1WQSA

Crystal structure of norovirus 3c-like protease
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
173
structure length
173
Chain Sequence
b'APPTLWSRVVRFGSGWGFWVSPTVFITTTHVIPTGVREFFGEPIESIAIHRAGEFTQFRFSRKVRPDLTGMVLEEGCPEGVVCSILIKRDSGELLPLAVRMGAIASMKIQGRLVHGQSGMLLTGANAKGMDLGTLPGDCGAPYVYKRNNDWVVCGVHAAATKSGNTVVCAVQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like protease
publication title A norovirus protease structure provides insights into active and substrate binding site integrity
pubmed doi rcsb
source organism Chiba virus
molecule tags Hydrolase
total genus 32
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wqsA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wqsA01
3K9XB 3BG4B 4AN7A 2H5CA 1P03A 3TU7H 1O32A 1OWEA 3HKJB 1ZMJA 1DM4B 2BDGA 3KQBA 1C1NA 3MNXA 1K1MA 2BD3A 2OINA 3RXKA 1O3FA 2WUCA 1DE7H 1Y3VA 2FTLE 1NU7B 2D8WA 1ABIH 3V12A 3U1IB 1PPCE 2Z3CA 1O2SA 1HNEE 3I29A 1Z8RA 1C2GA 3P17H 1EAXA 5TCCA 1GHAG 3BIVH 1SGQE 2H9TH 1IHTH 1HB0B 1QY6A 3MU8A 1HJ9A 4AG1A 2ZDLA 3FVFB 3UOPA 1ZRBA 2FDAA 2BD5A 2VIQA 2V35A 3A81A 3C27B 4UD9H 3E6PH 3FP6E 5ESTE 4NA9H 5DJ7A 2P59A 5JBCS 1GHWH 2CJIA 1C1MA 2SNWA 1GI6A 4ABIA 2BD8A 1ELGA 2Y6TA 1BJUA 1C4Y2 1GMCG 3E91A 1ANDA 1UTMA 3PROA 3DUXH 5CE1A 2ZCLP 1YPLH 1S83A 3RMOH 1TGCA 4IMZA 2Z94A 5DP9A 1L4DA 4IC5A 2OQ5A 2WPIS 4CRFA 2AMQA 2PGQB 4RSPA 5AFZH 1GBKA 1TOCB 1W0ZU 2BQ6B 1GJBB 2G8TA 1HXEH 5F8ZA 2Y5HA 3E1XB 3ATMA 3F9GA 3KQDA 1ZSKA 2ALVA 3F9HA 1SGCA 3PTNA 3AAVA 4FU8A 2Q6FA 3PM3A 3A8CA 2PR3A 1Z8GA 4MPVA 1G37A 2P16A 1SGDE 3URCA 3A7YA 1UVUH 3STIA 5FPSA 4AYYB 2FOAA 2ZHEH 1SGNE 4FVBA 2OXSA 1BRUP 4IN1A 3LC3A 1ETSH 3M5NA 1KXBA 2BX4A 1DWDH 2QCYA 3SGQE 1SGYE 4GUXA 1LKAA 4H6SB 4KTUA 5T3HA 2FMJA 1S6FA 1C9TA 4B1TA 3RXSA 1VGCC 2OQUA 1GDUA 5FX5A 1EJAA 3LH1A 2HPPH 3GCTG 5J4SA 1ESBA 2ZFPH 4Y11E 1WCZA 4MNYA 2RCEA 2C93B 2FI3E 3MOCA 1XXDA 1BRBE 2WV5A 3T25A 1ZLRA 2GTBA 1O2GH 1C1PA 5C20A 3RLYH 4XBDA 2ZHFH 1C5XB 1V2NT 3TGJE 3ZYDA 1UMAH 1MZAA 5IYTA 1XKBC 2PKAB 3AW1A 3SGBE 1THPB 1UVSH 4DT7B 1NC6A 3P6ZB 3C1KA 2H5DA 3SU3A 1MZDA 1VCWA 4SGBE 5C67A 3RXLA 5C3NA 1PQ7A 4CREA 3ZZ4A 4E05H 1O3JA 1ZPZA 4DJZB 2GMTC 1P0SH 5C1UA 1K9OE 2ZDMA 1TWXB 2SNVA 4JZIA 2B0FA 1V2UT 3TJVA 4AX9H 1F0SA 4GLYA 3LIWA 3VB5A 1Q31A 5C5NA 1WV7H 2ZQ1A 3BTTE 1SGEE 3H7OA 5L2ZH 2BZ6H 2FYRA 1K1NA 1MAXA 2W7UA 1TQ7B 1N6YA 4OS5A 3VXEH 4FUIA 4Y0ZE 2QYIA 3TITA 1L0ZA 1O2NA 2BY9X 1LCYA 1AB9B 1C5WB 1HAXB 4ZHAA 1TRNA 5T6FA 1FY5A 1DY8A 3KN2A 1CBWB 1G2MA 2ODQA 4GAWA 4ABBA 4K8BA 1YYY1 3QWCH 1GCTC 1HUTH 1P2MA 2VJ1A 1ELEE 1BBRH 2G5VA 1O2YA 1FY4A 3M35A 2WPKS 3M7QA 1SLWB 3EGKH 1JRTA 1T8MA 2AERH 1BHXB 3QGJA 1GMDF 3MU1A 1D3QB 4O97A 2B7DH 2XC4A 1O3AA 1AWHB 1UTNA 1C2LA 1D3PB 1DLEA 3UNSA 1P05A 1HXFH 2ZU1A 4AFZA 3SNCA 2Z9LA 1YPMH 3AAUA 3SI4H 1G3DA 2ODYB 2VVUA 1FV9A 1PPBH 3BV9B 1N8OB 4E7RG 4F49A 1A5IA 1EQ9A 4K3JA 3O8BA 3ITIA 3KEEA 4ISHH 1GDQA 1OKXA 4K2YA 2P8OB 5PTPA 4WJG2 1NFUA 2ZPRA 3TJOA 4AFUA 2VINA 6ESTA 1C1OA 4K1TA 3GYMA 1ARBA 4WH6A 1F0UA 1XVOA 2W5EA 2A7HA 2FEQH 2GV7A 3A8BA 5A8XA 1GMHF 1MTNC 4ZHLU 1V3XA 1Y3XA 1GBMA 3Q3KA 2GCHF 1SL3A 1HIAB 2CV3A 2BMGB 3NZIA 3DD2H 1G32B 3D65E 4K60A 1O2ZA 1ANBA 1P57B 3A83A 5I25A 5LPEA 4OS1A 1XUGA 3TGKE 1TALA 3M7UA 4X8UH 2O8UA 5HXFA 3AVZA 4WXIA 4FUJA 5FHTA 3GCHC 1MUEB 2THFB 1JXPA 2BZAA 2I6SA 2QAAA 3QZRA 2J9NA 4JK5A 4ABJA 2OCVB 3SGAE 4Y7AA 3SBKA 1GWAA 1W11U 2FLRH 2XC0A 1CSOE 4U01A 4NFEA 2FOBA 4AGJA 1YGCH 1V2VT 1ZHRA 2AMPA 1FUJA 1O2TA 1GI0A 3GISB 4U32A 4A1XA 2FO9A 1ELFA 3SJ8A 4RKOB 4X1PU 3RXCA 1D9IA 4D7FA 3S0NA 1GJ8B 1XUFA 4KELA 5GDSH 2OUAA 3V3MA 1E35B 3TNSA 4LXBH 2BHGA 3D62A 3SORA 2FWWA 3OY5U 3Q77A 1G3EA 5C2ZA 4BNRA 1QJ7B 3RXPA 5A0AE 1GJ6A 2OLGA 3PMBB 1Z1IA 1HYLA 3KCGH 1VCQA 1BMAA 1H1BA 1JRSA 3BTGE 3U8OH 1FLEE 2W7SA 1TNJA 1C2JA 1CGIE 1Y8TA 2A7JA 4YTAA 3AW0A 2ZPSA 2VIPA 1V2RT 3SUDA 3TPIZ 1UTPA 1GBLA 1AE8H 2GZ7A 4ISLA 2QXIA 1RRKA 3PWCA 3HPTB 1RGQA 1W3CA 2Y80A 3ODDA 3P70B 2O8WA 4KKDA 3FFGA 1B0EA 4I8JA 1C2MA 4J2YB 4YM9A 3TK9A 1UCYE 3M61U 1F2SE 3U98H 2CF9H 2PTCE 4FUGA 2J92A 3SU2A 1TGTA 2XBXA 2AH4X 4UFEH 3EQ0H 1Y59T 2OBOA 3OTJE 2EI6A 4AORA 3RXDA 4J1YA 4WMEA 4H4FA 2VGCC 1N1LA 3IITA 4FUDA 4NZQA 1F5RA 3OX7U 4INLA 4NA8A 4XBCA 3UUZA 1Z1JA 4UEHH 5SGAE 4UE7H 1HPGA 4AB8A 1VR1H 2QC2A 4OS2A 1HAVB 2BY7X 3CENA 4NWKA 1O34A 3QUMP 1OP8A 3ZVDA 3TGIE 2AMDA 2ZO3H 2F9NA 1F7ZA 1XUHA 4QT8C 2G51A 4M7GA 2BQWB 3FP8E 4U30A 1UVPA 5L30H 5EQQA 1BBRE 4TWYA 4DG4A 4Y8YA 5F8TA 1GG6C 2ZU3A 4THNH 1C5SA 5EW1H 1VGCB 3VB4A 3SV7A 4CBOA 1LTOA 2GZ8A 5A0CA 1C5VA 1MKWH 1Y3YA 3HATH 2BM2A 3M5MA 3RXHA 3BIUH 3URDA 1GJ7B 3PMJA 4NIXA 2G81E 4CHAC 3SU4A 1V2MT 1P04A 4GCHF 1LHGH 2R9PA 1KXAA 1B5GH 1PQ5A 1NM6A 4ZKSU 4JK6A 4UONA 3UWIA 3RC5A 1O5FH 2ZHWH 1C5NH 4INKA 2GDEH 2FYQA 1GI5A 1M9UA 1ELCA 1O2JA 1O2OA 4ZKNU 3PMAB 3VGCC 3KL6A 2SGDE 3A7XA 1O2IA 2BDAA 1NTPA 1C2DA 4Y79A 4K5ZA 1GI1A 2GMTB 1GL0E 4OGYA 4Q7ZA 2Z9GA 1HLTH 5DP5A 7GCHG 1AVXA 4MPUA 3VB3A 1KDQA 4YT6H 5JDUB 2BX3A 3QK1A 3HGPA 1KLTA 3RMLH 1O30A 3GDVA 3Q76A 5FCRA 4MNXA 1V2TT 1GBCA 2NU1E 2BDBA 1ESAA 1O3OA 2QXGA 2ZZUH 1IQHA 1V6DA 1BB0B 1S81A 2FIRH 1OP0A 1L4ZA 3QLPH 2FI4E 