1WQSA

Crystal structure of norovirus 3c-like protease
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
173
structure length
173
Chain Sequence
APPTLWSRVVRFGSGWGFWVSPTVFITTTHVIPTGVREFFGEPIESIAIHRAGEFTQFRFSRKVRPDLTGMVLEEGCPEGVVCSILIKRDSGELLPLAVRMGAIASMKIQGRLVHGQSGMLLTGANAKGMDLGTLPGDCGAPYVYKRNNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A norovirus protease structure provides insights into active and substrate binding site integrity
pubmed doi rcsb
source organism Chiba virus
molecule tags Hydrolase
molecule keywords 3C-like protease
total genus 32
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wqsA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wqsA01
2DE9A 1VITF 3ATKA 1GHAF 2AIPA 3LGTA 3KQCA 1BDAA 3SQHE 1S6FA 4RN6A 3OSYA 1KDQB 4JMYA 3HK3B 2UUKB 3ZZAA 1TE0A 1NFUA 1O33A 3RXMA 4B2CA 1BTZA 2Y7XA 3GCTF 3Q76A 1OX1A 1AE5A 1GHAG 1EZSC 2B9LA 4BAOB 3GISB 1EAWA 4CH8B 4I8HA 3SGAE 3D65E 2FOGA 2P59A 3M7QA 4D9QA 1GBMA 4OS6A 1IHTH 3K9XB 3M3VA 3QDZB 1P04A 3SV9A 2WPJS 3SJOA 1IQLA 2EI6A 4MPUA 1O2HA 1Z8JB 1NRSH 3GCTG 3SBKA 2OLGA 1GBBA 1BRAA 4IN2A 1O3KA 1BOQA 3RXPA 4X6MA 1UTJA 1YPEH 1DM4B 1UTLM 4Q7ZA 1LDTT 2F9VA 3PLBA 4XOJA 2EA3A 1LVBA 4ISLA 4Y7BA 2FZZA 5HM2A 2XWAA 1O3FA 1V2VT 4RSPA 3AVZA 1K2I1 1NZQH 2SGQE 3P8NA 4XBDA 2A32A 4R8TB 1ZLRA 2YOLA 2FEQH 1N1LA 2ZHFH 2A4OA 2FYRA 3RDZA 5EXLA 1ZJDA 3NKKA 4Y79A 1C2DA 2G00A 1IQFA 4YZUA 3PROA 4Y7AA 4ZXYH 2RA3A 4F49A 4I8KA 4Z0KA 3BN9A 2ODYB 1QL9A 2ZPSA 2ZDMA 1SGCA 1OXGA 1DSTA 2UUFB 2QF3A 2J95A 2CGAA 4INHA 5F6MA 1SGTA 2C8XB 1L1NA 1IHSH 1F0UA 1FN6A 3FP7E 3P8GA 2HRVA 1ZSJA 2BQWB 1SLVB 3TH2H 8ESTE 1O37A 1KXEA 4ISNA 1EXFA 1SL3A 1T8OA 1EB1H 3ZYEA 1BRBE 2FM2A 4D8NA 2VIPA 2C93B 1DICA 3KN2A 2OC7A 1A4WH 3VB6A 1J16A 4NA9H 1H9LB 2AIQA 3ESTA 1C1OA 2V3HH 2TGPZ 3SN8A 2Y5HA 1LVYA 1AWHB 1F0SA 1RXPA 2YNAA 1VZQH 1AWFH 3EA8A 1SPJA 3GYMA 1C5SA 4NIVA 1BQYA 2VGCB 1UCYE 4ABFA 1W3CA 3QLPH 1V2JT 1FV9A 1OPHB 2AH4X 2GDDA 2J34A 2VVCA 4CHAB 1P2KA 2ZKSA 5JBCS 4WXVA 3RXCA 3TPIZ 2TPIZ 1C2GA 2ZGCA 2ZHDA 3BTFE 1TBRH 2QXJA 1L1JA 2OCVB 1ESTA 1K1IA 2UWLA 4INLA 4HZHA 1BHXB 3P70B 1TPAE 1CVWH 2PGQB 1NFXA 3ZZ4A 3LGWA 3RXDA 2XC0A 2Z3CA 1AB9C 1YGCH 1CQQA 5C5OA 3LT3A 1C1QA 1W0YH 1BBRH 1MH0A 1DDJA 3PLKA 1O5BB 1ZPBA 1DUAA 3VFEA 4JYTA 1HAPH 3UY9A 2VIVA 1AZZA 3A8DA 2ZTYA 1FAKH 3O8DA 1C5QA 1TQ0B 4H6TA 5C5NA 1DPOA 4FUFA 2B5TB 5F8XA 4K5ZA 1NROH 2PKAB 2J2UA 3M35A 4AORA 3B8JA 1G30B 1O36A 2EI7A 3A7ZA 2BY8X 3I78A 3URDA 1J15A 4ZROA 1B0EA 1KXBA 5F8TA 1KLJH 1UMAH 4K60A 1GVZA 5AFZH 4K8BA 4ISHH 3A83A 2WYJA 2J9NA 2BLQA 5EGMA 2C90B 4LOYH 3HGPA 1IAUA 2O8UA 4WH6A 1FIWA 1BRCE 1UCYH 1HUTH 3PO1B 4FU8A 4FUIA 4HI3A 1CU1A 2GCTC 3TNTA 1MU8B 4BAHB 4ABEA 2BD3A 1WSSH 1SGFA 4ISOA 2O8MA 2HNTC 1T31A 2C4FH 2FPZA 1DWEH 1FXYA 4MNYA 4Q80A 3KEEA 2ZHWH 2I6QA 1GG6C 4BANB 2FESH 1GI9B 1ZTKA 2QV1A 3TK6A 4XBCA 3QZQA 4AOQA 2AGGX 1P10A 1VGCC 1XVMA 2VIOA 2SGFE 2VNTA 1TOCB 1FJSA 3RXVA 2AFQB 4PROA 5FPYA 1GJCB 5C3NA 1XUGA 2PHBA 2WV5A 3PMHB 2HGTH 1O3LA 3I77A 1DWBH 4YLUA 4XFQA 3T25A 1WU1A 4SGAE 1XXDA 3A80A 2ZDAH 4YOGA 1O2PA 2GVFA 1GMCG 3A82A 3EA9A 1J9CH 1H4WA 3MMGA 1TNKA 5EG4A 3P92A 2WPIS 4A1XA 2BDAA 1QRWA 1O5CB 1GCDA 3EA7A 3F6UH 4ABJA 1KXDA 1GBDA 1F0TA 3SHAH 3SNAA 2XWBI 8LPRA 2JH6D 2XTTB 1Z6EA 2H2ZA 1F5KU 2FYQA 1OP2A 1EJNA 1NM6A 1YF4A 4YOIA 4K1SA 4ZKSU 3MO9A 1AQ7A 3RU4D 2SNVA 1GMCF 1MKWH 2H5DA 2B7DH 3RXGA 2FP7B 3S9AA 2CHAC 1NO9H 1AKSA 1MTSA 1C9TA 1TBQH 3BIUH 4WWYA 4GAWA 1BBRE 4I31A 3FP6E 1T4UH 2G5VA 1WQVH 2BX3A 3BEIB 3BSQA 5DP4A 2V6NA 2ZU4A 4O3UA 3T26A 1B0FA 1TMUH 4JK6A 5J4QA 1O3IA 1Y3VA 3RXTA 4NFFA 5EPNA 3Q3YA 3SU0A 3ZZBA 1Y3UA 1L1GA 3VXFH 1C2FA 4Y8XA 3DD2H 3UIRA 3VB3A 1O3NA 1AGJA 2BD8A 2PV9B 4BAKB 1GI3A 5I46H 2BVSH 1OYTH 3FZZA 5EXMA 1GBJA 1LPGB 4FUCA 1N8OB 1SFIA 2A2XH 3LU9B 1UTOA 1D3QB 4AG1A 4WXIA 2QXHA 2ZTZA 1TAWA 1P9UA 1BTWA 2HLCA 4D76A 1PPFE 1VR1H 4AZ2B 1XUKA 3KQEA 1HJ8A 4YESB 4A6LA 4AFZA 1O5FH 2BHGA 4DIHH 1O5EH 2OBQA 4TYDA 4AFUA 1HFDA 1QIXB 5AHGH 3EYDA 4GPGA 1S81A 1MMJN 5L2YH 1K1MA 3A7YA 4UFDH 2W26A 1ELDE 5BRRE 1VITH 4LK4A 3BG4C 1GJ6A 1BIOA 7GCHF 1C5LH 1YPLH 5A8XA 4AYVB 3F1SB 3ZZ8A 3CP7A 1NN6A 3MI4A 4O3TA 2ZC9H 1H9HE 2P3FH 1T7CA 1WCZA 3DA9B 1O2NA 5DP7A 4E7RG 1Z1IA 4X6NA 2ZGHA 1O2YA 3RU4T 2BXTH 2Q6FA 4AYYB 1EPTC 1C1WH 1IQGA 2A5KA 1C5MD 1GCTC 3HKJB 3TJNA 3ZZ5A 7GCHG 1O3JA 1L0ZA 4JYVH 1YBWA 5GDSH 1OOKB 2VVVA 2TGDA 1TX6A 3MNCA 1UCYK 3GCHC 4IMZA 1S84A 4Y8YA 1A5IA 2HVXA 1D6RA 1XUIA 3QN7A 1W0ZU 2ZU3A 1OWKA 2PTCE 3K6ZA 1D6WA 5JBTA 1BMAA 1QA0A 1AHTH 2ANKH 2WV4A 1QR3E 1Z8IB 3SNDA 3BTHE 4ISIH 1OYQA 4IS5A 4BOHA 2BZAA 1OKXA 1MAXA 2WUCA 2PUQH 1EZUC 3SGBE 2PTNA 1C1NA 1O2QA 1Y5UT 3RC4A 1TWXB 2O8TA 1G3CA 1RIWB 1KDQA 1C5YB 1A0JA 1ZYOA 1MKWK 2A7JA 3NCLA 3AAUA 2PKSB 6GCHG 3HPTB 2GP9B 3GY6A 3SW2B 2KAIB 5JBBS 5CMXH 1TRNA 4LZ1H 4X2XA 4JK5A 1VCQA 4NIYA 1FAXA 1QBNA 5DP8A 2JH5D 1GCTB 1ZTJA 2A31A 2ZPRA 1C5VA 8GCHF 4FVBA 1ZMLA 3KGPA 1BJVA 1EP5A 3SHCH 6GCHF 3SUEA 1FONA 1HB0B 2R0LA 3G01A 4ABGA 1LMWB 1EATA 1IQIA 1E38B 1LQEA 1G37A 1PQ5A 2EEKA 4X1PU 1EQ9A 1UK4A 2XNIA 1J14A 3GYLB 5H4IB 1P3CA 4Q7YA 1LHCH 1YYY1 4Y10E 4A1TA 8KME2 8GCHG 