1WQSA

Crystal structure of norovirus 3c-like protease
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
173
structure length
173
Chain Sequence
APPTLWSRVVRFGSGWGFWVSPTVFITTTHVIPTGVREFFGEPIESIAIHRAGEFTQFRFSRKVRPDLTGMVLEEGCPEGVVCSILIKRDSGELLPLAVRMGAIASMKIQGRLVHGQSGMLLTGANAKGMDLGTLPGDCGAPYVYKRNNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like protease
publication title A norovirus protease structure provides insights into active and substrate binding site integrity
pubmed doi rcsb
source organism Chiba virus
total genus 32
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wqsA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wqsA01
3ZVGA 1PPEE 1DANH 1ZOMA 4D8NA 1L0ZA 1A3BH 1J17T 2ANWA 2FO9A 1M9UA 1YPLH 1C5UA 1BZXE 5GXPA 1EPTC 3LDXH 2P94A 1C1PA 2STBE 2GV7A 5DP4A 1SFIA 1W14U 1SQTA 3SQHE 1O2LA 2BY6X 3VB6A 2GT8A 2P16A 1IAUA 1LKBA 3RXQA 2ZA5A 2BDIA 4JK6A 1NU9A 3TGIE 2A45B 4YT6H 4AB8A 4JYUH 1AWHB 4K60A 5JBCS 4UONA 1HAOH 1H9LB 1TMTH 3BTKE 1ZPCA 3STIA 1GI3A 1ZMLA 1SFQB 1PYTD 2UWPA 1TX6A 2K1QA 4Y71A 1AUTC 3EGKH 4YLQH 1F0RA 3BTEE 4KTCA 3BIVH 1O2IA 1W11U 1PPCE 3A8AA 3RXFA 3UNRA 4CR9A 5GCHG 4DGJA 1C1WH 4WWYA 5JB8S 5A2MH 1G3CA 4X1PU 1JMOH 1P06A 3V13A 2OBOA 1A4WH 1O2JA 5EQRA 1GI8B 6CHAC 2H9HA 2UUKB 4BTTB 3RMOH 2EI7A 1B0FA 2OINA 3RXRA 3CENA 1AKSA 3DA9B 2PUQH 4O9VA 1PQ7A 3HGNA 1NS3A 2ODYB 1W7XH 1NFYA 3EAJA 2G81E 2XCFA 3A7YA 3E3TA 5C67A 1YPEH 1Y3VA 3GYMA 1WTHD 3SI4H 3SU0A 2QC2A 1NRRH 2NU2E 1GI6A 3CS7A 4CRAA 3R3GB 1HDTH 1HAVB 1XM1A 2Q1JA 1C5QA 3MH7A 5TJXA 1MUEB 1CBWC 4R0IA 3PMAB 1A2CH 2AMQA 1D6WA 3M61U 2BD2A 1HRTH 2ZFFH 2ALPA 2Z9JA 1SGPE 1KIGH 1HV7A 1RTLA 4ZXYH 3SNEA 3RM0H 3FP7E 4YLUA 1PJPA 4HZHA 4X0WU 1KDQB 1A7SA 4IC6A 5J4SA 4WXIA 2BM2A 3RC5A 2Z9KA 4XBCA 3F9GA 2BQWB 1O3HA 3BTHE 4NWKA 1OWDA 1UTNA 2G5VA 1BIOA 1OWKA 2J9NA 3SJIA 2OQ5A 3BN9A 3HGPA 3NKKA 2HALA 1HGTH 5C2ZA 3EA9A 1C1TA 3F68H 1KXBA 3FVFB 4I31A 1TONA 1IQIA 1ZSLA 3K6YA 3M3VA 2VIDA 2BDCA 4MLFB 4D7FA 2ZGXH 4Y11E 3TK5A 3UUZA 1F92A 2FS8A 3SV7A 2PUXB 4UE7H 5GJ4B 4O97A 1XKBC 3KHVA 1WQSA 1AWFH 1RTFB 2PKAA 1GI0A 4B76A 1V2VT 3OU0A 2R3UA 4H4FA 2BDHA 1Z1JA 2HLCA 2P8OB 4AGKA 1BJVA 3RC4A 2Z3CA 2PR3A 2O8WA 3ATLA 3PLBA 1IQKA 3U1IB 1T4UH 3GYLB 4X8TH 4JZDH 4BAHB 1AUJA 1CA0C 1FONA 2EEKA 3IITA 5A09A 5AFZH 3M7TA 5F8XA 1AVGH 3SORA 5G4BA 1KXAA 1BUIA 4H42U 4MPWA 1K1JA 1GPZA 2VIQA 4AX9H 2A31A 2F83A 2QY0B 3RLYH 3RXMA 4WMEA 1G37A 1SVPA 2FX6A 3UY9A 5EXLA 3SJ8A 1BDAA 3E1XB 2OC0A 4CRGA 2PKSB 3M5LA 4ABHA 1GBMA 2ANMH 1TX8A 1W10U 1BTZA 2VJ1A 4X2VA 5JBBS 1JIRA 1GHAG 3V3MA 4A92A 2ZCHP 1OKXA 1EAIA 3M37A 1GMDG 3PWBA 1OWJA 4KKDA 1XUGA 5E0GA 3LJOA 4Y0ZE 1CE5A 1GDQA 1F5LA 3A7ZA 5E0JA 3RXTA 2R2MB 4K8BA 1GBDA 4MTBA 2QAAA 3A85A 4AFUA 3TNTA 5B6OA 4J2YB 1MU8B 2FP7B 1BB0B 1DWDH 2VNTA 1W3CA 4Y8YA 1ELDE 1PPGE 3H7OA 1ELBA 1SGYE 2ZKSA 1EZQA 2QN5T 1VITH 3MU1A 1GJ8B 1AVXA 1HIAA 1LQEA 3CS0A 3QUMP 1OWIA 3QX5H 3RXLA 1QR3E 1P2MA 4A1VA 1FY3A 2XCNA 2BQ6B 1YBWA 2AS9A 4X2YA 4U2WA 1EJAA 1QJ1B 4Q7ZA 1YLCA 1YM0A 4Y8XA 2ZZUH 3SBKA 4Y7AA 1RFNA 2ZPSA 3U8OH 3U8RH 1SC8U 1ETSH 1WQVH 3QTVH 2ZGBH 1QQ4A 3ZYDA 4CBOA 1QL8A 1CT4E 4U01A 1LPGB 1SR5C 1L2EA 3BIUH 1UMAH 3ZZ6A 1SOTA 2EI8A 3BTFE 1T7CA 1C2EA 4ISOA 1C2DA 4DVAU 3SHAH 4BXSA 1NM6A 3ZZDA 4R8TB 3RXIA 2PKSC 4OGYA 1ZGIA 1EZUC 4NA7A 1QB6A 1WOFA 3SV9A 4DIHH 3FP6E 4AB9A 1AGJA 1ZGVA 3OTJE 2GCHF 3PB1E 2B0FA 2AH4X 2Z9LA 4NG9H 3EQ0H 3L6PA 3MU0A 3GCHB 1TA2A 2H5CA 3RXBA 3ZZ3A 4B71A 2OQUA 3C27B 4ZXXH 1PPFE 1AVWA 1Z8RA 1T8OA 3Q3KA 3ZVFA 1MZAA 1K2I1 1GGDB 3SGAE 1XVOA 3BTTE 1MAYA 4B74A 3OSYA 4NIYA 5PTPA 4KP0A 1FZZA 1NU7B 2VIWA 1P8VC 3LGYA 3FZDA 4INLA 3ZZAA 3S7KB 4ZHMU 3VB7A 3BSQA 4JMYA 1EJMA 3BTGE 3O8BA 3P92A 5BRRE 1EZXC 1O0DH 2XBVA 3ZZCA 1K9OE 3FAOA 1O30A 1C5TA 1ZPBA 1TPOA 1O3EA 1YCPH 1SHYA 2G8TA 4BTIB 4YT7H 1C1OA 2BOKA 3LT3A 1SGEE 2VIOA 2EI6A 1ELEE 3PWCA 3SUEA 4B2AA 4U30A 3P17H 4AFQA 1BRUP 1TRYA 1GBBA 4HTCH 3EE0B 3SV8A 3M7QA 1G3EA 1SHHB 1X7AC 3RM2H 1IHTH 2FOHA 2BDGA 4YOIA 2CMYA 1RRKA 1B5GH 1WBGB 4MQAA 5TCCA 1BA8B 2VH6A 1Z8JB 2YNAA 1B0EA 1V3XA 2FS9A 2ZC9H 3TK9A 3PROA 1DOJA 2OXSA 5ESBA 3UWJH 4JZ1A 3TJVA 3M3TA 2J94A 3PM3A 1GGDC 2RG3A 2Y80A 7ESTE 1FAXA 1ZRKA 1OWHA 5EU8A 1GMCF 2ZPQA 2ZFPH 2IN2A 4ABEA 2ZDAH 1Y5BT 2XW9A 1JRTA 1GBKA 1ANBA 1AN1E 1S6FA 2FOCA 3TH3H 2A32A 4AORA 1TQ0B 1ELTA 1JIMA 4X2XA 4TY6A 3UR6A 1P10A 3NPSA 1MBQA 4KELA 1ELGA 1P2QA 2GP9B 1ZYOA 1D3DB 5AFYH 1QHRB 2KAIA 1TBZH 1AU8A 3LH3A 1Z6EA 1AO5A 1C4Y2 4Y7BA 3ZVDA 3KL6A 2QF3A 2WV5A 3RMMH 1AZZA 3E0PB 3TJUA 4UFEH 1BBRE 2A0QB 2ZI2H 1HAZB 1ZTKA 4B2CA 2H5DA 2ZHWH 3M5MA 1EP5A 4Y79A 7LPRA 1GHAF 5JB9S 3A84A 3V7TA 4FVBA 1GMHF 2AGEX 4DY7B 1Z8GA 1IQFA 1EATA 2P59A 3A8DA 5F03A 2Y5FA 3OY6U 1NN6A 3BTDE 5C5NA 1UO6A 2GVFA 1VITF 1P01A 3GY3A 1OX1A 3BEUA 4ZUHA 1FNIA 3U69H 2CN0H 1V2KT 4NWLA 1NY22 4TPYA 4A7IB 4CH2B 2ESTE 1OPHB 4ESTE 2PW8H 4IS5A 2GV6A 3HATH 1TMUH 1IQGA 3KGPA 1N8OC 5DP8A 3V0XA 1DY9A 5TCAA 1HLTH 1SGFA 1O3OA 2BXTH 3P70B 4GVUA 4LK4A 1O2XA 2NU4E 1P2KA 1GBFA 4JCNA 4RSPA 2BLVA 3A86A 3F1SB 1Y59T 1DM4B 1GJ7B 1C2JA 4NSYA 1C1NA 2XWBI 1SLWB 1GHWH 4FUDA 1O33A 1O3GA 4JYTA 3T29A 3JZ1B 5DO4H 