LT 2BD9A 2OC7A 1F5LA 5LGOA 1TYNA 5C1UA 1ETRH 3A85A 2ZU2A 3RXFA 3S9AA 2XC4A 3SJKA 2W7SA 4E05H 3LOXA 1E38B 3D65E 5J4QA 2KAIB 1OXGA 4YLUA 2HNTC 5A8ZA 5C3NA 3UNSA 2VGCB 2Z9GA 3UREA 1OWJA 3WW7A 2VIQA 1BCUH 3DA9B 2BLWA 3M7UA 4SGBE 1EAIA 3HATH 4WXIA 2VB0A 2BMGB 1SOTA 1E79D 4BNRA 2BXUH 2A5IA 2ZCKP 1CA0C 1D3DB 2RG3A 1GBLA 3A7WA 1ZZZA 3F9HA 2XWBI 1P2KA 2WYGA 1QB9A 3OTPA 2GT8A 2D2DA 2AS9A 4DIIH 3LH3A 4TWWA 1MKWK 1C1NA 1O2GH 1V2ST 2KZ4A 3BV9B 1YM0A 1C9PA 3SJIA 4GHQA 1PPEE 4CR9A 2YOLA 1Z1JA 2C93B 1YLNA 3EE0B 1D3QB 1A4WH 4JMYA 1MBMA 1BTXA 4XBCA 2A4OA 2HVXA 2Y7XA 4IN2A 3A8BA 5GCHF 2WV4A 1GBKA 3RXVA 2QYIA 4K8BA 1KXDA 2FODA 3MNBA 1O5GH 4CREA 1IHSH 2VGCC 2ZHDA 4ZCNA 5A8YA 4ISLA 5FCKA 1KSNA 3SV7A 3MYWA 4I8KA 1IHTH 1N6XA 2VJ1A 1O0DH 4Q4LA 1J9CH 3F3BA 2WYJA 1DPOA 2ZEBA 1A7SA 2IPHA 2D26C 3CP7A 1O3AA 1P05A 2BY7X 1JIRA 2BVRH 1OWHA 3K6YA 3S7KB 3QTVH 4H6SB 3PRDA 4X6NA 1TGSZ 2DE8A 1XUKA 1O2NA 4HFPB 1CQQA 5FPSA 3GDUA 2XC5A 4VGCB 3BTTE 1FV9A 1CBWC 1UTLM 1C5SA 1SB1H 1LKBA 1FY4A 1G36A 1XXFA 2LPRA 1SGEE 3L33A 4ABDA 1TX7A 2Y5HA 4THNH 4I8HA 3C27B 1HIAB 1KMHB 1TFXA 2BXTH 1C4U2 3ESTA 5ESBA 1ARCA 2QV1A 5A0CA 1J15A 2V35A 4F4OC 1LDTT 5T1VA 1LHEH 1AMHA 2ZFFH 5GJ4B 1K2I1 2IN2A 2H2ZA 4A1VA 1MKXK 3MH5A 3OYPA 5FL7D 4KTSA 1BTYA 1WDIA 2LP6A 3U8RH 1FN6A 4XE4A 1W12U 4X2XA 1O34A 1SGTA 1XXDA 3F2FA 3RXGA 2EA3A 1NTPA 1O3PB 1SLWB 2XNIA 1WCZA 3SU3A 3SV8A 3QO6A 3PMAB 3W94A 2BVSH 4Y8ZA 2W6JD 4AZ2B 2F9OA 4I8LA 6GCHG 3UY9A 1HAVB 1EJAA 1A0HB 2GVFA 2W26A 4ABFA 1ZLRA 1P0SH 1MAYA 5EOKA 1ID5H 2ZGJA 2BQ6B 3OX7U 3UQVA
chains in the Genus database with same CATH topology
3SJ9A 1KDQB 3UWIA 2FYQA 3GDVA 2B0FA 1H8DH 2CGAA 1O35A 1GPZA 1Z8JB 1UTJA 1P09A 2VIWA 1HJAC 1O3GA 2ZU3A 2ANWA 1TOCB 1CGIE 2AIQA 8LPRA 2NU0E 1T8LA 4ZROA 2I6QA 4FXGH 4WH6A 2FOHA 1XMNB 3TJUA 1ELTA 1EQ9A 4IC6A 1O2VA 3TJOA 3RMLH 4HTCH 3TH4H 2F83A 3QGNB 1HAPH 1V2UT 3RXJA 4A92A 