5GWZA 2GZ7A 1BZXE 4FUHA 1QL8A 4Y6DA 4AFSA 1EX3A 1TGTA 1TYNA 1V2MT 4JZDH 2VWOA 1EJAA 4Y8ZA 4BNRA 4YO9A 2Z7FE 3GY3A 4ZKOU 2FXRA 2BB4A 1JRSA 3STIA 1RFNA 2NU3E 3SU3A 2BVRH 2PKSC 3TIUA 1Q31A 2GZ8A 3GY7A 2GCHF 1YLCA 1YM0A 1E36B 3EE0B 1QNJA 2OINA 5ESBA 1O3PB 1HAXB 1GVLA 1C1RA 3ODFA 4KGAA 1CGJE 5A2MH 3ZZ3A 1O2RA 1LTOA 1AVXA 1P12E 3RMNH 2ZQ1A 5A0AE 1SGNE 1C5NH 1O30A 1ZRBA 3MYWA 3FP8E 1NFWA 2FTMA 1C2EA 1JOUB 1FUJA 1OWHA 4GHTA 2Z9GA 5C1XA 1SR5C 2FIRH 2GV7A 4CRFA 1TX8A 1YLDA 1HV7A 2TGTA 2ZECA 3MNBA 3QTOH 1NU7B 3UWIA 4E7NA 1PPBH 4B2AA 4GLYA 5DJ7A 1EUFA 1P3EA 3ITIA 1Z8GA 1W8BH 1GHVH 1K1LA 1J17T 3MO3A 1QB9A 5E0JA 3RC6A 4CRDA 3SQEE 1BB0B 1W14U 3AAVA 2QAAA 3OY6U 2LNCA 3QTVH 1AE8H 3RXBA 3ZZDA 1BTXA 1V2LT 2FI3E 1O5AB 2I6SA 2R2WU 1B7XB 2Z6BD 2FOFA 2FOCA 4IN1A 6CHAC 1A2CH 1EZXC 1GI7B 1MUEB 1TGBA 2WPKS 1GJ4H 3M36A 2NU4E 1ZMJA 3H5CB 2RA0A 5E0HA 4O9VA 1DT2A 2PR3A 2WPMS 1YCPK 3BG4B 1O2SA 5E0GA 4NG9H 4FU7A 5LPEA 3BTGE 4ZHLU 3NUMA 4UD9H 3EQ0H 2BDCA 7KMEH 1QURH 3HATH 2W5EA 1IQEA 3LOXA 3RMOH 2ZFSA 2AGEX 3LGVA 5FCRA 2ZDLA 1K22H 2F9OA 1UHBB 2XRCA 1PQAA 1PPZA 2Y80A 1AMHA 3TGKE 3UREA 1D3TB 1HXFH 5DP9A 3GY4A 1TGCA 1EZQA 4KP0A 1W11U 1DSUA 2OD3B 1W12U 4UEHH 2CV3A 3RXAA 1X7AC 3K6YA 1PQ7A 4BTIB 1P2OA 3L3TA 2AMDA 1P8VC 1QB1A 1AKSB 3SV2H 4XDEA 5FBEA 4D7FA 2CHAB 2AYWA 1PYTC 3U1JB 1H1BA 4BAMB 5JDUB 3QGJA 3DHKH 4KTSA 3D23A 5FXLA 1C2HA 1SVPA 3LGYA 3RXLA 2BDYA 3LPRA 3U8TH 4TY7A 2BD4A 3PV4A 1ZHMA 1GMHF 1FNIA 4TWYA 3P8OA 2K1QA 4TPIZ 1RTLA 4ABHA 2BD7A 3DFJA 1YPGH 3SI3H 1VCPA 4MG3A 3F9FA 2BTCE 2P94A 1AZ8A 2H6MA 1QQUA 1VCWA 4ZKNU 4YT7H 5JYIA 4MVNA 1BTUA 1GMHG 1OWEA 4XE4A 1FY5A 3VGCC 4DJZB 4UDWH 4MLFB 3SNBA 4Y11E 1DY9A 4WH8A 1YCPM 2QY0B 3MU8A 1HIAA 3JZ2B 1TOMH 3TLOA 3SNCA 3BEUA 1D3DB 1DE7H 5I25A 2ZDVH 4UFEH 3Q3XA 3QO6A 1DY8A 4WMFA 3D62A 4MPWA 1UK3A 1ZHRA 1SHHB 2GMTB 1A5HA 1ARCA 2G8TA 2TRMA 5EQQA 4OS4A 2ZU1A 1CT2E 2F83A 3AW1A 2FS9A 2XYAA 1ABIH 4BXSA 2QXGA 1Y3YA 1K1OA 3B23B 3KIDU 2A4QA 1GHXH 2IJOB 2FOAA 4DT7B 1ELGA 1WUNH 4IMQA 3MTYA 3LH3A 2D26C 2ZFRH 2ZTXA 3RM2H 5DK1A 2P16A 1OWDA 1D4PB 1GBIA 1WYKA 1YCPH 4FUJA 5L30H 1O3EA 5AFYH 3WY8A 2Y5GA 2RCEA 4AFQA 4ZH8A 4BAQB 1SG8B 2ZZUH 4INKA 2VU8E 4TPYA 1T32A 1THRH 1MCVA 1CA8B 1IQMA 2PSXA 3HKIB 1ANDA 2FOBA 1F2SE 3RMMH 1HAYB 3BEFB 1BCUH 4K2YA 4B75A 2OXSA 9ESTA 2BY5X 4YT6H 2EC9H 3E0PB 1HAVB 1OP0A 2ODPA 3SV7A 3ZZ7A 1V2ST 3PO1C 4X8VH 1NT1A 3RXSA 1OP8A 5DP3A 1L4ZA 1QQ4A 4A92A 1NRPH 1QFKH 4B2BA 1ANCA 1K21H 3GCHB 2ZP0H 4B74A 3SOSA 4DY7B 1YPKH 4AN7A 1GBCA 1TA2A 2XC5A 4UFGH 2OTVA 4ZHAA 3DFLA 4A5TS 1BHXF 2QXIA 3PMAB 1LO6A 2GV6A 4KTUA 1CT4E 4MNWA 1S85A 1V2NT 1ANEA 5E2OA 3UNRA 3P95A 2NU0E 1V2UT 1ELFA 4I8GA 1P11E 3F9EA 2TBSA 1IQJA 2CJIA 2GX4A 1O2OA 3RXRA 2Y7ZA 1ZOMA 1OS8A 2BD9A 1DXPA 1IQHA 1C1VH 1GL1A 1V2OT 3OY5U 3T5FH 3M5NA 2J94A 2FX6A 1FZZA 3CENA 3RXOA 2GCTB 1O32A 1THPB 5EW2H 1RTKA 3SNEA 1DLEA 1LVOA 1JBUH 1WOFA 3OX7U 1UJ1A 3URCA 1O3DA 2ASUB 1XM1A 3NXPA 4BTTB 3GDSA 2W7SA 2A2QH 3CS7A 5EOKA 3SUDA 3MWIU 1RTFB 3HGNA 1N6YA 2ALPA 2SNWA 3CS0A 3E6PH 4RKJB 1GJDB 1QJ1B 5B6OA 3BIVH 1C5TA 2ZI2H 3MHWU 4FUGA 5TCAA 1TPSA 1TNHA 5FCKA 3ATLA 1TPOA 3U1IB 4ZUHA 4CRAA 1ELAA 5GCHG 1A0HB 1RIWC 1SMFE 2UUJB 2Z9JA 1BMNH 1P02A 3FFGA 1ESBA 2HWLB 2AS9A 3UOUA 4GVUA 5DPAA 2H9HA 1XKAC 1NESE 1O2MA 1S6HA 1PPCE 2ANMH 4LZ4B 4MQAA 1XMNB 1AVWA 1BTHH 3T62A 1DITH 1GI0A 1CBWB 2FMJA 1XUHA 3TJUA 1JXPA 3FVFB 3TNSA 2OQUA 2O8LA 2ZHQH 3SI4H 1WTGH 4OS2A 3SZNA 2ZGBH 1LVMA 1SGYE 5E2PA 3RXHA 1ESAA 3BF6H 3ZV9A 2XCNA 3F9GA 1C1TA 3SJ8A 5ETXA 1F7ZA 5FX5A 3SU6A 3Q00A 4H6SB 1MAYA 1JMOH 3U8RH 4CR5A 4X6PA 2OC1A 3TK9A 2ZF0H 1ELBA 2FLRH 1DWCH 2ZQ2A 1GDQA 6LPRA 2FODA 3V12A 1TBZH 3A7XA 3R0FA 1DLKB 2AGIX 4NGAH 3S9CA 3E1XB 3UTUH 1SOZA 5CE1A 4B73A 5EU8A 5IDKA 2GCHG 1DVAH 1WV7H 2BX4A 5E8EH 1C4V2 4F4OC 4DOQA 1L4DA 1ZMNA 5G4BA 3ATWA 1QB6A 2ZGXH 1TMTH 2QIQA 3DUXH 1CHOG 4AGKA 2UWOA 3HK6B 1NTPA 1GI1A 4A7IB 1G3BA 1W2KH 3MOCA 4FUDA 7ESTE 1FPHH 1JWTA 1TB6H 3E91A 5FAHA 5C1YA 1SGIB 1GI8B 3LDXH 4NZLA 1AN1E 1ZGVA 2GTBA 1O2ZA 1ETTH 2FDAA 1MBMA 4X1RU 1PPHE 3VEQB 1CHOF 1EAIA 3GCOA 3IG6B 4NA8A 1C2IA 5FX6A 2G4TA 1YPHC 4O03A 3E16B 1C5XB 1QJ7B 3UR6A 1HXEH 1C1MA 2Z9IA 4ZHMU 2ODQA 4AX9H 3MNXA 2BXUH 1HIAB 2IOTA 1W7XH 1BITA 1YPMH 2PGBB 3LGIA 3RU4E 1YP9A 4WY3A 4RKOB 3M3SA 1Z1JA 4X8SH 2BY7X 1K28D 3N7OA 5EPYA 3T27A 2P8OB 4NSYA 4H4FA 4XBBA 2ANWA 2KAIA 3ELAH 2JETB 1EOJA 1NS3A 1ZRKA 3QK1A 4ZKRU 3K65B 1ZSLA 1LCYA 1P09A 3UOPA 1H8IH 5LPRA 1EKBB 1TRYA 3V0XA 1NRQH 1FY3A 1SGEE 3A7VA 2V3OH 3A84A 1BRUP 1RGQA 2XBWA 5HMAA 5L2ZH 1V2TT 1F5RA 2ZFTA 2NU2E 4ZXXH 1NRRH 1HRTH 1KXFA 3LJOA 2J4IA 3MH4A 2BLOA 1O2IA 1J8AA 4X2WA 2HOBA 2HPPH 3VB7A 1PFXC 1FIZA 1Z6JH 1GJ9B 3PWCA 2BM2A 3TH3H 4IBLH 1A3EH 2ULLA 2V0BA 1MTVA 1ZR0A 3BTDE 2LPRA 1KLTA 3SU1A 6ESTA 2FWWA 4MDSA 2QGRA 4B76A 1P05A 2Y6TA 1ABJH 4WF8A 1AFEH 1C5OH 4Z6AH 2VJ1A 5EW1H 2G4UA 1C2LA 1ZTLA 1TNIA 4FU9A 1O2UA 5TCCA 1UVTH 4DW2U 2FOEA 2ZFFH 2CF8H 3ZVDA 4OS7A 4FVDA 3BG8A 4FUBA 4GCHF 5FPSA 4E06H 1GGDC 1FQ3A 3A8AA 1V2WT 1TX7A 2GKVE 5CHAC 3VB5A 3BV9B 1MTWA 3MH6A 1HGTH 5HXFA 2BOHB 4NIXA 1Q3XA 3O8RA 3MU5A 4NSVA 3V3MA 1O5GH 1LHDH 2DUCA 1SGPE 4X6OA 