1WQSA

Crystal structure of norovirus 3c-like protease
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
173
structure length
173
Chain Sequence
APPTLWSRVVRFGSGWGFWVSPTVFITTTHVIPTGVREFFGEPIESIAIHRAGEFTQFRFSRKVRPDLTGMVLEEGCPEGVVCSILIKRDSGELLPLAVRMGAIASMKIQGRLVHGQSGMLLTGANAKGMDLGTLPGDCGAPYVYKRNNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A norovirus protease structure provides insights into active and substrate binding site integrity
pubmed doi rcsb
source organism Chiba virus
molecule tags Hydrolase
molecule keywords 3C-like protease
total genus 32
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wqsA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wqsA01
1S0RA 2SFAA 1GVZA 1A5GH 3M7TA 3TGJE 1GJ5H 2FMJA 1ZPBA 3UOUA 3ZV9A 5L6NH 4AOQA 2PKSB 2FP7B 1O3GA 3A80A 3RXHA 1DUEA 2SGPE 5E0HA 3U1JB 1TMTH 3CP7A 4BTIB 3LH1A 2D8WA 3NUMA 1HJAB 2BX4A 2J34A 1K28D 1C4V2 2FI4E 2WUCA 3V7TA 1NZQH 1DICA 1MAYA 1HRTH 1Q2WA 2ODYB 1GMHG 5E0GA 4CRFA 3UREA 1TABE 1RIWB 2QXJA 1S85A 2O8TA 3E8LA 4X6MA 4AB8A 1FIZA 1FI8A 2PWXA 2XC5A 3A8BA 4ZMAH 2F91A 1BTXA 1P03A 2KAIB 1QA7A 4YO9A 2ZIQH 1FAXA 1EAUA 4B1TA 4I8HA 1QTFA 1BDAA 4DGJA 3LGVA 1O3KA 1O2YA 1FDPA 3M3SA 5FXLA 3BTQE 1INCA 3PMBB 1PPFE 2AIQA 2GP9B 4UDWH 4THNH 5A0BA 5J4QA 1HXFH 5L2ZH 3QLPH 3A81A 1JRTA 1O5EH 4AGJA 3RLYH 1TNGA 2C8YB 3RXSA 1H9IE 3M3TA 1CGJE 3EA7A 4TY7A 3S0NA 1C5LH 1N1LA 1EX3A 2GMTB 2A4RA 1AVGH 3ZV8A 3MNXA 5FX5A 7ESTE 2W5EA 1SHYA 2FYRA 3GY6A 1A3BH 1C1NA 1PPHE 3RC4A 1YLDA 5T6FA 2JETB 1PYTD 3O8RA 4JZFH 2ZDKA 2OP9A 2FX4A 3F9GA 2ZFPH 1UO6A 2ZO3H 2WV4A 1V2NT 2G4TA 4J2YB 3L3TA 1EASA 1IQIA 1ARBA 2A1DB 4MPVA 3GDVA 4AFZA 2P94A 4CH2B 1A3EH 3SBKA 2BLVA 3K6ZA 1UCYK 2FLBH 3ZZAA 1O3FA 1GJDB 4CBOA 1RFNA 2FEQH 2ZU1A 3NXPA 4INLA 2XXLA 1O2PA 2BTCE 2JH0D 1O3OA 1ID5H 1B0FA 1ELDE 3MU4A 1O3EA 1WQSA 2C4FH 2BOHB 1B5GH 1YPEH 5GJ4B 2BZAA 1QCPA 1TNJA 3U8TH 1J8AA 1PPGE 1LHGH 3PROA 2FZZA 1H4WA 3ATLA 1FY4A 5JBCS 4TPIZ 1WQVH 1O3NA 1Z6JH 2FOEA 5AF9H 1DXPA 5FHTA 4AZ2B 1KDQB 3RXFA 1HAZB 3EYDA 2BD9A 4ZHMU 4LZ4B 1LVOA 1T32A 3ZVEA 2FODA 1J9CH 2W3IA 4Y76A 3RXDA 3ZVFA 2VGCB 3TU7H 3UNQA 1LCYA 1TMUH 1ZSJA 1ZMLA 4BXWA 3LH3A 1HYLA 1GHWH 2O8MA 3HK3B 1IQGA 2J38A 3TJOA 3SNEA 1BCUH 3STJA 1BHXF 3V13A 1W14U 1UVPA 1VGCC 1Z1IA 4D7FA 1JXPA 3ZZBA 4WXIA 3TITA 1RD3B 2YNAA 1F7ZA 4D9QA 1D3TB 1YPHC 2PKSC 1ZYOA 4IGDA 1DSTA 1MZDA 5DP5A 4ZHAA 3ZVAA 3LGUA 2PHBA 4TYDA 4Y8XA 1V2PT 1K1IA 4E06H 4UFFH 1CQQA 2G51A 2Z7FE 5A8YA 4K8YA 5C3NA 3SGAE 1TNLA 4ZAEA 5C5NA 2NU3E 1ZRBA 2WPJS 5E8EH 2OXSA 2WYJA 3BEFB 1HJ9A 1CT0E 4MPUA 1GJ8B 4I8JA 2B9LA 2ZFSA 4D7GA 1TBZH 3GCHB 1RIWC 1D4PB 4MG3A 9ESTA 1IQLA 1TRNA 4X6OA 2V3OH 3TGKE 1TGSZ 5HM2A 1F5KU 4J1YA 3TK5A 1IAUA 2BD8A 5TCCA 1VITF 1H9LB 4B2AA 2CF8H 1IQFA 