4X1RU 1C2GA 1TNJA 1WOFA 1UK4A 2AGGX 4PROA 1QR3E 1YP9A 4OGXA 3EAJA 3QUMP 1RD3B 5T6GA 1O2YA 2XC0A 2Z9KA 1GI8B 1TOMH 1BBRH 2XRCA 1ZR0A 2BDGA 1VGCC 1JBUH 2ZO3H 3KGPA 1GI1A 4DIHH 3RXBA 2VIOA 2G51A 1LVYA 4ABIA 1EJNA 1TGTA 1YPMH 1G32B 2GP9B 1QRZA 1OSSA 1ELGA 1C2LA 2DUCA 2ZGCA 3GCNA 2ZDAH 2BM2A 1C5XB 2R3UA 1Z8IB 1WV7H 1ESTA 1AWHB 3FVFB 3RMOH 3M5LA 1DITH 1DANH 3SHAH 1O2KA 1PJPA 1P9SA 1DDJA 3BG4B 1XKBC 1P03A 2R0LA 1C1QA 2C8ZB 3SW2B 1SVPA 3ZZAA 1FAKH 2W3IA 2CN0H 5DG6A 3SU0A 1XUHA 1D6WA 1NRSH 3V13A 2PGBB 3SU5A 2C90B 2HRVA 2H5CA 2ZHEH 5EPYA 1C9TA 2HNTF 1ELVA 3S9BA 3Q76A 1B0FA 2J94A 1AKSB 4UONA 1UK2A 2XTTB 2RCEA 1VJ9U 1T8NA 6LPRA 4GAWA 1O30A 3AASA 3A86A 1SGIB 4JK6A 1GI3A 2H9EH 2Z3DA 5FBIA 1UCYE 2BDIA 2F9NA 2XXLA 3M61U 1AZZA 1BJVA 5EXMA 1JXPA 3ZZCA 4H6TA 3ZVFA 5GIBA 3GCHB 1VZQH 4YTAA 3LGVA 1GDQA 3Q3YA 4MNXA 3ZVCA 1BDAA 1KTTB 1E0FD 1GBAA 1QFKH 3SU6A 4U30A 1OX1A 1Y3XA 2CXVA 3GY6A 1YPEH 1HUTH 1QA7A 5CHAB 4LZ4B 1MAXA 3TLOA 1FMGA 3QZQA 7GCHG 3O8CA 4Q80A 4RN6A 4BAKB 2UWOA 2ZQ2A 4ZHMU 3SUEA 3HPTB 7KMEH 1TQ7B 3BTWE 1P3EA 5I46H 5GDSH 3T5FH 1VJAU 4NA8A 1CHOG 1S84A 2WPMS 3P92A 1VCQA 2C8WB 2P8OB 2ZQ1A 2BDCA 2ZGXH 1MTNB 3SN8A 4BAQB 2FP7B 3PWCA 2BTCE 1V3XA 2FYRA 1Q3XA 3RXTA 1UVTH 4ZH8A 3BEUA 1H8IH 3MNXA 2FTLE 4QT8C 3S69A 4NIVA 5CHAC 5E0GA 1O5BB 5ESTE 2A2XH 3GY8A 2Y80A 3BF6H 4LXBH 3SNDA 1AN1E 4ZKSU 4ISOA 1QBVH 1OP2A 1A46H 1W3CA 2RDLA 3QDZB 1RRKA 2OQUA 1TBRH 1GGDB 2EC9H 2ZFTA 1EAUA 2TPIZ 1NC6A 4Z0KA 5DJ7A 3S0NA 2OC1A 4FU7A 2QN5T 3V12A 1EPTB 2BQ7B 1TNLA 3A7XA 1P04A 2J38A 3LU9B 3S9CA 2ZCLP 3M5MA 2IOTA 4ABAA 2QC2A 5FX6A 1P9UA 1EAXA 2GD4B 3DFLA 1C5VA 3ELAH 3QGJA 2Z7FE 2V0BA 1P2MA 2ZGBH 3T62A 3OTJE 1TMUH 1D3PB 4NIXA 2FMJA 4E7NA 2O9QA 4X1NU 1O2MA 2FXRA 1FONA 3MMGA 5DP9A 2PUQH 1ZYOA 1KY9A 4LK4A 2F9UA 3QN7A 1GG6C 1F0SA 2OBQA 4NA9H 1HAOH 4AFZA 1ZGIA 2BDAA 2R2MB 1P11E 4K8YA 1FIZA 2ANMH 1P3CA 2G55A 3LH1A 1GHWH 1KIGH 