1GCTB 1QRWA 4KTSA 1T7CA 2YOLA 1HJAC 1FXYA 3T29A 3TK5A 1XKAC 1K1LA 2C8WB 3FANA 1V2OT 1WOFA 5DP8A 3A84A 5FBIA 1H9LB 3P92A 1H8DH 1MKXH 3MNSA 1EASA 3S7KB 1A46H 5EQSA 5E0JA 4ZUHA 3EA7A 2ZGJA 1DDJA 2A7CA 4WH8A 2Y82A 3BTFE 4NFFA 1O2VA 3PLKA 4O3TA 2ILNA 5JB8S 1K1IA 4XBBA 3BTWE 8LPRA 5JBBS 2FLBH 4FUEA 2HVXA 1AIXH 2NWNA 5JB9S 3SQEE 5F6MA 1PYTD 1UO6A 1YCPM 1WTGH 1SQAA 3H5CB 3UR9A 5TCAA 2QV1A 1G9IE 2STAE 1SSXA 4FXGH 3GCOA 1MTNB 4JCNA 3W95A 1QGFA 2LPRA 4X8VH 1BRCE 2CXVA 3EA8A 4BXWA 5LPFA 1ELBA 4OS7A 1TNIA 1CA8B 2VNTA 2Y7ZA 4BTUB 3FP7E 4FUFA 1GHBG 5CHAC 1AD8H 1KIGH 1EATA 1O3KA 3RC4A 3EA9A 1LVMA 2TGDA 6GCHF 1ZOMA 1IQEA 1Y3UA 3HK6B 1BA8B 3RXOA 4HGCA 2ZHDA 1XMNB 3GCHB 1G3BA 1AWFH 1ZHMA 3I77A 1GBIA 3MHWU 1C2KA 1SOTA 2C8ZB 2F9UA 2GDDA 2G55A 4RKJB 1SB1H 3W94A 1C1TA 4MTBA 1H8IH 4CRGA 3ZVAA 1MBQA 4Y8ZA 1NROH 1QJ6B 1NS3A 1ZZZA 1XM1A 2F9PA 2ZPQA 1HJ8A 1VITG 4BOHA 1TMBH 1F5LA 1O2WA 1CHOG 4U2WA 3A80A 2FOCA 2PSYA 5GCHG 1DWCH 1YPHE 3RLWH 2PGBB 3VXFH 1EZUC 2FTMA 1GVLA 3F68H 4Z0KA 1BUIA 1ZSLA 1EZQA 4BAHB 3LKWA 4I31A 3MMGA 2JH5D 1ZJDA 5EU8A 3KGPA 4HFPB 5DO4H 1ELTA 1J17T 4WVPE 1NRNH 1GI7B 2OC1A 3SUFA 4O3UA 1DFPA 4X2XA 4YESB 2SGFE 1O2LA 2F9VA 1C5OH 1EP5A 3S9AA 5J4QA 1U6QA 2A45B 2B9LA 5DP6A 1O3PB 3QGNB 3ESTA 3A87A 3FAOA 2AS9A 2PLXA 5BPEA 2ZGHA 3SU1A 4X1SU 1NN6A 3K6YA 3S7HB 1FY8E 1GDNA 4MNVA 3GY2A 3BTEE 1GBFA 1DSTA 4JZDH 3ZYEA 3P95A 2NU4E 4ZKOU 4KTCA 2WPJS 3LH3A 3TK6A 2F9OA 1LHDH 4DIHH 2V3HH 1FZZA 3BSQA 3RXTA 1J9CH 1ETTH 1P9UA 1T8LA 3ZVBA 1SLUB 2VIWA 1TBRH 1XX9A 3V7TA 4K1EA 1P12E 1QL9A 1BTWA 2XBWA 1IQLA 2QN5T 2VGCB 1NPMA 2XYAA 1SGFG 4NIYA 3MNBA 3SW2B 1L1GA 3GY3A 2QXHA 3P8NA 2TGPZ 3TH4H 1OX1A 4E06H 1WTHD 3E8LA 3M3TA 5ABWA 5EXLA 1OYQA 1Z6EA 1C5ZB 2VH0A 1GJDB 4Y0YE 2A4GA 4AFQA 1EPTA 2UUYA 1Y3WA 5HGGA 3NWUA 2G4UA 2TPIZ 2RG3A 1E37B 1UTQA 1YM0A 3A82A 4X8TH 3KHVA 1KXFA 1C1RA 1GHXH 3ENSB 3TIUA 1RIWC 4MNWA 1EKBB 1GG6B 3LOXA 5EPNA 1GJ9B 3B9FH 4YOIA 3SNBA 9ESTA 2BY5X 3RXIA 1GJCB 1TGSZ 3D23A 3SU6A 4Y8XA 3K2UA 3PLBA 5K0HA 5JYIA 2FOFA 2TGTA 3GDSA 4CHAB 1QA0A 2IOTA 2Z9IA 4ESTE 2GT7A 2ODPA 1W10U 1QFKH 3E0PB 2P3TB 1O36A 1NZQH 1O38A 1TBZH 1ORFA 4I8HA 2A5KA 4TY6A 3V0XA 4R8TB 1QURH 4WXVA 3RXEA 2ZG0H 3R0FA 2HWLB 1UCYK 2QGRA 2ZIQH 2P95A 3GY5A 3M3VA 1O37A 3Q3YA 5E2OA 3VGCB 3A86A 2ZDNA 1FJSA 2IPHA 3MU5A 2TIOA 4FUCA 2NU0E 3ZZ8A 1FONA 1ZJKA 2BYAX 1D3DB 4X2YA 4CH8B 2EC9H 3LGUA 1W14U 2O8LA 2A5AA 2BLQA 4NIWA 4SGAE 1NU9A 2VVCA 4NCYA 4Q80A 2XRCA 3I78A 1LHFH 1NRSH 3RC6A 1QL7A 1ZTJA 4ISIH 8GCHF 3A8DA 2VVVA 1D6RA 2OBQA 4D7GA 2ZP0H 1TNKA 1P8VC 4Z6AH 2H9EH 3ZVGA 5DGJA 3P8FA 1QBVH 1QTFA 1WU1A 4MPXA 1BBRK 3TVJB 2BD9A 1HRTH 3UPEA 3RXAA 1TQ0B 1HJAB 1T8OA 4BAKB 2M5TA 1TFXA 3PB1E 2GGVB 4NA7A 4Y10E 2R3UA 4X2VA 1OWDA 4JZ1A 5FPYA 7KMEH 1BIOA 2D2DA 4IMQA 2XXLA 3A7ZA 3EDXB 2FS8A 1BTUA 2H2ZA 3L33A 1B0FA 2FOEA 1P11E 4E7NA 2XC5A 1G30B 3UY9A 1LVOA 5GIBA 1FY3A 2AGIX 2A4RA 3H7TA 4CR5A 1HAZB 1XUIA 4AB9A 2A4OA 3SU5A 2QF3A 3HGNA 3SJOA 1RJXB 2FESH 1EAIA 2VIVA 3NK8A 3ATIA 1EAWA 1P2KA 3K65B 3R3GB 1Y5UT 1D4PB 4B2BA 1E34B 3U9AH 1NRRH 2XNIA 1YPKH 4UFFH 1CU1A 1HFDA 3CS0A 2UWPA 1AHTH 1KSNA 1OWJA 4IN2A 1SQTA 2GX4A 4JYTA 3RXGA 2ZTXA 4I8KA 4MDSA 2IN2A 1OWIA 1V2PT 4BANB 1O2RA 1NO9H 5JBTA 4JYVH 1QJ1B 4AG2A 4WY3A 4Y76A 1W7GH 3VB7A 4CR9A 1ANCA 2PWXA 3STJA 5I46H 1PPFE 2BD4A 3F9EA 5CHAB 1TLDA 1AQ7A 5DP7A 5LH8A 3F9FA 4O03A 4Y6DA 3RU4D 2JETC 1MTVA 2A4QA 1TPPA 1QRZA 1KDQB 4YLUA 1BQYA 2ZFSA 3GY8A 1HDTH 2ZQ2A 1ETRH 2VIDA 1DANH 5F8XA 1AZZA 1C1WH 2PV9B 2ZA5A 4CRCA 1EX3A 4TY7A 1F5KU 3QN7A 3NKKA 3RP2A 5C1YA 1GMDG 4GHTA 1CQQA 4CRAA 1C5LH 1MBMA 1FI8A 1ESTA 4INHA 1BRAA 2H9HA 1E38B 1Z71A 1PPEE 1K28D 2C4FH 1FIWA 4IBLH 5ETXA 5DK1A 3RXVA 1O2KA 1BMNH 1BITA 3QTVH 4DURA 2F91A 2PKSC 1H9HE 3BTHE 3EAJA 1ZTLA 1O0DH 3RXJA 3BTQE 2G4TA 2EI7A 5DPAA 1P02A 4UFGH 2HNTE 4JYUH 3PO1C 8ESTE 1ZTKA 4NZLA 2WINI 3MU4A 4AOQA 1TX7A 5A2MH 1GMHG 1DS2E 1GGDC 1VZQH 3B8JA 1P2IA 4Q2KA 1EJMA 2R0LA 5K7RA 1A4WH 1GBTA 1FDPA 5EPYA 2GCHG 1QCPA 4Y7BA 3SQHE 2UWLA 1GI4A 1NESE 1E0FD 1DY9A 3TNTA 3GY7A 2KAIA 1C1SA 1THSH 1ID5H 1P2NA 1O33A 3L6PA 5L2YH 1NFWA 1GI8B 1CT4E 4FVDA 3SV9A 2K1QA 4ZH8A 6CHAC 2BDYA 1GBAA 1YCPK 4I8GA 1P06A 3MH7A 1BTZA 4ISOA 3SUGA 3ZV8A 4XOJA 3PTBA 1S5SA 4NGAH 4NG9H 1TOMH 5A0BA 1EUFA 3MH5A 1VJAU 1GI9B 3V13A 2R3YA 2PUQH 1O3BA 4O9VA 1O3HA 2STBE 1AFQC 4FU7A 1TYNA 2C8XB 4FUHA 4ZMAH 2J95A 1SHHB 1TBQH 2QY0B 2A0QB 2F9BH 5JBAS 2ZNKH 2Y5GA 3QZQA 1GBBA 1O3EA 1YF4A 4K1SA 3LGWA 3K6ZA 2BB4A 2G00A 5E0GA 1IQMA 2ZU2A 3A8AA 1G3CA 1YPHC 1BTYA 2CF8H 3PYHA 4D9QA 1SVPA 2FOHA 1RIWB 3LU9B 1MU6B 1O5BB 4ZROA 4MQAA 3BTKE 2FX6A 2HGTH 2ZGCA 1P2JA 2YNAA 1O5EH 3SJIA 2QA9E 3ATLA 3EYDA 1AO5A 1FN6A 1SC8U 1V2QT 3ATKA 1SG8B 1MTWA 2ZTZA 4LOYH 3LGYA 3GYLB 4HZHA 3T5FH 1BMMH 1EZSC 3RU4E 3CS7A 1TABE 3SZNA 2BD2A 1BOQA 2AIQA 3P8GA 2JH6D 1C5UA 1ZRKA 3BG8A 1BMLA 1LMWB 2EA3A 4WMDA 1EOLA 3UIRA 1C1UH 2UUKB 1ZHPA 1O3IA 2B5TB 3RXUA 2RA0A 1Z7KA 1J8AA 6LPRA 4MPWA 1T4VH 5E0HA 1DX5M 2DUCA 1F0RA 2BLWA 1GHBF 1W7XH 1C2EA 1YP9A 3IWMA 1LVBA 1HGTH 4ABDA 4X8SH 1ACBE 3GY4A 3UOUA 4CRBA 4UDWH 4HI3A 4D9RA 1PQAA 2GZ9A 1AU8A 2QIQA 2HNTF 1L2EA 2RDLA 4HTCH 2A32A 