1TPAE 2WPLS 4X1NU 3TGKE 1NPMA 3MNXA 5FHTA 4ASHA 3FP8E 2G00A 2XYAA 1DS2E 1KLTA 1QBNA 2CGAA 2FODA 1TIOA 5LPFA 1ZMNA 2ZTZA 3D23A 1GI5A 1GHVH 4O3TA 1QA0A 4Y76A 3GCNA 1O3BA 1SOZA 3S69A 3ZZ4A 1DITH 3T25A 1GL0E 5I25A 1UTQA 3F6UH 2ZIQH 3URCA 1F5RA 4TPIZ 4B2BA 1GCDA 5DKMA 2BZAA 2VVCA 2ZDLA 1LVMA 5FPYA 1HCGA 1YPHE 3E90B 1O37A 2XXLA 5JBTA 5L2YH 1SQAA 2A4RA 3P6ZB 3SV2H 2VB0A 2GZ7A 1KYNA 4CREA 1ESTA 1KTTB 5HMAA 1BTHH 5DP6A 5F8TA 1AZ8A 2GMTC 3SO3A 2SFAA 3LH1A 2H1UA 1O2MA 4CH8B 4X1RU 5L6NH 5K7RA 2AFQB 4I8JA 5FCKA 4DOQA 3DUXH 1GI4A 5ETXA 1NFWA 2FLBH 4GAWA 2RCEA 4D9RA 2Z6BD 3PO1B 1C5LH 3EYDA 4X8SH 3AW1A 2HWLB 1HAIH 1NROH 2WYJA 4NSVA 1QA7A 3M5OA 1U6QA 5FAHA 1S83A 1P04A 1T8LA 1S82A 1PYTC 2G4UA 5EW2H 2HNTE 2VWLA 4UEHH 1VR1H 4XDEA 1T31A 1MH0A 1O2KA 4NA9H 5DP3A 1MD7A 1W2KH 2WINI 1P0SH 1EB2A 1K22H 1DUEA 1C2MA 1HYLA 1O3JA 1BMAA 3A87A 1O2HA 3KF2A 2A5KA 1P2JA 2F9BH 3GY2A 3SUFA 1ZSJA 5T3HA 1LHGH 3UREA 1K1LA 3A80A 1BRBE 3AAUA 1MKWH 2NWNA 1GHBF 3SU3A 1O34A 2AIQA 1DFPA 1TE0A 3KN2A 5CE1A 2UUJB 3QDZB 1HAYB 2FI3E 1GJ6A 3RXKA 2QV1A 2ASUB 3I29A 1AB9C 2FX4A 4RN6A 2VVUA 3UQVA 2B9LA 3EA7A 2GCHG 3TITA 2OTVA 1EB1H 2Y81A 3SU5A 1O3PB 2FWWA 2ZDVH 1MQ6A 1MKWK 5C5OA 1A5IA 1IQEA 1Y5AT 3RLWH 1XMNB 1G2MA 1MBMA 1WU1A 4GCHF 1K28D 1O3DA 1BHXF 3DFLA 1KXCA 1GBTA 1KLJH 2WUBA 1FAKH 1O2SA 3MO9A 1CO7E 1XKAC 1L1GA 4IC5A 1Z71A 3PO1C 2GX4A 1SSXA 2A4OA 4E05H 3PMHB 4NFFA 1FQ3A 1GBLA 4K1SA 1TRMA 3GICB 1ZHPA 2BD3A 2A7HA 4VGCB 1OYTH 2Z3DA 4MG3A 1O2YA 3SJKA 3QZQA 4AZ2B 2XC0A 1WV7H 1QB1A 1K1OA 2A5AA 1JXPA 3DFJA 1E0FD 1RS0A 2TIOA 2Q6FA 5LPRA 1K1IA 1TNGA 1ZTJA 1VCWA 4YOJA 1O31A 2VVVA 2ZECA 2XBYA 2D8WA 2AERH 1EOLA 1FI8A 3D49H 1FY1A 1O5GH 3SU6A 1FPCH 2R2WU 5EW1H 2C3SA 1C1RA 3ODFA 1HXFH 1H8IH 1HAPH 2OD3B 1W13U 2GZ8A 2PSXA 1KXEA 1JWTA 1BTXA 3OY5U 1WCZA 5E8EH 1LHDH 1C2KA 3SHCH 1KY9A 1IOEA 1QTFA 2ODPA 1DVAH 2FOFA 3P8GA 1UJ1A 3AASA 2P95A 2AMPA 4X8UH 2QGRA 1UCYE 2ZU1A 2Y82A 4RKJB 2QA9E 1FIZA 1GJDB 2ZCKP 2C8XB 4HGCA 4GHQA 2AIPA 3A8CA 1DUAA 3ENSB 1GBCA 2QXHA 3RXEA 2ZP0H 1GBEA 1C1SA 1P02A 1DXPA 2CXVA 3TU7H 5ABWA 2FZZA 1IQMA 4NFEA 1GVLA 2B8OH 3QGNB 1HB0B 1YPKH 3RXSA 4ABFA 1GMCG 4X2WA 4DG4A 1GJ5H 1V2ST 3RXAA 2BD8A 2CHAB 3S9CA 1O2UA 4VGCC 1AMHA 1XUFA 3SU1A 3MNCA 4ZKSU 1ETRH 2ZCLP 4INKA 1CGHA 3TLOA 4O3UA 2H2ZA 3BTME 5DP9A 1EAXA 3RU4E 2BX4A 4UFDH 1UTJA 4CRBA 2FOBA 1A46H 1SGNE 2A1DB 3E6PH 1ZPZA 3A89A 1C5SA 2W3KA 5T6FA 3FANA 3GY5A 1UK4A 4I32A 4TYDA 1RXPA 1YKTA 1MTNB 1BRAA 1QFKH 1OSSA 1QBOA 2QXJA 3KEEA 2A4QA 2Z9GA 1GMHG 1NESE 2PWXA 1O3FA 2UUYA 2ZPRA 4ISIH 1NO9H 1UTOA 4NA8A 5EQSA 2W7UA 2G5NA 4K3JA 3RXHA 2BD5A 5EQQA 1A5HA 1FY4A 2HPQH 1AKSB 1YPHC 4K5ZA 1C5PA 1EAWA 2ALVA 1ANDA 4FUHA 3QN7A 1GCTB 2BMGB 3PTBA 1VITG 5GDSH 1P3CA 3A8BA 2Y5HA 1C5VA 1E35B 1GJAB 4YESB 3SOSA 3ZZ9A 3U9AH 1MKXH 1YYY1 1O36A 2C90B 2BLWA 1UVPA 1Q2WA 1VGCB 3ZVEA 2CHAC 3I78A 4UDWH 2P8OC 4AFZA 3SUDA 3O8RA 5DP5A 3MH4A 4AFSA 1DE7H 1V2QT 3LOXA 1XXFA 1P9SA 3A7TA 1FN8A 4NZLA 1LPKB 1TPPA 4AYVB 2OLGA 2W26A 1UHBA 4FU7A 1KLIH 2ZGCA 3SNDA 1MKXK 4Y8ZA 3HKIB 1XUJA 1TPSA 3SU2A 3UWIA 1C1QA 4IW4E 1CHOF 2FOMB 3UNSA 2TGAA 1YCPM 2H9TH 2HNTC 2WPJS 1BMNH 1ARCA 1K1MA 2VWNA 1FPHH 3S0NA 1QRZA 1V2MT 3QK1A 1MTNC 1RIWB 3MYWA 4H6SB 5ESTE 1YPJH 2HVXA 1L4ZA 2GKVE 1EP6A 1C2GA 1MCTA 2ANYA 4ABIA 1HAGE 1OP8A 5T6GA 3SJ9A 2A7CA 3SZNA 1NFUA 3KQDA 1TOCB 1GCTC 1H9IE 1FIWA 4X6NA 4XOJA 5EODA 4YM9A 2FTLE 4CRCA 5FBIA 4WVPE 3LPRA 4BAOB 3TJOA 1BJUA 2PKAB 2BTCE 2GDEH 1FN6A 2D1JA 3P8FA 4LZ1H 1LCYA 2R0KA 3ZVCA 3UQOA 1DWEH 1S0QA 1UK2A 2GT7A 2F91A 1VGCC 2P3TB 3SNBA 1TX7A 4H6TA 4M7GA 1BOQA 3GDVA 1K1PA 5AHGH 2DE9A 3KNXA 2DE8A 1N6XA 1CU1A 1GL1A 1QIXB 2A2QH 1L1JA 2HRVA 4OS4A 1TWXB 2OUAA 4DT7B 1TOMH 4UFGH 3A81A 1KXDA 1K1NA 2BLQA 1OS8A 2QXIA 1O2TA 1IQJA 1GDUA 3GY7A 3RC6A 4MPXA 1GG6B 3TVJB 3U98H 3A7XA 2TBSA 4ZHLU 1UK3A 1D9IA 2ZF0H 2IJOB 4YO9A 2BY5X 2Z94A 4KTSA 3MMGA 1V6DA 4F49A 1RIWC 2GZ9A 1P05A 3Q00A 3S9BA 5HXFA 3T28A 5I46H 1MAXA 3ODDA 2BDYA 1UCYK 3NK8A 4UD9H 5EOKA 1EPTA 2RDLA 2BOHB 3LGWA 2ZHQH 4AOQA 4XSKU 4B75A 3LU9B 2Q6DA 4Q2KA 1J9CH 1S81A 3GCHC 3FZZA 1MTSA 3B9FH 2ZU2A 1P2NA 1C2IA 2SGPE 3GY4A 1GJCB 2P3FH 4BXWA 1GHBG 4ABGA 4HI3A 4IMZA 2J4IA 1HIAB 1NC6A 3FFGA 3QO6A 3ZZ5A 2D26C 4FUEA 1XVMA 1EXFA 2FPZA 4INHA 3BTQE 3PLPA 3ZZBA 1V2WT 2GDDA 1LHEH 1YC0A 2HPPH 3ATIA 2ZFTA 3BV9B 1NRNH 3MOCA 1AY6H 5A0AE 3C1KA 4GCHG 1TYNA 3B23B 3LKWA 2ZQ2A 2W7SA 1FY8E 1OP2A 1THRH 3M7UA 2O8TA 2J92A 1VJAU 3URDA 3MH5A 1A5GH 1LVBA 3TGJE 5T6DA 4D76A 1OWEA 4X6PA 1N6YA 1ELVA 2SGEE 1J16A 2UUFB 1GBAA 3IG6B 1C5YB 3RMLH 2J95A 5LPEA 1G9IE 3HK3B 4MNYA 4NGAH 4FUGA 1MMJN 2ZFRH 4ABJA 1CQQA 1CSOE 3GDSA 5C20A 4ZROA 5AVDA 2A7JA 3L3TA 1V2PT 4MDSA 1LTOA 1VZQH 3P8OA 5BPEA 3K9XB 1C4U2 1H4WA 1DSUA 1QRXA 2Z7FE 2AMDA 2NU1E 4OS7A 2JETB 4MPVA 1O5BB 4GLYA 1O3NA 3MH6A 1UTPA 2ZHEH 3E0NB 2ZGHA 1O3CA 1Z7KA 3AAVA 1JRSA 3MHWU 3SV6A 4BAQB 4A5TS 5EXNA 2BY7X 4IMQA 4TWWA 3MTYA 1O2ZA 1O3KA 1GJBB 4WY3A 1B7XB 2XC5A 1KXFA 1VJ9U 3VFEA 1AE8H 1AFEH 2XBXA 1CVWH 3M3SA 2A5IA 5E2OA 3VGCB 2P93A 2G51A 1ZMJA 1BTYA 1CA8B 2ZTYA 1W7GH 1LPZB 1BRCE 2BD4A 4WH6A 2CF9H 4B1TA 4E7NA 2A2XH 1L4DA 1OYQA 1GVZA 1DY8A 1QL7A 