1SGFG 5IYTA 3TH3H 1AVGH 1O36A 1JOUB 3OSYA 2J34A 2Q6DA 1PPBH 3RM2H 2AEIH 1YF4A 3T26A 1PYTC 1HAZB 1D6RA 2Y81A 1LCYA 4INLA 4O9VA 1DT2A 4ZUHA 4B2BA 4K5ZA 2P3FH 1NU9A 4AN7A 1UTMA 5DP7A 1A5IA 3T28A 1DE7H 3K2UA 1G9IE 1C4V2 2P95A 3STJA 2AH4X 3RXRA 1O2UA 1RGQA 1B7XB 1SGDE 5I25A 2UUYA 2YNAA 1AVXA 1TAWA 1TPSA 4NCYA 2ZNKH 3UR6A 1EX3A 1WQVH 2Y5FA 4X0WU 2DE9A 1XX9A 2J92A 3P8GA 2BQWB 2BY9X 3MU5A 3RP2A 3TIUA 1MU8B 1YYY1 4ABGA 2SGDE 2GZ8A 5F8TA 2QXJA 4M7GA 2TGPZ 4OS7A 1DOJA 1O3KA 2XWAA 3GDSA 4CRBA 3D23A 1LHDH 1C2FA 1ZTJA 1P10A 2HOBA 1V2QT 1MQ6A 1HAXB 3FZDA 2FI3E 3KEEA 1TWXB 3ZVEA 6CHAC 1C2HA 2J4IA 1FDPA 7ESTE 2P93A 5FX5A 4CRDA 1SOZA 3I29A 3UFAA 5EXLA 1TB6H 2WUCA 2HWLB 1J17T 1TQ0B 1VITG 2Z3EA 1O39A 1G37A 2ZFSA 1IQFA 3E90B 3A8DA 4X8UH 1EB1H 2PGQB 1SG8B 4NSYA 4IN1A 2VVVA 5DP3A 1MZDA 3H7OA 2ZGHA 5DP8A 1AIXH 1RS0A 1ZPCA 2TGDA 1V2TT 2A31A 1PQ7A 1NO9H 4HI3A 3A87A 1AZ8A 2GV7A 1Y3WA 1K1MA 3GY5A 1RTLA 1OWIA 2O8MA 4UFEH 3VEQB 2NU1E 1T8OA 1AHTH 4YOGA 3RXOA 1P12E 1EOLA 3PB1E 3ENSB 2P3UB 1GI4A 1WTGH 4Z6AH 1XUGA 1GVKB 2FEQH 3P8FA 1W11U 3SZNA 4OS2A 1TX6A 1NFWA 1GHBF 1O2PA 3E8LA 1IOEA 1ACBE 1P06A 4BTIB 4OS5A 1WSSH 1S83A 3P8NA 2F91A 4Q7ZA 4Y7AA 4IS5A 3RXLA 4U01A 1NPMA 2OBOA 3ZZ7A 1HDTH 1F0RA 1HAHH 1V2VT 2GCHG 2A4RA 4WVPE 2VWLA 3RXDA 4DURA 3BIVH 3SV9A 1HCGA 1QQ4A 5FHTA 3NUMA 1O3LA 1P8VC 1G2LA 2ZDNA 3ZVAA 5DP6A 3MO3A 2ZHWH 1O3NA 4GLYA 1FY8E 2EEKA 4FUHA 2A7JA 4NZLA 1K1PA 3UOUA 1DY8A 1E35B 3A83A 3RC6A 1ELFA 1TMTH 4GUXA 3M3TA 3RXIA 2ODYB 3KCGH 1DLEA 1O2TA 3A7YA 1GI7B 4AFUA 2W7UA 2AERH 1C5TA 1A2CH 3LJOA 3SV2H 2BD8A 1SGCA 4ISHH 4CR5A 1GMDG 3A7ZA 3A89A 1KLTA 2XCFA 5JB8S 3QX5H 5FCRA 4A5TS 3GOVB 4CBOA 4X2YA 1O5FH 1W2KH 1TGCA 1GJDB 5L6NH 1IQJA 1NU7B 3PMJA 2NWNA 2HLCA 4Y76A 4X2VA 5E2PA 1S0RA 1DS2E 2GCTB 1XUJA 3TH2H 3SQHE 3ATLA 3ZYEA 1C2IA 3SUDA 1EOJA 2ZZUH 1BMNH 5A0AE 3MNCA 3TNTA 1HV7A 2EI6A 1F2SE 1UMAH 1VITH 2SGFE 