4XSKU 1O2MA 3DFJA 1FN8A 2ZU5A 4XFQA 2FM2A 5FBEA 4AYVB 1UHBA 1C5MD 1DITH 1ZR0A 2BXTH 1MMJN 3F6UH 4GPGA 2XCFA 4X6PA 1OS8A 2ZGBH 3UNRA 3A88A 3O8RA 1V2KT 2GP9B 1OYTH 1TMUH 1DICA 4ABAA 1GHAF 1TGBA 3UNQA 1KLJH 3ZZBA 1TPSA 1A61H 1SBWA 2XW9A 2ASUB 3SOSA 1MKXK 2BD7A 3CP7A 2DE8A 1PPHE 1SLXB 4TYDA 3E0NB 3MH6A 3RXMA 1FMGA 3G01A 4GCHG 1MD7A 4JMYA 5C5OA 3A85A 4ZKRU 1NY22 1O35A 1YLDA 1KTTB 5DG6A 1TMTH 1GMCF 1EAUA 3OSYA 3JZ1B 2WYGA 1G2LA 3M7TA 1H4WA 1PPGE 3MFJA 2Q6DA 4Q7XA 1SOZA 5G4BA 1IOEA 1GCDA 4BTTB 1UVOA 1RXPA 2P94A 3KQEA 1O2QA 1WSSH 2D1JA 4AZ2B 1P2OA 5DKMA 2ZHQH 1GJAB 3LGVA 3A89A 5T6DA 2W3IA 5HMAA 1PQ8A 4B71A 4B73A 1G36A 2TGAA 1FNIA 4X6NA 2O8TA 1O39A 1O3CA 3SJKA 1RTLA 4DIIH 1WAYB 3ZZ5A 1O5CB 3OYPA 3M36A 2AYWA 2BDCA 1WYKA 2C3SA 2XBYA 2JETB 2ZGXH 1SI5H 4X6OA 1AN1E 4H42U 5T6GA 2ZDVH 5AF9H 2WYJA 2ZFRH 2OD3B 1N6XA 1F0TA 2A2XH 2A2QH 1L1JA 2A31A 3UFAA 3SO3A 3VFEA 5A8ZA 1EP6A 1UTLM 2ZCHP 1TAWA 1AGJA 2FOMB 2SFAA 1SFIA 2I6QA 1RTFB 2EI8A 1MQ6A 1JOUB 2ZDAH 1CHGA 1LHEH 1DUAA 1THRH 3GCTF 3LC5A 1ZSJA 2Z3DA 5FAHA 1IHSH 1P2QA 1Z8IB 2JKHA 2BQ7B 5GPIB 4WMFA 2IJOB 1GJ4H 1S85A 1UTOA 1HAYB 2W3KA 3SNEA 1CO7E 1GBDA 1O2HA 2J38A 2BDHA 1XXFA 1UK2A 3MO3A 3MWIU 1A1RA 1O2XA 3O8CA 1AVGH 2PKSB 1INCA 2VH6A 1TNLA 2V0BA 2BOHB 3T28A 3S9BA 5EXMA 3PO1B 3SV8A 1Q3XA 3EE0B 3LONA 4Y71A 1RD3B 2BLOA 2Z3EA 1GGDB 1DLKB 2A1DB 3FZDA 2VWMA 2HOBA 2QXJA 1PPZA 4VGCC 3BEIB 1AKSA 4A92A 3ATWA 5AFYH 3DA9B 1ARCA 2SGQE 1A0HB 1K2I1 2SGEE 2Z6BD 1JWTA 1LHCH 1YKTA 3UQOA 1K21H 1GHYH 1BTHH 6GCHG 1C5RA 1C5YB 6CHAB 1QQ4A 1S0RA 1HAGE 1P01A 1Z6JH 3ZVEA 5LGOA 1HAHH 3MH4A 1QA7A 1LKBA 1C5TA 2FZZA 2OC0A 4CH2B 1Q2WA 3VB6A 1V2JT 1QQUA 2ZDKA 3ZVFA 1Y5BT 3TH2H 1DPOA 4YO9A 3QX5H 4XDEA 2Y5FA 1KLIH 1UK4A 1AFQB 5EQRA 1W13U 2ANMH 3TLOA 5A8YA 1MTUA 1BJVA 4GVUA 5A09A 3BEFB 5CMXH 4X2WA 1JMOH 4I7YH 4D76A 1TIOA 1C4V2 2XCNA 5F03A 1ZMNA 1O3MA 1DT2A 2V3OH 1AVWA 1GBJA 1T32A 1FY1A 3NCLA 3T27A 1O2PA 3SNAA 5GJ4B 2WPHS 1QBNA 1SHYA 3ZVCA 1MTSA 4R0IA 1DSUA 1LQDB 1S84A 3T2NA 1VCPA 2UUFB 2YNBA 3SN8A 3ZV9A 1VITH 3NXPA 1C5QA 1TA6A 3ZZAA 1SGFA 1AFEH 1GVKB 2DE9A 3LDXH 4ZAEA 3SUEA 2Z7FE 1MAYA 4NIVA 1HAIH 4CRDA 1CA0C 1JIRA 2J4IA 1AI8H 1J15A 2FOGA 1YPJH 4IW4E 1MU8B 1UCYH 2HNTC 7LPRA 2UUJB 1EOJA 5EW2H 3B23B 1DWBH 3DFLA 4X1RU 3QDZB 5E8EH 1UJ1A 3MO6A 1KXCA 2W26A 4H6TA 2ZEBA 1TONA 3RM0H 1HAPH 2KAIB 1O31A 1QRXA 1S82A 1P09A 4BAMB 2ANKH 4RN6A 3GDUA 4A1VA 1AUJA 1J14A 1QB9A 9LPRA 3RXRA 3M3SA 1HBTH 1W12U 3VPKA 1OXGA 4ABFA 1GVZA 3RXFA 5ESBA 5FX6A 2BY6X 1O3DA 3SHAH 1SR5C 5GWZA 1IQJA 3MTYA 1TPOA 3GCNA 4LK4A 2Y81A 3A7VA 3LJJA 1O5GH 2ZFQH 1NRQH 1WQSA 4LZ4B 3RMNH 1EPTC 4AGKA 1ABJH 2GKVE 2PTNA 3PV4A 5H4IB 1GJ5H 1RTKA 1BZXE 1SFQB 5EODA 3QO6A 3T62A 1A5GH 1O2UA 1DVAH 1P9SA 4YT7H 4ZXYH 5BRRE 1IQIA 1SGIB 4OS6A 1QR3E 1AUTC 3UWJH 2CHAC 1C2FA 2AGEX 4A5TS 2ZU4A 3MU0A 3UREA 1A7SA 1EB1H 1YLCA 3MI4A 4TPIZ 1UVTH 1NFXA 4X6MA 1T31A 1LQEA 3U8TH 2WUBA 4DOQA 2JH0D 2P3FH 3NUMA 1TA2A 2BDIA 3U1JB 5AHGH 2VWNA 2ZTYA 1BHXF 2F83A 3ZZ6A 1EXFA 1K1OA 1OP2A 1FQ3A 2WV4A 1XUJA 1CGHA 1MCTA 2R2MB 4DVAU 2ZFFH 3UR6A 1LDTT 1MCVA 2GCTC 3BN9A 4B75A 3UQVA 1ZGVA 1TRYA 1W2KH 1CGJE 1OPHB 2NU3E 2H1UA 4YZUA 1HCGA 2FX4A 3GOVB 3LGTA 1AZ8A 1KXDA 1SPJA 3BTDE 4B2AA 3VEQB 1QIXB 4ZHMU 1LPGB 1QL8A 4X1NU 3SI3H 3SHCH 1E36B 4ISNA 4JZFH 2SGPE 3BG4C 1TNHA 8KME2 1TGNA 8GCHG 1TE0A 3ZZ7A 2Z9JA 1GI3A 2J2UA 1LPZB 5EGMA 1C9PA 3ZZDA 2R0KA 7ESTE 1NT1A 2BLVA 4BAQB 4DW2U 1KY9A 4NSVA 2GT8A 1ZGIA 1VJ9U 4I32A 2BVXH 1BCUH 1GPZA 1EZXC 4B76A 2OC8A 3N7OA 1SMFE 1HV7A 2FI5E 4KP0A 2GVFA 3FZZA 2VWLA 1DXPA 2FXRA 2VB0A 1CVWH 4B74A 2ANYA 2C8YB 2G5NA 3MNCA 2ZC9H 4A1TA 3ZZ3A 1EJNA 2ZWLH 1UHBB 2V6NA 4YOJA 3SV2H 1TPAE 3A7WA 4GSOA 1BT7A 2TRMA 5C1XA 5L6NH 1A5HA 3TJUA 1KTSB 1NFYA 2PKAA 2Y7XA 4A6LA 4D8NA 2AFQB 1ZPBA 3S9CA 1ANEA 2PFEA 3BF6H 1S0QA 5TJXA 5LPRA 1FPHH 3BTME 2OC7A 3LT3A 3QTOH 2CN0H 5EOKA 1SGPE 2B8OH 1K22H 3RXBA 1QB1A 2CMYA 1T4UH 1TX8A 4PROA 4I8LA 1IQFA 1SQOA 3M5OA 4ABEA 1C5PA 3OU0A 4K8YA 1WUNH 3PLPA 4F4OC 1GHVH 3M5LA 2LNCA 3D49H 2HALA 3HKIB 1ELAA 3KIDU 1RFNA 1T8NA 1LVYA 2ZF0H 2ULLA 3AASA 4VGCB 2XTTB 1H9IE 1O5AB 2WPMS 2P3UB 7GCHF 5GXPA 2UWOA 3RXQA 1V2WT 4JZEH 1MD8A 1O3NA 1YCPH 1Z8JB 2F3CE 1IAUA 4ASHA 4DY7B 1SGTA 1IQNA 1D3TB 2SGAA 1DXWA 2WPLS 1AY6H 4IS5A 2XWAA 1SGRE 2BTCE 3O8DA 2VWOA 4A7IB 1OOKB 1ZPCA 3E90B 4DGJA 1C1QA 4K69A 2HLCA 3Q00A 1P3EA 1ELVA 4OGXA 1IQKA 2O9QA 1LO6A 2A5IA 2HPQH 1A0LA 1XVMA 2FODA 5EXNA 2ZECA 2FS9A 3IG6B 2Q1JA 5FCKA 1EB2A 3SV6A 1O5DH 1J16A 1MKWK 4MG3A 3LPRA 2ALPA 3SNDA 1GBEA 3TH3H 3RU4T 2H6MA 1GL1A 2PHBA 2BXUH 1YPGH 2BY8X 3HK3B 4CBNA 1D6WA 4FU9A 1K1PA 2ZKSA 4NSYA 1B7XB 1ZMLA 1IQGA 2XBVA 1NRPH 2BOKA 4BXSA 3RM2H 3Q3XA 5DP4A 1O3GA 2VIOA 1YPEH 1OSSA 2OTVA 1HIAA 4YOGA 3E3TA 3KNXA 4MLFB 5HM9A 1PFXC 2HRVA 1WBGB 4TPYA 2ZFTA 4ABGA 5HM2A 3KQCA 1MQ5A 2TBSA 1CA0B 1XUKA 1GHZA 3GICB 4NWLA 4ABHA 1KXEA 2P93A 1ELDE 4IC6A 1OWHA 1W0YH 5FXLA 3OY6U 2FPZA 1JIMA 4BAOB 4WF8A 3U69H 3KF2A 2AEIH 3L3TA 3A7TA 1AKSB 5JPMH 1AB9C 1YBWA 1JBUH 1DUEA 1ZYOA 5AVDA 1RS0A 2D26C 1K1JA 1X7AC 1P10A 1CBWC 3RUOA 4DCDA 2BVRH 3WY8A 2BVSH 2GD4B 3DT0H 3T26A 1DWEH 3DHKH 3RMMH 1FPCH 3F1SB 1TX6A 