3IWMA 5DKMA 3UPEA 1HAOH 3QWCH 1UTPA 3M5MA 1S0RA 2ZCHP 3MNSA 3E3TA 3ZVCA 1DFPA 1IOEA 1E35B 1NFYA 4ABDA 2Z3EA 1CA0B 1F92A 3U98H 1HPGA 1Y3WA 4UONA 1OSSA 2BDGA 2F3CE 1ZJKA 1QCPA 1UTMA 3RMLH 5LGOA 1BTPA 3H7TA 4UE7H 4OS1A 4U01A 1G3DA 3ZVBA 3RM0H 1H8DH 1SGRE 3M37A 1XKBC 4U2WA 4X8UH 5C2ZA 2H9TH 3F68H 1KXAA 2P95A 2GMTC 5F03A 4NWKA 1GHZA 3SU2A 5C1UA 2GZ9A 3S69A 5LH8A 3UNQA 1N8OC 3RUOA 1T8MA 2ESTE 4J2YB 4H42U 2YNBA 1QBVH 2G51A 1P01A 3U69H 4JZFH 1HJAC 2BY6X 1T4VH 5DP6A 2VH6A 4X2VA 1SHYA 1C1UH 1L2EA 2UUYA 3RC5A 2ZDNA 1A1RA 1GI4A 1SGDE 5GJ4B 3OU0A 1UHBA 1P9SA 3MU4A 2PSYA 3VXEH 2NWNA 1LHEH 1G36A 1CSOE 4YLQH 2R3UA 1MU6B 1G2LA 1YPHE 3SO3A 3BTWE 1ELTA 1Y3XA 3FZDA 4I8JA 2OBOA 1K1PA 3Q77A 1SLUB 1W7GH 3SU5A 3ZVEA 4CH2B 2FI5E 3IITA 1AO5A 3A85A 4OS5A 5A09A 4THNH 3LC5A 1BMMH 1GBEA 2OC0A 2W7UA 5A0CA 1CGHA 4JZIA 1RRKA 2STAE 4DGJA 1P2JA 1BJUA 4X2YA 1O2VA 5AVDA 1KLIH 2PUXB 3W94A 4CR9A 1WBGB 3C27B 2V35A 3SJIA 1PPEE 1VJAU 1GBLA 1GDNA 1BA8B 2XBVA 3A8BA 3B9FH 1GHWH 3A87A 1C5PA 1UK2A 5JPMH 5C20A 2BY9X 5FPTA 1MQ5A 3KQBA 1O2GH 2TGAA 4DIIH 1KTTB 2BDIA 1LPZB 4NFEA 1C9PA 1V3XA 1AFQB 1F0RA 4WJG2 1O0DH 5A0BA 1ANBA 2O8WA 2ZCLP 1NRNH 1RD3B 1SQTA 3MU0A 1FY4A 1ZPZA 1BTYA 5T6GA 2OC8A 1DWDH 4ABIA 1DANH 1CT0E 1W13U 4K69A 5T6FA 1AUTC 1EP6A 4WVPE 2Y81A 3TGJE 1ETSH 1WAYB 5JB8S 3PMBB 1GHBF 1KXCA 3SU4A 5CHAB 2A7HA 1K1NA 5FBIA 5K0HA 1EPTB 4DG4A 1ELCA 1P2NA 4KTCA 5SGAE 3C1KA 2VH0A 4YOJA 3Q3KA 2C3SA 2SGAA 3SGQE 2VVUA 2EI8A 1QTFA 1Y8TA 4Y71A 4B1TA 5DP5A 2BD5A 1TNGA 2CN0H 3OTJE 2C8ZB 1AU8A 1SGQE 1ZGIA 1NU9A 4CBNA 1MQ6A 1ETRH 3S7HB 1SOTA 2C8YB 3QGNB 1CA0C 1E0FD 1C5UA 1O38A 5EQRA 3V7TA 3T28A 4X1SU 2JH0D 3PB1E 1D9IA 1LPKB 3KF2A 4X1NU 5GCHF 2A5IA 1XX9A 2D2DA 5GIBA 4NA7A 1P57B 2HALA 3ZVFA 4U32A 1ORFA 1HJ9A 1AB9B 1O3OA 3VB4A 1E37B 2RDLA 1C4Y2 1GJBB 2PKAA 1G2MA 2THFB 2ZU5A 2SGPE 1SLWB 4X1QU 7LPRA 2FOMB 1GGDB 4CREA 3KNXA 4JZ1A 1G32B 1O2WA 3ZVGA 1AIXH 1HAHH 2WPHS 1DOJA 4FUEA 1C1SA 1G9IE 1TLDA 3EAJA 2XW9A 1SI5H 3BTQE 2ANYA 4DVAU 4ASHA 3O8CA 2XXLA 1MTNB 4GSOA 4U30A 3RXFA 1CHGA 1NY22 4ABBA 3VGCB 3P8FA 1SBWA 2NU1E 1AY6H 4OGYA 1GBAA 1GL0E 1O2LA 3GOVB 1AFQC 3GICB 4WMEA 1HLTH 3RXUA 3STJA 3VPKA 2F9NA 1ZZZA 4A1VA 2VWLA 2FI4E 5DG6A 1G3EA 3A7TA 3SORA 5EXNA 1VJ9U 2R2MB 3TITA 2CF9H 1VITG 3TK5A 2BLVA 3MH5A 2Q6DA 1QGFA 5HYOA 2F91A 3U9AH 4GUXA 2QC2A 2AERH 3R3GB 2GT7A 3LGUA 4VGCB 4J1YA 1M9UA 1W10U 2VWNA 1C4U2 2ZGJA 3NK8A 4Y0ZE 3GDVA 1P0SH 2A0QB 1IQNA 3FAOA 1TQ7B 3GY2A 1FDPA 1TNJA 1RJXB 3SUGA 1QA7A 4KELA 3KL6A 5ESTE 1EOLA 1GMDG 2F9UA 3QUMP 4HTCH 1DX5M 1TALA 3T29A 2M5TA 1ACBE 2Z9KA 1GJ8B 2WYGA 3S9BA 4I33A 2O9QA 1GI2A 2ZEBA 4DURA 1TABE 1AD8H 2Z94A 4IGDA 1C5ZB 1FPCH 1ZHPA 4K8YA 1OWIA 3PYHA 1HCGA 1SQAA 1GMDF 3ATIA 3LONA 4K1EA 1SC8U 1LHGH 4Q2KA 1TRMA 1GBKA 1DS2E 3LKWA 3EDXB 3GCNA 2D1JA 2QCYA 3TVJB 1OWJA 4GHQA 1LQDB 1XVOA 4D7GA 5ABWA 3ZZ9A 2BDHA 1O3AA 1GJ5H 1SSXA 1GI6A 3ATMA 4ABAA 4D9RA 3KQDA 2P8OC 4CRBA 4HGCA 3RLYH 4I32A 3UQVA 2QYIA 3AASA 3ZV8A 1A0LA 3JZ1B 4Y0YE 1Z7KA 1MCTA 1TGSZ 1B5GH 3BTKE 1Y5BT 3M61U 5LPFA 3UNSA 2H1UA 2STBE 2J92A 5GXPA 1BUIA 4R0IA 2GGVB 4BTUB 2AEIH 3P17H 4LXBH 3LIWA 2BDBA 3S0NA 1HNEE 4JZEH 2H5CA 2XBXA 1UVOA 2ALVA 2ZFQH 3M5OA 4O97A 1MZAA 1QL7A 4IW4E 3PM3A 2ZU2A 3TJVA 1TGNA 1HYLA 1Y59T 5JBAS 1TONA 1TA6A 3KCGH 1XUFA 5F8ZA 1KY9A 2Q1JA 2F9BH 4CRCA 2HNTE 1Z8RA 1BMLA 5A8ZA 2VGCC 1GHYH 5EQSA 1HBTH 4I7YH 4BXWA 5EODA 2ZA5A 1E34B 4JCNA 1TPPA 3V13A 1GG6B 1K1JA 1EASA 4CHAC 1HAGE 1RS0A 3KHVA 1ELEE 3A89A 2XC4A 1JRTA 2Y82A 1WQSA 2Q6GA 2BYAX 3FANA 3BTME 1MZDA 1Y5AT 1XXFA 3M7UA 2SGDE 1GJAB 3ODDA 4GCHG 4NZQA 5IYTA 2PW8H 2IN2A 1P2QA 1MTUA 3AW0A 1A3BH 2QF0A 2TIOA 3PLPA 2IPHA 1UTKA 2VINA 2W3KA 2Z9LA 1HAIH 2FS8A 1A7SA 1EAXA 4TY6A 4WMDA 1KYNA 1C5RA 2D8WA 1O3MA 1UVUH 2ZNKH 1CBWC 2PLXA 4HFPB 3SV8A 1S0QA 4ZAEA 1P2IA 1V2KT 3E90B 1O39A 3LJJA 1XUJA 3NZIA 5C67A 1C2JA 2ZDKA 1V2PT 2RG3A 1IQKA 1V6DA 3S7KB 1THSH 1O31A 3QZRA 1FY1A 1EPTA 4AB9A 1U6QA 1QRXA 2XBYA 2C8WB 4FXGH 2JKHA 1SQOA 5PTPA 2VIWA 2G52A 4IC6A 2BOKA 2W3IA 2B0FA 2WINI 3W95A 1MKXH 3PWBA 3L33A 3BTTE 1GDUA 4MNXA 3RXIA 2FX4A 1K9OE 1O3GA 3MFJA 9LPRA 1EB2A 1TMBH 2UWPA 2OQ5A 3L6PA 3PTBA 3M7TA 2GDEH 1LKBA 1C2KA 3RXQA 1YPJH 1ZPCA 3A7WA 2ZO3H 1LKAA 3ZYDA 4M7GA 2HNTF 1ID5H 1PJPA 3PTNA 4VGCC 1TFXA 1T8LA 3ZVAA 2J38A 2AMPA 1MD8A 1GJ7B 2WPLS 2QA9E 1CO7E 1HJAB 3LH1A 2F9PA 2PWXA 2H9EH 3T2NA 1GWAA 2R3YA 1YC0A 5T3HA 3H7OA 1A61H 4B71A 3F9HA 2CXVA 2OP9A 2BQ6B 1KTSB 3MO6A 1P06A 2G5NA 1QBOA 2BVXH 1TIOA 1FI8A 3TJOA 2VIDA 3RP2A 2XCFA 2SGEE 2ZIQH 4JYUH 2BQ7B 2R9PA 3MU1A 3UUZA 3NPSA 1HAZB 2FOHA 1PPGE 1VGCB 2ZWLH 4NWLA 1O2KA 2FLBH 1O3BA 5A8YA 1QY6A 3M5LA 1EJMA 2VB0A 1ELVA 2A45B 3BTEE 1S82A 2A7CA 1ARBA 1SB1H 5HGGA 3A88A 3M3TA 2A5AA 2CMYA 1DUEA 1O5DH 3TU7H 1P03A 3SV6A 1N6XA 2HPQH 1A5GH 1O2XA 2B8OH 1FY8E 1AI8H 2OUAA 4KKDA 1D3PB 2FTLE 1DXWA 3NWUA 1YKTA 2P3UB 5L6NH 4E05H 3LC3A 2BMGB 4AG2A 5TJXA 4K1TA 5AF9H 3SJKA 4AGJA 5K7RA 2WUBA 4TWWA 1QRZA 2JETC 3SJ9A 3K2UA 3ZZ6A 5J4SA 1MBQA 1FMGA 3SUFA 3TGIE 1INCA 1PYTD 2FO9A 2P93A 4X8TH 2ZPQA 1GI5A 1LHFH 2Y5FA 2DE8A 3UFAA 1GVKB 1S5SA 3UQOA 5BPEA 1UVPA 1WTHD 4ZMAH 1P2MA 3UR9A 1AVGH 4XSKU 