2ZG0H 3KQDA 1TPAE 4KGAA 2BVXH 2SNWA 4GPGA 1O2IA 4AB9A 2AMPA 1AE5A 1BB0B 1H9IE 1NY22 2Y5GA 5GWZA 1OWEA 2FTMA 4D8NA 1TA2A 1IQLA 1DWEH 2QAAA 5EXNA 3EA7A 2BOHB 2ZC9H 1P2JA 5C1YA 4RKOB 3RC5A 1FJSA 3DUXH 3FP6E 2QF3A 1U6QA 3NKKA 1MTVA 4YO9A 3VGCB 2PLXA 2NU3E 4MDSA 4NGAH 1ZJKA 3ZYDA 2J95A 1Y5BT 1L1JA 4ZXYH 4ABEA 3RC4A 4CRFA 3F9EA 1GBDA 1F5RA 4FVDA 4D9RA 2LNCA 1T8MA 4ISIH 4CH8B 1HBTH 1DXWA 1P01A 3HGNA 3LC5A 1IQIA 1MD7A 1W14U 4BANB 4TY7A 1AFQB 1L1NA 2Q6FA 1TGNA 1PPCE 1EB2A 1ANDA 6GCHF 8GCHF 1ESBA 1NROH 2OP9A 3A7VA 1G3EA 1IQNA 1BBRK 4WMDA 1DLKB 2BD5A 1DUEA 1B0EA 1GBTA 1LHCH 1W8BH 3AVZA 4E06H 5E0JA 1C5NH 2FESH 1EZUC 2HPQH 1ANCA 1O3FA 2M5TA 3OY5U 4K2YA 1FLEE 3BIUH 3TJVA 4LZ1H 4R8TB 8GCHG 4VGCC 2BB4A 3PLKA 3FAOA 1K1JA 1UCYH 1P02A 2SGAA 1OP8A 2PTCE 1ZMLA 1MCVA 1RJXB 1V2OT 5CMXH 3I78A 1C1RA 1KLIH 2QXIA 2Z9LA 1VR1H 4ASHA 2XCNA 1CGJE 1KXBA 3A88A 1FPCH 1O5CB 4YZUA 5T6DA 3ZZ9A 1C5MD 4JZDH 4ZKNU 1ZPZA 2Y7ZA 1AQ7A 1AFQC 1SPJA 1E37B 3SO3A 5AFZH 4OS4A 4FUDA 1ESAA 5LH8A 1Z7KA 2Z9IA 3KHVA 2VH0A 2AMDA 1SFIA 3ITIA 2Y82A 3RU4T 3MH6A 1KTSB 4YM9A 1BITA 3HK6B 2ESTE 2KAIA 3ZZDA 5AFYH 1NM6A 5C67A 1HYLA 1EXFA 1QTFA 4K1SA 1GVZA 4K3JA 2FX4A 3O8BA 4TYDA 1BT7A 2BHGA 2PKAA 3M7QA 2FM2A 2VWNA 4UE7H 2OTVA 4B71A 1DX5M 2JETB 2GDEH 3R3GB 1DSTA 1FAXA 1HRTH 1YPHE 2W3KA 3JZ2B 4YESB 2F9PA 2PTNA 3P17H 3PTBA 1ELCA 1HB0B 1LTOA 1TIOA 2ZECA 3ZZBA 5EW1H 2AFQB 5E8EH 1RTFB 3MO6A 2ZWLH 1GHAG 1A1RA 1HLTH 1GCTB 4JZ1A 2CJIA 3NPSA 3UNRA 3IG6B 5C2ZA 1SGYE 1B5GH 1SGQE 3P70B 1HXFH 4ABJA 1D3TB 1RIWB 2ZDKA 2VNTA 4OS1A 3E1XB 4NG9H 5A2MH 1O3EA 2FI5E 3KF2A 1IQEA 1KXEA 1S6HA 2FPZA 2STAE 1UHBA 3LKWA 1OWDA 3F68H 2R2WU 3A8CA 1EAWA 1L1GA 3SJOA 1S82A 2IJOB 1K1LA 3S7HB 3BEFB 1G3DA 1WUNH 1YPHC 1QB1A 2TGTA 4XBBA 1ETTH 2OC0A 2GKVE 4BAHB 2ZIQH 4KKDA 2PUXB 1Z6EA 1E34B 2W5EA 1H9HE 1O33A 1V6DA 1BHXF 2WV5A 2A45B 3KQBA 2SNVA 2FZZA 4ZAEA 5JB9S 2ZI2H 1AVWA 