2HALA 1WU1A 5GXPA 3SV6A 1MUEB 1NT1A 2PTCE 3A87A 5LPEA 3SHCH 2A31A 2F9UA 1V2ST 1CT2E 1KTSB 2ODQA 4BOHA 4AN7A 1QJ6B 4X6PA 3UQOA 3RUOA 1C5PA 1RTFB 4NIWA 2CGAA 3SOSA 1K9OE 2CHAC 1HGTH 3GDSA 1CGIE 8ESTE 4DOQA 1P12E 3K2UA 1BOQA 4Q7ZA 4FVDA 5FCRA 3TH2H 1VJ9U 1L2EA 3PMHB 3BG4B 1GHBG 1HJAC 4GCHG 1C2LA 1BB0B 2AMQA 4ISOA 2F9OA 4XDEA 3GCOA 2QCYA 2ZNKH 3PLPA 2SGDE 1NESE 2CF9H 3DA9B 3PV4A 3MH7A 3O8DA 3VB5A 1F0TA 3LC5A 4BAMB 1O35A 2FPZA 2BLQA 1NU9A 1G36A 3E0PB 1GG6C 1PQ8A 4X2VA 2STAE 2OC8A 4MNXA 2H5CA 2UWLA 1J16A 2Z9JA 3CENA 4X8SH 1Y3YA 1ABIH 4Y0ZE 4B74A 2ZU2A 3EAJA 4A7IB 1PQAA 1AU8A 2AERH 1J14A 2QIQA 4GHQA 2C90B 2P3FH 1ORFA 2QC2A 1EOLA 2H9TH 2C8ZB 1QRZA 4K69A 1C5ZB 2WPMS 3U1IB 3KGPA 1P11E 2Y6TA 3SV7A 3LGTA 1G3BA 1NS3A 1P2OA 3AVZA 2A4OA 1HAPH 1VITH 4YZUA 1GJBB 4INHA 2UUYA 4GVUA 4K2YA 3B9FH 1GVLA 4QT8C 1XX9A 3HKIB 4ZKSU 2VVVA 1AN1E 1E35B 1TBQH 2A5IA 1ELBA 2G81E 2THFB 1YF4A 3ZVGA 4A6LA 4DVAU 2RA0A 4OS1A 4OS7A 5DP8A 1JMOH 4FUJA 1HNEE 4X1SU 1C5OH 1KXFA 1P2QA 1D3QB 1ZR0A 2FWWA 1HV7A 1S81A 1ESTA 1IHSH 2ZG0H 2IN2A 2ZA5A 2J9NA 3EA9A 1O5DH 1HJ8A 2ZGXH 2FI3E 4ABGA 2ZDLA 1TAWA 3LGWA 2BDBA 1O2VA 1FXYA 1DWEH 4GPGA 1GMCF 3U9AH 1TRYA 1O30A 4NIYA 1BTZA 3QWCH 1EXFA 4B73A 2P93A 1MD7A 3TNTA 2PV9B 1NRSH 3Q00A 4FUCA 1F5RA 3V12A 3OTJE 1D6WA 2FS9A 4I8GA 3MH4A 1XUGA 4FUDA 5EQSA 1BTPA 4CH8B 5I25A 2ZU5A 4IS5A 2GT7A 3PMJA 2FESH 2VIDA 1LVBA 2Z9IA 3W94A 1O2XA 1X7AC 4XBCA 4NWKA 1GI8B 1HAVA 2GTBA 3UIRA 1LHFH 2FI5E 5HXFA 1TBRH 3SN8A 1W7GH 2HLCA 2OC1A 1EOJA 1EJAA 1XUJA 2OBQA 3SUFA 1V2OT 2EA3A 1OWEA 3STIA 1W3CA 3RXPA 1VGCB 1QB1A 3RXEA 1P3CA 4CR5A 2ZDVH 2ZCHP 1GHAF 3FAOA 2BOKA 2KAIA 1MTVA 2R9PA 3GY3A 3VB4A 8GCHG 1SLXB 1C4U2 2ZF0H 3KQBA 2PSYA 2QF3A 3NKKA 4ZROA 1ELCA 3BEIB 1UK4A 1IQEA 1MKXK 1P2MA 3KCGH 1AKSB 1AB9C 1P9SA 1OYQA 2J95A 2W3KA 4X8TH 1O2IA 3RXAA 1FY1A 4MVNA 3BTFE 4BAOB 3SGBE 2ZFTA 1E36B 3H7TA 5DP6A 1O2OA 4DY7B 3PWBA 1SGNE 3KQDA 1HXEH 4WY3A 2ZHEH 2QV1A 1BTWA 1TQ7B 2BY5X 1WOFA 1KTTB 1P01A 3OSYA 4NG9H 2Z3DA 1ZRKA 4Q7YA 4CREA 3E3TA 3LONA 1GI1A 3HGPA 2CHAB 2G5NA 3ZZ8A 3BIVH 3SV8A 4IW4E 1Y3WA 1Z7KA 1O5GH 2XBYA 2VNTA 1TIOA 4WXVA 3U8RH 1F2SE 1P2IA 4A92A 4OGYA 3FZZA 1BJUA 3SV9A 4ISLA 2TIOA 2VH0A 4OS4A 5DP3A 1VZQH 1KXDA 3SNCA 1QB6A 4Y6DA 3TNSA 1GMCG 2GZ8A 4NWLA 3QUMP 3F9FA 1KIGH 1DM4B 2DE9A 3RXUA 1CE5A 1CA0B 1VR1H 2XCNA 1C2MA 2ZCKP 1O3IA 1KSNA 4B2BA 2ZC9H 1H9HE 1DUAA 3UOPA 3UFAA 1T8OA 2GCTC 2Z9LA 1H8DH 1UCYE 1GI3A 5EQQA 1H8IH 3Q3YA 4UFGH 6ESTA 2ZFFH 1W0ZU 3MOCA 3ZVCA 5JB8S 3KF2A 2FOFA 4HI3A 4WWYA 1UK3A 1GHYH 2GDEH 3SU0A 1W7XH 2FXRA 1AY6H 1GHBF 3KQEA 1JIMA 3GOVB 1BMLA 2Y7ZA 3UR9A 4I33A 1GBHA 3PTNA 1KDQA 1HCGA 2HOBA 1K1PA 1YM0A 4BAHB 2HPQH 3NCLA 6GCHF 2AIPA 3ZZ4A 4BANB 2GKVE 3SUGA 4HGCA 2OD3B 1XKAC 4CHAB 1C1SA 1FN6A 