3MO9A 2CGAA 4I33A 1BTPA 1LPKB 1DOJA 1TRMA 2Q6GA 3S69A 1WQVH 1FIZA 5HYOA 3BEUA 3SU0A 1VITF 4GHQA 1W8BH 1MH0A 2VU8E 2G52A 1CHOF 5GCHF 4B2CA 1QBOA 4BTIB 5EG4A 3JZ2B 2AGGX 3ZZCA 1A3BH 2OP9A 2Z9KA 4Q7YA 1C2IA 1EPTB 1OWKA 1PYTC 1KYNA 1A3EH 3LJOA 3PWBA 1BDAA 2FP7B 1QNJA 1N8OC 1L1NA 4MVNA 1YC0A 1AMHA 1GI2A 2ANWA 2C90B 2ZCKP 4XE4A 3PMHB 5E2PA 2CHAB 5FPTA 1TB6H 5B6OA 1C2HA 2RA3A 3LGIA 1Y5AT 2P8OC 4YLQH 2O8MA 1BTXA 1UK3A 4X1QU 1FAKH 1FAXA 4OS4A 4X0WU 1S6HA 1F92A 1A0JA 1A2CH 3GY6A 3ZZ9A 2NU2E 1QB6A 3TJNA 2PUXB 1O3LA 2J94A 1PJPA 2XWBI 1V2LT 3NPSA 3P8OA 3MYWA 4WWYA 4FUBA 5IDKA 1QHRB 4KGAA 3SJ9A 5DP3A 2EEKA 1CT2E 1CE5A 4AFSA 2J34A 3UTUH 2GCTB 1HAOH 3M37A 4UFDH 4LZ1H 1GBHA 1SLVB 4IGDA 2R2WU 2GV6A 2PSXA 1TNGA 2ZI2H 1C4U2 2AIPA 1AE5A 3U8RH 3ELAH 4TWWA 3RDZA 2PW8H 3ODFA 2QF0A 1HAVA 1UTJA 2ESTE 4ZXXH 1P3CA 1V2ST 1C1VH 3E16B 1UTKA 1CT0E
chains in the Genus database with same CATH superfamily
3K9XB 3BG4B 4AN7A 2H5CA 1P03A 3TU7H 1O32A 1OWEA 3HKJB 1ZMJA 1DM4B 2BDGA 3KQBA 1C1NA 3MNXA 1K1MA 2BD3A 2OINA 3RXKA 1O3FA 2WUCA 1DE7H 1Y3VA 2FTLE 1NU7B 2D8WA 1ABIH 3V12A 3U28C 3U1IB 1PPCE 2Z3CA 1O2SA 1HNEE 3I29A 2JIZD 1Z8RA 1C2GA 3P17H 1EAXA 5TCCA 1GHAG 3BIVH 1SGQE 2H9TH 3N99A 1IHTH 1HB0B 1QY6A 3MU8A 1HJ9A 4AG1A 2ZDLA 3FVFB 3UOPA 1ZRBA 2FDAA 2BD5A 2VIQA 3WW7A 2V35A 3A81A 3C27B 4UD9H 2KCAA 3EE7A 3E6PH 3FP6E 5ESTE 4NA9H 5DJ7A 2P59A 5JBCS 1GHWH 2CJIA 1C1MA 2SNWA 1GI6A 4ABIA 2W6JD 2BD8A 1ELGA 2Y6TA 1BJUA 1C4Y2 1GMCG 3E91A 1ANDA 1UTMA 5C94A 3PROA 3DUXH 5CE1A 2ZCLP 1YPLH 1S83A 3RMOH 1TGCA 4IMZA 2Z94A 5DP9A 2WPDD 1L4DA 4IC5A 2OQ5A 2WPIS 4CRFA 2AMQA 2PGQB 3ZIAD 4RSPA 5AFZH 1GBKA 1TOCB 1W0ZU 2BQ6B 1GJBB 2G8TA 1HXEH 5F8ZA 2Y5HA 3E1XB 3ATMA 3F9GA 3KQDA 1ZSKA 4M9FA 2ALVA 3F9HA 4FOUC 1SGCA 3PTNA 2JJ1D 3AAVA 4FU8A 2Q6FA 3PM3A 3A8CA 5C0TA 2PR3A 1Z8GA 4MPVA 1G37A 2P16A 1SGDE 2J98A 3URCA 3A7YA 1UVUH 3STIA 5FPSA 4AYYB 2FOAA 2ZHEH 1SGNE 4FVBA 2OXSA 1BRUP 4IN1A 3LC3A 1ETSH 3M5NA 1KXBA 2BX4A 1DWDH 2QCYA 3SGQE 1SGYE 4GUXA 1LKAA 2WHXA 4H6SB 4KTUA 5T3HA 2FMJA 1S6FA 1C9TA 4B1TA 3RXSA 1VGCC 2OQUA 1GDUA 5FX5A 1EJAA 3LH1A 2HPPH 3GCTG 5J4SA 1ESBA 2ZFPH 4Y11E 1WCZA 4MNYA 2RCEA 2C93B 2FI3E 3MOCA 1XXDA 1BRBE 2WV5A 3T25A 1ZLRA 2GTBA 1O2GH 1C1PA 5C20A 3RLYH 4XBDA 2ZHFH 1C5XB 1V2NT 5C0UA 3TGJE 3ZYDA 1UMAH 1MZAA 5IYTA 1XKBC 2PKAB 3AW1A 3SGBE 1THPB 1UVSH 4DT7B 3F2HA 1NC6A 3P6ZB 3C1KA 2H5DA 3SU3A 1MZDA 1VCWA 4SGBE 5C67A 3RXLA 5C3NA 1PQ7A 4CREA 3ZZ4A 4E05H 1O3JA 1ZPZA 4DJZB 2GMTC 1P0SH 5C1UA 1K9OE 2ZDMA 1TWXB 2SNVA 4JZIA 2B0FA 1V2UT 3TJVA 4AX9H 1F0SA 4GLYA 3LIWA 3VB5A 1Q31A 5C5NA 1WV7H 2ZQ1A 3BTTE 1SGEE 3H7OA 5L2ZH 2BZ6H 2FYRA 1K1NA 1MAXA 2W7UA 1TQ7B 1N6YA 4OS5A 3VXEH 4FUIA 4Y0ZE 2QYIA 3TITA 1L0ZA 1O2NA 2BY9X 1LCYA 1AB9B 1C5WB 1HAXB 4ZHAA 1TRNA 3FN8A 5T6FA 1FY5A 1DY8A 3KN2A 1CBWB 1G2MA 2ODQA 4GAWA 4ABBA 4K8BA 1YYY1 3N7DA 3QWCH 1GCTC 1HUTH 1P2MA 2VJ1A 1ELEE 1BBRH 2G5VA 1O2YA 1FY4A 5GNDA 3M35A 2WPKS 3M7QA 1SLWB 3EGKH 1JRTA 1T8MA 2AERH 1BHXB 3QGJA 1GMDF 3MU1A 1D3QB 4O97A 2B7DH 2XC4A 2KCYA 1O3AA 1AWHB 1UTNA 1C2LA 1D3PB 1DLEA 3UNSA 1P05A 1HXFH 2ZU1A 4AFZA 3SNCA 2Z9LA 1YPMH 3AAUA 3SI4H 2CK3D 1G3DA 2ODYB 2VVUA 1FV9A 1PPBH 3BV9B 1N8OB 4E7RG 4F49A 1A5IA 1EQ9A 4K3JA 3O8BA 3ITIA 3KEEA 4ISHH 1GDQA 1OKXA 3OE7D 4K2YA 2P8OB 5PTPA 1NBMD 4WJG2 1NFUA 2ZPRA 3TJOA 4AFUA 2XNDD 5C17A 2VINA 6ESTA 1C1OA 4K1TA 3GYMA 1ARBA 4WH6A 1F0UA 1XVOA 2W5EA 2A7HA 2FEQH 2GV7A 3A8BA 5A8XA 1GMHF 1MTNC 4ZHLU 2QF4A 1V3XA 1Y3XA 1GBMA 3Q3KA 2GCHF 1SL3A 1HIAB 2CV3A 2BMGB 3NZIA 3DD2H 1G32B 3D65E 4K60A 1O2ZA 1ANBA 1P57B 3A83A 5I25A 5LPEA 4OS1A 1XUGA 3TGKE 1TALA 3M7UA 2GJGA 4X8UH 2O8UA 5HXFA 3AVZA 4WXIA 4FUJA 5FHTA 3GCHC 5KECA 1H8ED 1MUEB 2THFB 1JXPA 2BZAA 2I6SA 2QAAA 3QZRA 2J9NA 4JK5A 4ABJA 2OCVB 3SGAE 4Y7AA 3SBKA 1GWAA 1W11U 2FLRH 2XC0A 1CSOE 4U01A 4NFEA 2FOBA 4AGJA 1YGCH 1V2VT 1ZHRA 2AMPA 1FUJA 1O2TA 1GI0A 3GISB 4U32A 4A1XA 2FO9A 1ELFA 3SJ8A 4RKOB 4X1PU 3RXCA 1D9IA 4FETA 4D7FA 3S0NA 1GJ8B 1XUFA 4KELA 1YY3A 2OUAA 5GDSH 1E35B 3V3MA 3TNSA 4LXBH 2BHGA 2KM0A 3D62A 3SORA 2FWWA 3OY5U 3Q77A 1G3EA 5C2ZA 4BNRA 1QJ7B 3RXPA 5A0AE 1GJ6A 2OLGA 3PMBB 1Z1IA 1HYLA 3KCGH 1VCQA 1BMAA 1H1BA 1JRSA 3BTGE 3U8OH 1FLEE 2W7SA 1TNJA 2J5UA 1C2JA 1CGIE 1Y8TA 2A7JA 4YTAA 3AW0A 2ZPSA 2VIPA 1V2RT 3SUDA 3TPIZ 1UTPA 1GBLA 1AE8H 2GZ7A 4ISLA 2QXIA 1RRKA 3PWCA 3HPTB 1RGQA 1W3CA 2Y80A 3ODDA 3P70B 2O8WA 4KKDA 3FFGA 1B0EA 4I8JA 1C2MA 4J2YB 4YM9A 3TK9A 1UCYE 3M61U 4RT1A 1F2SE 1UW7A 3U98H 2CF9H 2K8IA 2PTCE 4FUGA 2J92A 4Q4LA 3SU2A 1TGTA 2XBXA 2AH4X 4UFEH 3EQ0H 1Y59T 2OBOA 3OTJE 2EI6A 4AORA 3RXDA 4J1YA 4WMEA 4H4FA 2VGCC 3VG8A 1N1LA 3IITA 4FUDA 4NZQA 2EQNA 1F5RA 3OX7U 4INLA 4NA8A 3SYJA 4XBCA 3UUZA 1Z1JA 4UEHH 5SGAE 4UE7H 1K0HA 1HPGA 4AB8A 1VR1H 2QC2A 4OS2A 1HAVB 2BY7X 3CENA 3OEED 1O34A 4NWKA 3QUMP 1OP8A 3ZVDA 3TGIE 2AMDA 2ZO3H 2F9NA 1F7ZA 1XUHA 4QT8C 2G51A 4M7GA 2BQWB 3FP8E 4U30A 1UVPA 5L30H 5EQQA 5EJLA 1BBRE 4TWYA 4DG4A 2M2AA 4Y8YA 5F8TA 1GG6C 2ZU3A 4THNH 1C5SA 5EW1H 1VGCB 3VB4A 3SV7A 1E1QD 1LTOA 4CBOA 2GZ8A 5A0CA 1C5VA 1MKWH 1Y3YA 3HATH 2BM2A 3M5MA 3RXHA 2JDID 3BIUH 3URDA 1GJ7B 3PMJA 4NIXA 2G81E 4CHAC 3SU4A 1V2MT 