3B9FH 1LVMA 4CH2B 2G5NA 4ZKRU 3M7TA 7GCHF 1BTPA 3FP8E 3V0XA 2A7HA 3MH4A 1SGFA 3O8RA 4FU8A 3MNSA 1JRTA 3UNQA 3RU4D 1N8OB 3BG4C 2ZDVH 5FXLA 1QHRB 3GCOA 1QRWA 4Y10E 3PMBB 1QGFA 1UO6A 5DK1A 5HM2A 3UPEA 1LHGH 1CHGA 3RXUA 1RXPA 3B23B 5GXPA 1SMFE 4B76A 4NWLA 1CHOF 2ZKSA 3ZV9A 5BRRE 4YT7H 1GI2A 1CT0E 4IMZA 1QB6A 2ZTYA 2C8YB 3RDZA 1TX8A 4BOHA 1GCDA 1THRH 1NZQH 1MQ5A 2D8WA 2ZTZA 3TITA 4BXWA 3E91A 2BD2A 1MBQA 2A1DB 4YLQH 2Z9JA 2ILNA 2F9VA 2FO9A 1V2PT 3EA8A 4K1TA 1V2KT 4MLFB 6ESTA 3GYMA 5DKMA 1ELDE 1O2SA 4MNWA 1O3MA 1KDQA 3GCHC 1NFYA 2F9BH 2B7DH 4MG3A 5ABWA 4WXVA 3ATIA 2CV3A 3UIRA 4IGDA 2BOKA 1YCPH 1XVOA 5DO4H 5HYOA 1BJUA 1D9IA 2NU4E 4BTUB 1FUJA 1CA8B 1GJ5H 4FUCA 4MPXA 3MU8A 1LMWB 1ZPBA 1BTWA 5EU8A 3PYHA 1SSXA 1Y3VA 1ZTKA 1P2QA 5A09A 1Z6JH 1HXEH 2H5DA 1GMHG 2BDBA 1K22H 4TY6A 1K1NA 1QRXA 1UTPA 4Y7BA 3UR9A 2ZCHP 5HXFA 1EZQA 2P8OC 1HAYB 3DT0H 3HKJB 4ZKOU 3NK8A 2C3SA 1LVOA 1MTNC 2WPKS 2YNBA 5L2YH 3HK3B 1UTKA 1ELAA 3ZVDA 1L4ZA 4BAMB 2WPLS 1YPKH 2STBE 2GZ7A 1FPHH 3RXAA 4MPVA 4X1SU 5TCAA 3R0FA 1O32A 1TLDA 3VXEH 3I77A 1IQMA 3RM0H 1C5WB 1Q2WA 1YLCA 2VH6A 2GZ9A 3SNAA 1A0LA 1DICA 2QIQA 3Q77A 4DG4A 1ELBA 1QCPA 2BZAA 1AB9B 2VWMA 2CHAB 1AWFH 3UTUH 1YPJH 1PPFE 5EG4A 1VCWA 4WMFA 3RXPA 4D76A 4AFSA 2AGIX 5BPEA 3M5NA 1PQ5A 1BMMH 1GGDC 4B73A 4A7IB 3UQOA 4DGJA 3D62A 2QGRA 2BY8X 4JZIA 1FXYA 4TPYA 1QBOA 1EPTC 2V6NA 1DM4B 1FI8A 1JMOH 1C5PA 2B5TB 1L2EA 2BZ6H 1UK3A 3ATMA 2Q6GA 1C2JA 3IWMA 1QJ1B 1PQ8A 2A32A 3E6PH 2XBWA 1L4DA 4FUFA 1DSUA 2J9NA 3C1KA 4XOJA 3AAUA 4A1TA 1UTOA 2ZU1A 2PV9B 4F49A 1TBZH 1M9UA 3RU4E 1AU8A 4DT7B 1AB9C 4AORA 4JZFH 1KXFA 2H6MA 3PO1B 5F6MA 4X6MA 3TK9A 3MI4A 1O2OA 1FY3A 3GY2A 4HGCA 1N1LA 2SGPE 1V2RT 1WTHD 1Z8GA 1NRPH 2H9TH 1GHVH 4Y6DA 3U98H 1QJ6B 2XBXA 2VVCA 5L30H 1G3BA 1X7AC 2G4UA 1UVPA 2AMQA 3BTGE 1QY6A 3BTHE 2PSYA 4MNYA 2QXGA 2BD4A 4X6PA 4FVBA 2B8OH 2J2UA 3TPIZ 1VITF 3MO9A 1V2JT 1C5RA 2JH5D