2F9UA 3T5FH 1XUKA 1SG8B 3RXPA 2AGGX 4SGAE 4GHTA 1WTGH 1O5AB 1EX3A 1AIXH 5A0BA 2G55A 1P09A 3MU8A 1GJ9B 3SNAA 1FV9A 1AQ7A 3NCLA 4ZHAA 4CHAB 1QJ6B 3T26A 1HAVA 3RXDA 1O38A 2PSYA 2JH0D 2JETC 2J34A 4ABBA 2Z9IA 3UR9A 2TGTA 2QYIA 2WUCA 4K1EA 3PLKA 1TBRH 1O3LA 1BMLA 1J14A 5A8ZA 3RXCA 1THSH 3F9HA 1GBIA 4ZH8A 4DW2U 2ILNA 2CJIA 1FY5A 1G30B 3W95A 3KQEA 1TABE 2BLOA 1A1RA 1XXDA 1ZJKA 3NZIA 1D3QB 2BVSH 4THNH 3ATKA 2BY8X 1G2LA 3M5NA 5L30H 2W3IA 1O2QA 3HPTB 2B7DH 2CF8H 2Y6TA 5DK1A 3OYPA 4OS1A 1QQUA 2BX3A 1QURH 2WPIS 3O8CA 4ISLA 1KDQA 2OC7A 3BTWE 1HPGA 5LH8A 2KAIB 1O5CB 1DLEA 1PFXC 1PQAA 4CBNA 1IQLA 2LPRA 3RU4T 2ANKH 1ACBE 4KTUA 4BAMB 8ESTE 3Q76A 4OS5A 1BTPA 6CHAB 2PLXA 1DICA 2XWAA 1MD8A 1E34B 1FMGA 1K21H 2BVXH 1SGDE 4DIIH 2A4GA 1O5FH 3RXJA 1EKBB 1AHTH 3EA8A 3VXFH 4LOYH 1HBTH 1AFQB 4Z6AH 1HNEE 1P2IA 3G01A 3R0FA 3W94A 2FLRH 2VIVA 1V2UT 1QL9A 1ZJDA 1P03A 4JZEH 1SMFE 1GI2A 4LXBH 6GCHF 4X6OA 4WXVA 1TBQH 8KME2 2WYGA 4KGAA 2OC8A 2BDBA 1CHOG 1MCVA 2PGBB 2WPMS 2XC4A 1SLVB 1P11E 1TNKA 4CHAC 3SGBE 2FDAA 2AGIX 3SGQE 1SLXB 3RMNH 3TK6A 1CBWB 4PROA 1ETTH 2VWOA 2ZU4A 1S6HA 3TH2H 3UPEA 3SW2B 5FBEA 2PV9B 1HAXB 1VCPA 3D62A 4X1QU 2I6SA 2C4FH 2C93B 4IGDA 3T62A 1SGFG 1IQNA 3LGIA 3UOPA 3RXOA 2BD9A 3S7HB 1BTUA 1DX5M 1BBRH 3BF6H 3T27A 4NIXA 4Y6DA 1DLKB 7KMEH 1Y5UT 5EXMA 1H9HE 4MPUA 2LNCA 3WY8A 3UTUH 2NU3E 1ZRBA 4FUCA 1NT1A 1ANEA 2M5TA 1UVUH 2THFB 1CT2E 9ESTA 1ELAA 1SGQE 4X8VH 1Y3WA 5C1XA 1TFXA 9LPRA 1BBRK 1AFQC 1LKAA 1EZSC 3PMJA 1Q31A 4IN1A 1DWBH 2G4TA 2ZTXA 5H4IB 1V2TT 2TGDA 4XE4A 1P12E 4I8KA 1T8MA 2SNWA 2F9VA 1C5OH 2I6QA 4QT8C 2V3HH 1EASA 2WPKS 3TIUA 1L1NA 1PPZA 1OXGA 1W0ZU 1NRQH 3V12A 2F9PA 5FXLA 4XBBA 1ZLRA 2FESH 3A7VA 4BANB 4D7GA 1DWCH 1VCQA 3DD2H 3TNSA 1CA0B 1TGNA 4MVNA 2ZEBA 1RGQA 3ATWA 1C5ZB 1HUTH 1MZDA 1ANCA 2C8WB 1EAUA 8LPRA 6LPRA 3MO6A 3GCTF 3Q3YA 2FYQA 5FX6A 1DXWA 5E0HA 2Y5GA 4ZKRU 3UFAA 1SPJA 3I77A 2QIQA 2BB4A 2P3UB 2FMJA 4SGBE 1D4PB 3A82A 5CMXH 1TGTA 3OX7U 5FCRA 1RJXB 3ZVAA 1JOUB 4I7YH 2OBQA 1TALA 4D9QA 1FUJA 1O2OA 1QGFA 1UVSH 8GCHF 1NFXA 2ZHFH 1UTLM 1WSSH 1O3MA 1V2LT 5EPNA 3UOUA 3TH4H 1Z1IA 4A6LA 1FDPA 1FLEE 4K69A 4UFFH 1HFDA 1NRSH 2F9NA 2GTBA 5GWZA 1HAHH 2FIRH 1A0HB 1S0RA 1Z6JH 3GOVB 1SL3A 5FPTA 2PHBA 5FX5A 1TQ7B 4FUJA 1WAYB 3ZZ8A 2G52A 1PPBH 2ZU5A 2QF0A 1O5EH 5DJ7A 1P57B 3HKJB 1J8AA 3U1JB 3K65B 1Q3XA 1W8BH 2VH0A 3RDZA 3N7OA 2Z3EA 3U8TH 5HM9A 3EDXB 2V0BA 5L2ZH 3PTNA 1O3AA 1O39A 1O5DH 2PTNA 3MI4A 2Y7ZA 1GI1A 1ZHRA 1LMWB 1ESAA 2QXGA 4DCDA 1JBUH 1PQ5A 1CT0E 1SGRE 5C1YA 1C5MD 7GCHF 2JKHA 2IPHA 3NWUA 2H6MA 3MO3A 3NXPA 3E16B 3TPIZ 4HFPB 5JYIA 1GHXH 2BD7A 4WMDA 5HGGA 3NUMA 2ZDMA 4FUBA 2FXRA 2GD4B 2HOBA 4ZKNU 1O2PA 4MNWA 1TRNA 1TGCA 2EA3A 1F7ZA 1ZHMA 3H7TA 4E7RG 3VXEH 1ESBA 2VWMA 4I8GA 1C5XB 3A83A 5J4QA 3SJOA 3K2UA 3F9EA 3LGUA 4FVDA 4GUXA 1C5RA 2J38A 1NTPA 2V6NA 3A88A 2VINA 3SU4A 3MWIU 1H1BA 3LGVA 3ZV9A 4K8YA 1IHSH 3JZ2B 5JBAS 3S9AA 5EG4A 2SGFE 4NZQA 2ZFQH 3MNBA 2XRCA 4BTUB 4BOHA 1LHFH 2FI5E 1GBJA 1O3IA 2GGVB 2BXUH 2ZG0H 1GI9B 4I33A 3LONA 3LIWA 6ESTA 3SI3H 4GSOA 5LGOA 1TB6H 2OC1A 1EQ9A 1V2JT 1CHGA 1W0YH 1ABIH 2BVRH 5F6MA 3A7WA 3GY6A 5GIBA 5DGJA 3ZVBA 1S5SA 1E37B 3KIDU 3SNCA 2ZQ1A 3PYHA 1HJ8A 3RXVA 1ABJH 5HYOA 1DT2A 4OGXA 5EPYA 4B73A 1QJ7B 3QZRA 3MU4A 4TY7A 4ABDA 2BY9X 1F0TA 2ZHDA 3GISB 2FOGA 1ORFA 2BQ7B 1QCPA 5EGMA 1GI7B 3VB4A 2FI4E 1C2HA 5JPMH 3O8DA 1BCUH 3RUOA 2FEQH 1HJAB 5GCHF 1F0SA 1GHZA 1QY6A 1E36B 2O8UA 4U32A 3DHKH 2BDAA 4Y10E 1MTWA 3VB3A 1QNJA 1ZSKA 2XBWA 3LJJA 1O2NA 3LC5A 4A1XA 3B8JA 1GDNA 2PTCE 3AVZA 2CV3A 3RXGA 2PFEA 1C5WB 1YF4A 2SNVA 1A0LA 2HGTH 4X1SU 1P3EA 2F9OA 4ISHH 2V3OH 4F4OC 1AI8H 1C1VH 1CGIE 5AF9H 2FYRA 2FOAA 5CHAB 2FOEA 1TNJA 1V2OT 4WJG2 5HM2A 1C5NH 1HJ9A 1UTMA 2Y7XA 5K0HA 1LVOA 4RKOB 3SUGA 2TPIZ 1A61H 1SGIB 1UCYH 1GJ4H 3F9FA 4I8HA 3PMBB 3Q77A 4GPGA 1SGCA 4J1YA 1AE5A 1AD8H 1Y3YA 2TRMA 5DP7A 2ZU3A 1WUNH 2BHGA 1MQ5A 2WV4A 1T32A 1TNHA 4ISNA 3PV4A 4Q7XA 3MNSA 1TGBA 2YOLA 4AGJA 4ZAEA 4K2YA 3ZZ7A 1C4V2 1ELCA 4NIWA 6GCHG 4FUIA 2BYAX 1SB1H 3MU5A 5DPAA 3ESTA 2FTMA 2XNIA 2QCYA 4DJZB 1YPMH 4AYYB 2GCTB 1QBVH 1SGTA 2R3YA 4FUFA 2NU0E 1DDJA 1D6RA 2OCVB 2UWLA 1Y3UA 1G3BA 2ZNKH 3BEIB 4AN7A 2D2DA 2WPHS 1HJAC 3UNQA 1LHCH 1CGJE 3T2NA 4OS2A 3SQEE 4OS6A 1G3DA 1D3TB 1NRPH 2O8LA 1SLUB 1G32B 1YCPK 3BG4B 1OP0A 1SI5H 1N1LA 1P2OA 4XFQA 4JYVH 1LO6A 1YGCH 2STAE 2ZO3H 1WYKA 3QTOH 3TJNA 1BITA 1O35A 3Q3XA 1TGSZ 1ZTLA 2C8YB 4DURA 5C1UA 2ZDNA 2ODQA 1IQHA 4ABAA 1MU6B 1RTKA 3K6ZA 3ATMA 1UHBB 1T4VH 1KTSB 1MTUA 5CHAC 1BHXB 2YNBA 4CRFA 3QWCH 1THPB 4WF8A 3ZYEA 2F3CE 1GG6C 3MFJA 1N8OB 1ELFA 4BNRA 2ZDKA 3SN8A 1ZZZA 1OOKB 3GCOA 5E2PA 1F5KU 1TNLA 2V35A 1DSTA 4Z0KA 1RD3B 4MNXA 1HXEH 1INCA 1GWAA 3UIRA 1DPOA 3VPKA 3BG8A 3IWMA 1QB9A 2GCTC 3QLPH 3L33A 1LQDB 1LDTT 4FU9A 4K1TA 5C3NA 1UVTH 1SBWA 4E06H 1KSNA 4IBLH 3CP7A 2HNTF 3E8LA 1EJNA 1SQOA 1P9UA 3KQCA 2H9EH 3BG4C 2O8MA 4CRDA 1GMDF 2R9PA 1BMMH 4Y0YE 1T8NA 3QGJA 1ID5H 4FXGH 1C9TA 4TWYA 1W12U 2VGCB 2OP9A 3GY8A 3HK6B 4I8LA 3RU4D 1C2FA 1O2VA 3GCTG 2VIPA 3ITIA 1EOJA 2ZWLH 2Q6GA 3RP2A 4NCYA 3VB5A 2B5TB 3KQBA 5FPSA 1UTKA 4Q80A 3STJA 2J2UA 1V2NT 1O2GH 1XX9A 5GPIB 1Y8TA 