1P04A 4GCHF 1LHGH 2R9PA 1KXAA 1B5GH 1PQ5A 1NM6A 4ZKSU 4JK6A 4UONA 3UWIA 5T1VA 3RC5A 1O5FH 2ZHWH 1C5NH 1E1RD 2GDEH 4INKA 2FYQA 1GI5A 1M9UA 1ELCA 1O2JA 1O2OA 4ZKNU 4ASUD 3PMAB 3VGCC 3KL6A 2SGDE 3A7XA 1O2IA 2BDAA 1NTPA 1C2DA 4Y79A 4K5ZA 3NRLA 4TT3D 1GI1A 2GMTB 1GL0E 4OGYA 2RDEA 4Q7ZA 2Z9GA 1HLTH 5DP5A 7GCHG 1AVXA 4MPUA 3VB3A 1KDQA 4YT6H 5JDUB 2BX3A 3QK1A 3HGPA 1KLTA 3RMLH 1O30A 3GDVA 3Q76A 5FCRA 4MNXA 1V2TT 1GBCA 2NU1E 2BDBA 1ESAA 1O3OA 2QXGA 2ZZUH 1IQHA 1V6DA 1BB0B 2YMSC 1S81A 2FIRH 1OP0A 1L4ZA 3QLPH 2FI4E 1GCTB 1QRWA 4KTSA 1T7CA 2YOLA 1HJAC 1FXYA 3T29A 3TK5A 1XKAC 1K1LA 2C8WB 3FANA 1V2OT 1WOFA 5DP8A 4Q63A 3A84A 5FBIA 1H9LB 3P92A 1H8DH 1MKXH 3MNSA 1EASA 3S7KB 1A46H 5EQSA 5E0JA 4ZUHA 3EA7A 2ZGJA 1DDJA 2A7CA 4WH8A 2Y82A 3BTFE 4NFFA 1O2VA 3PLKA 4O3TA 2ILNA 5JB8S 1K1IA 4XBBA 3BTWE 8LPRA 5JBBS 2FLBH 4FUEA 2HVXA 1AIXH 2NWNA 5JB9S 3SQEE 5F6MA 1PYTD 1UO6A 1YCPM 1WTGH 1SQAA 5EJ1A 3H5CB 3KQ5A 3OAAD 3UR9A 5TCAA 2QV1A 1G9IE 2STAE 1SSXA 2KX4A 4FXGH 3GCOA 1MTNB 4JCNA 3W95A 1QGFA 2LPRA 4X8VH 1BRCE 2CXVA 3EA8A 4BXWA 5LPFA 1ELBA 4OS7A 1TNIA 1CA8B 2VNTA 2Y7ZA 4BTUB 3FP7E 4FUFA 3PRDA 5KGOA 1GHBG 5CHAC 1AD8H 1KIGH 1EATA 1O3KA 3RC4A 5B6LA 3EA9A 1LVMA 2TGDA 6GCHF 1ZOMA 1IQEA 1Y3UA 3HK6B 1BA8B 3RXOA 4HGCA 2ZHDA 1XMNB 3GCHB 1G3BA 1AWFH 1ZHMA 3I77A 1GBIA 3MHWU 1C2KA 1SOTA 2C8ZB 2F9UA 2GDDA 2G55A 3OTPA 4RKJB 1SB1H 3W94A 1C1TA 4MTBA 1H8IH 4CRGA 3ZVAA 1MBQA 4Y8ZA 1NROH 1QJ6B 1NS3A 1ZZZA 1XM1A 2F9PA 2ZPQA 1HJ8A 1VITG 4BOHA 1TMBH 1F5LA 1O2WA 1CHOG 4U2WA 3A80A 2FOCA 2PSYA 5GCHG 1DWCH 1YPHE 3RLWH 2PGBB 3VXFH 1EZUC 2FTMA 1GVLA 3F68H 1WXRA 4Z0KA 1BUIA 1ZSLA 1EZQA 4BAHB 3LKWA 4I31A 3MMGA 2JH5D 1ZJDA 5EU8A 3KGPA 4HFPB 5DO4H 1ELTA 1J17T 4WVPE 1NRNH 1GI7B 2OC1A 3SUFA 4O3UA 1DFPA 4X2XA 4YESB 2SGFE 1O2LA 2F9VA 1C5OH 1EP5A 3S9AA 5J4QA 1U6QA 2A45B 2B9LA 5DP6A 1O3PB 3QGNB 3ESTA 3A87A 3FAOA 2AS9A 2PLXA 5BPEA 2ZGHA 3SU1A 4X1SU 1NN6A 3K6YA 3S7HB 1FY8E 1GDNA 4MNVA 3GY2A 3BTEE 1GBFA 1DSTA 4JZDH 3ZYEA 3P95A 2NU4E 4ZKOU 4KTCA 2WPJS 3LH3A 3TK6A 2F9OA 1LHDH 4DIHH 2V3HH 1FZZA 3BSQA 3RXTA 1J9CH 1ETTH 1P9UA 1T8LA 3ZVBA 1SLUB 2L6OA 2VIWA 1TBRH 1XX9A 3V7TA 4K1EA 1P12E 1QL9A 1BTWA 2XBWA 1IQLA 2QN5T 2VGCB 1NPMA 2XYAA 1SGFG 4NIYA 3MNBA 3SW2B 1L1GA 3GY3A 2QXHA 3P8NA 2TGPZ 3TH4H 3KYFA 1OX1A 4E06H 1WTHD 3E8LA 3M3TA 5ABWA 5EXLA 1OYQA 1Z6EA 1C5ZB 2VH0A 1GJDB 4Y0YE 2A4GA 4AFQA 1EPTA 2UUYA 1Y3WA 5HGGA 3NWUA 2G4UA 2TPIZ 2RG3A 1E37B 1UTQA 1YM0A 3A82A 4X8TH 3KHVA 1KXFA 1C1RA 1GHXH 3ENSB 3FO8D 3TIUA 1RIWC 4MNWA 1EKBB 1GG6B 3LOXA 5EPNA 1GJ9B 3B9FH 4YOIA 3SNBA 9ESTA 2BY5X 3RXIA 2WV9A 1GJCB 1TGSZ 3D23A 3SU6A 4Y8XA 3K2UA 3PLBA 5K0HA 5JYIA 2FOFA 2TGTA 3GDSA 4CHAB 1QA0A 2IOTA 2Z9IA 4ESTE 2GT7A 2ODPA 1W10U 1QFKH 3E0PB 1O36A 1NZQH 1O38A 2P3TB 1TBZH 1ORFA 4I8HA 2A5KA 4TY6A 3V0XA 4R8TB 1QURH 4WXVA 3RXEA 2ZG0H 3R0FA 2HWLB 1BMFD 1UCYK 2QGRA 2ZIQH 2P95A 3GY5A 3M3VA 1O37A 3Q3YA 5E2OA 1KMHB 3VGCB 3A86A 2ZDNA 2QE7D 1FJSA 2IPHA 3MU5A 2TIOA 4FUCA 2NU0E 3ZZ8A 1FONA 1ZJKA 3PRBA 2BYAX 1D3DB 4X2YA 3SZEA 4CH8B 2EC9H 3LGUA 1W14U 2O8LA 2A5AA 2BLQA 4NIWA 4SGAE 1NU9A 2VVCA 4NCYA 4Q80A 2XRCA 3W1EA 3I78A 1LHFH 1NRSH 3RC6A 1QL7A 1ZTJA 4ISIH 8GCHF 4P02A 3A8DA 2VVVA 1D6RA 2OBQA 4D7GA 2ZP0H 1TNKA 1P8VC 4Z6AH 2H9EH 3ZVGA 4DT4A 2YMSB 5DGJA 3P8FA 1QBVH 1QTFA 1WU1A 4MPXA 1BBRK 3TVJB 2BD9A 4Z1MD 1HRTH 3UPEA 3RXAA 1TQ0B 1HJAB 1T8OA 4BAKB 2M5TA 1TFXA 3PB1E 2GGVB 4NA7A 4Y10E 2R3UA 4X2VA 1OWDA 4JZ1A 5FPYA 7KMEH 1BIOA 2D2DA 3OFND 4IMQA 2XXLA 3A7ZA 2OK5A 3EDXB 3AK5A 2FS8A 1BTUA 2H2ZA 3L33A 1B0FA 2FOEA 1P11E 4E7NA 2XC5A 1G30B 3UY9A 1LVOA 5GIBA 1FY3A 2AGIX 2A4RA 3H7TA 4CR5A 1HAZB 1XUIA 4AB9A 2A4OA 3SU5A 2QF3A 3HGNA 3SJOA 1RJXB 2FESH 1EAIA 2VIVA 3NK8A 3ATIA 1EAWA 1P2KA 3K65B 3R3GB 1Y5UT 1D4PB 4B2BA 1E34B 3U9AH 1NRRH 2XNIA 1YPKH 4UFFH 1CU1A 1HFDA 3CS0A 2UWPA 2L74A 1AHTH 1KSNA 1OWJA 4IN2A 1QZ8A 1SQTA 2GX4A 4JYTA 2ZTXA 4I8KA 3RXGA 4MDSA 2IN2A 1OWIA 1V2PT 4BANB 3DCLA 1O2RA 1NO9H 5JBTA 4JYVH 1QJ1B 4AG2A 4WY3A 4Y76A 1W7GH 3VB7A 4CR9A 1ANCA 2PWXA 3STJA 5I46H 1PPFE 2BD4A 3F9EA 5CHAB 1TLDA 1AQ7A 5DP7A 5LH8A 3F9FA 4O03A 4Y6DA 2F43B 3RU4D 2JETC 4B6FA 1MTVA 2A4QA 1TPPA 1QRZA 1KDQB 4YLUA 1BQYA 2ZFSA 3GY8A 1HDTH 4ACBA 2ZQ2A 1ETRH 2VIDA 1DANH 5F8XA 1AZZA 1C1WH 2PV9B 2ZA5A 4CRCA 1EX3A 4TY7A 1F5KU 3QN7A 3NKKA 3RP2A 4OM9A 5C1YA 1GMDG 3OEHD 4GHTA 1CQQA 4CRAA 1C5LH 1MBMA 1FI8A 1ESTA 4INHA 1BRAA 2H9HA 1E38B 1Z71A 1PPEE 1K28D 2C4FH 1FIWA 4IBLH 5ETXA 5DK1A 3RXVA 2XOKD 1O2KA 1BMNH 1BITA 3QTVH 4DURA 2F91A 2PKSC 1H9HE 3BTHE 3EAJA 1ZTLA 1O0DH 3RXJA 3BTQE 2G4TA 2EI7A 5DPAA 1P02A 4UFGH 3DSOA 2HNTE 4JYUH 3PO1C 8ESTE 1ZTKA 4NZLA 2WINI 3MU4A 4AOQA 2EY4C 1TX7A 5A2MH 1GMHG 1DS2E 1GGDC 1VZQH 3B8JA 1P2IA 4Q2KA 1EJMA 2R0LA 5K7RA 1A4WH 1GBTA 1FDPA 1OHHD 5EPYA 2GCHG 1QCPA 4Y7BA 3SQHE 2UWLA 1GI4A 1NESE 1E0FD 1DY9A 3TNTA 3GY7A 2KAIA 1C1SA 1THSH 1ID5H 1P2NA 1O33A 3L6PA 5L2YH 1NFWA 1GI8B 1CT4E 4FVDA 3SV9A 2K1QA 4ZH8A 6CHAC 2BDYA 1GBAA 1YCPK 4I8GA 1P06A 3MH7A 1BTZA 4ISOA 3SUGA 3ZV8A 4XOJA 3PTBA 1S5SA 4NGAH 4TSFD 2HLDD 4NG9H 1TOMH 5A0BA 1EUFA 3MH5A 1VJAU 3KYGA 1GI9B 3V13A 2R3YA 2PUQH 1O3BA 1VKYA 1NBME 4O9VA 1O3HA 2STBE 