3OYPA 1BT7A 5T6DA 1O2TA 1PQ8A 3GY5A 4ESTE 1MKXK 1GHBG 2ZCKP 1C1PA 2QN5T 4OGXA 4I8LA 4MNVA 4MPVA 1V2RT 1C2MA 3A81A 1Q2WA 1JIMA 1Z71A 1UTQA 5DO4H 3ZZCA 3U8OH 4CBOA 1CE5A 5DGJA 4NCYA 5FHTA 1MD7A 3DT0H 4K3JA 1S83A 1BBRK 2GT8A 1JIRA 1MTNC 4CRGA 4UFFH 1H9IE 3UWJH 3ENSB 2ZFPH 2AMQA 1QJ6B 1T8NA 2SFAA 3RXKA 2ILNA 5HM9A 3RLWH 2G81E 1AUJA 4Y76A 3I29A 1KIGH 1O34A 1FN8A 3QX5H 1O3CA 3A8CA 1SLXB 1TNLA 1HDTH 3EGKH 4X0WU 4DCDA 3RXJA 1UVSH 2Z3DA 4YTAA 1KSNA 1O35A 5JB9S 1EAUA 2BLWA 3TH4H 1FLEE 1UTNA 1GPZA 3RXEA 1C5WB 1SGFG 2A4RA 2P3TB 3P6ZB 1UO6A 1GBFA 4YM9A 4MPXA 1NPMA 1A46H 1NC6A 2BD2A 3E8LA 4SGBE 1GBTA 4QT8C 3D49H 3O8BA 6CHAB 1F5LA 2VIQA 4IC5A 1O3HA 2R0KA 5GPIB 1V2QT 4AB8A 1O2JA 3PMJA 1HAVA 2VWMA 1SFQB 4NIWA 2PFEA 4MTBA 3GDUA 1GBHA 2G55A 3A86A 3MH7A 1CGIE 3E0NB 2ZG0H 3GY8A 2GD4B 4Q7XA 2A1DB 1QHRB 2A4GA 2BZ6H 2ZHEH 1ZSKA
chains in the Genus database with same CATH superfamily
2DE9A 1VITF 3ATKA 1GHAF 2AIPA 3LGTA 3KQCA 1BDAA 4HG6A 3SQHE 1S6FA 4RN6A 3OSYA 1KDQB 4JMYA 3HK3B 2UUKB 3ZZAA 1TE0A 1NFUA 1O33A 3RXMA 4B2CA 1BTZA 2Y7XA 3GCTF 3Q76A 1OX1A 1AE5A 1GHAG 1EZSC 2B9LA 4BAOB 3GISB 1EAWA 4CH8B 4I8HA 3SGAE 3FO8D 3D65E 2FOGA 2P59A 3M7QA 4D9QA 1GBMA 4OS6A 1IHTH 3K9XB 3MQKC 3M3VA 3QDZB 1P04A 3SV9A 2WPJS 3SJOA 4ASUD 2EI6A 1IQLA 4MPUA 1NBMD 1O2HA 1Z8JB 1NRSH 3GCTG 5EIYA 1S6LA 3SBKA 2OLGA 1GBBA 1BRAA 4IN2A 1O3KA 1BOQA 3RXPA 4X6MA 1UTJA 1YPEH 1DM4B 1UTLM 4Q7ZA 1LDTT 2F9VA 3PLBA 4XOJA 2EA3A 1LVBA 4ISLA 4Y7BA 2FZZA 5HM2A 1VKYA 5CDFE 3UAIC 2XWAA 1O3FA 1V2VT 4RSPA 3AVZA 1K2I1 1NZQH 2SGQE 3P8NA 4XBDA 2A32A 4R8TB 1ZLRA 2YOLA 2FEQH 1N1LA 2ZHFH 2A4OA 2FYRA 3RDZA 5EXLA 1ZJDA 3NKKA 4Y79A 1C2DA 2G00A 1IQFA 4YZUA 3PROA 4Y7AA 4ZXYH 2RA3A 4F49A 4I8KA 4Z0KA 3BN9A 2ODYB 1QL9A 2ZPSA 2ZDMA 1SGCA 1OXGA 1DSTA 2UUFB 2QF3A 2J95A 2CGAA 4INHA 5F6MA 1SGTA 3OE7D 2C8XB 1L1NA 1IHSH 1F0UA 1FN6A 3FP7E 3P8GA 2HRVA 1ZSJA 2BQWB 1SLVB 3TH2H 8ESTE 1O37A 1KXEA 4ISNA 1EXFA 1SL3A 1T8OA 1EB1H 3ZYEA 1BRBE 2FM2A 3UB0A 4D8NA 2VIPA 2C93B 1DICA 3KN2A 2OC7A 1A4WH 3VB6A 1J16A 4NA9H 1H9LB 2AIQA 3ESTA 1C1OA 2V3HH 2TGPZ 3SN8A 2Y5HA 1LVYA 1AWHB 1F0SA 1RXPA 2YNAA 1VZQH 1AWFH 3EA8A 1SPJA 1H8ED 3GYMA 2V7QD 1C5SA 4NIVA 1BQYA 2VGCB 1UCYE 4ABFA 1W3CA 2KFWA 3QLPH 1V2JT 1FV9A 1OPHB 2AH4X 2GDDA 2J34A 2VVCA 4CHAB 1P2KA 2ZKSA 5JBCS 4WXVA 3RXCA 2KCAA 3TPIZ 2TPIZ 1C2GA 2ZGCA 2ZHDA 3BTFE 1TBRH 2QXJA 1L1JA 3PV2A 3SYJA 2OCVB 1ESTA 1K1IA 3DCLA 2UWLA 4INLA 4HZHA 1BHXB 3P70B 1TPAE 1CVWH 2PGQB 2YMSC 1NFXA 3ZZ4A 3LGWA 3RXDA 2XC0A 2Z3CA 1AB9C 1YGCH 1CQQA 5C5OA 3LT3A 1C1QA 1W0YH 1BBRH 1MH0A 1DDJA 3PLKA 1O5BB 1ZPBA 1DUAA 3VFEA 4JYTA 1HAPH 3UY9A 2VIVA 1AZZA 3A8DA 2ZTYA 1FAKH 3O8DA 1C5QA 1TQ0B 4B6EA 4H6TA 5C5NA 1DPOA 4FUFA 2B5TB 2JIZD 5F8XA 4K5ZA 1NROH 2PKAB 2J2UA 3M35A 4AORA 3B8JA 1G30B 1O36A 4P00A 2EI7A 2WSSD 3A7ZA 2BY8X 3I78A 3URDA 1J15A 4ZROA 1B0EA 1KXBA 2QE7D 5F8TA 1KLJH 1UMAH 4K60A 1GVZA 5AFZH 4K8BA 2QF4A 4ISHH 3A83A 2WYJA 2J9NA 2BLQA 2PP6A 5EGMA 2C90B 2LP6A 3F0PA 4LOYH 3HGPA 1IAUA 2O8UA 4WH6A 1FIWA 1BRCE 1UCYH 1HUTH 3PO1B 4FU8A 4FUIA 4HI3A 1CU1A 2GCTC 3TNTA 1MU8B 4BAHB 4ABEA 2BD3A 1WSSH 1SGFA 4ISOA 2O8MA 2HNTC 1T31A 2C4FH 2FPZA 1DWEH 1FXYA 4MNYA 4Q80A 3KEEA 2ZHWH 2I6QA 1GG6C 4BANB 2FESH 1GI9B 1ZTKA 2QV1A 3TK6A 4XBCA 3QZQA 4AOQA 2AGGX 1P10A 1VGCC 1XVMA 2VIOA 2SGFE 2VNTA 1TOCB 1FJSA 3RXVA 3OEED 2AFQB 4PROA 5FPYA 1GJCB 5C3NA 1XUGA 2PHBA 2WV5A 3PMHB 2HGTH 1O3LA 3I77A 1DWBH 4YLUA 4XFQA 3T25A 1WU1A 4SGAE 1XXDA 3A80A 2ZDAH 4YOGA 1O2PA 2GVFA 1GMCG 3A82A 3EA9A 1J9CH 1H4WA 3MMGA 1TNKA 5EG4A 1E1QD 3P92A 2WPIS 4A1XA 2BDAA 1QRWA 1O5CB 1GCDA 3EA7A 3F6UH 4ABJA 1KXDA 1GBDA 1F0TA 3SHAH 3SNAA 2XWBI 8LPRA 2JH6D 2XTTB 1Z6EA 2H2ZA 1F5KU 2FYQA 1OP2A 1EJNA 1NM6A 1YF4A 4YOIA 4K1SA 4ZKSU 3MO9A 1AQ7A 3RU4D 2SNVA 1GMCF 1MKWH 4B6FA 2H5DA 2B7DH 3RXGA 2FP7B 3S9AA 2CHAC 1NO9H 1AKSA 1MTSA 1C9TA 1TBQH 3BIUH 4WWYA 4GAWA 1BBRE 4I31A 3FP6E 1T4UH 2G5VA 1WQVH 2BX3A 3BEIB 3BSQA 5DP4A 4OM9A 2V6NA 2ZU4A 4O3UA 1NBME 3T26A 1B0FA 1TMUH 4JK6A 5J4QA 3WWFA 1O3IA 1Y3VA 3RXTA 4NFFA 5EPNA 3Q3YA 3SU0A 3ZZBA 1Y3UA 1L1GA 3VXFH 1C2FA 4Y8XA 3DD2H 3UIRA 3VB3A 1O3NA 1AGJA 2BD8A 2PV9B 4BAKB 1GI3A 5I46H 2BVSH 1OYTH 3FZZA 5EXMA 1GBJA 1LPGB 4FUCA 1N8OB 1SFIA 1WXRA 2A2XH 3LU9B 1UTOA 1D3QB 4AG1A 4WXIA 2QXHA 2ZTZA 1TAWA 1P9UA 4FOUC 1BTWA 2HLCA 4D76A 1PPFE 1VR1H 4AZ2B 1XUKA 3KQEA 1HJ8A 4YESB 4A6LA 4AFZA 1O5FH 2BHGA 4DIHH 1O5EH 2OBQA 4TYDA 4AFUA 1HFDA 1QIXB 5AHGH 3EYDA 4GPGA 1S81A 1MMJN 5HIYA 5L2YH 3F2GA 1K1MA 2YMSB 3A7YA 4UFDH 2W26A 1ELDE 5BRRE 1VITH 4LK4A 3BG4C 1GJ6A 1BIOA 7GCHF 1C5LH 1YPLH 5A8XA 4AYVB 3F1SB 3ZZ8A 3CP7A 2XOKD 1NN6A 3MI4A 4O3TA 2ZC9H 1H9HE 2P3FH 1T7CA 1WCZA 3DA9B 1O2NA 3FOAA 5DP7A 4E7RG 1Z1IA 4X6NA 2ZGHA 1O2YA 3RU4T 2BXTH 2Q6FA 3EE7A 4AYYB 1EPTC 1C1WH 1IQGA 2A5KA 1C5MD 1GCTC 3HKJB 3TJNA 3ZZ5A 7GCHG 1O3JA 1L0ZA 4JYVH 1YBWA 5GDSH 2KCOA 1OOKB 2VVVA 2TGDA 1TX6A 3MNCA 1UCYK 3GCHC 4IMZA 1S84A 4Y8YA 5IK2D 1A5IA 2HVXA 1D6RA 1XUIA 3QN7A 1W0ZU 2ZU3A 1OWKA 2PTCE 3K6ZA 1D6WA 5JBTA 1BMAA 1QA0A 1AHTH 2ANKH 2WV4A 1QR3E 1Z8IB 3SNDA 3BTHE 4ISIH 1OYQA 4IS5A 4BOHA 2BZAA 1OKXA 1MAXA 2WUCA 2PUQH 1EZUC 3SGBE 2PTNA 1C1NA 