4WMFA 1BTWA 1Z8IB 1F2SE 2C8ZB 1YP9A 1TAWA 4JZFH 1O2RA 1TA6A 8GCHG 4NIVA 4BAKB 3P95A 1GVKB 1ARBA 1J15A 4WH8A 1BQYA 3M35A 4XBDA 2EC9H 4A1TA 2PGQB 2RA3A 5IDKA 3BEFB 1FJSA 5SGAE 4JZIA 4AG1A 2GMTB 1TNIA 2BZ6H 5F8ZA 1F0UA 2ZFSA 5A8YA 3DT0H 1ZR0A 1C1UH 4YTAA 5A8XA 4YZUA 2TGPZ 1EPTB 1PQ8A 2SGQE 3AW0A 1QRWA 1C2LA 3VEQB 2W5EA 1EUFA 1YPGH 2RA0A 1FXYA 3D65E 4Q7YA 2JH5D 2UWOA 2AYWA 3M36A 5A0CA 4YOGA 5JDUB 4CR5A 1GBHA 1GHYH 4ZMAH 1O32A 3ELAH 3LGTA 4O03A 2DUCA 2SGDE 2VGCC 7GCHG 1O2WA 2R0LA 4MNVA 1NZQH 1TLDA 3ZV8A 1S84A 2VU8E 2AEIH 3GDUA 1Y3XA 4AG2A 1C1MA 2FM2A 5DG6A 1G36A 2ZGJA 4JK5A 2IOTA 1XUIA 1YLDA 1BT7A 4ZKOU 3VGCC 4FU8A 1H8DH 2JH6D 1A3EH 3KCGH 1D3PB 1XUHA 4X6MA 1UVOA 4IN2A 1A0JA 2O9QA 4LZ4B 2ULLA 5IYTA 1MTVA 3H5CB 2SGAA 1TMBH 1AB9B 3E91A 1C9PA 2XTTB 3P8NA 3LC3A 1E38B 1S85A 1V2RT 1PPHE 3RXUA 1LVYA
chains in the Genus database with same CATH superfamily
3ZVGA 1PPEE 1DANH 3N99A 1ZOMA 3FKSD 4TSFD 4D8NA 1L0ZA 1A3BH 1J17T 2ANWA 2FO9A 1M9UA 1YPLH 1C5UA 1BZXE 5GXPA 1EPTC 3LDXH 2P94A 1C1PA 2STBE 4DT4A 2GV7A 4OM9A 5DP4A 1SFIA 1W14U 4ASUD 1SQTA 3SQHE 1O2LA 2WHXA 2BY6X 3VB6A 2GT8A 4Z1MD 2P16A 1IAUA 1LKBA 3RXQA 2ZA5A 2BDIA 4JK6A 1NU9A 5HIZA 3TGIE 2A45B 4YT6H 4AB8A 4JYUH 1AWHB 4K60A 2LELA 5JBCS 4AC9A 4UONA 1HAOH 1H9LB 1TMTH 3BTKE 1ZPCA 3STIA 1GI3A 1ZMLA 1SFQB 1PYTD 2UWPA 1TX6A 2K1QA 4Y71A 1AUTC 3EGKH 4YLQH 1F0RA 3BTEE 4KTCA 3BIVH 1O2IA 1W11U 1PPCE 3A8AA 3RXFA 3UNRA 4CR9A 5GCHG 4DGJA 1C1WH 4WWYA 5JB8S 5A2MH 1G3CA 4X1PU 1JMOH 1P06A 3V13A 2OBOA 1A4WH 1O2JA 5EQRA 1GI8B 6CHAC 2V3MA 2H9HA 2UUKB 4BTTB 3RMOH 2EI7A 1B0FA 1E1QD 2OINA 3RXRA 3CENA 1AKSA 3DA9B 2PUQH 4O9VA 1PQ7A 3HGNA 1NS3A 2ODYB 1W7XH 3WWBA 1NFYA 3EAJA 2G81E 2XCFA 3A7YA 3E3TA 5C67A 2J97A 1YPEH 1Y3VA 3GYMA 1WTHD 3SI4H 3SU0A 2QC2A 1NRRH 2NU2E 1GI6A 3CS7A 4CRAA 3R3GB 3FO8D 1HDTH 1HAVB 1XM1A 2Q1JA 1C5QA 3MH7A 5TJXA 1MUEB 1CBWC 4R0IA 3PMAB 1A2CH 2AMQA 1D6WA 3M61U 2BD2A 1HRTH 2ZFFH 2ALPA 2Z9JA 1SGPE 2KM0A 4M9FA 3WW7A 1KIGH 1HV7A 1RTLA 4ZXYH 3SNEA 3RM0H 3FP7E 4YLUA 1PJPA 4HZHA 4X0WU 1KDQB 1A7SA 4IC6A 5J4SA 4WXIA 2BM2A 3RC5A 2Z9KA 4XBCA 3F9GA 2BQWB 1O3HA 3BTHE 4FETA 4NWKA 1OWDA 1UTNA 2G5VA 1BIOA 1OWKA 2J9NA 3SJIA 2OQ5A 3BN9A 3HGPA 3NKKA 2HALA 1HGTH 5C2ZA 3EA9A 1C1TA 3F68H 1KXBA 3FVFB 4I31A 1TONA 1IQIA 1ZSLA 3K6YA 3M3VA 2VIDA 2BDCA 4MLFB 4D7FA 2ZGXH 3PV2A 4Y11E 3TK5A 3UUZA 1F92A 2FS8A 3SV7A 2PUXB 4UE7H 5GJ4B 1YLNA 4O97A 1XKBC 3KHVA 1WQSA 1AWFH 1RTFB 2PKAA 1GI0A 4B76A 1V2VT 3OU0A 2R3UA 4H4FA 2BDHA 1Z1JA 2HLCA 2P8OB 4AGKA 1BJVA 3RC4A 5C0UA 2Z3CA 2PR3A 2O8WA 3ATLA 3PLBA 1IQKA 3U1IB 1T4UH 2KR7A 3GYLB 4X8TH 4JZDH 3CNRA 4BAHB 1AUJA 1CA0C 1FONA 2EEKA 3IITA 2AHME 5A09A 5AFZH 3M7TA 5F8XA 1AVGH 3SORA 5G4BA 1KXAA 1BUIA 4H42U 4MPWA 1K1JA 1GPZA 2VIQA 4AX9H 2A31A 2F83A 2QY0B 3RLYH 3RXMA 4HG6A 4WMEA 1G37A 1SVPA 2FX6A 3UY9A 5EXLA 3SJ8A 3PV5A 1BDAA 3E1XB 2OC0A 4CRGA 2PKSB 3M5LA 4ABHA 1GBMA 2ANMH 1TX8A 1W10U 1BTZA 2VJ1A 4X2VA 5JBBS 1JIRA 1GHAG 3V3MA 4A92A 2ZCHP 5C94A 1OKXA 1EAIA 3M37A 1GMDG 3PWBA 1OWJA 4KKDA 1XUGA 5E0GA 3LJOA 4Y0ZE 1CE5A 1GDQA 1F5LA 3A7ZA 5E0JA 3RXTA 2R2MB 4K8BA 1GBDA 4MTBA 2QAAA 3AK5A 3A85A 4AFUA 2L74A 5C17A 3TNTA 5B6OA 4J2YB 1MU8B 2FP7B 1NBMD 1BB0B 1DWDH 2VNTA 1W3CA 4Y8YA 1ELDE 1PPGE 3H7OA 1ELBA 1SGYE 2ZKSA 1EZQA 2QN5T 1VITH 3MU1A 1GJ8B 1AVXA 1HIAA 1LQEA 3CS0A 3QUMP 1OWIA 3QX5H 3RXLA 1QR3E 1P2MA 4A1VA 1FY3A 2XCNA 2BQ6B 1YBWA 3N7EA 5IK2D 2AS9A 2KCAA 4X2YA 4U2WA 1EJAA 1QJ1B 4Q7ZA 1YLCA 1YM0A 4Y8XA 2ZZUH 3SBKA 4Y7AA 1RFNA 2ZPSA 3OAAD 3U8OH 3U8RH 1SC8U 1ETSH 1WQVH 3QTVH 2ZGBH 1QQ4A 3ZYDA 4CBOA 1QL8A 1CT4E 4U01A 1LPGB 1SR5C 1L2EA 3BIUH 1UMAH 3ZZ6A 1SOTA 2EI8A 3BTFE 1T7CA 1C2EA 4ISOA 1C2DA 4DVAU 3SHAH 4BXSA 1NM6A 3ZZDA 4R8TB 3RXIA 2PKSC 4OGYA 1ZGIA 1EZUC 4NA7A 1QB6A 1WOFA 3SV9A 4DIHH 3NRLA 3FP6E 4AB9A 1AGJA 1ZGVA 3OTJE 2GCHF 3PB1E 2B0FA 2AH4X 2Z9LA 4NG9H 3EQ0H 3L6PA 3MU0A 3GCHB 1TA2A 2H5CA 3RXBA 3ZZ3A 4B71A 2OQUA 3C27B 4ZXXH 1PPFE 1AVWA 1Z8RA 1T8OA 3Q3KA 3ZVFA 1MZAA 1K2I1 1GGDB 3SGAE 1XVOA 3BTTE 1MAYA 4B74A 3OSYA 4NIYA 5PTPA 4KP0A 1FZZA 1NU7B 2VIWA 1P8VC 3LGYA 3FZDA 4INLA 4ACAA 3ZZAA 3S7KB 4ZHMU 2W6JD 3VB7A 3BSQA 4JMYA 1EJMA 5KECA 3BTGE 3O8BA 3P92A 5BRRE 1EZXC 1O0DH 2XBVA 2J98B 3ZZCA 1K9OE 3FAOA 1O30A 1C5TA 1ZPBA 1TPOA 1O3EA 1YCPH 1SHYA 2G8TA 4BTIB 4YT7H 1C1OA 2BOKA 1SKYE 3LT3A 1SGEE 2VIOA 2EI6A 1ELEE 3PWCA 3SUEA 4B2AA 4U30A 1SQRA 3P17H 4AFQA 1BRUP 1TRYA 1GBBA 4HTCH 3EE0B 3SV8A 3M7QA 1G3EA 1SHHB 1X7AC 3RM2H 1IHTH 2FOHA 2BDGA 4YOIA 2CMYA 1RRKA 1B5GH 1WBGB 4MQAA 5TCCA 1BA8B 2VH6A 1Z8JB 2YNAA 1B0EA 4P00A 1V3XA 2FS9A 2ZC9H 3TK9A 3PROA 1DOJA 2OXSA 5ESBA 3UWJH 4JZ1A 3TJVA 3M3TA 2J94A 3PM3A 1GGDC 2RG3A 2Y80A 7ESTE 1FAXA 1ZRKA 1OWHA 5HIYA 5EU8A 1GMCF 2ZPQA 2ZFPH 2IN2A 4ABEA 2ZDAH 1Y5BT 2XW9A 1JRTA 1GBKA 1ANBA 1AN1E 1S6FA 2FOCA 5DN6D 3TH3H 2A32A 4F48B 4AORA 1TQ0B 1ELTA 1JIMA 4X2XA 4TY6A 3UR6A 1P10A 3NPSA 1MBQA 4KELA 1ELGA 1P2QA 2GP9B 1ZYOA 1D3DB 5AFYH 1QHRB 2KAIA 1TBZH 1AU8A 3LH3A 1Z6EA 1AO5A 1C4Y2 4Y7BA 3ZVDA 2F4LA 2QF3A 2WV5A 3KL6A 3RMMH 1AZZA 3E0PB 3TJUA 4UFEH 1BBRE 2A0QB 2PP6A 2ZI2H 1HAZB 1ZTKA 4B2CA 2H5DA 2ZHWH 3M5MA 1EP5A 4Y79A 7LPRA 