1AFQC 4FU7A 1TYNA 2C8XB 4FUHA 4ZMAH 2J95A 1SHHB 1TBQH 2QY0B 2A0QB 2F9BH 5JBAS 2ZNKH 2Y5GA 3QZQA 1GBBA 1O3EA 1YF4A 4K1SA 3LGWA 3K6ZA 2BB4A 2F4LA 2G00A 5E0GA 1IQMA 2ZU2A 3A8AA 1G3CA 1YPHC 1BTYA 2CF8H 3PYHA 4D9QA 1SVPA 2FOHA 1RIWB 3LU9B 1MU6B 1O5BB 4ZROA 4MQAA 3BTKE 2FX6A 2HGTH 2ZGCA 4HG6A 1P2JA 2YNAA 1O5EH 2QF5A 3SJIA 3UAIC 2QA9E 3ATLA 3EYDA 4P00A 1AO5A 1FN6A 1SC8U 1V2QT 3ATKA 1SG8B 1MTWA 2ZTZA 4LOYH 3LGYA 3GYLB 4HZHA 3T5FH 1BMMH 1EZSC 3RU4E 3CS7A 1TABE 3SZNA 2BD2A 1BOQA 4B6EA 2AIQA 3P8GA 2JH6D 1C5UA 1ZRKA 3BG8A 1BMLA 1LMWB 2EA3A 4WMDA 2KR7A 1EOLA 3UIRA 1C1UH 2UUKB 1ZHPA 2IPQX 5KEDA 1O3IA 2B5TB 3RXUA 2RA0A 1Z7KA 1J8AA 6LPRA 4MPWA 1T4VH 5E0HA 1DX5M 2DUCA 2V3MA 5CHBA 1F0RA 2BLWA 1GHBF 1W7XH 1C2EA 1YP9A 3IWMA 1LVBA 1HGTH 4ABDA 3FOAA 4X8SH 1ACBE 3GY4A 3UOUA 4CRBA 4UDWH 4HI3A 4D9RA 1PQAA 2GZ9A 2J98B 1AU8A 2QIQA 2HNTF 1L2EA 2RDLA 4HTCH 2A32A 4XSKU 1O2MA 3DFJA 1FN8A 2ZU5A 4XFQA 2FM2A 5FBEA 4AYVB 1UHBA 1C5MD 1DITH 1ZR0A 5HIZA 2BXTH 1MMJN 3F6UH 4GPGA 4ACAA 2XCFA 4X6PA 1OS8A 2ZGBH 3UNRA 3A88A 3O8RA 1V2KT 2GP9B 1OYTH 1TMUH 1DICA 4ABAA 1GHAF 1TGBA 3UNQA 1KLJH 3ZZBA 1TPSA 1A61H 5DN6D 1SBWA 2XW9A 2ASUB 3SOSA 1MKXK 2BD7A 3CP7A 2DE8A 1PPHE 1SLXB 2YMSD 2K0QA 4TYDA 3E0NB 3MH6A 3RXMA 1FMGA 3G01A 4GCHG 1MD7A 4JMYA 5C5OA 3A85A 4ZKRU 1NY22 1O35A 1YLDA 1KTTB 5DG6A 1TMTH 1GMCF 1EAUA 3OSYA 3JZ1B 2WYGA 1G2LA 3M7TA 1H4WA 1PPGE 3MFJA 2Q6DA 4Q7XA 1SOZA 5G4BA 1IOEA 1GCDA 4BTTB 1UVOA 1RXPA 3N7EA 2P94A 3KQEA 1O2QA 1SQRA 1WSSH 2D1JA 3F3BA 4AZ2B 1P2OA 5DKMA 2ZHQH 1GJAB 3LGVA 3A89A 5T6DA 2W3IA 5HMAA 1PQ8A 4B71A 4B73A 1G36A 2TGAA 1FNIA 4X6NA 2JJ2D 2O8TA 1O39A 1O3CA 5EJZA 3SJKA 1RTLA 4DIIH 1COWD 1WAYB 3ZZ5A 1O5CB 3OYPA 3M36A 2AYWA 2BDCA 1WYKA 2C3SA 2XBYA 2JETB 2ZGXH 1SI5H 4X6OA 1AN1E 4H42U 1SKYE 2ZDVH 5T6GA 5AF9H 2WYJA 2ZFRH 2OD3B 1W0KD 1N6XA 1F0TA 2A2XH 2A2QH 1L1JA 2A31A 3UFAA 3SO3A 3VFEA 5A8ZA 1EP6A 1UTLM 2ZCHP 1TAWA 1AGJA 2FOMB 2SFAA 1SFIA 2I6QA 3WWBA 1RTFB 2EI8A 1MQ6A 2LELA 1JOUB 2ZDAH 1CHGA 1LHEH 1DUAA 3F2FA 1THRH 3GCTF 3LC5A 1ZSJA 2Z3DA 5FAHA 1IHSH 1P2QA 1Z8IB 2JKHA 2BQ7B 5GPIB 4WMFA 2IJOB 1GJ4H 1S85A 1UTOA 1HAYB 2W3KA 3GS9A 3SNEA 1CO7E 1GBDA 1O2HA 2J38A 2BDHA 1XXFA 1UK2A 3MO3A 3MWIU 1A1RA 1O2XA 3O8CA 3F2GA 1AVGH 2PKSB 1INCA 2VH6A 1TNLA 2V0BA 2BOHB 3T28A 3S9BA 5EXMA 3PO1B 3SV8A 1Q3XA 3EE0B 3LONA 4Y71A 1RD3B 2BLOA 2Z3EA 1YWUA 1GGDB 1DLKB 2A1DB 3FZDA 2VWMA 2HOBA 2QXJA 1PPZA 4VGCC 3BEIB 5EIYA 1AKSA 4A92A 3ATWA 5AFYH 3DA9B 1ARCA 3FKSD 2SGQE 1A0HB 1K2I1 2SGEE 2Z6BD 1JWTA 1LHCH 1YKTA 3UQOA 1K21H 1GHYH 2WSSD 1BTHH 6GCHG 1C5RA 1C5YB 6CHAB 1QQ4A 1S0RA 1HAGE 1P01A 1Z6JH 3ZVEA 5LGOA 1HAHH 3MH4A 1QA7A 1LKBA 1C5TA 2FZZA 2OC0A 4CH2B 1Q2WA 3VB6A 1V2JT 1QQUA 2ZDKA 3ZVFA 1Y5BT 3TH2H 1DPOA 4YO9A 3QX5H 4XDEA 2Y5FA 1KLIH 1UK4A 1AFQB 5EQRA 1W13U 2ANMH 3TLOA 5A8YA 5FL7D 1MTUA 1BJVA 4GVUA 2VBCA 5A09A 3BEFB 5CMXH 4X2WA 2WZQA 1JMOH 4I7YH 4D76A 1TIOA 1C4V2 5F53A 2XCNA 5F03A 1ZMNA 1O3MA 1DT2A 2V3OH 1AVWA 1GBJA 1T32A 1FY1A 3NCLA 3T27A 1O2PA 3SNAA 5GJ4B 2WPHS 1QBNA 1SHYA 3ZVCA 1MTSA 4R0IA 1DSUA 1LQDB 1S84A 3T2NA 1VCPA 2UUFB 2YNBA 3SN8A 3ZV9A 1VITH 3NXPA 1C5QA 1TA6A 3ZZAA 1SGFA 1AFEH 1GVKB 2DE9A 3LDXH 4ZAEA 3SUEA 2Z7FE 1MAYA 1W0JD 4NIVA 1HAIH 4CRDA 2PP6A 1CA0C 1JIRA 2J4IA 1AI8H 1J15A 3DSPA 2FOGA 1YPJH 4IW4E 1MU8B 1UCYH 2HNTC 7LPRA 2UUJB 1EOJA 5EW2H 1EFRD 3B23B 1DWBH 3DFLA 4X1RU 3QDZB 5E8EH 1UJ1A 3MO6A 1KXCA 2W26A 4H6TA 2ZEBA 1TONA 3RM0H 1HAPH 2KAIB 1O31A 1QRXA 1S82A 1P09A 1MABB 4BAMB 2ANKH 4RN6A 3GDUA 4A1VA 1AUJA 1J14A 1QB9A 9LPRA 3RXRA 3M3SA 1HBTH 1W12U 3VPKA 3MQKC 1OXGA 4ABFA 1GVZA 3RXFA 5ESBA 5FX6A 3WWFA 2BY6X 1O3DA 3SHAH 1SR5C 2W6ID 5GWZA 1IQJA 3MTYA 1TPOA 3GCNA 4LK4A 2Y81A 3A7VA 3LJJA 1O5GH 2ZFQH 1NRQH 5HKKD 1WQSA 4LZ4B 3RMNH 1EPTC 4AGKA 1ABJH 2GKVE 2PTNA 3PV4A 5H4IB 1GJ5H 1RTKA 1BZXE 1SFQB 5EODA 3QO6A 3T62A 1A5GH 1O2UA 2KCPA 1DVAH 1P9SA 4YT7H 2V7QD 4ZXYH 5BRRE 1IQIA 1SGIB 4OS6A 1QR3E 1AUTC 3UWJH 2CHAC 1C2FA 2AGEX 4A5TS 1S6LA 2ZU4A 3MU0A 3UREA 1A7SA 1EB1H 1YLCA 3MI4A 4TPIZ 1UVTH 1NFXA 4X6MA 1T31A 1LQEA 3U8TH 2WUBA 4DOQA 2JH0D 2P3FH 3NUMA 1TA2A 2BDIA 3U1JB 5AHGH 2VWNA 2ZTYA 1BHXF 2F83A 3ZZ6A 2IJD1 1EXFA 1K1OA 1OP2A 1FQ3A 2WV4A 1XUJA 1CGHA 1MCTA 2R2MB 4DVAU 2ZFFH 3UR6A 3UB0A 1YLNA 1LDTT 1MCVA 2GCTC 3BN9A 4B75A 3UQVA 4XRNA 1ZGVA 1TRYA 1W2KH 1CGJE 1OPHB 2NU3E 2H1UA 4YZUA 1HCGA 2FX4A 3PV2A 3GOVB 3LGTA 1AZ8A 1KXDA 1SPJA 3BTDE 4B2AA 3VEQB 1QIXB 4ZHMU 1LPGB 1QL8A 4X1NU 3SI3H 3SHCH 1E36B 4ISNA 4JZFH 2SGPE 3BG4C 1TNHA 8KME2 1TGNA 8GCHG 2HVYB 1TE0A 3ZZ7A 2RFKC 2Z9JA 1GI3A 2J2UA 1LPZB 5EGMA 1C9PA 3ZZDA 2R0KA 3F0PA 7ESTE 1NT1A 2BLVA 4BAQB 4DW2U 1KY9A 4NSVA 2GT8A 1ZGIA 1VJ9U 4I32A 2BVXH 1BCUH 1GPZA 1EZXC 3H09A 4B76A 2OC8A 3N7OA 1SMFE 1HV7A 2FI5E 4KP0A 2GVFA 3FZZA 4RI0A 2VWLA 1DXPA 2FXRA 2VB0A 1CVWH 4B74A 2ANYA 2C8YB 2J97A 2G5NA 4YXWD 3MNCA 2ZC9H 4A1TA 3ZZ3A 1EJNA 2ZWLH 1UHBB 2V6NA 4YOJA 3SV2H 5IK2D 1TPAE 3A7WA 4GSOA 1BT7A 2TRMA 5C1XA 5L6NH 1A5HA 3TJUA 1KTSB 1NFYA 2PKAA 2Y7XA 4A6LA 4D8NA 2AFQB 1ZPBA 3S9CA 1ANEA 2PFEA 3BF6H 1S0QA 5TJXA 5LPRA 1WDIA 1FPHH 3BTME 2OC7A 3LT3A 3QTOH 2CN0H 5EOKA 1SGPE 2B8OH 5CDFE 1K22H 3RXBA 1QB1A 