5C5OA 1DLKB 2QXGA 2H1UA 1DDJA 2QY0B 1TPOA 1WUNH 2GT8A 1YPHE 1JWTA 4MTBA 2G00A 2Z9KA 3RU4D 1TX6A 4LK4A 2FX6A 1CBWB 1Y5AT 1J17T 3JZ2B 2Y82A 1QIXB 3H5CB 4DG4A 4YOIA 1W0YH 2YNBA 1O39A 5AHGH 2Y5HA 9LPRA 1GJ7B 1AKSA 3P6ZB 5EODA 2BVSH 4JK5A 1BRBE 3LT3A 1TYNA 2A32A 3QZRA 2BD4A 2RG3A 3LJJA 1MBQA 4NZLA 2BD2A 1QQUA 2ANYA 2J2UA 1GJAB 3FP8E 3T26A 2C8XB 5EXMA 3E6PH 1GI2A 1TOCB 4XBBA 1P06A 1QNJA 2EI7A 3QTOH 4BAQB 3RU4T 1P8VC 1DX5M 6CHAC 3CS0A 3H7OA 2WPKS 1O2NA 1SOTA 3M7UA 4WMDA 3QZQA 3M5OA 2NU1E 5G4BA 4Y8ZA 1OWIA 3ATWA 1C2JA 3UQVA 1SLVB 3BTDE 4A5TS 4B76A 1SSXA 1O33A 2BVXH 5HMAA 1VITG 5TJXA 3SJOA 1IQNA 2PGBB 2ULLA 3ZZ5A 2PLXA 1M9UA 2J92A 1SG8B 1YC0A 2J4IA 1RGQA 1LQEA 1KLIH 4X8UH 1NM6A 1QJ7B 3A8DA 4CR9A 3MU1A 4H4FA 1T4VH 2BY8X 2PKAA 5GCHF 4UE7H 3BTKE 4NFFA 5EPNA 1AE8H 1AI8H 1MQ5A 2HGTH 1O0DH 1CHGA 3RMNH 1DT2A 1SGFA 1YP9A 2IPHA 4ABBA 4ASHA 1V6DA 2A5AA 3A7VA 2RDLA 3RM0H 4GSOA 3BTWE 2R2WU 3LC3A 3GY2A 3RMMH 3SV2H 1A7SA 3PLBA 1O2GH 1ZLRA 1C1QA 3SU4A 3ZYEA 2FOBA 3VEQB 3T25A 1OSSA 3RC6A 1TPAE 2I6SA 4ZXXH 2ZP0H 1SFIA 1C5SA 4BAKB 3LGIA 4FUFA 3VB7A 5EXNA 3V3MA 1UVSH 5FAHA 5A0CA 3ENSB 1P09A 3RLWH 4ABDA 1DLEA 1MTUA 1O5CB 2BDHA 3FP7E 4YT7H 4AG1A 4ZKOU 1HAOH 1SGYE 3C1KA 1GJ4H 1C2GA 1V2TT 1CT4E 1GBDA 2BQWB 5K7RA 2BY6X 1FY8E 1CA0C 1C5YB 4RN6A 2BY7X 3RXTA 3ESTA 4DIIH 6LPRA 1RS0A 1EPTB 4IBLH 1Q31A 4JZ1A 4AFSA 3MU8A 1C5UA 1SGRE 8LPRA 2XC0A 1TWXB 3PLKA 1AHTH 1C5VA 1GL0E 1JIRA 4TWWA 3P17H 4O03A 2V3HH 1Z8JB 2AEIH 1FJSA 1IHTH 2P95A 3VB6A 3VB3A 4WVPE 4F49A 3BEUA 1YCPH 3M61U 2GCTB 4M7GA 1Z1JA 2BLOA 1NO9H 1C9TA 5A2MH 1EKBB 3D23A 4ZH8A 1HIAA 1GI7B 1GVKB 3PMAB 1V2LT 3RXBA 3IITA 1F0SA 2EI8A 4MPWA 4U32A 1OP8A 4ABAA 1ACBE 1LHEH 1PQ5A 1DS2E 3RXJA 4CHAC 5PTPA 5EXLA 3MO6A 1AWHB 1ZHPA 1EP6A 1QL8A 1CHOG 1TB6H 3SI3H 2BX3A 5AFZH 4FUBA 1GHXH 1NFYA 1AWFH 1O2JA 3MU0A 2ESTE 5ESTE 1NRNH 3QX5H 1O38A 3MH5A 3RU4E 1NC6A 3EDXB 4KP0A 2C3SA 3B23B 4K8BA 4MDSA 2B8OH 4BXSA 2F9PA 1QURH 1LPGB 3ATIA 3SJKA 3A8CA 4FU8A 4JZDH 1MU8B 2FS8A 2A4QA 1XVOA 2Y5FA 1WAYB 1XKBC 3A7XA 4U01A 1BMMH 1JRSA 1NRPH 2BDAA 2NU4E 1PFXC 4MQAA 1BJVA 1A2CH 1DITH 3PO1C 4AB9A 2FTMA 5HYOA 1T8NA 2ZHDA 2ZI2H 1GHAG 4JYVH 1S6HA 1T31A 2ZFQH 4YESB 1H1BA 2XTTB 4KTSA 1LKBA 1SGFG 3A83A 3MWIU 5EGMA 3KNXA 4A1TA 3SJ9A 1F0RA 2DUCA 2Z94A 4X1NU 1SMFE 2ZQ1A 5C2ZA 2GCHF 1FMGA 1QRWA 4ABEA 4IC5A 4KKDA 3SNBA 4H42U 2RCEA 1HLTH 2FLRH 4WH6A 1TE0A 2BM2A 3IG6B 1NY22 2DE8A 3HK6B 1D6RA 5C1YA 1JBUH 3V0XA 4U30A 5C1UA 2A45B 1WTHD 1AMHA 1AVXA 3RXMA 1GMDF 3OX7U 1PPCE 1W10U 3UR6A 1V2WT 4NA7A 2ZGBH 1AFEH 2ZHQH 4LOYH 3ZZCA 1DOJA 2VGCC 1THSH 5C1XA 1C5TA 1YCPM 3KL6A 4UEHH 2QN5T 4FU7A 5EG4A 1AUJA 1NROH 2XYAA 4FUEA 2TGAA 2WINI 1V2UT 4D9RA 1K1MA 3RXKA 2GMTC 3S7HB 2TGPZ 2A2QH 1MAXA 2VWOA 4SGBE 2EI6A 2VJ1A 5T3HA 