1GHAF 5JB9S 3ZIAD 3A84A 3V7TA 4FVBA 1GMHF 2AGEX 4DY7B 1Z8GA 1IQFA 1EATA 2YMSB 2P59A 3A8DA 5F03A 2Y5FA 3OY6U 5FL7D 1NN6A 3BTDE 5C5NA 1UO6A 2GVFA 1VITF 1P01A 3GY3A 1OX1A 3BEUA 4ZUHA 1FNIA 3U69H 2CN0H 1V2KT 4NWLA 1NY22 4TPYA 4A7IB 4CH2B 2ESTE 1OPHB 4ESTE 2PW8H 4IS5A 2GV6A 3HATH 1TMUH 1IQGA 3KGPA 1N8OC 5DP8A 3V0XA 1DY9A 5TCAA 1HLTH 1SGFA 1O3OA 4ZCNA 2BXTH 3P70B 4GVUA 4LK4A 1O2XA 2NU4E 1P2KA 1GBFA 4JCNA 4RSPA 2BLVA 3A86A 3F1SB 1Y59T 1DM4B 1GJ7B 1C2JA 4NSYA 1C1NA 2XWBI 1SLWB 1GHWH 4FUDA 1O33A 1O3GA 4JYTA 1UW7A 3T29A 3JZ1B 5DO4H 1TPAE 2WPLS 4X1NU 3TGKE 1NPMA 3MNXA 5FHTA 1WXRA 4ASHA 3FP8E 2G00A 2XYAA 1DS2E 1KLTA 1QBNA 2CGAA 2FODA 1TIOA 5LPFA 1ZMNA 2ZTZA 4FOUC 3D23A 1GI5A 1GHVH 4O3TA 1QA0A 4Y76A 3GCNA 3H09A 1O3BA 1SOZA 3S69A 3ZZ4A 1DITH 3T25A 1GL0E 5I25A 1UTQA 3F6UH 2ZIQH 3URCA 1F5RA 4TPIZ 4B2BA 1GCDA 5DKMA 2BZAA 2VVCA 2ZDLA 1LVMA 5FPYA 1HCGA 1YPHE 3E90B 1O37A 2XXLA 5JBTA 5L2YH 1SQAA 2A4RA 3P6ZB 3SV2H 2VB0A 2GZ7A 1KYNA 4CREA 1ESTA 1KTTB 3UAIC 5HMAA 1BTHH 5DP6A 5F8TA 1AZ8A 2GMTC 3SO3A 2SFAA 3LH1A 2H1UA 1O2MA 3UB0A 4X1RU 4CH8B 5K7RA 5L6NH 2AFQB 4I8JA 5FCKA 4DOQA 3DUXH 1GI4A 5ETXA 1NFWA 2FLBH 4GAWA 2RCEA 4D9RA 2Z6BD 3PO1B 1C5LH 3EYDA 4X8SH 3AW1A 2HWLB 1HAIH 4P02A 1NROH 2WYJA 4NSVA 1QA7A 3M5OA 5F53A 1U6QA 5FAHA 1S83A 1P04A 1T8LA 1S82A 1PYTC 2G4UA 5CHBA 5EW2H 2HNTE 2VWLA 4UEHH 2GJGA 1VR1H 4XDEA 1T31A 1MH0A 1O2KA 4NA9H 5DP3A 1MD7A 1W2KH 2WINI 2JDID 1P0SH 1EB2A 1K22H 1DUEA 1C2MA 1HYLA 1O3JA 1BMAA 3A87A 1O2HA 3KF2A 4RI0A 4Q63A 2A5KA 1P2JA 2F9BH 3GY2A 3SUFA 1ZSJA 5T3HA 1LHGH 3OEED 3UREA 2JJ1D 1K1LA 3A80A 4F55A 1BRBE 3AAUA 1MKWH 2NWNA 1GHBF 3SU3A 1O34A 2AIQA 1DFPA 1TE0A 3KN2A 5CE1A 2UUJB 3QDZB 1HAYB 2FI3E 1GJ6A 3RXKA 2QV1A 2ASUB 3I29A 1AB9C 2FX4A 4RN6A 2VVUA 3UQVA 2B9LA 3EA7A 2GCHG 4XRNA 3TITA 2OTVA 1EB1H 2Y81A 3SU5A 1O3PB 2FWWA 2ZDVH 1MQ6A 1MKWK 5C5OA 1A5IA 1IQEA 1Y5AT 3RLWH 1XMNB 1G2MA 1MBMA 1WU1A 4GCHF 1K28D 1O3DA 1BHXF 2LP6A 3DFLA 1KXCA 1GBTA 1KLJH 2WUBA 1FAKH 1O2SA 3MO9A 3KQ5A 1CO7E 1XKAC 1L1GA 4IC5A 1Z71A 3PO1C 2GX4A 5EJ1A 1SSXA 2A4OA 4E05H 3PMHB 4NFFA 2IPQX 1FQ3A 1GBLA 2XNDD 4K1SA 1TRMA 3GICB 1ZHPA 2BD3A 2A7HA 4VGCB 1OYTH 2Z3DA 3KYGA 4MG3A 1O2YA 3SJKA 3F0OA 1VKYA 3QZQA 4AZ2B 2XC0A 1WV7H 1QB1A 1K1OA 2A5AA 1JXPA 3DFJA 1E0FD 1RS0A 2TIOA 2Q6FA 5LPRA 1K1IA 1TNGA 1ZTJA 1VCWA 2F43B 4YOJA 1O31A 2VVVA 2ZECA 1KMHB 2XBYA 2D8WA 2AERH 1EOLA 1FI8A 3D49H 1FY1A 1O5GH 3SU6A 1FPCH 2R2WU 5EW1H 2C3SA 1C1RA 3ODFA 3OE7D 1HXFH 1H8IH 1HAPH 2OD3B 1W13U 2GZ8A 2PSXA 1KXEA 1JWTA 1BTXA 3OY5U 1WCZA 5E8EH 1LHDH 3F2HA 1C2KA 3SHCH 1KY9A 1IOEA 1QTFA 5EJZA 2ODPA 1DVAH 2FOFA 3P8GA 1UJ1A 3AASA 2P95A 2AMPA 4X8UH 2QGRA 1UCYE 2ZU1A 2Y82A 2EY4C 4RKJB 2QA9E 1FIZA 1GJDB 2ZCKP 2C8XB 4HGCA 4GHQA 2AIPA 3A8CA 1DUAA 3ENSB 1GBCA 2QXHA 3RXEA 2ZP0H 1GBEA 1C1SA 1P02A 1DXPA 2CXVA 3TU7H 5ABWA 2FZZA 1IQMA 4NFEA 1GVLA 2B8OH 3QGNB 1HB0B 1YPKH 3RXSA 4ABFA 1GMCG 4X2WA 4DG4A 1GJ5H 1V2ST 3RXAA 2BD8A 2CHAB 3S9CA 1O2UA 4VGCC 1AMHA 1XUFA 3SU1A 3MNCA 4ZKSU 1ETRH 1OHHD 2ZCLP 4INKA 1CGHA 3TLOA 4O3UA 2H2ZA 3BTME 5DP9A 1EAXA 3RU4E 2BX4A 4UFDH 1UTJA 4CRBA 2FOBA 1A46H 1SGNE 2A1DB 3E6PH 1ZPZA 3A89A 4B6FA 1C5SA 2W3KA 5T6FA 3FANA 3GY5A 1UK4A 4I32A 3OFND 4TYDA 5T1VA 1RXPA 1YKTA 1MTNB 1BRAA 1QFKH 1OSSA 1QBOA 2QXJA 3KEEA 2A4QA 2Z9GA 1GMHG 1NESE 2PWXA 1O3FA 2UUYA 2ZPRA 4ISIH 1NO9H 1UTOA 4NA8A 5EQSA 2W7UA 2G5NA 4K3JA 3RXHA 2BD5A 5EQQA 1A5HA 1FY4A 2HPQH 1AKSB 1YPHC 4K5ZA 1C5PA 1EAWA 2ALVA 1ANDA 4FUHA 3QN7A 1GCTB 2BMGB 3PTBA 1VITG 5GDSH 1P3CA 3SZEA 3A8BA 2Y5HA 1C5VA 1E35B 1GJAB 4YESB 3SOSA 3ZZ9A 2CK3D 3U9AH 1MKXH 1YYY1 1O36A 2C90B 1H8ED 2BLWA 1UVPA 1Q2WA 1VGCB 3ZVEA 2CHAC 3I78A 4UDWH 2P8OC 4AFZA 3SUDA 3O8RA 5DP5A 3MH4A 4AFSA 1DE7H 1V2QT 3LOXA 1XXFA 1P9SA 3A7TA 1FN8A 4NZLA 1LPKB 1TPPA 4AYVB 2OLGA 2W26A 1UHBA 4FU7A 1KLIH 2ZGCA 3SNDA 1MKXK 4Y8ZA 3HKIB 1XUJA 1TPSA 3SU2A 3UWIA 1C1QA 4IW4E 1CHOF 2FOMB 3UNSA 4TT3D 2TGAA 1YCPM 2H9TH 2HNTC 2WPJS 1BMNH 1ARCA 1K1MA 2VWNA 1FPHH 3S0NA 1QRZA 1V2MT 3QK1A 1MTNC 1RIWB 3MYWA 4H6SB 3PRBA 5ESTE 1YPJH 2HVXA 1L4ZA 2GKVE 1EP6A 1C2GA 1MCTA 2ANYA 2JIZD 4ABIA 1HAGE 3W1EA 1OP8A 5T6GA 3SJ9A 2A7CA 3SZNA 1NFUA 3KQDA 1TOCB 1GCTC 1H9IE 1FIWA 5B6LA 4X6NA 4XOJA 5EODA 2RFKC 4YM9A 2FTLE 4CRCA 5FBIA 4WVPE 3LPRA 4BAOB 3TJOA 1BJUA 2PKAB 2BTCE 2GDEH 1FN6A 2D1JA 3P8FA 4LZ1H 1LCYA 2R0KA 3ZVCA 3UQOA 1DWEH 1S0QA 1UK2A 2GT7A 2F91A 1VGCC 2P3TB 3SNBA 1TX7A 3OEHD 4H6TA 2K8IA 4M7GA 1BOQA 3GDVA 1K1PA 5AHGH 2DE9A 3KNXA 2DE8A 1N6XA 1CU1A 1GL1A 1QIXB 2A2QH 1L1JA 2HRVA 4OS4A 1TWXB 2OUAA 4DT7B 1TOMH 4UFGH 3A81A 1KXDA 1K1NA 2BLQA 1OS8A 2QXIA 1O2TA 1IQJA 3F0PA 1GDUA 3GY7A 3RC6A 4MPXA 1GG6B 3TVJB 3U98H 3A7XA 2TBSA 4ZHLU 1UK3A 1D9IA 2ZF0H 2IJOB 4YO9A 2BY5X 2Z94A 3WWFA 4KTSA 3MMGA 1V6DA 4F49A 1RIWC 2GZ9A 1P05A 3Q00A 1EFRD 3S9BA 5HXFA 3T28A 5I46H 1MAXA 3ODDA 2BDYA 1UCYK 3NK8A 4UD9H 5EOKA 1E1RD 1EPTA 2RDLA 2BOHB 3LGWA 2ZHQH 4AOQA 4XSKU 4B75A 3LU9B 2Q6DA 4Q2KA 1J9CH 1S81A 3GCHC 3FZZA 1MTSA 3B9FH 2ZU2A 1P2NA 1C2IA 2SGPE 3GY4A 1GJCB 2P3FH 4BXWA 1GHBG 4ABGA 4HI3A 4IMZA 2J4IA 1HIAB 1NC6A 3FFGA 3QO6A 3ZZ5A 2D26C 4FUEA 1XVMA 1EXFA 2FPZA 4INHA 3BTQE 3PLPA 3ZZBA 