2CMYA 1T4UH 1TX8A 4PROA 4I8LA 1IQFA 1SQOA 3M5OA 4ABEA 1C5PA 3OU0A 4XD7D 4K8YA 1WUNH 3PLPA 4F4OC 1GHVH 3M5LA 2LNCA 3D49H 2HALA 3HKIB 1ELAA 3KIDU 1RFNA 2AHME 1T8NA 1LVYA 2ZF0H 2ULLA 3AASA 4VGCB 2XTTB 1H9IE 1O5AB 2WPMS 3DSGA 2P3UB 7GCHF 5GXPA 2UWOA 3RXQA 1V2WT 4JZEH 1MD8A 1O3NA 1YCPH 1Z8JB 2F3CE 1IAUA 4ASHA 4DY7B 1SGTA 1IQNA 1D3TB 2SGAA 1DXWA 2WPLS 1AY6H 4IS5A 2XWAA 1SGRE 2BTCE 3O8DA 2VWOA 4A7IB 1H8HD 1OOKB 1ZPCA 3E90B 4DGJA 1C1QA 4K69A 2HLCA 3Q00A 1P3EA 1ELVA 1FX0B 3F0OA 4OGXA 1IQKA 2O9QA 1LO6A 2A5IA 2HPQH 1A0LA 1XVMA 2FODA 5EXNA 2ZECA 2KZ4A 2FS9A 3IG6B 2Q1JA 5FCKA 1EB2A 3SV6A 1O5DH 1J16A 1MKWK 4MG3A 3LPRA 2ALPA 3SNDA 1GBEA 3TH3H 3RU4T 2H6MA 1GL1A 2PHBA 2BXUH 1YPGH 2BY8X 3HK3B 4CBNA 1D6WA 4FU9A 1K1PA 2ZKSA 4NSYA 1B7XB 1ZMLA 1IQGA 2XBVA 1NRPH 2BOKA 4BXSA 3RM2H 3Q3XA 5DP4A 1O3GA 2VIOA 1YPEH 1OSSA 2OTVA 1HIAA 4YOGA 3E3TA 3KNXA 4MLFB 5HM9A 1PFXC 2HRVA 1WBGB 4TPYA 2ZFTA 4ABGA 5HM2A 3KQCA 1MQ5A 2TBSA 1CA0B 1XUKA 1GHZA 3GICB 4NWLA 4ABHA 1KXEA 2P93A 1ELDE 4IC6A 1OWHA 1W0YH 5FXLA 3OY6U 2FPZA 1JIMA 4BAOB 4WF8A 2KCOA 3U69H 3KF2A 2AEIH 3L3TA 3A7TA 1AKSB 5JPMH 1AB9C 1YBWA 1JBUH 1DUEA 1ZYOA 5AVDA 1RS0A 2D26C 1K1JA 1X7AC 1P10A 1CBWC 3RUOA 4DCDA 2BVRH 3WY8A 2BVSH 2GD4B 3DT0H 3T26A 1DWEH 3DHKH 3CNRA 3RMMH 1FPCH 3F1SB 1TX6A 3PV5A 3MO9A 2CGAA 1E79D 4I33A 1BTPA 1LPKB 1DOJA 1TRMA 2Q6GA 4ZCNA 3S69A 1WQVH 1FIZA 5HYOA 4I86A 4F48B 3BEUA 3SU0A 1VITF 4GHQA 1W8BH 1MH0A 2VU8E 2G52A 1CHOF 5GCHF 4B2CA 5HIYA 1QBOA 4BTIB 5EG4A 3JZ2B 2AGGX 3ZZCA 4RT0A 1A3BH 2OP9A 2Z9KA 4Q7YA 1C2IA 1EPTB 1OWKA 1PYTC 1KYNA 4F55A 1A3EH 3LJOA 3PWBA 1BDAA 2FP7B 1QNJA 1N8OC 1L1NA 2LP6A 4MVNA 1YC0A 1AMHA 1GI2A 2ANWA 2C90B 2ZCKP 4XE4A 3PMHB 5E2PA 2CHAB 5FPTA 1TB6H 5B6OA 1C2HA 2RA3A 3LGIA 1Y5AT 2P8OC 4YLQH 2O8MA 1BTXA 1UK3A 4X1QU 5DSFA 1FAKH 1FAXA 4OS4A 4X0WU 1S6HA 1F92A 1A0JA 1A2CH 3GY6A 3ZZ9A 2NU2E 1QB6A 3TJNA 2PUXB 1O3LA 2J94A 1PJPA 2XWBI 1V2LT 3NPSA 3P8OA 3MYWA 4WWYA 4FUBA 5IDKA 1QHRB 4KGAA 3SJ9A 5DP3A 2EEKA 2KFWA 1CT2E 1CE5A 4AFSA 2J34A 3UTUH 2GCTB 1HAOH 3M37A 4UFDH 4LZ1H 1GBHA 4AC9A 1SLVB 4IGDA 2R2WU 2GV6A 2PSXA 1TNGA 2ZI2H 1C4U2 2AIPA 1AE5A 3U8RH 3ELAH 4TWWA 3RDZA 2PW8H 3ODFA 2QF0A 1HAVA 1UTJA 2ESTE 4ZXXH 1P3CA 1V2ST 1C1VH 3E16B 1UTKA 1CT0E
chains in the Genus database with same CATH topology
3K9XB 3BG4B 4AN7A 2H5CA 1P03A 3TU7H 1O32A 1OWEA 3HKJB 1ZMJA 1DM4B 2BDGA 3KQBA 1C1NA 3MNXA 1K1MA 2BD3A 2OINA 3RXKA 1O3FA 2WUCA 1DE7H 1Y3VA 2FTLE 1NU7B 2D8WA 1ABIH 3V12A 3U1IB 1PPCE 2Z3CA 1O2SA 1HNEE 3I29A 1Z8RA 1C2GA 3P17H 1EAXA 5TCCA 1GHAG 3BIVH 1SGQE 2H9TH 1IHTH 1HB0B 1QY6A 3MU8A 1HJ9A 4AG1A 2ZDLA 3FVFB 3UOPA 1ZRBA 2FDAA 2BD5A 2VIQA 2V35A 3A81A 3C27B 4UD9H 3E6PH 3FP6E 5ESTE 4NA9H 5DJ7A 2P59A 5JBCS 1GHWH 2CJIA 1C1MA 2SNWA 1GI6A 4ABIA 2BD8A 1ELGA 2Y6TA 1BJUA 1C4Y2 1GMCG 3E91A 1ANDA 1UTMA 3PROA 3DUXH 5CE1A 2ZCLP 1YPLH 1S83A 3RMOH 1TGCA 4IMZA 2Z94A 5DP9A 1L4DA 4IC5A 2OQ5A 2WPIS 4CRFA 2AMQA 2PGQB 4RSPA 5AFZH 1GBKA 1TOCB 1W0ZU 2BQ6B 1GJBB 2G8TA 1HXEH 5F8ZA 2Y5HA 3E1XB 3ATMA 3F9GA 3KQDA 1ZSKA 2ALVA 3F9HA 1SGCA 3PTNA 3AAVA 4FU8A 2Q6FA 3PM3A 3A8CA 2PR3A 1Z8GA 4MPVA 1G37A 2P16A 1SGDE 3URCA 3A7YA 1UVUH 3STIA 5FPSA 4AYYB 2FOAA 2ZHEH 1SGNE 4FVBA 2OXSA 1BRUP 4IN1A 3LC3A 1ETSH 3M5NA 1KXBA 2BX4A 1DWDH 2QCYA 3SGQE 1SGYE 4GUXA 1LKAA 4H6SB 4KTUA 5T3HA 2FMJA 1S6FA 1C9TA 4B1TA 3RXSA 1VGCC 2OQUA 1GDUA 5FX5A 1EJAA 3LH1A 2HPPH 3GCTG 5J4SA 1ESBA 2ZFPH 4Y11E 1WCZA 4MNYA 2RCEA 2C93B 2FI3E 3MOCA 1XXDA 1BRBE 2WV5A 3T25A 1ZLRA 2GTBA 1O2GH 1C1PA 5C20A 3RLYH 4XBDA 2ZHFH 1C5XB 1V2NT 3TGJE 3ZYDA 1UMAH 1MZAA 5IYTA 1XKBC 2PKAB 3AW1A 3SGBE 1THPB 1UVSH 4DT7B 1NC6A 3P6ZB 3C1KA 2H5DA 3SU3A 1MZDA 1VCWA 4SGBE 5C67A 3RXLA 5C3NA 1PQ7A 4CREA 3ZZ4A 4E05H 1O3JA 1ZPZA 4DJZB 2GMTC 1P0SH 5C1UA 1K9OE 2ZDMA 1TWXB 2SNVA 4JZIA 2B0FA 1V2UT 3TJVA 4AX9H 1F0SA 4GLYA 3LIWA 3VB5A 1Q31A 5C5NA 1WV7H 2ZQ1A 3BTTE 1SGEE 3H7OA 5L2ZH 2BZ6H 2FYRA 1K1NA 1MAXA 2W7UA 1TQ7B 1N6YA 4OS5A 3VXEH 4FUIA 4Y0ZE 2QYIA 3TITA 1L0ZA 1O2NA 2BY9X 1LCYA 1AB9B 1C5WB 1HAXB 4ZHAA 1TRNA 5T6FA 1FY5A 1DY8A 3KN2A 1CBWB 1G2MA 2ODQA 4GAWA 4ABBA 4K8BA 1YYY1 3QWCH 1GCTC 1HUTH 1P2MA 2VJ1A 1ELEE 1BBRH 2G5VA 1O2YA 1FY4A 3M35A 2WPKS 3M7QA 1SLWB 3EGKH 1JRTA 1T8MA 2AERH 1BHXB 3QGJA 1GMDF 3MU1A 1D3QB 4O97A 2B7DH 2XC4A 1O3AA 1AWHB 1UTNA 1C2LA 1D3PB 1DLEA 3UNSA 1P05A 1HXFH 2ZU1A 4AFZA 3SNCA 2Z9LA 1YPMH 3AAUA 3SI4H 1G3DA 2ODYB 2VVUA 1FV9A 1PPBH 3BV9B 1N8OB 4E7RG 4F49A 1A5IA 1EQ9A 4K3JA 3O8BA 3ITIA 3KEEA 4ISHH 1GDQA 1OKXA 4K2YA 2P8OB 5PTPA 4WJG2 1NFUA 2ZPRA 3TJOA 4AFUA 2VINA 6ESTA 1C1OA 4K1TA 3GYMA 1ARBA 4WH6A 1F0UA 1XVOA 2W5EA 2A7HA 2FEQH 2GV7A 3A8BA 5A8XA 1GMHF 1MTNC 4ZHLU 1V3XA 1Y3XA 1GBMA 3Q3KA 2GCHF 1SL3A 1HIAB 2CV3A 2BMGB 3NZIA 3DD2H 1G32B 3D65E 4K60A 1O2ZA 1ANBA 1P57B 3A83A 5I25A 5LPEA 4OS1A 1XUGA 3TGKE 1TALA 3M7UA 4X8UH 2O8UA 5HXFA 3AVZA 4WXIA 4FUJA 5FHTA 3GCHC 1MUEB 2THFB 1JXPA 2BZAA 2I6SA 2QAAA 3QZRA 2J9NA 4JK5A 4ABJA 2OCVB 3SGAE 4Y7AA 3SBKA 1GWAA 1W11U 2FLRH 2XC0A 1CSOE 4U01A 4NFEA 2FOBA 4AGJA 1YGCH 1V2VT 1ZHRA 2AMPA 1FUJA 1O2TA 1GI0A 3GISB 4U32A 4A1XA 2FO9A 1ELFA 3SJ8A 4RKOB 4X1PU 3RXCA 1D9IA 4D7FA 3S0NA 1GJ8B 1XUFA 