1O2QA 1Y5UT 3RC4A 1TWXB 2O8TA 1G3CA 1RIWB 1E79D 1KDQA 1C5YB 1A0JA 1ZYOA 1MKWK 2A7JA 3NCLA 3AAUA 2PKSB 6GCHG 3HPTB 2GP9B 3GY6A 3SW2B 2KAIB 5JBBS 5CMXH 2L74A 1TRNA 4LZ1H 4X2XA 4JK5A 1VCQA 4NIYA 1FAXA 1QBNA 5DP8A 2JH5D 1GCTB 1ZTJA 2A31A 3N7EA 2ZPRA 1C5VA 8GCHF 4FVBA 1ZMLA 3KGPA 1BJVA 2K8IA 1EP5A 2OK5A 3SHCH 6GCHF 3SUEA 1FONA 1HB0B 2R0LA 3G01A 2AHME 4ABGA 1LMWB 1EATA 1IQIA 1E38B 1LQEA 1G37A 1PQ5A 2EEKA 4X1PU 1EQ9A 1UK4A 2XNIA 1J14A 3GYLB 5H4IB 1P3CA 4Q7YA 1LHCH 1YYY1 4Y10E 4A1TA 2VBCA 8KME2 8GCHG 5GWZA 2JDID 2GZ7A 1BZXE 4FUHA 1QL8A 4Y6DA 4AFSA 1EX3A 1TGTA 1TYNA 2WZQA 1V2MT 4JZDH 2VWOA 1EJAA 4Y8ZA 3WWBA 4BNRA 4YO9A 2Z7FE 3GY3A 4ZKOU 2FXRA 2BB4A 1JRSA 3STIA 1RFNA 2NU3E 3SU3A 2BVRH 2PKSC 3TIUA 1Q31A 2GZ8A 3GY7A 2GCHF 3DSOA 1YLCA 1YM0A 1E36B 3EE0B 1QNJA 2OINA 5ESBA 1O3PB 1HAXB 1GVLA 1C1RA 3ODFA 1SKYE 2KZ4A 4KGAA 1CGJE 5A2MH 1MABB 3ZZ3A 1W0KD 1O2RA 1LTOA 1AVXA 1P12E 3RMNH 2ZQ1A 5A0AE 1SGNE 1C5NH 1O30A 1ZRBA 3MYWA 3FP8E 1NFWA 2FTMA 1C2EA 1JOUB 1FUJA 1OWHA 4GHTA 2Z9GA 5C1XA 1SR5C 2FIRH 2GV7A 4CRFA 1TX8A 1YLDA 5CHBA 1HV7A 2TGTA 2ZECA 3MNBA 3QTOH 1NU7B 3UWIA 4E7NA 1PPBH 4B2AA 4GLYA 1YY3A 5DJ7A 1EUFA 1P3EA 3ITIA 1Z8GA 4XD7D 1W8BH 1GHVH 1K1LA 1J17T 2V3MA 1QB9A 3MO3A 5E0JA 3RC6A 4CRDA 3SQEE 1BB0B 1W14U 3AAVA 3F0OA 2QAAA 3OY6U 2LNCA 3QTVH 1AE8H 3RXBA 3ZZDA 1BTXA 1V2LT 2XNDD 2FI3E 1O5AB 2I6SA 2R2WU 1B7XB 2Z6BD 2FOFA 2FOCA 4IN1A 6CHAC 1A2CH 1EZXC 1GI7B 1MUEB 3WW7A 1TGBA 2WPKS 1GJ4H 3M36A 2NU4E 1ZMJA 3H5CB 2RA0A 5E0HA 4O9VA 1DT2A 2PR3A 2WPMS 1YCPK 3BG4B 1O2SA 5E0GA 4NG9H 4FU7A 5LPEA 3BTGE 4ZHLU 3NUMA 3OTPA 4UD9H 3EQ0H 2BDCA 7KMEH 1QURH 3HATH 2W5EA 1IQEA 3LOXA 5HIZA 3RMOH 2ZFSA 2AGEX 3LGVA 5FCRA 5DSFA 2ZDLA 1K22H 2F9OA 1UHBB 2XRCA 1K0HA 1PQAA 1PPZA 2Y80A 1AMHA 3TGKE 3UREA 1D3TB 1HXFH 5DP9A 3GY4A 1TGCA 1EZQA 4KP0A 1W11U 1DSUA 2OD3B 1W12U 2KCPA 4UEHH 2CV3A 2L6OA 1X7AC 3K6YA 3RXAA 1PQ7A 4BTIB 1P2OA 3L3TA 2AMDA 3PRDA 1P8VC 1QB1A 1UW7A 1AKSB 3SV2H 4XDEA 5FBEA 4D7FA 2CHAB 2AYWA 1PYTC 3U1JB 1H1BA 4BAMB 5JDUB 3QGJA 3DHKH 4KTSA 3D23A 5FXLA 1C2HA 1SVPA 3LGYA 3RXLA 1KMHB 2BDYA 3LPRA 3U8TH 4TY7A 2BD4A 3PV4A 1ZHMA 1GMHF 1FNIA 4TWYA 3P8OA 2K1QA 4TPIZ 1RTLA 4ABHA 2BD7A 3DFJA 1YPGH 3SI3H 1VCPA 4MG3A 3F9FA 2BTCE 2P94A 2RDEA 1AZ8A 2H6MA 1QQUA 1VCWA 4ZKNU 4YT7H 5JYIA 3ZIAD 4MVNA 1BTUA 1GMHG 1OWEA 4XE4A 1FY5A 3VGCC 4DJZB 4UDWH 4MLFB 3SNBA 4Y11E 1DY9A 4WH8A 1YCPM 2QY0B 3MU8A 1HIAA 3JZ2B 1TOMH 3TLOA 3SNCA 3BEUA 1D3DB 1DE7H 5I25A 2ZDVH 4UFEH 3Q3XA 3QO6A 1DY8A 4WMFA 3D62A 4MPWA 1UK3A 1ZHRA 1SHHB 2GMTB 1A5HA 1ARCA 2G8TA 2TRMA 2J98A 5EQQA 4OS4A 2ZU1A 1CT2E 2F83A 3AW1A 4M9FA 2FS9A 2XYAA 1ABIH 4BXSA 2QXGA 1Y3YA 1K1OA 3B23B 3KIDU 3DSPA 2A4QA 1GHXH 2IJOB 2FOAA 4DT7B 1ELGA 1WUNH 4IMQA 3MTYA 3LH3A 2D26C 2ZFRH 2ZTXA 3RM2H 5DK1A 2P16A 1OWDA 1D4PB 1GBIA 1WYKA 1YCPH 4FUJA 5L30H 1O3EA 5AFYH 3WY8A 2Y5GA 2RCEA 4AFQA 4ZH8A 4BAQB 1SG8B 2ZZUH 4INKA 2VU8E 4TPYA 1T32A 1THRH 1MCVA 1CA8B 1IQMA 2IPQX 2PSXA 3HKIB 1ANDA 2FOBA 1F2SE 3RMMH 1HAYB 3BEFB 1BCUH 4K2YA 4B75A 2OXSA 9ESTA 2BY5X 4YT6H 2EC9H 3E0PB 1HAVB 1OP0A 2ODPA 3SV7A 3ZZ7A 1V2ST 3PO1C 4X8VH 5EJ1A 2WPDD 1NT1A 3RXSA 3KYFA 2HVYB 1OP8A 5DP3A 1L4ZA 1QQ4A 2F43B 4A92A 1NRPH 1QFKH 4B2BA 1ANCA 1K21H 3GCHB 2ZP0H 4B74A 3SOSA 4DY7B 1YPKH 4AN7A 1GBCA 1TA2A 2XC5A 3OEHD 2OTVA 4UFGH 4ZHAA 5C94A 3DFLA 4A5TS 1BHXF 2QXIA 3PMAB 1LO6A 2GV6A 4KTUA 1CT4E 4MNWA 1S85A 1V2NT 1ANEA 5E2OA 3UNRA 3P95A 2NU0E 1V2UT 3W1EA 1ELFA 4I8GA 1P11E 3F9EA 2TBSA 1IQJA 2CJIA 3FKSD 2GX4A 1O2OA 3RXRA 2Y7ZA 1ZOMA 1OS8A 2BD9A 1DXPA 1IQHA 1C1VH 1GL1A 1V2OT 3OY5U 5FL7D 3T5FH 1BMFD 3M5NA 2J94A 2FX6A 1FZZA 3CENA 3RXOA 2GCTB 1O32A 1THPB 5EW2H 1RTKA 3SNEA 1DLEA 1LVOA 1JBUH 1WOFA 3OX7U 1UJ1A 3URCA 1O3DA 2ASUB 1XM1A 3NXPA 4BTTB 3GDSA 2W7SA 2A2QH 3CS7A 5EOKA 3SUDA 3MWIU 1RTFB 3HGNA 1N6YA 2ALPA 2SNWA 3CS0A 3E6PH 4RKJB 1GJDB 1QJ1B 5B6OA 3BIVH 1C5TA 2WV9A 2ZI2H 3MHWU 4FUGA 5TCAA 1TPSA 1TNHA 5FCKA 3ATLA 1TPOA 3U1IB 4ZUHA 4CRAA 1ELAA 5GCHG 1A0HB 1RIWC 1SMFE 2UUJB 2Z9JA 1BMNH 1P02A 3FFGA 1ESBA 2HWLB 2AS9A 3UOUA 4GVUA 5DPAA 2H9HA 1XKAC 1NESE 1O2MA 2F4LA 1S6HA 1PPCE 2ANMH 4LZ4B 5C17A 4MQAA 1XMNB 1AVWA 1BTHH 3T62A 1DITH 1GI0A 1CBWB 2FMJA 1XUHA 3TJUA 1JXPA 2CK3D 3FVFB 3TNSA 2OQUA 2O8LA 2ZHQH 3SI4H 1WTGH 4OS2A 3SZNA 2ZGBH 1LVMA 1SGYE 5E2PA 3RXHA 1ESAA 3BF6H 3ZV9A 2XCNA 3F9GA 1C1TA 3SJ8A 5ETXA 1F7ZA 5FX5A 3SU6A 3Q00A 4H6SB 1MAYA 1JMOH 3U8RH 4CR5A 4X6PA 1E1RD 2OC1A 3TK9A 2ZF0H 4RT1A 1ELBA 2FLRH 1DWCH 2ZQ2A 1GDQA 6LPRA 2FODA 3V12A 1TBZH 3A7XA 3R0FA 1DLKB 2AGIX 4NGAH 3S9CA 3E1XB 3UTUH 1SOZA 5CE1A 4B73A 2J98B 5EU8A 5IDKA 2GCHG 1DVAH 1WV7H 2BX4A 5E8EH 1C4V2 4F4OC 4DOQA 4ACBA 3PV5A 1L4DA 1ZMNA 5G4BA 3ATWA 1QB6A 3PRBA 2ZGXH 1TMTH 2QIQA 3DUXH 1CHOG 4AGKA 2UWOA 3HK6B 5KGOA 1NTPA 1GI1A 3CNRA 1G3BA 4A7IB 1W2KH 3MOCA 4FUDA 7ESTE 1FPHH 1JWTA 1W0JD 1TB6H 2KM0A 3E91A 5FAHA 5C1YA 1SGIB 1GI8B 3LDXH 4NZLA 1AN1E 1ZGVA 2GTBA 1O2ZA 1ETTH 2FDAA 1MBMA 4X1RU 1PPHE 3VEQB 1CHOF 1EAIA 3GCOA 3IG6B 4NA8A 1C2IA 5FX6A 2G4TA 1YPHC 4O03A 3E16B 1C5XB 1QJ7B 3UR6A 5F53A 1HXEH 1C1MA 2Z9IA 4ZHMU 2ODQA 1COWD 4AX9H 3MNXA 2BXUH 1HIAB 2IOTA 3GS9A 1W7XH 1BITA 1YPMH 2PGBB 