1V2WT 2GDDA 1LHEH 1YC0A 2HPPH 3ATIA 2ZFTA 3BV9B 1NRNH 3MOCA 1K0HA 1AY6H 5A0AE 3C1KA 4GCHG 1TYNA 3B23B 3LKWA 2ZQ2A 2W7SA 1FY8E 1OP2A 1THRH 3M7UA 2O8TA 2J92A 1VJAU 3URDA 3MH5A 1A5GH 1LVBA 3TGJE 5T6DA 4D76A 1OWEA 4X6PA 1N6YA 1ELVA 2SGEE 1J16A 2UUFB 1GBAA 3IG6B 1C5YB 3RMLH 2J95A 5LPEA 1G9IE 3HK3B 4MNYA 4NGAH 4FUGA 1MMJN 3F2GA 2ZFRH 4ABJA 1CQQA 1CSOE 3GDSA 5C20A 4ZROA 5AVDA 2A7JA 3L3TA 1V2PT 4MDSA 1LTOA 1VZQH 3P8OA 5BPEA 3K9XB 1C4U2 1H4WA 1DSUA 1QRXA 3N7DA 2WPDD 2Z7FE 2AMDA 2NU1E 4OS7A 2JETB 4MPVA 4RT0A 1O5BB 4GLYA 3U28C 1O3NA 1W0KD 3MH6A 2HVYB 1UTPA 2ZHEH 3E0NB 2ZGHA 1O3CA 1Z7KA 3AAVA 1JRSA 3MHWU 3SV6A 4BAQB 4A5TS 5EXNA 3PRDA 2BY7X 4IMQA 4TWWA 3MTYA 1O2ZA 1O3KA 1GJBB 4WY3A 3MQKC 1B7XB 2XC5A 1KXFA 1VJ9U 3VFEA 1AE8H 1AFEH 2XBXA 1CVWH 3M3SA 2A5IA 5E2OA 3VGCB 2P93A 2G51A 1ZMJA 1BTYA 1CA8B 2ZTYA 1W7GH 1LPZB 1BRCE 2BD4A 4WH6A 2CF9H 4B1TA 4E7NA 2A2XH 1L4DA 1OYQA 1GVZA 1DY8A 1QL7A 1H8HD 2F9UA 5C0TA 3T5FH 1XUKA 1SG8B 3RXPA 2AGGX 4SGAE 3OTPA 4GHTA 1WTGH 1O5AB 1EX3A 1AIXH 2YMSC 5A0BA 2G55A 1P09A 3MU8A 1GJ9B 2W6ID 3SNAA 1NBME 1FV9A 1AQ7A 3NCLA 4ZHAA 4CHAB 1QJ6B 2L6OA 3T26A 1HAVA 3RXDA 1O38A 2PSYA 2JH0D 2JETC 2J34A 4ABBA 2Z9IA 3UR9A 2TGTA 2QYIA 2WUCA 4K1EA 3PLKA 1TBRH 1O3LA 1BMLA 1J14A 5A8ZA 3RXCA 1THSH 3F9HA 1GBIA 4ZH8A 4DW2U 2ILNA 2CJIA 1FY5A 1G30B 3W95A 3KQEA 3SYJA 3DSGA 1TABE 2BLOA 1BMFD 1A1RA 1XXDA 1ZJKA 3NZIA 1D3QB 2BVSH 4THNH 3ATKA 2BY8X 1G2LA 3M5NA 5L30H 2W3IA 1O2QA 2M2AA 3HPTB 2B7DH 2CF8H 2Y6TA 5DK1A 3F2FA 3OYPA 4OS1A 1QQUA 2BX3A 1QURH 2WPIS 3O8CA 4ISLA 1KDQA 2OC7A 3BTWE 1HPGA 5LH8A 2KAIB 1O5CB 1DLEA 1PFXC 1PQAA 4CBNA 1IQLA 2KFWA 2LPRA 2ANKH 1ACBE 3RU4T 4KTUA 4BAMB 8ESTE 3Q76A 4OS5A 1BTPA 6CHAB 2PLXA 1DICA 2XWAA 1MD8A 1E34B 1FMGA 1K21H 2BVXH 1SGDE 4DIIH 2A4GA 1O5FH 3RXJA 1EKBB 1AHTH 3EA8A 3VXFH 4LOYH 1HBTH 1AFQB 4Z6AH 1HNEE 1P2IA 3G01A 3R0FA 3W94A 2FLRH 2VIVA 1V2UT 1QL9A 1ZJDA 1P03A 4JZEH 1SMFE 1GI2A 4LXBH 6GCHF 4X6OA 4WXVA 1TBQH 8KME2 2WYGA 4KGAA 2OC8A 2BDBA 1CHOG 1MCVA 2PGBB 2WPMS 2XC4A 4I86A 1SLVB 1P11E 1TNKA 4CHAC 3SGBE 2FDAA 2AGIX 3SGQE 1SLXB 3RMNH 3TK6A 1CBWB 4PROA 1ETTH 2VWOA 2ZU4A 1S6HA 3TH2H 3UPEA 3SW2B 5FBEA 2PV9B 1HAXB 1VCPA 3D62A 4X1QU 2I6SA 2C4FH 2C93B 4IGDA 3T62A 1SGFG 1IQNA 3LGIA 3UOPA 3RXOA 2BD9A 3S7HB 2HLDD 1BTUA 1DX5M 1BBRH 3BF6H 3T27A 4NIXA 5EIYA 4Y6DA 1DLKB 7KMEH 1Y5UT 5EXMA 1H9HE 4MPUA 2LNCA 3WY8A 3UTUH 2NU3E 1ZRBA 4FUCA 4YXWD 4RT1A 1NT1A 1ANEA 2M5TA 1UVUH 2THFB 1CT2E 9ESTA 1ELAA 1SGQE 4X8VH 1Y3WA 5C1XA 1TFXA 9LPRA 1BBRK 1AFQC 1LKAA 1EZSC 3PMJA 1Q31A 4IN1A 1DWBH 2G4TA 2ZTXA 5H4IB 1V2TT 2TGDA 4XE4A 1P12E 4I8KA 1T8MA 2SNWA 2F9VA 1C5OH 2I6QA 4QT8C 2V3HH 1EASA 2WPKS 3TIUA 1L1NA 1PPZA 1OXGA 1W0ZU 1NRQH 3V12A 2F9PA 2KCOA 5FXLA 4XBBA 1ZLRA 2FESH 3A7VA 4BANB 4D7GA 1DWCH 1VCQA 3DD2H 3TNSA 1CA0B 1TGNA 4MVNA 2ZEBA 5HKKD 2KZ4A 1RGQA 3ATWA 1C5ZB 1HUTH 1MZDA 1ANCA 1YWUA 2C8WB 1EAUA 8LPRA 6LPRA 3MO6A 3GCTF 3Q3YA 2FYQA 5FX6A 1DXWA 5E0HA 2Y5GA 4ZKRU 3UFAA 5EJLA 1SPJA 3I77A 2QIQA 2BB4A 2FMJA 2P3UB 4SGBE 1D4PB 3A82A 5CMXH 1TGTA 3OX7U 5FCRA 1RJXB 3ZVAA 1JOUB 4I7YH 2OBQA 1TALA 4D9QA 1FUJA 1O2OA 1QGFA 1UVSH 8GCHF 1NFXA 2ZHFH 1UTLM 1WSSH 1O3MA 1V2LT 5EPNA 3UOUA 3TH4H 1Z1IA 4A6LA 1FDPA 1FLEE 4K69A 4UFFH 1HFDA 1NRSH 2F9NA 2GTBA 5GWZA 1HAHH 2FIRH 1A0HB 1S0RA 1Z6JH 3GOVB 1SL3A 5FPTA 2PHBA 5FX5A 1TQ7B 4FUJA 2IJD1 1WAYB 3ZZ8A 2G52A 1PPBH 2ZU5A 2QF0A 1O5EH 5DJ7A 1P57B 3HKJB 1J8AA 3U1JB 3K65B 1Q3XA 1W8BH 2VH0A 3RDZA 3N7OA 2Z3EA 3U8TH 5HM9A 2WSSD 3F3BA 3EDXB 2V0BA 5L2ZH 3PTNA 1O3AA 1O39A 1O5DH 2PTNA 3MI4A 2Y7ZA 1GI1A 1ZHRA 1LMWB 1ESAA 2QXGA 4DCDA 1JBUH 1PQ5A 1CT0E 1SGRE 5C1YA 1C5MD 7GCHF 2JKHA 2QE7D 2IPHA 2J98A 3NWUA 2H6MA 3MO3A 3NXPA 3E16B 3TPIZ 4HFPB 5JYIA 1GHXH 2BD7A 4WMDA 5HGGA 3NUMA 2ZDMA 4FUBA 2FXRA 2GD4B 2HOBA 4ZKNU 1O2PA 4MNWA 1TRNA 1TGCA 2EA3A 1F7ZA 1ZHMA 3H7TA 4E7RG 3VXEH 1ESBA 2VWMA 4I8GA 1C5XB 3A83A 5KGOA 5J4QA 3SJOA 3K2UA 3F9EA 3LGUA 4FVDA 4GUXA 1C5RA 2KCYA 2J38A 1NTPA 2V6NA 3A88A 2VINA 2WV9A 3SU4A 3MWIU 1H1BA 3LGVA 3DSPA 3ZV9A 4K8YA 1IHSH 3JZ2B 5JBAS 3S9AA 5EG4A 2SGFE 4NZQA 2ZFQH 3MNBA 2XRCA 4BTUB 4BOHA 1LHFH 2FI5E 1GBJA 1O3IA 2GGVB 2BXUH 2ZG0H 1GI9B 4I33A 3LONA 3LIWA 6ESTA 3SI3H 4GSOA 4B6EA 5LGOA 1TB6H 2OC1A 1EQ9A 1MABB 1V2JT 1CHGA 1W0YH 1ABIH 2BVRH 5F6MA 3A7WA 3GY6A 5GIBA 4XD7D 5DGJA 3ZVBA 1S5SA 1E37B 3KIDU 3SNCA 2ZQ1A 3PYHA 1HJ8A 3RXVA 1ABJH 5HYOA 1DT2A 4OGXA 5EPYA 4B73A 1WDIA 1QJ7B 3QZRA 4ACBA 3MU4A 4TY7A 4ABDA 2BY9X 1F0TA 2ZHDA 3GISB 2FOGA 1ORFA 2BQ7B 1QCPA 5EGMA 1GI7B 3VB4A 2FI4E 1C2HA 3DCLA 5JPMH 3O8DA 1BCUH 3RUOA 2FEQH 1HJAB 5GCHF 2JJ2D 1F0SA 5CDFE 1GHZA 1QY6A 1E36B 2O8UA 4U32A 3DHKH 2BDAA 4Y10E 1MTWA 3VB3A 1QNJA 1ZSKA 2XBWA 3LJJA 1O2NA 3LC5A 4A1XA 3B8JA 1GDNA 2PTCE 3AVZA 2CV3A 3RXGA 2PFEA 1C5WB 1YF4A 2SNVA 1A0LA 2HGTH 4X1SU 1P3EA 2F9OA 4ISHH 2V3OH 4F4OC 1AI8H 1C1VH 1CGIE 5AF9H 2FYRA 2FOAA 5CHAB 2FOEA 1TNJA 1V2OT 4WJG2 1W0JD 5HM2A 1C5NH 1HJ9A 1UTMA 2Y7XA 5K0HA 1LVOA 4RKOB 3SUGA 2TPIZ 1A61H 1SGIB 1UCYH 1GJ4H 2J5UA 3F9FA 4I8HA 3PMBB 3Q77A 4GPGA 1SGCA 4J1YA 4Q4LA 1AE5A 1AD8H 1Y3YA 2TRMA 5DP7A 2ZU3A 1WUNH 2BHGA 1MQ5A 2WV4A 1T32A 1TNHA 4ISNA 3PV4A 4Q7XA 