4JK6A 1C1MA 3VFEA 1K22H 3AW0A 1OWJA 4IN2A 5K0HA 1PJPA 1FUJA 1AE5A 1LDTT 3ZYDA 2A5KA 4GHTA 1Y8TA 3RXQA 1AIXH 2ZCLP 3A82A 2I6QA 3SORA 3Q3KA 1L0ZA 3RXRA 1GBTA 3RP2A 4OS5A 4Y10E 1XM1A 1W2KH 1UTQA 1IQMA 3F6UH 1NFUA 1QFKH 1SGIB 4X6NA 2ZPRA 1YLCA 1UTOA 1W8BH 3SJIA 3M5NA 1OP2A 3KN2A 4YOJA 1PPBH 2FDAA 1A46H 2TBSA 3SQEE 2EC9H 1V2MT 1O34A 2GGVB 2P3UB 1P2KA 3A86A 1A1RA 2ALPA 4O3TA 1W13U 2G55A 1P05A 1C1PA 1EZSC 3I29A 3D62A 1O3JA 2VIWA 4MNWA 3D49H 2BQ7B 1G30B 1UTNA 4WJG2 1OWDA 2R0LA 3AASA 2XWAA 1A5HA 1G2MA 1SB1H 1SGQE 2VWMA 4WMEA 4IMQA 1T8MA 5DGJA 1IQHA 3TJVA 3TVJB 1B7XB 3MO3A 3W95A 1FY3A 1UTLM 2SGEE 1G3DA 1GDUA 2OC7A 4AYVB 1SR5C 4UFEH 1HAHH 3UNSA 2J94A 1IQKA 1Y5BT 1W12U 1QQ4A 2HWLB 3SO3A 1GBFA 1P10A 2R3YA 3PYHA 3CS7A 1TX7A 1C5QA 1GBMA 2ALVA 1UCYH 2VINA 1SQTA 1AD8H 3T62A 2AGGX 4D76A 1ESAA 1DANH 3GCHC 3ZZ7A 2R0KA 4ISHH 4NGAH 4Y0YE 2EEKA 1HAYB 1ANCA 1GDQA 1HB0B 3M37A 3S69A 2BXTH 2ZGJA 3ATMA 3C27B 5IDKA 1NFWA 2ZECA 1S84A 2P3TB 3LGYA 2AFQB 3MYWA 4XSKU 3GCTG 2W7UA 1L4DA 2QA9E 1KXCA 3SNAA 5DK1A 1HAIH 3OY6U 1ZMJA 1LVYA 3I77A 4NIVA 3A7WA 5EU8A 2OC0A 1EB2A 1QJ1B 4UFDH 3NPSA 2A4GA 3A8AA 1O2HA 1ZPZA 4K1EA 3ELAH 2ZTXA 1SC8U 2Z3EA 2BYAX 3MU5A 1L1JA 5GIBA 1S5SA 2ANWA 2LNCA 4FUGA 2B0FA 1XUIA 2YOLA 3BG4C 1SBWA 1V3XA 1GI0A 1BBRK 3GCNA 1MU6B 2RA3A 1SLUB 4HFPB 3ODDA 1VCWA 1TMBH 2FOAA 2VIPA 2K1QA 1AZ8A 1C5RA 1ZMNA 2VH6A 1XUFA 3MTYA 4ABJA 2QF0A 3HKJB 1GBEA 2JH6D 4ISIH 4IN1A 1ELAA 4ESTE 1V2VT 1BT7A 2TGTA 2P59A 1UMAH 1UTMA 1O2QA 3SU5A 4A1VA 2XRCA 2A7JA 1FIWA 2Q6FA 3GICB 1LQDB 4FVBA 5DJ7A 2BDCA 3ZVDA 1G3CA 5I46H 2G52A 2O9QA 2Q1JA 1MQ6A 1LO6A 1F0UA 1XXDA 1XUHA 3TH4H 3M35A 2Z6BD 4X8VH 1GJ6A 2F9VA 2ZFRH 1W11U 1CO7E 4WH8A 2CJIA 3UPEA 1K1JA 4KGAA 1XUKA 2V6NA 5HGGA 1HAVB 1GG6B 1YPGH 4YT6H 3QTVH 3GY8A 4HTCH 1K1OA 3S9BA 1T7CA 3TK6A 1ABJH 1WV7H 1GBLA 1UTKA 1EPTA 1E0FD 1O3AA 4Z0KA 4VGCB 4CRGA 1SI5H 1TRMA 3B8JA 4E05H 1SGEE 1GI5A 1EATA 1MTNB 3S9CA 4I8KA 4AFQA 1XVMA 2PW8H 1O3BA 3GISB 2UUKB 1MCTA 3LU9B 2ANMH 2Q6GA 1ELVA 3M5LA 1GHVH 2W7SA 3MNSA 3GY4A 1PYTC 2FO9A 2SNWA 3T29A 3TH3H 1HPGA 2H9HA 1FPHH 3F1SB 5T6GA 3BIUH 1ZGVA 1Y59T 3FVFB 3IWMA 3ZVBA 1MMJN 2F3CE 3M3VA 2A7HA 5SGAE 3PO1B 1O5AB 1O2KA 1O3DA 1WSSH 1K2I1 1TLDA 2BDIA 1G9IE 6GCHG 1O2TA 4NSVA 2XC4A 2VVUA 3L33A 3P70B 3A88A 1NU7B 3K65B 4R8TB 5FPSA 1GGDB 1Y3UA 3DT0H 2VIOA 2AH4X 2ZQ2A 1TGNA 2OTVA 5TCAA 1Y3VA 1YPJH 3SNDA 1C2HA 3LDXH 2ZHWH 3PTBA 4K1TA 2VU8E 3RXOA 1SHHB 1CU1A 1VCQA 4GCHF 2Y7XA 3RDZA 4DIHH 1YBWA 4X1RU 4FXGH 1WCZA 4JZEH 3VPKA 2F9NA 7LPRA 3RXVA 1Y3XA 1C2IA 3ODFA 1O2LA 5JBAS 4Y8YA 4B71A 1FQ3A 1TALA 1TX8A 8KME2 4LZ1H 1DFPA 2QXIA 1YPMH 4LXBH 2XNIA 1C1WH 1TGCA 1SQAA 1AO5A 1FNIA 1SOZA 4K3JA 4BNRA 1E38B 5GPIB 3BN9A 2R3UA 1MKWH 1GWAA 1FONA 1WYKA 1BRAA 2PUXB 3SGQE 4AFUA 