3LGIA 3RU4E 1YP9A 4WY3A 4RKOB 3M3SA 1Z1JA 4X8SH 2BY7X 1K28D 3N7OA 5EPYA 3AK5A 3T27A 2P8OB 4NSYA 4H4FA 4XBBA 1EFRD 2ANWA 2KAIA 3ELAH 2JETB 1EOJA 4F55A 1NS3A 1OHHD 1ZRKA 3F2FA 3QK1A 4ZKRU 3K65B 1ZSLA 1LCYA 1P09A 3UOPA 1H8IH 5LPRA 1EKBB 1TRYA 3V0XA 1NRQH 1FY3A 1SGEE 3A7VA 2V3OH 3A84A 1BRUP 1RGQA 2XBWA 5HMAA 3DSGA 5L2ZH 1V2TT 1F5RA 2ZFTA 2EY4C 2NU2E 4ZXXH 1NRRH 1HRTH 1KXFA 3LJOA 2J4IA 3MH4A 2BLOA 1O2IA 1J8AA 4X2WA 2HOBA 2HPPH 3VB7A 1PFXC 4TSFD 1FIZA 1Z6JH 1GJ9B 3PWCA 2BM2A 3TH3H 4IBLH 1A3EH 2ULLA 2V0BA 1MTVA 1ZR0A 3BTDE 2LPRA 1KLTA 3SU1A 6ESTA 2FWWA 4MDSA 2QGRA 4B76A 1P05A 2Y6TA 1ABJH 4WF8A 1AFEH 1C5OH 2GJGA 4Z6AH 2VJ1A 5EW1H 2G4UA 1C2LA 1ZTLA 1TNIA 4FU9A 1O2UA 5TCCA 1UVTH 4DW2U 2FOEA 2ZFFH 2CF8H 3ZVDA 4OS7A 4FVDA 3BG8A 4FUBA 4GCHF 5FPSA 4E06H 1GGDC 1FQ3A 3A8AA 4AC9A 1V2WT 1TX7A 2GKVE 5CHAC 3VB5A 3BV9B 1MTWA 3MH6A 1HGTH 5HXFA 2BOHB 4NIXA 1Q3XA 3O8RA 3MU5A 4NSVA 3V3MA 1O5GH 1LHDH 2DUCA 1SGPE 4X6OA 3IWMA 5DKMA 3UPEA 1HAOH 3QWCH 1UTPA 3M5MA 1S0RA 2ZCHP 3MNSA 3E3TA 3ZVCA 1DFPA 1IOEA 1E35B 1NFYA 4ABDA 2Z3EA 1CA0B 1F92A 3U98H 1HPGA 1Y3WA 4UONA 2K0QA 1OSSA 2BDGA 2F3CE 1ZJKA 4I86A 1QCPA 1UTMA 3RMLH 5LGOA 1BTPA 3H7TA 4UE7H 4OS1A 4U01A 1G3DA 3ZVBA 3RM0H 1H8DH 1SGRE 3M37A 1XKBC 4U2WA 4X8UH 5C2ZA 2H9TH 3F68H 1KXAA 2P95A 2GMTC 5F03A 4NWKA 1GHZA 3SU2A 4Q4LA 5C1UA 2GZ9A 3S69A 2KCYA 5LH8A 3UNQA 1N8OC 3RUOA 1T8MA 2ESTE 4J2YB 4H42U 2YNBA 1QBVH 2J97A 2G51A 3NRLA 1P01A 3U69H 4JZFH 1HJAC 2BY6X 1T4VH 5DP6A 2VH6A 4X2VA 1SHYA 1C1UH 1L2EA 2UUYA 3RC5A 2ZDNA 1A1RA 1GI4A 1SGDE 5GJ4B 3OU0A 1UHBA 5HKKD 1P9SA 3MU4A 2PSYA 3VXEH 2NWNA 1LHEH 1G36A 1CSOE 4YLQH 2R3UA 1MU6B 1G2LA 1YPHE 3SO3A 3BTWE 1ELTA 1Y3XA 3FZDA 4I8JA 2OBOA 1K1PA 3Q77A 1SLUB 1W7GH 3SU5A 3ZVEA 4CH2B 2FI5E 3IITA 1AO5A 3A85A 4OS5A 5A09A 4THNH 3LC5A 1BMMH 1GBEA 2OC0A 2W7UA 5A0CA 1CGHA 4JZIA 1RRKA 2STAE 2KX4A 4DGJA 1P2JA 1BJUA 4X2YA 1O2VA 3F2HA 5AVDA 1KLIH 2PUXB 3W94A 4CR9A 1WBGB 3C27B 2V35A 2M2AA 3KQ5A 3SJIA 1PPEE 1VJAU 1GBLA 1GDNA 1BA8B 2XBVA 3A8BA 3B9FH 1GHWH 3A87A 1C5PA 1UK2A 5JPMH 5C20A 2BY9X 5FPTA 1MQ5A 3KQBA 5KECA 1O2GH 2TGAA 4DIIH 1KTTB 2BDIA 1LPZB 4NFEA 1C9PA 1V3XA 1AFQB 1F0RA 4WJG2 1O0DH 5A0BA 1ANBA 2O8WA 2ZCLP 1NRNH 1RD3B 1SQTA 3MU0A 1FY4A 1ZPZA 1BTYA 5T6GA 2OC8A 1DWDH 4ABIA 1DANH 1CT0E 1W13U 3KYGA 4K69A 5T6FA 5GNDA 1AUTC 1EP6A 4WVPE 2Y81A 3TGJE 1ETSH 1WAYB 5JB8S 3PMBB 1GHBF 1KXCA 3SU4A 5CHAB 2A7HA 1K1NA 5FBIA 5K0HA 1EPTB 4DG4A 1ELCA 1P2NA 4KTCA 5SGAE 3C1KA 2VH0A 4YOJA 3Q3KA 2C3SA 2SGAA 3SGQE 2VVUA 2EI8A 1QTFA 1Y8TA 4Y71A 4B1TA 5DP5A 2BD5A 1TNGA 2CN0H 3OTJE 2C8ZB 1AU8A 1SGQE 1ZGIA 1NU9A 4CBNA 1MQ6A 1ETRH 3S7HB 1SOTA 2C8YB 3QGNB 1CA0C 1E0FD 1C5UA 1O38A 5EQRA 3V7TA 3T28A 4X1SU 2JH0D 3PB1E 1D9IA 1LPKB 3KF2A 3H09A 4X1NU 3N99A 5GCHF 2A5IA 1XX9A 2D2DA 5GIBA 4NA7A 1P57B 2HALA 3ZVFA 3FN8A 4U32A 1ORFA 1HJ9A 1AB9B 1O3OA 3VB4A 1E37B 2RDLA 1C4Y2 1GJBB 2PKAA 1G2MA 2THFB 2ZU5A 2SGPE 1SLWB 4X1QU 7LPRA 4FETA 2FOMB 1GGDB 4CREA 3KNXA 4TT3D 4JZ1A 1G32B 1O2WA 3ZVGA 1AIXH 1HAHH 2WPHS 2WHXA 1DOJA 4FUEA 1C1SA 1G9IE 1TLDA 3EAJA 2KR7A 2XW9A 1SI5H 3BTQE 2ANYA 4DVAU 4ASHA 3O8CA 2XXLA 1MTNB 4GSOA 2W6ID 4U30A 3RXFA 1CHGA 1NY22 4ABBA 3VGCB 3P8FA 1SBWA 2NU1E 3U28C 1AY6H 4OGYA 1GBAA 2QF5A 1GL0E 1O2LA 3GOVB 1AFQC 3GICB 4WMEA 1HLTH 3OAAD 3RXUA 3STJA 3VPKA 2F9NA 1ZZZA 4A1VA 2VWLA 2FI4E 5DG6A 1G3EA 3A7TA 3SORA 5EXNA 1VJ9U 2R2MB 3TITA 2CF9H 1VITG 3TK5A 2BLVA 3MH5A 4DT4A 2Q6DA 1QGFA 5HYOA 2F91A 3U9AH 4GUXA 2QC2A 2AERH 3R3GB 2GT7A 3LGUA 4VGCB 4J1YA 1M9UA 1W10U 2VWNA 1C4U2 2ZGJA 3NK8A 2RFKC 4Y0ZE 3GDVA 1P0SH 2A0QB 1IQNA 3FAOA 1TQ7B 3GY2A 1FDPA 1TNJA 1RJXB 3SUGA 1QA7A 4KELA 3KL6A 5ESTE 1EOLA 1GMDG 2F9UA 3QUMP 4HTCH 1DX5M 1TALA 3T29A 2M5TA 1ACBE 2JJ2D 2Z9KA 1GJ8B 2WYGA 3S9BA 4I33A 2O9QA 1GI2A 2ZEBA 5KEDA 5C0UA 4DURA 1TABE 1AD8H 2Z94A 4IGDA 1C5ZB 1FPCH 1ZHPA 4K8YA 2IJD1 1OWIA 3PYHA 1HCGA 1SQAA 1GMDF 3ATIA 3LONA 4P02A 4K1EA 1SC8U 1LHGH 4Q2KA 1YLNA 1TRMA 1GBKA 1DS2E 3LKWA 3EDXB 3GCNA 2D1JA 2QCYA 3TVJB 1OWJA 1WDIA 4GHQA 1LQDB 1XVOA 4D7GA 5ABWA 3ZZ9A 2BDHA 1O3AA 1GJ5H 1SSXA 1GI6A 3ATMA 4ABAA 4D9RA 3KQDA 5EJLA 2P8OC 4CRBA 4HGCA 3RLYH 4I32A 3UQVA 2QYIA 3AASA 3ZV8A 1A0LA 3JZ1B 4Y0YE 1Z7KA 1MCTA 1TGSZ 1B5GH 3BTKE 1Y5BT 3M61U 5LPFA 3UNSA 2H1UA 2STBE 2J92A 5GXPA 1BUIA 4R0IA 4YXWD 2GGVB 4BTUB 2AEIH 3P17H 4LXBH 3LIWA 2BDBA 3S0NA 1HNEE 4JZEH 2H5CA 2XBXA 2HLDD 1UVOA 2ALVA 2ZFQH 3M5OA 4O97A 1MZAA 4ACAA 1QL7A 4IW4E 3PM3A 2ZU2A 3TJVA 1TGNA 1HYLA 1Y59T 5JBAS 1TONA 1TA6A 3KCGH 1XUFA 5F8ZA 1KY9A 2Q1JA 2F9BH 4CRCA 2HNTE 1Z8RA 1BMLA 5A8ZA 2VGCC 1GHYH 5EJZA 5EQSA 1HBTH 4I7YH 4BXWA 2LELA 5EODA 2ZA5A 1E34B 4JCNA 1TPPA 3V13A 1GG6B 1K1JA 1EASA 4CHAC 1HAGE 1RS0A 3KHVA 1ELEE 3A89A 2XC4A 1JRTA 2Y82A 1WQSA 2JJ1D 2Q6GA 2BYAX 3FANA 3BTME 1MZDA 1Y5AT 1XXFA 3M7UA 2SGDE 1GJAB 3ODDA 4GCHG 4NZQA 5IYTA 2PW8H 2IN2A 1P2QA 1MTUA 3AW0A 1A3BH 2QF0A 2TIOA 3PLPA 2IPHA 1UTKA 2VINA 2W3KA 2Z9LA 1HAIH 2FS8A 1A7SA 1EAXA 4TY6A 4WMDA 1KYNA 1C5RA 2D8WA 1O3MA 1UVUH 1SQRA 2ZNKH 1CBWC 2PLXA 4HFPB 3SV8A 1S0QA 4ZAEA 1P2IA 1V2KT 3E90B 1O39A 3LJJA 1XUJA 1FX0B 3NZIA 5C67A 1C2JA 2ZDKA 1V2PT 2RG3A 1IQKA 1V6DA 3S7KB 1THSH 