3MNSA 1TGBA 2YOLA 4AGJA 4ZAEA 1YY3A 4K2YA 3ZZ7A 1C4V2 1ELCA 4NIWA 6GCHG 4FUIA 2BYAX 1SB1H 3MU5A 5DPAA 3ESTA 2FTMA 2XNIA 1S6LA 2QCYA 4DJZB 1YPMH 4AYYB 2GCTB 1QBVH 2QF5A 1SGTA 2R3YA 4FUFA 2NU0E 1DDJA 1D6RA 2OCVB 2UWLA 1Y3UA 1G3BA 2KX4A 2ZNKH 3BEIB 2D2DA 4AN7A 2WPHS 1HJAC 3UNQA 1LHCH 1CGJE 3T2NA 4OS2A 3SQEE 4OS6A 2EQNA 1G3DA 1D3TB 1NRPH 3EE7A 2O8LA 1SLUB 1G32B 1YCPK 3KYFA 3BG4B 1OP0A 1SI5H 1N1LA 1P2OA 4XFQA 4JYVH 1LO6A 1YGCH 2STAE 2ZO3H 1WYKA 3QTOH 3TJNA 3FN8A 1BITA 1O35A 3Q3XA 1TGSZ 1ZTLA 2C8YB 4DURA 5C1UA 2ZDNA 2ODQA 1IQHA 4ABAA 1MU6B 1RTKA 3K6ZA 3ATMA 1UHBB 1T4VH 1KTSB 1MTUA 5CHAC 1BHXB 5GNDA 1FX0B 2YNBA 4CRFA 3QWCH 1THPB 4WF8A 3ZYEA 2F3CE 1GG6C 3MFJA 1N8OB 1ELFA 4BNRA 2ZDKA 3SN8A 2XOKD 1ZZZA 1OOKB 3GCOA 2K0QA 5E2PA 1F5KU 1TNLA 1QZ8A 2V35A 1DSTA 4Z0KA 1COWD 1RD3B 4MNXA 1HXEH 1INCA 1GWAA 3UIRA 1DPOA 3VPKA 3BG8A 3IWMA 1QB9A 2GCTC 3QLPH 3L33A 1LQDB 1LDTT 4FU9A 4K1TA 5C3NA 1UVTH 1SBWA 4E06H 1KSNA 4IBLH 3CP7A 2HNTF 3E8LA 1EJNA 1SQOA 1P9UA 3KQCA 2H9EH 2KCPA 3DSOA 3BG4C 3FOAA 2O8MA 4CRDA 1GMDF 2R9PA 1BMMH 4Y0YE 1T8NA 3QGJA 1ID5H 4FXGH 1C9TA 4TWYA 1W12U 2VGCB 2OP9A 3GY8A 3HK6B 4I8LA 3RU4D 1C2FA 1E79D 1O2VA 2VIPA 3GCTG 3ITIA 1EOJA 2ZWLH 2Q6GA 3RP2A 4NCYA 3VB5A 2B5TB 3KQBA 5FPSA 1UTKA 4Q80A 2RDEA 3STJA 2J2UA 1V2NT 1O2GH 1XX9A 5GPIB 1Y8TA 4WMFA 1BTWA 1Z8IB 5KEDA 1F2SE 2C8ZB 1YP9A 1TAWA 3GS9A 1O2RA 1TA6A 4JZFH 8GCHG 4NIVA 4BAKB 3P95A 1GVKB 2OK5A 1ARBA 1J15A 4WH8A 1BQYA 3M35A 4XBDA 2EC9H 4A1TA 5DSFA 2PGQB 2RA3A 5IDKA 2WZQA 3BEFB 1FJSA 5SGAE 4JZIA 4AG1A 2GMTB 1TNIA 2BZ6H 5F8ZA 1F0UA 2ZFSA 5A8YA 3DT0H 1ZR0A 1C1UH 4YTAA 5A8XA 4YZUA 2TGPZ 1EPTB 1PQ8A 2SGQE 3AW0A 1QRWA 1C2LA 3VEQB 2W5EA 1EUFA 1YPGH 2RA0A 1FXYA 3D65E 4Q7YA 3VG8A 2JH5D 2UWOA 2AYWA 3M36A 5A0CA 4YOGA 5JDUB 4CR5A 1GBHA 1GHYH 2QF4A 4ZMAH 2V7QD 1O32A 3ELAH 3LGTA 4O03A 2DUCA 2SGDE 2VGCC 7GCHG 1O2WA 2R0LA 4MNVA 1NZQH 1TLDA 3ZV8A 1S84A 2VU8E 2AEIH 3GDUA 1Y3XA 4AG2A 1C1MA 2FM2A 5DG6A 1G36A 2ZGJA 4JK5A 2IOTA 1XUIA 1YLDA 1BT7A 2YMSD 4ZKOU 3VGCC 4FU8A 1H8DH 2JH6D 1A3EH 3KCGH 1D3PB 1XUHA 4X6MA 2VBCA 1UVOA 4IN2A 1A0JA 2O9QA 4LZ4B 2ULLA 5IYTA 1MTVA 3H5CB 2SGAA 1TMBH 1AB9B 3E91A 1C9PA 2XTTB 3P8NA 3LC3A 1E38B 1S85A 1V2RT 1PPHE 3RXUA 1LVYA
chains in the Genus database with same CATH topology
3ZVGA 1PPEE 1DANH 1ZOMA 4D8NA 1L0ZA 1A3BH 1J17T 2ANWA 2FO9A 1M9UA 1YPLH 1C5UA 1BZXE 5GXPA 1EPTC 3LDXH 2P94A 1C1PA 2STBE 2GV7A 5DP4A 1SFIA 1W14U 1SQTA 3SQHE 1O2LA 2BY6X 3VB6A 2GT8A 2P16A 1IAUA 1LKBA 3RXQA 2ZA5A 2BDIA 4JK6A 1NU9A 3TGIE 2A45B 4YT6H 4AB8A 4JYUH 1AWHB 4K60A 5JBCS 4UONA 1HAOH 1H9LB 1TMTH 3BTKE 1ZPCA 3STIA 1GI3A 1ZMLA 1SFQB 1PYTD 2UWPA 1TX6A 2K1QA 4Y71A 1AUTC 3EGKH 4YLQH 1F0RA 3BTEE 4KTCA 3BIVH 1O2IA 1W11U 1PPCE 3A8AA 3RXFA 3UNRA 4CR9A 5GCHG 4DGJA 1C1WH 4WWYA 5JB8S 5A2MH 1G3CA 4X1PU 1JMOH 1P06A 3V13A 2OBOA 1A4WH 1O2JA 5EQRA 1GI8B 6CHAC 2H9HA 2UUKB 4BTTB 3RMOH 2EI7A 1B0FA 2OINA 3RXRA 3CENA 1AKSA 3DA9B 2PUQH 4O9VA 1PQ7A 3HGNA 1NS3A 2ODYB 1W7XH 1NFYA 3EAJA 2G81E 2XCFA 3A7YA 3E3TA 5C67A 1YPEH 1Y3VA 3GYMA 1WTHD 3SI4H 3SU0A 2QC2A 1NRRH 2NU2E 1GI6A 3CS7A 4CRAA 3R3GB 1HDTH 1HAVB 1XM1A 2Q1JA 1C5QA 3MH7A 5TJXA 1MUEB 1CBWC 4R0IA 3PMAB 1A2CH 2AMQA 1D6WA 3M61U 2BD2A 1HRTH 2ZFFH 2ALPA 2Z9JA 1SGPE 1KIGH 1HV7A 1RTLA 4ZXYH 3SNEA 3RM0H 3FP7E 4YLUA 1PJPA 4HZHA 4X0WU 1KDQB 1A7SA 4IC6A 5J4SA 4WXIA 2BM2A 3RC5A 2Z9KA 4XBCA 3F9GA 2BQWB 1O3HA 3BTHE 4NWKA 1OWDA 1UTNA 2G5VA 1BIOA 1OWKA 2J9NA 3SJIA 2OQ5A 3BN9A 3HGPA 3NKKA 2HALA 1HGTH 5C2ZA 3EA9A 1C1TA 3F68H 1KXBA 3FVFB 4I31A 1TONA 1IQIA 1ZSLA 3K6YA 3M3VA 2VIDA 2BDCA 4MLFB 4D7FA 2ZGXH 4Y11E 3TK5A 3UUZA 1F92A 2FS8A 3SV7A 2PUXB 4UE7H 5GJ4B 4O97A 1XKBC 3KHVA 1WQSA 1AWFH 1RTFB 2PKAA 1GI0A 4B76A 1V2VT 3OU0A 2R3UA 4H4FA 2BDHA 1Z1JA 2HLCA 2P8OB 4AGKA 1BJVA 3RC4A 2Z3CA 2PR3A 2O8WA 3ATLA 3PLBA 1IQKA 3U1IB 1T4UH 3GYLB 4X8TH 4JZDH 4BAHB 1AUJA 1CA0C 1FONA 2EEKA 3IITA 5A09A 5AFZH 3M7TA 5F8XA 1AVGH 3SORA 5G4BA 1KXAA 1BUIA 4H42U 4MPWA 1K1JA 1GPZA 2VIQA 4AX9H 2A31A 2F83A 2QY0B 3RLYH 3RXMA 4WMEA 1G37A 1SVPA 2FX6A 3UY9A 5EXLA 3SJ8A 1BDAA 3E1XB 2OC0A 4CRGA 2PKSB 3M5LA 4ABHA 1GBMA 2ANMH 1TX8A 1W10U 1BTZA 2VJ1A 4X2VA 5JBBS 1JIRA 1GHAG 3V3MA 4A92A 2ZCHP 1OKXA 1EAIA 3M37A 1GMDG 3PWBA 1OWJA 4KKDA 1XUGA 5E0GA 3LJOA 4Y0ZE 1CE5A 1GDQA 1F5LA 3A7ZA 5E0JA 3RXTA 2R2MB 4K8BA 1GBDA 4MTBA 2QAAA 3A85A 4AFUA 3TNTA 5B6OA 4J2YB 1MU8B 2FP7B 1BB0B 1DWDH 2VNTA 1W3CA 4Y8YA 1ELDE 1PPGE 3H7OA 1ELBA 1SGYE 2ZKSA 1EZQA 2QN5T 1VITH 3MU1A 1GJ8B 1AVXA 1HIAA 1LQEA 3CS0A 3QUMP 1OWIA 3QX5H 3RXLA 1QR3E 1P2MA 4A1VA 1FY3A 2XCNA 2BQ6B 1YBWA 2AS9A 4X2YA 4U2WA 1EJAA 1QJ1B 4Q7ZA 1YLCA 1YM0A 4Y8XA 2ZZUH 3SBKA 4Y7AA 1RFNA 2ZPSA 3U8OH 3U8RH 1SC8U 1ETSH 1WQVH 3QTVH 2ZGBH 1QQ4A 3ZYDA 4CBOA 1QL8A 1CT4E 4U01A 1LPGB 1SR5C 1L2EA 3BIUH 1UMAH 3ZZ6A 1SOTA 2EI8A 3BTFE 1T7CA 1C2EA 4ISOA 1C2DA 4DVAU 3SHAH 4BXSA 1NM6A 3ZZDA 4R8TB 3RXIA 2PKSC 4OGYA 1ZGIA 1EZUC 4NA7A 1QB6A 1WOFA 3SV9A 4DIHH 3FP6E 4AB9A 1AGJA 1ZGVA 3OTJE 2GCHF 3PB1E 2B0FA 2AH4X 2Z9LA 4NG9H 3EQ0H 3L6PA 3MU0A 3GCHB 1TA2A 2H5CA 3RXBA 3ZZ3A 4B71A 2OQUA 3C27B 4ZXXH 1PPFE 1AVWA 1Z8RA 1T8OA 3Q3KA 3ZVFA 1MZAA 1K2I1 