1PPZA 2C8WB 1ETRH 4CRCA 5FBEA 4Y71A 3GY7A 1DE7H 1HDTH 2HPPH 1Z71A 2HNTC 1MZAA 1FN8A 2G4UA 3D65E 1YPLH 1VCPA 1HFDA 2ZWLH 3E90B 4YLQH 1P57B 3T27A 4MPXA 2Z9GA 1S83A 4X1PU 3I78A 3A7ZA 4JMYA 5GCHG 1D9IA 1TNHA 1THPB 4YLUA 1EZXC 3KHVA 1ELTA 1LPKB 3P8OA 3DFLA 3OU0A 4H6SB 3BTEE 3RC5A 2ZZUH 4UONA 2BLWA 1AB9B 1PPEE 2BVRH 4DT7B 3TJUA 1C4Y2 4A1XA 1TPPA 1GI4A 2ZPSA 5T6DA 4MNVA 2FOHA 2WYGA 2ZDNA 3HATH 1MBMA 1ANEA 1AQ7A 3LIWA 1AFQC 3F68H 3SU6A 1DWBH 1TGTA 4KELA 2CN0H 5EQRA 1HAGE 2FOGA 4NA9H 2C93B 1FAKH 5JYIA 1GMDG 3SU1A 1F5LA 2V35A 3EQ0H 4X0WU 3BF6H 3TPIZ 2HNTF 2TPIZ 2STBE 3L6PA 1TFXA 2WPIS 1TNIA 1C2DA 1ETSH 1C1UH 1SGCA 4NFEA 3SQHE 4R0IA 1GMHF 4SGAE 1UK2A 2OQUA 4TPYA 5F8TA 5IYTA 3URDA 2BD3A 1ZSKA 2ILNA 5ETXA 1ZGIA 2XBVA 2A7CA 1MTWA 2AMDA 5EPYA 2UUJB 4I32A 2GV6A 1BZXE 4DURA 3SJ8A 1GCTC 2BD5A 1ZJKA 5AFYH 1XXFA 1TONA 3AAVA 3SW2B 2IOTA 3FFGA 2ZHFH 1C9PA 3NZIA 2PR3A 4BTTB 1KXEA 4Q80A 2XBXA 4ISNA 5A8XA 1LTOA 1A4WH 1QL7A 3M36A 4ZHLU 2O8LA 2UUFB 4X2YA 2VIQA 3TLOA 1MTNC 2UWOA 3QK1A 1O3HA 4O3UA 1EP5A 3MHWU 1DWCH 1CBWC 3BSQA 5C20A 3S9AA 1LVMA 3BTME 3MFJA 2GZ7A 2HVXA 2M5TA 1DPOA 1YCPK 4GUXA 1SQOA 1DWDH 1MH0A 1NFXA 5B6OA 4CRAA 2ZU3A 1MKXH 4MNYA 4O97A 3P8NA 1EJNA 1CGHA 2P16A 1UVUH 2NU0E 3OYPA 3URCA 3PB1E 5LH8A 3A84A 7KMEH 2CMYA 5LGOA 1P3EA 4WF8A 5E2PA 3S7KB 2PTNA 4NCYA 3MNBA 3EGKH 2BHGA 5DP4A 1UVOA 2SGAA 4IC6A 1OXGA 1F92A 1Z6EA 4F4OC 1BTHH 4DJZB 1J15A 1QBNA 3GY5A 4YTAA 1AGJA 1HIAB 1UVTH 3BG8A 5CHAC 2A0QB 4AYYB 1JOUB 3M7QA 4FUIA 4XBDA 1KLJH 5F8XA 1O2SA 1GBIA 1MCVA 4KTUA 1KY9A 1K1NA 1V2RT 1YPKH 3ATKA 3GYMA 1BBRE 1O2ZA 4I7YH 2CXVA 2A2XH 1GL1A 4FUHA 1U6QA 4UD9H 1UHBA 2PFEA 3UUZA 2GD4B 2TGDA 1GGDC 2BDYA 3E91A 3SI4H 1O2MA 1ZTKA 1O3LA 1TA6A 1EUFA 3O8CA 2ZGCA 1GJ9B 1O5BB 1S0QA 3HPTB 3MO9A 5GDSH 3ZZ6A 1ZTLA 3E1XB 1Z8RA 1RTKA 4E7NA 1AZZA 2NWNA 1T4UH 1FZZA 2FOCA 5J4SA 1BITA 1THRH 1O2RA 5JBTA 1BIOA 5FPTA 5FBIA 5F8ZA 1TA2A 1KXAA 2ZGHA 1EAIA 3SU2A 5A8ZA 1Y5UT 1QHRB 1CVWH 1HAXB 1OP0A 1Z8GA 1N6XA 4NA8A 1ESBA 3LJOA 5JBBS 2XW9A 4X2XA 1BBRH 4AORA 2HRVA 4NZQA 5L2YH 4ABFA 1ELEE 2VWNA 2ZPQA 2GX4A 2H5DA 5AVDA 1GHZA 2GV7A 1EZUC 5E0JA 1SFQB 2Y5GA 3U8OH 4AX9H 1GDNA 2OBOA 1QGFA 1QR3E 2UWPA 1AFQB 2PGQB 3KQCA 3P95A 1ZHRA 4K1SA 2ZTZA 2OINA 3PWCA 3G01A 1ARCA 2BD7A 1BMNH 3TK9A 1KYNA 2P8OB 1MTSA 3P8GA 2FOMB 2V0BA 4D8NA 3E0NB 2ZKSA 1ZHMA 2AYWA 1C5XB 2Z3CA 5EW2H 3QGNB 1GJCB 5EW1H 3F9HA 1P04A 1TOMH 1V2JT 5F03A 2LPRA 4PROA 4B75A 4RKJB 2OUAA 4XE4A 1GBBA 1P2NA 4AG2A 2D2DA 1V2QT 2W26A 5JDUB 1V2KT 2BZ6H 1EPTC 1E34B 1O32A 1GBCA 1O36A 1GCTB 1NTPA 3F9EA 2F9BH 2QAAA 4H6TA 1GBJA 3AW1A 5BPEA 1TGBA 1O3CA 2Y80A 1G32B 2H6MA 3QDZB 1KXBA 4ABIA 1YKTA 1CSOE 3MNCA 1IQJA 1K21H 1K1LA 3N7OA 1O3MA 1A5IA 2GCHG 1G2LA 1GCDA 3VXEH 1P0SH 2WV5A 4Z6AH 3DFJA 