1O31A 3QZRA 1FY1A 1EPTA 4AB9A 1U6QA 1QRXA 2XBYA 2C8WB 4FXGH 2JKHA 1SQOA 5PTPA 2VIWA 2G52A 4IC6A 2BOKA 2W3IA 2B0FA 2WINI 3W95A 1MKXH 3PWBA 3L33A 3BTTE 1GDUA 4MNXA 3RXIA 2FX4A 1K9OE 1O3GA 3MFJA 9LPRA 1EB2A 3OFND 1TMBH 2UWPA 2OQ5A 3L6PA 3PTBA 3M7TA 2GDEH 1LKBA 1C2KA 1YWUA 1YPJH 3RXQA 1ZPCA 3A7WA 2ZO3H 4RI0A 1LKAA 3ZYDA 4M7GA 2HNTF 1ID5H 1PJPA 3PTNA 4VGCC 3SZEA 1TFXA 1T8LA 3ZVAA 2J38A 2AMPA 1MD8A 1GJ7B 2WPLS 2QA9E 1CO7E 1HJAB 3LH1A 2F9PA 2PWXA 2H9EH 3T2NA 1GWAA 2R3YA 1YC0A 5T3HA 1H8HD 3H7OA 1A61H 4B71A 3F9HA 2CXVA 2OP9A 2BQ6B 1KTSB 3MO6A 1P06A 2G5NA 1QBOA 2BVXH 1TIOA 1FI8A 3TJOA 2VIDA 3RP2A 2XCFA 2SGEE 2ZIQH 4JYUH 2BQ7B 2R9PA 3MU1A 3UUZA 3NPSA 1HAZB 2FOHA 1PPGE 1VGCB 2ZWLH 4NWLA 1O2KA 2FLBH 1O3BA 5A8YA 1QY6A 3M5LA 1EJMA 1ELVA 2VB0A 2A45B 3BTEE 1S82A 2A7CA 1ARBA 1SB1H 5HGGA 3A88A 3M3TA 5T1VA 2A5AA 2CMYA 1DUEA 1O5DH 3TU7H 1P03A 3SV6A 1N6XA 2HPQH 1A5GH 1O2XA 2B8OH 1FY8E 1AI8H 2OUAA 4KKDA 4F48B 1D3PB 2FTLE 1DXWA 3NWUA 1YKTA 2P3UB 5L6NH 4E05H 3LC3A 2BMGB 4AG2A 3VG8A 5TJXA 4K1TA 5AF9H 3SJKA 4AGJA 5K7RA 2WUBA 4TWWA 2J5UA 1QRZA 2JETC 3SJ9A 3K2UA 3ZZ6A 5J4SA 5DN6D 1MBQA 1FMGA 3SUFA 3TGIE 1INCA 1PYTD 2FO9A 2P93A 4X8TH 2ZPQA 1GI5A 1LHFH 2Y5FA 2DE8A 3UFAA 1GVKB 4ZCNA 1S5SA 3UQOA 5BPEA 1UVPA 1WTHD 4ZMAH 1P2MA 3UR9A 1AVGH 4XSKU 3OYPA 5C0TA 1BT7A 4RT0A 5T6DA 1O2TA 1PQ8A 3GY5A 4ESTE 1MKXK 1GHBG 2ZCKP 1C1PA 2QN5T 4OGXA 4I8LA 4XRNA 4MNVA 4MPVA 1V2RT 1C2MA 3A81A 1Q2WA 1JIMA 1Z71A 1UTQA 5DO4H 2YMSD 3ZZCA 3U8OH 2EQNA 4CBOA 1CE5A 5DGJA 4NCYA 5FHTA 1MD7A 3DT0H 4K3JA 1S83A 1BBRK 2GT8A 1JIRA 1MTNC 4CRGA 4UFFH 1H9IE 3UWJH 3ENSB 2ZFPH 2AMQA 1QJ6B 1T8NA 2SFAA 3RXKA 2ILNA 5HM9A 3RLWH 2G81E 4Z1MD 1AUJA 4Y76A 3I29A 1KIGH 1O34A 1FN8A 3QX5H 1O3CA 3A8CA 1SLXB 1TNLA 1HDTH 3EGKH 4X0WU 4DCDA 3RXJA 1UVSH 2Z3DA 4YTAA 1KSNA 1O35A 5JB9S 1EAUA 2BLWA 3TH4H 1FLEE 1UTNA 1GPZA 3RXEA 1C5WB 1SGFG 2A4RA 2P3TB 3N7DA 3P6ZB 1UO6A 1GBFA 4YM9A 4MPXA 5B6LA 3F3BA 1NPMA 1A46H 1NC6A 2BD2A 3E8LA 4SGBE 1GBTA 4QT8C 4Q63A 3D49H 1QZ8A 3O8BA 6CHAB 1F5LA 2VIQA 4IC5A 1O3HA 2R0KA 5GPIB 1V2QT 4AB8A 1O2JA 3PMJA 1HAVA 2W6JD 2VWMA 1SFQB 4NIWA 2PFEA 4MTBA 3GDUA 1GBHA 2G55A 3A86A 3MH7A 1CGIE 3E0NB 2ZG0H 3GY8A 2GD4B 4Q7XA 2A1DB 1QHRB 2A4GA 2BZ6H 2ZHEH 1ZSKA
chains in the Genus database with same CATH topology
2DE9A 1VITF 3ATKA 1GHAF 2AIPA 3LGTA 3KQCA 1BDAA 3SQHE 1S6FA 4RN6A 3OSYA 1KDQB 4JMYA 3HK3B 2UUKB 3ZZAA 1TE0A 1NFUA 1O33A 3RXMA 4B2CA 1BTZA 2Y7XA 3GCTF 3Q76A 1OX1A 1AE5A 1GHAG 1EZSC 2B9LA 4BAOB 3GISB 1EAWA 4CH8B 4I8HA 3SGAE 3D65E 2FOGA 2P59A 3M7QA 4D9QA 1GBMA 4OS6A 1IHTH 3K9XB 3M3VA 3QDZB 1P04A 3SV9A 2WPJS 3SJOA 1IQLA 2EI6A 4MPUA 1O2HA 1Z8JB 1NRSH 3GCTG 3SBKA 2OLGA 1GBBA 1BRAA 4IN2A 1O3KA 1BOQA 3RXPA 4X6MA 1UTJA 1YPEH 1DM4B 1UTLM 4Q7ZA 1LDTT 2F9VA 3PLBA 4XOJA 2EA3A 1LVBA 4ISLA 4Y7BA 2FZZA 5HM2A 2XWAA 1O3FA 1V2VT 4RSPA 3AVZA 1K2I1 1NZQH 2SGQE 3P8NA 4XBDA 2A32A 4R8TB 1ZLRA 2YOLA 2FEQH 1N1LA 2ZHFH 2A4OA 2FYRA 3RDZA 5EXLA 1ZJDA 3NKKA 4Y79A 1C2DA 2G00A 1IQFA 4YZUA 3PROA 4Y7AA 4ZXYH 2RA3A 4F49A 4I8KA 4Z0KA 3BN9A 2ODYB 1QL9A 2ZPSA 2ZDMA 1SGCA 1OXGA 1DSTA 2UUFB 2QF3A 2J95A 2CGAA 4INHA 5F6MA 1SGTA 2C8XB 1L1NA 1IHSH 1F0UA 1FN6A 3FP7E 3P8GA 2HRVA 1ZSJA 2BQWB 1SLVB 3TH2H 8ESTE 1O37A 1KXEA 4ISNA 1EXFA 1SL3A 1T8OA 1EB1H 3ZYEA 1BRBE 2FM2A 4D8NA 2VIPA 2C93B 1DICA 3KN2A 2OC7A 1A4WH 3VB6A 1J16A 4NA9H 1H9LB 2AIQA 3ESTA 1C1OA 2V3HH 2TGPZ 3SN8A 2Y5HA 1LVYA 1AWHB 1F0SA 1RXPA 2YNAA 1VZQH 1AWFH 3EA8A 1SPJA 3GYMA 1C5SA 4NIVA 1BQYA 2VGCB 1UCYE 4ABFA 1W3CA 3QLPH 1V2JT 1FV9A 1OPHB 2AH4X 2GDDA 2J34A 2VVCA 4CHAB 1P2KA 2ZKSA 5JBCS 4WXVA 3RXCA 3TPIZ 2TPIZ 1C2GA 2ZGCA 2ZHDA 3BTFE 1TBRH 2QXJA 1L1JA 2OCVB 1ESTA 1K1IA 2UWLA 4INLA 4HZHA 1BHXB 3P70B 1TPAE 1CVWH 2PGQB 1NFXA 3ZZ4A 3LGWA 3RXDA 2XC0A 2Z3CA 1AB9C 1YGCH 1CQQA 5C5OA 3LT3A 1C1QA 1W0YH 1BBRH 1MH0A 1DDJA 3PLKA 1O5BB 1ZPBA 1DUAA 3VFEA 4JYTA 1HAPH 3UY9A 2VIVA 1AZZA 3A8DA 2ZTYA 1FAKH 3O8DA 1C5QA 1TQ0B 4H6TA 5C5NA 1DPOA 4FUFA 2B5TB 5F8XA 4K5ZA 1NROH 2PKAB 2J2UA 3M35A 4AORA 3B8JA 1G30B 1O36A 2EI7A 3A7ZA 2BY8X 3I78A 3URDA 1J15A 4ZROA 1B0EA 1KXBA 5F8TA 1KLJH 1UMAH 4K60A 1GVZA 5AFZH 4K8BA 4ISHH 3A83A 2WYJA 2J9NA 2BLQA 5EGMA 2C90B 4LOYH 3HGPA 1IAUA 2O8UA 4WH6A 1FIWA 1BRCE 1UCYH 1HUTH 3PO1B 4FU8A 4FUIA 4HI3A 1CU1A 2GCTC 3TNTA 1MU8B 4BAHB 4ABEA 2BD3A 1WSSH 1SGFA 4ISOA 2O8MA 2HNTC 1T31A 2C4FH 2FPZA 1DWEH 1FXYA 4MNYA 4Q80A 3KEEA 2ZHWH 2I6QA 1GG6C 4BANB 2FESH 1GI9B 1ZTKA 2QV1A 3TK6A 4XBCA 3QZQA 4AOQA 2AGGX 1P10A 1VGCC 1XVMA 2VIOA 2SGFE 2VNTA 1TOCB 1FJSA 3RXVA 2AFQB 4PROA 5FPYA 1GJCB 5C3NA 1XUGA 2PHBA 2WV5A 3PMHB 2HGTH 1O3LA 3I77A 1DWBH 4YLUA 4XFQA 3T25A 1WU1A 4SGAE 1XXDA 3A80A 2ZDAH 4YOGA 1O2PA 2GVFA 1GMCG 3A82A 3EA9A 1J9CH 1H4WA 3MMGA 1TNKA 5EG4A 3P92A 2WPIS 4A1XA 2BDAA 1QRWA 1O5CB 1GCDA 3EA7A 3F6UH 4ABJA 1KXDA 1GBDA 1F0TA 3SHAH 3SNAA 2XWBI 8LPRA 2JH6D 2XTTB 1Z6EA 2H2ZA 1F5KU 2FYQA 1OP2A 1EJNA 1NM6A 1YF4A 4YOIA 4K1SA 4ZKSU 3MO9A 1AQ7A 3RU4D 2SNVA 1GMCF 1MKWH 2H5DA 2B7DH 3RXGA 2FP7B 3S9AA 2CHAC 1NO9H 1AKSA 1MTSA 1C9TA 1TBQH 3BIUH 4WWYA 4GAWA 1BBRE 4I31A 3FP6E 1T4UH 2G5VA 1WQVH 2BX3A 3BEIB 3BSQA 5DP4A 2V6NA 2ZU4A 4O3UA 3T26A 