4KELA 5GDSH 2OUAA 3V3MA 1E35B 3TNSA 4LXBH 2BHGA 3D62A 3SORA 2FWWA 3OY5U 3Q77A 1G3EA 5C2ZA 4BNRA 1QJ7B 3RXPA 5A0AE 1GJ6A 2OLGA 3PMBB 1Z1IA 1HYLA 3KCGH 1VCQA 1BMAA 1H1BA 1JRSA 3BTGE 3U8OH 1FLEE 2W7SA 1TNJA 1C2JA 1CGIE 1Y8TA 2A7JA 4YTAA 3AW0A 2ZPSA 2VIPA 1V2RT 3SUDA 3TPIZ 1UTPA 1GBLA 1AE8H 2GZ7A 4ISLA 2QXIA 1RRKA 3PWCA 3HPTB 1RGQA 1W3CA 2Y80A 3ODDA 3P70B 2O8WA 4KKDA 3FFGA 1B0EA 4I8JA 1C2MA 4J2YB 4YM9A 3TK9A 1UCYE 3M61U 1F2SE 3U98H 2CF9H 2PTCE 4FUGA 2J92A 3SU2A 1TGTA 2XBXA 2AH4X 4UFEH 3EQ0H 1Y59T 2OBOA 3OTJE 2EI6A 4AORA 3RXDA 4J1YA 4WMEA 4H4FA 2VGCC 1N1LA 3IITA 4FUDA 4NZQA 1F5RA 3OX7U 4INLA 4NA8A 4XBCA 3UUZA 1Z1JA 4UEHH 5SGAE 4UE7H 1HPGA 4AB8A 1VR1H 2QC2A 4OS2A 1HAVB 2BY7X 3CENA 4NWKA 1O34A 3QUMP 1OP8A 3ZVDA 3TGIE 2AMDA 2ZO3H 2F9NA 1F7ZA 1XUHA 4QT8C 2G51A 4M7GA 2BQWB 3FP8E 4U30A 1UVPA 5L30H 5EQQA 1BBRE 4TWYA 4DG4A 4Y8YA 5F8TA 1GG6C 2ZU3A 4THNH 1C5SA 5EW1H 1VGCB 3VB4A 3SV7A 4CBOA 1LTOA 2GZ8A 5A0CA 1C5VA 1MKWH 1Y3YA 3HATH 2BM2A 3M5MA 3RXHA 3BIUH 3URDA 1GJ7B 3PMJA 4NIXA 2G81E 4CHAC 3SU4A 1V2MT 1P04A 4GCHF 1LHGH 2R9PA 1KXAA 1B5GH 1PQ5A 1NM6A 4ZKSU 4JK6A 4UONA 3UWIA 3RC5A 1O5FH 2ZHWH 1C5NH 4INKA 2GDEH 2FYQA 1GI5A 1M9UA 1ELCA 1O2JA 1O2OA 4ZKNU 3PMAB 3VGCC 3KL6A 2SGDE 3A7XA 1O2IA 2BDAA 1NTPA 1C2DA 4Y79A 4K5ZA 1GI1A 2GMTB 1GL0E 4OGYA 4Q7ZA 2Z9GA 1HLTH 5DP5A 7GCHG 1AVXA 4MPUA 3VB3A 1KDQA 4YT6H 5JDUB 2BX3A 3QK1A 3HGPA 1KLTA 3RMLH 1O30A 3GDVA 3Q76A 5FCRA 4MNXA 1V2TT 1GBCA 2NU1E 2BDBA 1ESAA 1O3OA 2QXGA 2ZZUH 1IQHA 1V6DA 1BB0B 1S81A 2FIRH 1OP0A 1L4ZA 3QLPH 2FI4E 1GCTB 1QRWA 4KTSA 1T7CA 2YOLA 1HJAC 1FXYA 3T29A 3TK5A 1XKAC 1K1LA 2C8WB 3FANA 1V2OT 1WOFA 5DP8A 3A84A 5FBIA 1H9LB 3P92A 1H8DH 1MKXH 3MNSA 1EASA 3S7KB 1A46H 5EQSA 5E0JA 4ZUHA 3EA7A 2ZGJA 1DDJA 2A7CA 4WH8A 2Y82A 3BTFE 4NFFA 1O2VA 3PLKA 4O3TA 2ILNA 5JB8S 1K1IA 4XBBA 3BTWE 8LPRA 5JBBS 2FLBH 4FUEA 2HVXA 1AIXH 2NWNA 5JB9S 3SQEE 5F6MA 1PYTD 1UO6A 1YCPM 1WTGH 1SQAA 3H5CB 3UR9A 5TCAA 2QV1A 1G9IE 2STAE 1SSXA 4FXGH 3GCOA 1MTNB 4JCNA 3W95A 1QGFA 2LPRA 4X8VH 1BRCE 2CXVA 3EA8A 4BXWA 5LPFA 1ELBA 4OS7A 1TNIA 1CA8B 2VNTA 2Y7ZA 4BTUB 3FP7E 4FUFA 1GHBG 5CHAC 1AD8H 1KIGH 1EATA 1O3KA 3RC4A 3EA9A 1LVMA 2TGDA 6GCHF 1ZOMA 1IQEA 1Y3UA 3HK6B 1BA8B 3RXOA 4HGCA 2ZHDA 1XMNB 3GCHB 1G3BA 1AWFH 1ZHMA 3I77A 1GBIA 3MHWU 1C2KA 1SOTA 2C8ZB 2F9UA 2GDDA 2G55A 4RKJB 1SB1H 3W94A 1C1TA 4MTBA 1H8IH 4CRGA 3ZVAA 1MBQA 4Y8ZA 1NROH 1QJ6B 1NS3A 1ZZZA 1XM1A 2F9PA 2ZPQA 1HJ8A 1VITG 4BOHA 1TMBH 1F5LA 1O2WA 1CHOG 4U2WA 3A80A 2FOCA 2PSYA 5GCHG 1DWCH 1YPHE 3RLWH 2PGBB 3VXFH 1EZUC 2FTMA 1GVLA 3F68H 4Z0KA 1BUIA 1ZSLA 1EZQA 4BAHB 3LKWA 4I31A 3MMGA 2JH5D 1ZJDA 5EU8A 3KGPA 4HFPB 5DO4H 1ELTA 1J17T 4WVPE 1NRNH 1GI7B 2OC1A 3SUFA 4O3UA 1DFPA 4X2XA 4YESB 2SGFE 1O2LA 2F9VA 1C5OH 1EP5A 3S9AA 5J4QA 1U6QA 2A45B 2B9LA 5DP6A 1O3PB 3QGNB 3ESTA 3A87A 3FAOA 2AS9A 2PLXA 5BPEA 2ZGHA 3SU1A 4X1SU 1NN6A 3K6YA 3S7HB 1FY8E 1GDNA 4MNVA 3GY2A 3BTEE 1GBFA 1DSTA 4JZDH 3ZYEA 3P95A 2NU4E 4ZKOU 4KTCA 2WPJS 3LH3A 3TK6A 2F9OA 1LHDH 4DIHH 2V3HH 1FZZA 3BSQA 3RXTA 1J9CH 1ETTH 1P9UA 1T8LA 3ZVBA 1SLUB 2VIWA 1TBRH 1XX9A 3V7TA 4K1EA 1P12E 1QL9A 1BTWA 2XBWA 1IQLA 2QN5T 2VGCB 1NPMA 2XYAA 1SGFG 4NIYA 3MNBA 3SW2B 1L1GA 3GY3A 2QXHA 3P8NA 2TGPZ 3TH4H 1OX1A 4E06H 1WTHD 3E8LA 3M3TA 5ABWA 5EXLA 1OYQA 1Z6EA 1C5ZB 2VH0A 1GJDB 4Y0YE 2A4GA 4AFQA 1EPTA 2UUYA 1Y3WA 5HGGA 3NWUA 2G4UA 2TPIZ 2RG3A 1E37B 1UTQA 1YM0A 3A82A 4X8TH 3KHVA 1KXFA 1C1RA 1GHXH 3ENSB 3TIUA 1RIWC 4MNWA 1EKBB 1GG6B 3LOXA 5EPNA 1GJ9B 3B9FH 4YOIA 3SNBA 9ESTA 2BY5X 3RXIA 1GJCB 1TGSZ 3D23A 3SU6A 4Y8XA 3K2UA 3PLBA 5K0HA 5JYIA 2FOFA 2TGTA 3GDSA 4CHAB 1QA0A 2IOTA 2Z9IA 4ESTE 2GT7A 2ODPA 1W10U 1QFKH 3E0PB 2P3TB 1O36A 1NZQH 1O38A 1TBZH 1ORFA 4I8HA 2A5KA 4TY6A 3V0XA 4R8TB 1QURH 4WXVA 3RXEA 2ZG0H 3R0FA 2HWLB 1UCYK 2QGRA 2ZIQH 2P95A 3GY5A 3M3VA 1O37A 3Q3YA 5E2OA 3VGCB 3A86A 2ZDNA 1FJSA 2IPHA 3MU5A 2TIOA 4FUCA 2NU0E 3ZZ8A 1FONA 1ZJKA 2BYAX 1D3DB 4X2YA 4CH8B 2EC9H 3LGUA 1W14U 2O8LA 2A5AA 2BLQA 4NIWA 4SGAE 1NU9A 2VVCA 4NCYA 4Q80A 2XRCA 3I78A 1LHFH 1NRSH 3RC6A 1QL7A 1ZTJA 4ISIH 8GCHF 3A8DA 2VVVA 1D6RA 2OBQA 4D7GA 2ZP0H 1TNKA 1P8VC 4Z6AH 2H9EH 3ZVGA 5DGJA 3P8FA 1QBVH 1QTFA 1WU1A 4MPXA 1BBRK 3TVJB 2BD9A 1HRTH 3UPEA 3RXAA 1TQ0B 1HJAB 1T8OA 4BAKB 2M5TA 1TFXA 3PB1E 2GGVB 4NA7A 4Y10E 2R3UA 4X2VA 1OWDA 4JZ1A 5FPYA 7KMEH 1BIOA 2D2DA 4IMQA 2XXLA 3A7ZA 3EDXB 2FS8A 1BTUA 2H2ZA 3L33A 1B0FA 2FOEA 1P11E 4E7NA 2XC5A 1G30B 3UY9A 1LVOA 5GIBA 1FY3A 2AGIX 2A4RA 3H7TA 4CR5A 1HAZB 1XUIA 4AB9A 2A4OA 3SU5A 2QF3A 3HGNA 3SJOA 1RJXB 2FESH 1EAIA 2VIVA 3NK8A 3ATIA 1EAWA 1P2KA 3K65B 3R3GB 1Y5UT 1D4PB 4B2BA 1E34B 3U9AH 1NRRH 2XNIA 1YPKH 4UFFH 1CU1A 1HFDA 3CS0A 2UWPA 1AHTH 1KSNA 1OWJA 4IN2A 1SQTA 2GX4A 4JYTA 3RXGA 2ZTXA 4I8KA 4MDSA 2IN2A 1OWIA 1V2PT 4BANB 1O2RA 1NO9H 5JBTA 4JYVH 1QJ1B 4AG2A 4WY3A 4Y76A 1W7GH 3VB7A 4CR9A 1ANCA 2PWXA 3STJA 5I46H 1PPFE 2BD4A 3F9EA 5CHAB 1TLDA 1AQ7A 5DP7A 5LH8A 3F9FA 4O03A 4Y6DA 3RU4D 2JETC 1MTVA 2A4QA 1TPPA 1QRZA 1KDQB 4YLUA 1BQYA 2ZFSA 3GY8A 1HDTH 2ZQ2A 1ETRH 2VIDA 1DANH 5F8XA 1AZZA 1C1WH 2PV9B 2ZA5A 4CRCA 1EX3A 4TY7A 1F5KU 3QN7A 3NKKA 3RP2A 5C1YA 1GMDG 4GHTA 1CQQA 4CRAA