4X1QU 1OPHB 3ZZ3A 1RXPA 2VVCA 5H4IB 1SLWB 3P92A 3ITIA 2ZEBA 5BRRE 1C2EA 1C5NH 4Q2KA 2IJOB 4CRDA 2SGQE 1ZJDA 1NPMA 1OOKB 5JB9S 1ELFA 1Z8IB 2BXUH 3K6YA 1ETTH 3UY9A 1ELGA 2ODPA 2NU2E 2BY9X 3BTGE 1QL9A 4B2CA 3T5FH 2ZTYA 1O2WA 1GI9B 3FP6E 4WMFA 5GWZA 2ANKH 1G3EA 1QBVH 2O8WA 1RRKA 1OWKA 3LKWA 3GCTF 2G5VA 4OS2A 5A09A 4X2WA 3RMLH 3SU3A 4MLFB 4OS6A 1E37B 2AMPA 1L4ZA 1C5WB 2ZDAH 5CHAB 2QXHA 1CA8B 3A85A 3VXFH 2AS9A 3K9XB 5LPRA 3VGCC 1SPJA 3LOXA 4I31A 4NSYA 4Q7XA 1Q3XA 1TNKA 1EAWA 3R3GB 2JETC 3GDUA 1N8OB 1FLEE 3MI4A 2Q6DA 4K5ZA 3RXGA 1HBTH 1D3PB 1S82A 3RXCA 1C5MD 2B7DH 2WPLS 1UJ1A 5HM9A 5ABWA 4JCNA 2XCFA 1SGDE 1DY8A 2JH5D 1GBKA 3KEEA 3A7YA 3A7TA 1C1VH 1S6FA 5DG6A 1L1GA 1OS8A 2B5TB 1OKXA 2AGIX 4TWYA 1CHOF 1ZOMA 5DPAA 1UTJA 2ZDMA 1GBAA 1FY5A 1P9UA 1LMWB 2PUQH 2FIRH 1WBGB 2D26C 5DP9A 8GCHF 1FV9A 1OX1A 1RJXB 7GCHF 5LPFA 3QO6A 1QRXA 3EA8A 3U69H 4YM9A 2XWBI 3NWUA 3TGIE 3QN7A 3SUDA 5L30H 3FANA 4O9VA 4INKA 3T28A 1TQ0B 1BRCE 1ZPCA 1ZTJA 1YYY1 3M5MA 5DP7A 1GI6A 4TY6A 1EQ9A 1ZSLA 2VB0A 2OQ5A 5ESBA 3RMOH 4KTCA 1OYTH 1RTLA 2ASUB 4ZUHA 1SVPA 2OCVB 1B0EA 3ZZDA 1BMAA 4XFQA 3SHAH 1DSUA 3HGNA 2QGRA 4CRBA 3PM3A 2G8TA 3UWJH 4GLYA 4Y79A 2BDGA 4XOJA 4CBNA 1QY6A 1TPSA 3Q3XA 2HNTE 2P8OC 1ANDA 1BRUP 1EZQA 1ANBA 4FU9A 2WUBA 4Y7AA 2QYIA 1FPCH 3JZ1B 1BA8B 5A0AE 1BUIA 2ZU4A 1G37A 1O5FH 3MH6A 4ZKNU 2SNVA 5JPMH 4U2WA 1SGTA 5E2OA 2VIVA 1LHCH 3FZDA 2R2MB 3TIUA 2TRMA 1T8LA 4YOGA 4HZHA 1DVAH 5FX6A 3UNRA 4RSPA 1MD8A 2PSXA 2BMGB 4DCDA 3EE0B 1GPZA 3AAUA 1DY9A 4OGXA 4ABHA 3ZZ9A 4E7RG 4VGCC 2OLGA 1MKWK 1O2UA 1L1NA 2VWLA 1AVWA 1A0HB 2FTLE 3T2NA 4K60A 2JKHA 1NRRH 1LKAA 1UTPA 5DO4H 3NK8A 3OY5U 1LHDH 1A0LA 3KIDU 2O8UA 2AGEX 3DHKH 3QGJA 3E16B 3A89A 2BQ6B 2FM2A 1O3PB 4Y11E 2GZ9A 3BTTE 1QBOA 4JYUH 5EOKA 4RKOB 1QB9A 5DKMA 3TJNA 1NN6A 1EAXA 3RM2H 7GCHG 2BB4A 3MMGA 4ZXYH 1C1RA 4DW2U 1DXWA 1N6YA 3WY8A 2F83A 1QA0A 2GDDA 3SZNA 1EB1H 3UTUH 3UWIA 4I8LA 1XMNB 1O31A 4NIXA 5F6MA 1AUTC 1UHBB 4JYTA 1YGCH 3BTHE 5FPYA 4Y7BA 2SGFE 4BTUB 1BQYA 4IMZA 1LPZB 1EJMA 1A61H 1C1OA 1WTGH 3LPRA 1C2FA 4AGKA 1ZZZA 3BV9B 1C1TA 3RXLA 2XBWA 1PQ7A 1A0JA 1SGPE 1P2JA 1KLTA 4GAWA 5CE1A 3Q76A 4JZIA 5FCKA 2PKAB 2Y81A 2GVFA 3Q77A 5CMXH 3P8FA 1BHXB 3R0FA 1O37A 3SUEA 1P02A 3VGCB 1BTUA 3DD2H 2H2ZA 1HUTH 1VJAU 3DUXH 6CHAB 3RXIA 1N8OC 2CV3A 3GYLB 1SL3A 4ZKRU 5C67A 1NRQH 1BTYA 1C2KA 2D1JA 1OWHA 3U98H 1IOEA 2FYQA 2H9EH 3O8BA 2WPHS 1D3DB
chains in the Genus database with same CATH superfamily