1B0FA 1TMUH 4JK6A 5J4QA 1O3IA 1Y3VA 3RXTA 4NFFA 5EPNA 3Q3YA 3SU0A 3ZZBA 1Y3UA 1L1GA 3VXFH 1C2FA 4Y8XA 3DD2H 3UIRA 3VB3A 1O3NA 1AGJA 2BD8A 2PV9B 4BAKB 1GI3A 5I46H 2BVSH 1OYTH 3FZZA 5EXMA 1GBJA 1LPGB 4FUCA 1N8OB 1SFIA 2A2XH 3LU9B 1UTOA 1D3QB 4AG1A 4WXIA 2QXHA 2ZTZA 1TAWA 1P9UA 1BTWA 2HLCA 4D76A 1PPFE 1VR1H 4AZ2B 1XUKA 3KQEA 1HJ8A 4YESB 4A6LA 4AFZA 1O5FH 2BHGA 4DIHH 1O5EH 2OBQA 4TYDA 4AFUA 1HFDA 1QIXB 5AHGH 3EYDA 4GPGA 1S81A 1MMJN 5L2YH 1K1MA 3A7YA 4UFDH 2W26A 1ELDE 5BRRE 1VITH 4LK4A 3BG4C 1GJ6A 1BIOA 7GCHF 1C5LH 1YPLH 5A8XA 4AYVB 3F1SB 3ZZ8A 3CP7A 1NN6A 3MI4A 4O3TA 2ZC9H 1H9HE 2P3FH 1T7CA 1WCZA 3DA9B 1O2NA 5DP7A 4E7RG 1Z1IA 4X6NA 2ZGHA 1O2YA 3RU4T 2BXTH 2Q6FA 4AYYB 1EPTC 1C1WH 1IQGA 2A5KA 1C5MD 1GCTC 3HKJB 3TJNA 3ZZ5A 7GCHG 1O3JA 1L0ZA 4JYVH 1YBWA 5GDSH 1OOKB 2VVVA 2TGDA 1TX6A 3MNCA 1UCYK 3GCHC 4IMZA 1S84A 4Y8YA 1A5IA 2HVXA 1D6RA 1XUIA 3QN7A 1W0ZU 2ZU3A 1OWKA 2PTCE 3K6ZA 1D6WA 5JBTA 1BMAA 1QA0A 1AHTH 2ANKH 2WV4A 1QR3E 1Z8IB 3SNDA 3BTHE 4ISIH 1OYQA 4IS5A 4BOHA 2BZAA 1OKXA 1MAXA 2WUCA 2PUQH 1EZUC 3SGBE 2PTNA 1C1NA 1O2QA 1Y5UT 3RC4A 1TWXB 2O8TA 1G3CA 1RIWB 1KDQA 1C5YB 1A0JA 1ZYOA 1MKWK 2A7JA 3NCLA 3AAUA 2PKSB 6GCHG 3HPTB 2GP9B 3GY6A 3SW2B 2KAIB 5JBBS 5CMXH 1TRNA 4LZ1H 4X2XA 4JK5A 1VCQA 4NIYA 1FAXA 1QBNA 5DP8A 2JH5D 1GCTB 1ZTJA 2A31A 2ZPRA 1C5VA 8GCHF 4FVBA 1ZMLA 3KGPA 1BJVA 1EP5A 3SHCH 6GCHF 3SUEA 1FONA 1HB0B 2R0LA 3G01A 4ABGA 1LMWB 1EATA 1IQIA 1E38B 1LQEA 1G37A 1PQ5A 2EEKA 4X1PU 1EQ9A 1UK4A 2XNIA 1J14A 3GYLB 5H4IB 1P3CA 4Q7YA 1LHCH 1YYY1 4Y10E 4A1TA 8KME2 8GCHG 5GWZA 2GZ7A 1BZXE 4FUHA 1QL8A 4Y6DA 4AFSA 1EX3A 1TGTA 1TYNA 1V2MT 4JZDH 2VWOA 1EJAA 4Y8ZA 4BNRA 4YO9A 2Z7FE 3GY3A 4ZKOU 2FXRA 2BB4A 1JRSA 3STIA 1RFNA 2NU3E 3SU3A 2BVRH 2PKSC 3TIUA 1Q31A 2GZ8A 3GY7A 2GCHF 1YLCA 1YM0A 1E36B 3EE0B 1QNJA 2OINA 5ESBA 1O3PB 1HAXB 1GVLA 1C1RA 3ODFA 4KGAA 1CGJE 5A2MH 3ZZ3A 1O2RA 1LTOA 1AVXA 1P12E 3RMNH 2ZQ1A 5A0AE 1SGNE 1C5NH 1O30A 1ZRBA 3MYWA 3FP8E 1NFWA 2FTMA 1C2EA 1JOUB 1FUJA 1OWHA 4GHTA 2Z9GA 5C1XA 1SR5C 2FIRH 2GV7A 4CRFA 1TX8A 1YLDA 1HV7A 2TGTA 2ZECA 3MNBA 3QTOH 1NU7B 3UWIA 4E7NA 1PPBH 4B2AA 4GLYA 5DJ7A 1EUFA 1P3EA 3ITIA 1Z8GA 1W8BH 1GHVH 1K1LA 1J17T 3MO3A 1QB9A 5E0JA 3RC6A 4CRDA 3SQEE 1BB0B 1W14U 3AAVA 2QAAA 3OY6U 2LNCA 3QTVH 1AE8H 3RXBA 3ZZDA 1BTXA 1V2LT 2FI3E 1O5AB 2I6SA 2R2WU 1B7XB 2Z6BD 2FOFA 2FOCA 4IN1A 6CHAC 1A2CH 1EZXC 1GI7B 1MUEB 1TGBA 2WPKS 1GJ4H 3M36A 2NU4E 1ZMJA 3H5CB 2RA0A 5E0HA 4O9VA 1DT2A 2PR3A 2WPMS 1YCPK 3BG4B 1O2SA 5E0GA 4NG9H 4FU7A 5LPEA 3BTGE 4ZHLU 3NUMA 4UD9H 3EQ0H 2BDCA 7KMEH 1QURH 3HATH 2W5EA 1IQEA 3LOXA 3RMOH 2ZFSA 2AGEX 3LGVA 5FCRA 2ZDLA 1K22H 2F9OA 1UHBB 2XRCA 1PQAA 1PPZA 2Y80A 1AMHA 3TGKE 3UREA 1D3TB 1HXFH 5DP9A 3GY4A 1TGCA 1EZQA 4KP0A 1W11U 1DSUA 2OD3B 1W12U 4UEHH 2CV3A 3RXAA 1X7AC 3K6YA 1PQ7A 4BTIB 1P2OA 3L3TA 2AMDA 1P8VC 1QB1A 1AKSB 3SV2H 4XDEA 5FBEA 4D7FA 2CHAB 2AYWA 1PYTC 3U1JB 1H1BA 4BAMB 5JDUB 3QGJA 3DHKH 4KTSA 3D23A 5FXLA 1C2HA 1SVPA 3LGYA 3RXLA 2BDYA 3LPRA 3U8TH 4TY7A 2BD4A 3PV4A 1ZHMA 1GMHF 1FNIA 4TWYA 3P8OA 2K1QA 4TPIZ 1RTLA 4ABHA 2BD7A 3DFJA 1YPGH 3SI3H 1VCPA 4MG3A 3F9FA 2BTCE 2P94A 1AZ8A 2H6MA 1QQUA 1VCWA 4ZKNU 4YT7H 5JYIA 4MVNA 1BTUA 1GMHG 1OWEA 4XE4A 1FY5A 3VGCC 4DJZB 4UDWH 4MLFB 3SNBA 4Y11E 1DY9A 4WH8A 1YCPM 2QY0B 3MU8A 1HIAA 3JZ2B 1TOMH 3TLOA 3SNCA 3BEUA 1D3DB 1DE7H 5I25A 2ZDVH 4UFEH 3Q3XA 3QO6A 1DY8A 4WMFA 3D62A 4MPWA 1UK3A 1ZHRA 1SHHB 2GMTB 1A5HA 1ARCA 2G8TA 2TRMA 5EQQA 4OS4A 2ZU1A 1CT2E 2F83A 3AW1A 2FS9A 2XYAA 1ABIH 4BXSA 2QXGA 1Y3YA 1K1OA 3B23B 3KIDU 2A4QA 1GHXH 2IJOB 2FOAA 4DT7B 1ELGA 1WUNH 4IMQA 3MTYA 3LH3A 2D26C 2ZFRH 2ZTXA 3RM2H 5DK1A 2P16A 1OWDA 1D4PB 1GBIA 1WYKA 1YCPH 4FUJA 5L30H 1O3EA 5AFYH 3WY8A 2Y5GA 2RCEA 4AFQA 4ZH8A 4BAQB 1SG8B 2ZZUH 4INKA 2VU8E 4TPYA 1T32A 1THRH 1MCVA 1CA8B 1IQMA 2PSXA 3HKIB 1ANDA 2FOBA 1F2SE 3RMMH 1HAYB 3BEFB 1BCUH 4K2YA 4B75A 2OXSA 9ESTA 2BY5X 4YT6H 2EC9H 3E0PB 1HAVB 1OP0A 2ODPA 3SV7A 3ZZ7A 1V2ST 3PO1C 4X8VH 1NT1A 3RXSA 1OP8A 5DP3A 1L4ZA 1QQ4A 4A92A 1NRPH 1QFKH 4B2BA 1ANCA 1K21H 3GCHB 2ZP0H 4B74A 3SOSA 4DY7B 1YPKH 4AN7A 1GBCA 1TA2A 2XC5A 4UFGH 2OTVA 4ZHAA 3DFLA 4A5TS 1BHXF 2QXIA 3PMAB 1LO6A 2GV6A 4KTUA 1CT4E 4MNWA 1S85A 1V2NT 1ANEA 5E2OA 3UNRA 3P95A 2NU0E 1V2UT 1ELFA 4I8GA 1P11E 3F9EA 2TBSA 1IQJA 2CJIA 2GX4A 1O2OA 3RXRA 2Y7ZA 1ZOMA 1OS8A 2BD9A 1DXPA 1IQHA 1C1VH 1GL1A 1V2OT 3OY5U 3T5FH 3M5NA 2J94A 2FX6A 1FZZA 3CENA 3RXOA 2GCTB 1O32A 1THPB 5EW2H 1RTKA 3SNEA 1DLEA 1LVOA 1JBUH 1WOFA 3OX7U 1UJ1A 3URCA 1O3DA 2ASUB 1XM1A 3NXPA 4BTTB 3GDSA 2W7SA 2A2QH 3CS7A 5EOKA 3SUDA 3MWIU 1RTFB 3HGNA 1N6YA 2ALPA 2SNWA 3CS0A 3E6PH 4RKJB 1GJDB 1QJ1B 5B6OA 3BIVH 1C5TA 2ZI2H 3MHWU 4FUGA 5TCAA 1TPSA 1TNHA 5FCKA 3ATLA 1TPOA 3U1IB 4ZUHA 4CRAA 1ELAA 5GCHG 1A0HB 1RIWC 1SMFE 2UUJB 2Z9JA 1BMNH 1P02A 3FFGA 1ESBA 2HWLB 2AS9A 3UOUA 4GVUA 5DPAA 2H9HA 1XKAC 1NESE 1O2MA 1S6HA 1PPCE 2ANMH 4LZ4B 4MQAA 1XMNB 1AVWA 1BTHH 3T62A 1DITH 1GI0A 1CBWB 2FMJA 1XUHA 3TJUA 1JXPA 3FVFB 3TNSA 2OQUA 2O8LA 2ZHQH 3SI4H 1WTGH 4OS2A 3SZNA 2ZGBH 1LVMA 1SGYE 5E2PA 3RXHA 1ESAA 3BF6H 3ZV9A 2XCNA 3F9GA 1C1TA 3SJ8A 5ETXA 1F7ZA 5FX5A 3SU6A 3Q00A 4H6SB 1MAYA