1GGDB 3SGAE 1XVOA 3BTTE 1MAYA 4B74A 3OSYA 4NIYA 5PTPA 4KP0A 1FZZA 1NU7B 2VIWA 1P8VC 3LGYA 3FZDA 4INLA 3ZZAA 3S7KB 4ZHMU 3VB7A 3BSQA 4JMYA 1EJMA 3BTGE 3O8BA 3P92A 5BRRE 1EZXC 1O0DH 2XBVA 3ZZCA 1K9OE 3FAOA 1O30A 1C5TA 1ZPBA 1TPOA 1O3EA 1YCPH 1SHYA 2G8TA 4BTIB 4YT7H 1C1OA 2BOKA 3LT3A 1SGEE 2VIOA 2EI6A 1ELEE 3PWCA 3SUEA 4B2AA 4U30A 3P17H 4AFQA 1BRUP 1TRYA 1GBBA 4HTCH 3EE0B 3SV8A 3M7QA 1G3EA 1SHHB 1X7AC 3RM2H 1IHTH 2FOHA 2BDGA 4YOIA 2CMYA 1RRKA 1B5GH 1WBGB 4MQAA 5TCCA 1BA8B 2VH6A 1Z8JB 2YNAA 1B0EA 1V3XA 2FS9A 2ZC9H 3TK9A 3PROA 1DOJA 2OXSA 5ESBA 3UWJH 4JZ1A 3TJVA 3M3TA 2J94A 3PM3A 1GGDC 2RG3A 2Y80A 7ESTE 1FAXA 1ZRKA 1OWHA 5EU8A 1GMCF 2ZPQA 2ZFPH 2IN2A 4ABEA 2ZDAH 1Y5BT 2XW9A 1JRTA 1GBKA 1ANBA 1AN1E 1S6FA 2FOCA 3TH3H 2A32A 4AORA 1TQ0B 1ELTA 1JIMA 4X2XA 4TY6A 3UR6A 1P10A 3NPSA 1MBQA 4KELA 1ELGA 1P2QA 2GP9B 1ZYOA 1D3DB 5AFYH 1QHRB 2KAIA 1TBZH 1AU8A 3LH3A 1Z6EA 1AO5A 1C4Y2 4Y7BA 3ZVDA 3KL6A 2QF3A 2WV5A 3RMMH 1AZZA 3E0PB 3TJUA 4UFEH 1BBRE 2A0QB 2ZI2H 1HAZB 1ZTKA 4B2CA 2H5DA 2ZHWH 3M5MA 1EP5A 4Y79A 7LPRA 1GHAF 5JB9S 3A84A 3V7TA 4FVBA 1GMHF 2AGEX 4DY7B 1Z8GA 1IQFA 1EATA 2P59A 3A8DA 5F03A 2Y5FA 3OY6U 1NN6A 3BTDE 5C5NA 1UO6A 2GVFA 1VITF 1P01A 3GY3A 1OX1A 3BEUA 4ZUHA 1FNIA 3U69H 2CN0H 1V2KT 4NWLA 1NY22 4TPYA 4A7IB 4CH2B 2ESTE 1OPHB 4ESTE 2PW8H 4IS5A 2GV6A 3HATH 1TMUH 1IQGA 3KGPA 1N8OC 5DP8A 3V0XA 1DY9A 5TCAA 1HLTH 1SGFA 1O3OA 2BXTH 3P70B 4GVUA 4LK4A 1O2XA 2NU4E 1P2KA 1GBFA 4JCNA 4RSPA 2BLVA 3A86A 3F1SB 1Y59T 1DM4B 1GJ7B 1C2JA 4NSYA 1C1NA 2XWBI 1SLWB 1GHWH 4FUDA 1O33A 1O3GA 4JYTA 3T29A 3JZ1B 5DO4H 1TPAE 2WPLS 4X1NU 3TGKE 1NPMA 3MNXA 5FHTA 4ASHA 3FP8E 2G00A 2XYAA 1DS2E 1KLTA 1QBNA 2CGAA 2FODA 1TIOA 5LPFA 1ZMNA 2ZTZA 3D23A 1GI5A 1GHVH 4O3TA 1QA0A 4Y76A 3GCNA 1O3BA 1SOZA 3S69A 3ZZ4A 1DITH 3T25A 1GL0E 5I25A 1UTQA 3F6UH 2ZIQH 3URCA 1F5RA 4TPIZ 4B2BA 1GCDA 5DKMA 2BZAA 2VVCA 2ZDLA 1LVMA 5FPYA 1HCGA 1YPHE 3E90B 1O37A 2XXLA 5JBTA 5L2YH 1SQAA 2A4RA 3P6ZB 3SV2H 2VB0A 2GZ7A 1KYNA 4CREA 1ESTA 1KTTB 5HMAA 1BTHH 5DP6A 5F8TA 1AZ8A 2GMTC 3SO3A 2SFAA 3LH1A 2H1UA 1O2MA 4CH8B 4X1RU 5L6NH 5K7RA 2AFQB 4I8JA 5FCKA 4DOQA 3DUXH 1GI4A 5ETXA 1NFWA 2FLBH 4GAWA 2RCEA 4D9RA 2Z6BD 3PO1B 1C5LH 3EYDA 4X8SH 3AW1A 2HWLB 1HAIH 1NROH 2WYJA 4NSVA 1QA7A 3M5OA 1U6QA 5FAHA 1S83A 1P04A 1T8LA 1S82A 1PYTC 2G4UA 5EW2H 2HNTE 2VWLA 4UEHH 1VR1H 4XDEA 1T31A 1MH0A 1O2KA 4NA9H 5DP3A 1MD7A 1W2KH 2WINI 1P0SH 1EB2A 1K22H 1DUEA 1C2MA 1HYLA 1O3JA 1BMAA 3A87A 1O2HA 3KF2A 2A5KA 1P2JA 2F9BH 3GY2A 3SUFA 1ZSJA 5T3HA 1LHGH 3UREA 1K1LA 3A80A 1BRBE 3AAUA 1MKWH 2NWNA 1GHBF 3SU3A 1O34A 2AIQA 1DFPA 1TE0A 3KN2A 5CE1A 2UUJB 3QDZB 1HAYB 2FI3E 1GJ6A 3RXKA 2QV1A 2ASUB 3I29A 1AB9C 2FX4A 4RN6A 2VVUA 3UQVA 2B9LA 3EA7A 2GCHG 3TITA 2OTVA 1EB1H 2Y81A 3SU5A 1O3PB 2FWWA 2ZDVH 1MQ6A 1MKWK 5C5OA 1A5IA 1IQEA 1Y5AT 3RLWH 1XMNB 1G2MA 1MBMA 1WU1A 4GCHF 1K28D 1O3DA 1BHXF 3DFLA 1KXCA 1GBTA 1KLJH 2WUBA 1FAKH 1O2SA 3MO9A 1CO7E 1XKAC 1L1GA 4IC5A 1Z71A 3PO1C 2GX4A 1SSXA 2A4OA 4E05H 3PMHB 4NFFA 1FQ3A 1GBLA 4K1SA 1TRMA 3GICB 1ZHPA 2BD3A 2A7HA 4VGCB 1OYTH 2Z3DA 4MG3A 1O2YA 3SJKA 3QZQA 4AZ2B 2XC0A 1WV7H 1QB1A 1K1OA 2A5AA 1JXPA 3DFJA 1E0FD 1RS0A 2TIOA 2Q6FA 5LPRA 1K1IA 1TNGA 1ZTJA 1VCWA 4YOJA 1O31A 2VVVA 2ZECA 2XBYA 2D8WA 2AERH 1EOLA 1FI8A 3D49H 1FY1A 1O5GH 3SU6A 1FPCH 2R2WU 5EW1H 2C3SA 1C1RA 3ODFA 1HXFH 1H8IH 1HAPH 2OD3B 1W13U 2GZ8A 2PSXA 1KXEA 1JWTA 1BTXA 3OY5U 1WCZA 5E8EH 1LHDH 1C2KA 3SHCH 1KY9A 1IOEA 1QTFA 2ODPA 1DVAH 2FOFA 3P8GA 1UJ1A 3AASA 2P95A 2AMPA 4X8UH 2QGRA 1UCYE 2ZU1A 2Y82A 4RKJB 2QA9E 1FIZA 1GJDB 2ZCKP 2C8XB 4HGCA 4GHQA 2AIPA 3A8CA 1DUAA 3ENSB 1GBCA 2QXHA 3RXEA 2ZP0H 1GBEA 1C1SA 1P02A 1DXPA 2CXVA 3TU7H 5ABWA 2FZZA 1IQMA 4NFEA 1GVLA 2B8OH 3QGNB 1HB0B 1YPKH 3RXSA 4ABFA 1GMCG 4X2WA 4DG4A 1GJ5H 1V2ST 3RXAA 2BD8A 2CHAB 3S9CA 1O2UA 4VGCC 1AMHA 1XUFA 3SU1A 3MNCA 4ZKSU 1ETRH 2ZCLP 4INKA 1CGHA 3TLOA 4O3UA 2H2ZA 3BTME 5DP9A 1EAXA 3RU4E 2BX4A 4UFDH 1UTJA 4CRBA 2FOBA 1A46H 1SGNE 2A1DB 3E6PH 1ZPZA 3A89A 1C5SA 2W3KA 5T6FA 3FANA 3GY5A 1UK4A 4I32A 4TYDA 1RXPA 1YKTA 1MTNB 1BRAA 1QFKH 1OSSA 1QBOA 2QXJA 3KEEA 2A4QA 2Z9GA 1GMHG 1NESE 2PWXA 1O3FA 2UUYA 2ZPRA 4ISIH 1NO9H 1UTOA 4NA8A 5EQSA 2W7UA 2G5NA 4K3JA 3RXHA 2BD5A 5EQQA 1A5HA 1FY4A 2HPQH 1AKSB 1YPHC 4K5ZA 1C5PA 1EAWA 2ALVA 1ANDA 4FUHA 3QN7A 1GCTB 2BMGB 3PTBA 1VITG 5GDSH 1P3CA 3A8BA 2Y5HA 1C5VA 1E35B 1GJAB 4YESB 3SOSA 3ZZ9A 3U9AH 1MKXH 1YYY1 1O36A 2C90B 2BLWA 1UVPA 1Q2WA 1VGCB 3ZVEA 2CHAC 3I78A 4UDWH 2P8OC 4AFZA 3SUDA 3O8RA 5DP5A 3MH4A 4AFSA 1DE7H 1V2QT 3LOXA 1XXFA 1P9SA 3A7TA 1FN8A 4NZLA 1LPKB 1TPPA 4AYVB 2OLGA 2W26A 1UHBA 4FU7A 1KLIH 2ZGCA 3SNDA 1MKXK 4Y8ZA 3HKIB 1XUJA 1TPSA 3SU2A 3UWIA 1C1QA 4IW4E 1CHOF 2FOMB 3UNSA 2TGAA 1YCPM 2H9TH 2HNTC 2WPJS 1BMNH 1ARCA 1K1MA 2VWNA 1FPHH 3S0NA 1QRZA 1V2MT 3QK1A 1MTNC 1RIWB 3MYWA 4H6SB 5ESTE 1YPJH 2HVXA 1L4ZA 2GKVE 1EP6A 1C2GA 1MCTA 2ANYA 4ABIA 1HAGE 1OP8A 5T6GA 3SJ9A 2A7CA 3SZNA 1NFUA 3KQDA 1TOCB 1GCTC 1H9IE 1FIWA 4X6NA 4XOJA 5EODA 4YM9A 2FTLE 4CRCA 5FBIA 4WVPE 3LPRA 4BAOB 3TJOA 1BJUA 2PKAB 2BTCE 2GDEH 1FN6A 2D1JA 3P8FA 4LZ1H 1LCYA 2R0KA 3ZVCA 3UQOA 1DWEH 1S0QA 1UK2A 2GT7A 2F91A