1S0RA 2SFAA 1GVZA 1A5GH 3M7TA 3TGJE 1GJ5H 1WXRA 2FMJA 1ZPBA 3UOUA 3ZV9A 5L6NH 4AOQA 2PKSB 2FP7B 1O3GA 3A80A 3RXHA 1DUEA 2SGPE 3PV5A 5E0HA 3U1JB 1TMTH 3CP7A 4BTIB 3LH1A 2D8WA 3NUMA 3SYJA 1HJAB 2BX4A 2J34A 5B6LA 1K28D 1C4V2 2FI4E 2WUCA 3V7TA 2J98B 1NZQH 1DICA 5C0UA 1MAYA 1HRTH 1Q2WA 2ODYB 3DSPA 1GMHG 5E0GA 4CRFA 3UREA 1TABE 1RIWB 2QXJA 1S85A 2O8TA 3E8LA 4X6MA 4AB8A 1FIZA 1FI8A 2PWXA 2XC5A 3A8BA 4ZMAH 2F91A 1BTXA 1P03A 2KAIB 1QA7A 4YO9A 2ZIQH 1FAXA 1EAUA 1K0HA 4B1TA 4I8HA 1QTFA 3OEHD 1BDAA 4DGJA 3LGVA 5EJZA 1O3KA 1O2YA 1FDPA 4TSFD 3M3SA 5FXLA 3BTQE 1INCA 3PMBB 1PPFE 2AIQA 2GP9B 4UDWH 4THNH 5A0BA 5J4QA 1HXFH 5L2ZH 3QLPH 5EJLA 3A81A 1JRTA 1O5EH 4AGJA 3RLYH 1TNGA 2C8YB 3RXSA 1H9IE 3M3TA 1CGJE 3EA7A 3N7DA 4TY7A 3S0NA 1C5LH 3OTPA 1VKYA 1N1LA 1EX3A 2GMTB 2A4RA 1AVGH 3F0PA 3ZV8A 3MNXA 5FX5A 7ESTE 2W5EA 1SHYA 2FYRA 3GY6A 1A3BH 5KEDA 4Q4LA 1C1NA 1PPHE 3RC4A 1YLDA 5T6FA 2JETB 1PYTD 3O8RA 4JZFH 2ZDKA 2OP9A 1COWD 2FX4A 3F9GA 2ZFPH 3OFND 1UO6A 2XNDD 2ZO3H 2WV4A 1V2NT 2G4TA 4J2YB 3L3TA 1EASA 1IQIA 2GJGA 1ARBA 2A1DB 4MPVA 3GDVA 4AFZA 2P94A 5F53A 4CH2B 1A3EH 3SBKA 2BLVA 3K6ZA 1UCYK 2FLBH 3ZZAA 2JIZD 1O3FA 4AC9A 1GJDB 3FO8D 4CBOA 1RFNA 2FEQH 2ZU1A 3NXPA 4INLA 2XXLA 1O2PA 2BTCE 2JH0D 1O3OA 1ID5H 1B0FA 1ELDE 2CK3D 3MU4A 1O3EA 1WQSA 1H8ED 2C4FH 2BOHB 1B5GH 3PRBA 1YPEH 5GJ4B 2BZAA 1QCPA 1TNJA 3U8TH 1J8AA 1PPGE 1LHGH 3PROA 2FZZA 4YXWD 1H4WA 3ATLA 1FY4A 5JBCS 4TPIZ 1WQVH 1O3NA 1Z6JH 2FOEA 5AF9H 1DXPA 5FHTA 4AZ2B 1KDQB 3RXFA 1HAZB 3EYDA 2BD9A 4ZHMU 4LZ4B 1LVOA 1T32A 3ZVEA 2FODA 1J9CH 2W3IA 4Y76A 3RXDA 3ZVFA 2VGCB 3TU7H 3UNQA 1LCYA 1TMUH 1ZSJA 1ZMLA 4BXWA 3LH3A 1HYLA 1GHWH 2O8MA 3HK3B 1IQGA 2J38A 3TJOA 3SNEA 1BCUH 3STJA 1BHXF 3V13A 1W14U 1UVPA 1VGCC 1Z1IA 4D7FA 1JXPA 3ZZBA 4WXIA 1QZ8A 3TITA 1RD3B 2YNAA 1F7ZA 4D9QA 1D3TB 1YPHC 2PKSC 1ZYOA 4IGDA 1DSTA 1MZDA 5DP5A 4ZHAA 3ZVAA 3LGUA 2PHBA 4TYDA 4Y8XA 1V2PT 1K1IA 4E06H 4UFFH 1CQQA 2G51A 2Z7FE 5A8YA 4K8YA 5C3NA 3SGAE 1TNLA 4ZAEA 5C5NA 3PV2A 2NU3E 1ZRBA 2WPJS 5E8EH 2OXSA 2WYJA 3BEFB 1HJ9A 1CT0E 4MPUA 1GJ8B 4I8JA 2B9LA 2ZFSA 4D7GA 1TBZH 3GCHB 1RIWC 1D4PB 4MG3A 9ESTA 1IQLA 1TRNA 4X6OA 2V3OH 3TGKE 1TGSZ 5HM2A 1F5KU 4J1YA 3TK5A 1IAUA 2BD8A 5TCCA 1VITF 1H9LB 4B2AA 2CF8H 1IQFA 4RI0A 2HALA 1WU1A 5GXPA 3SV6A 1MUEB 1NT1A 2PTCE 3A87A 5LPEA 3SHCH 2A31A 5EIYA 5HIZA 2F9UA 1V2ST 1CT2E 1KTSB 2ODQA 4BOHA 4AN7A 1QJ6B 4X6PA 3UQOA 3RUOA 1C5PA 1RTFB 4NIWA 2CGAA 3SOSA 1K9OE 2CHAC 1HGTH 3GDSA 1CGIE 8ESTE 4DOQA 1P12E 3K2UA 1BOQA 4Q7ZA 4FVDA 5FCRA 3TH2H 1VJ9U 1L2EA 3PMHB 3BG4B 1GHBG 1HJAC 4GCHG 1C2LA 1BB0B 2AMQA 4ISOA 4B6EA 2F9OA 4XDEA 3GCOA 2QCYA 2ZNKH 3PLPA 2SGDE 1NESE 2L6OA 2CF9H 3DA9B 3PV4A 3MH7A 3O8DA 3VB5A 1F0TA 3LC5A 4BAMB 1O35A 2FPZA 2BLQA 1NU9A 1G36A 3E0PB 1GG6C 1PQ8A 4X2VA 2STAE 2OC8A 4MNXA 2H5CA 2UWLA 1J16A 2Z9JA 3CENA 4X8SH 1Y3YA 1ABIH 4Y0ZE 4B74A 2ZU2A 3EAJA 4A7IB 1PQAA 1AU8A 2AERH 1J14A 2QIQA 4GHQA 2C90B 2P3FH 1ORFA 2QC2A 1EOLA 2H9TH 2C8ZB 1QRZA 4K69A 1C5ZB 2WPMS 3U1IB 3KGPA 1P11E 2Y6TA 3SV7A 3LGTA 1G3BA 1NS3A 4OM9A 1P2OA 3AVZA 2A4OA 1HAPH 1VITH 4YZUA 1GJBB 4INHA 2UUYA 4M9FA 4GVUA 4K2YA 3B9FH 1GVLA 4QT8C 1XX9A 3HKIB 4ZKSU 2VVVA 3FOAA 1AN1E 2K0QA 1E35B 1TBQH 2A5IA 1ELBA 2G81E 2THFB 1YF4A 3ZVGA 4A6LA 4DVAU 2RA0A 4OS1A 4OS7A 5DP8A 1JMOH 4FUJA 1HNEE 4X1SU 1C5OH 1KXFA 1P2QA 1D3QB 1ZR0A 2FWWA 1HV7A 1S81A 1ESTA 1IHSH 2ZG0H 3UAIC 2IN2A 4Z1MD 2ZA5A 2J9NA 3EA9A 1O5DH 1HJ8A 2ZGXH 2FI3E 4ABGA 2ZDLA 1TAWA 3LGWA 2BDBA 1O2VA 2PP6A 1FXYA 1DWEH 1NBME 1GMCF 4GPGA 3U9AH 1TRYA 1O30A 4NIYA 1BTZA 3QWCH 1EXFA 4B73A 2P93A 1MD7A 3TNTA 2PV9B 1NRSH 3Q00A 4FUCA 1F5RA 3V12A 3OTJE 1D6WA 2FS9A 4I8GA 3MH4A 1XUGA 3FKSD 4FUDA 1BTPA 5EQSA 4CH8B 5I25A 2ZU5A 4IS5A 2GT7A 3PMJA 2FESH 2VIDA 1LVBA 2Z9IA 3W94A 1O2XA 1X7AC 4XBCA 4NWKA 1GI8B 1HAVA 2GTBA 3UIRA 1LHFH 2FI5E 5HXFA 1TBRH 3SN8A 1W7GH 2HLCA 2OC1A 1EOJA 1EJAA 1XUJA 2OBQA 3SUFA 1V2OT 2EA3A 1OWEA 3STIA 1W3CA 3RXPA 1VGCB 1QB1A 3RXEA 1P3CA 4CR5A 2ZDVH 2ZCHP 1GHAF 3FAOA 2BOKA 2KAIA 1MTVA 2R9PA 3GY3A 3VB4A 8GCHG 1SLXB 1C4U2 2ZF0H 3KQBA 2PSYA 2QF3A 3NKKA 4ZROA 1ELCA 3BEIB 1UK4A 1IQEA 1MKXK 1P2MA 3KCGH 1AKSB 1AB9C 1P9SA 1OYQA 2J95A 2W3KA 4X8TH 1O2IA 3RXAA 1FY1A 4MVNA 3BTFE 4BAOB 3SGBE 2ZFTA 1E36B 2EQNA 3H7TA 5DP6A 1O2OA 4DY7B 3PWBA 1SGNE 2YMSB 3KQDA 1HXEH 4WY3A 2ZHEH 2QV1A 1BTWA 1TQ7B 2BY5X 1WOFA 1KTTB 1P01A 2QF5A 3OSYA 4NG9H 2Z3DA 1ZRKA 4Q7YA 4CREA 3E3TA 3LONA 1GI1A 3HGPA 2CHAB 2G5NA 3ZZ8A 3BIVH 3SV8A 4IW4E 1Y3WA 1Z7KA 1O5GH 2XBYA 2WHXA 2VNTA 1TIOA 4WXVA 3U8RH 1F2SE 1P2IA 4A92A 4OGYA 3FZZA 1BJUA 3SV9A 3H09A 4ISLA 2TIOA 2VH0A 4OS4A 5DP3A 1VZQH 1KXDA 3SNCA 1QB6A 4Y6DA 3TNSA 1GMCG 2GZ8A 4NWLA 3QUMP 3F9FA 1KIGH 1DM4B 2DE9A 1E1QD 3RXUA 1CE5A 1CA0B 1VR1H 2XCNA 1C2MA 2ZCKP 1O3IA 1KSNA 4B2BA 2ZC9H 1H9HE 1DUAA 3UOPA 3UFAA 3AK5A 2LP6A 1T8OA 2GCTC 2Z9LA 2L74A 1H8DH 1UCYE 1GI3A 5EQQA 1H8IH 3Q3YA 4UFGH 6ESTA 2ZFFH 1W0ZU 3MOCA 3ZVCA 5JB8S 3KF2A 2FOFA 4HI3A 4WWYA 1UK3A 1GHYH 2GDEH 3SU0A 1W7XH 2FXRA 1AY6H 1GHBF 3KQEA 1JIMA 3GOVB 1BMLA 2Y7ZA 3UR9A 4I33A 1GBHA 3PTNA 2LELA 4FETA 1KDQA 1HCGA 2HOBA 1K1PA 1YM0A 4P02A 4BAHB 2HPQH 3NCLA 6GCHF 2AIPA 3ZZ4A 4BANB 2GKVE 3SUGA 4HGCA 3KQ5A 2OD3B 1XKAC 4CHAB 1C1SA 1FN6A 5C5OA 1DLKB 2QXGA 2H1UA 1DDJA 2QY0B 1TPOA 2QF4A 1WUNH 2GT8A 1YPHE 1JWTA 4MTBA 2G00A 2Z9KA 3RU4D 1TX6A 4LK4A 2FX6A 1CBWB 1Y5AT 1J17T 3JZ2B 2Y82A 1QIXB 3H5CB 4DG4A 4YOIA 1W0YH 2YNBA 1O39A 5AHGH 2Y5HA 4ACAA 4B6FA 9LPRA 1GJ7B 1AKSA 3P6ZB 4Q63A 5EODA 2BVSH 4JK5A 1BRBE 3LT3A 1TYNA 2V3MA 2A32A 2QE7D 3QZRA 2BD4A 2RG3A 3LJJA 1MBQA 4NZLA 2BD2A 1QQUA 2ANYA 2J2UA 1GJAB 3FP8E 3T26A 2C8XB 5EXMA 3E6PH 1GI2A 1TOCB 4XBBA 1P06A 1QNJA 2EI7A 3QTOH 4BAQB 3RU4T 1P8VC 1DX5M 6CHAC 3CS0A 4DT4A 3H7OA 2WPKS 1O2NA 1SOTA 3M7UA 4WMDA 3QZQA 3M5OA 2NU1E 5G4BA 4Y8ZA 1OWIA 3ATWA 1C2JA 3UQVA 1SLVB 3BTDE 4A5TS 4B76A 4ZCNA 1SSXA 1O33A 2BVXH 5HMAA 1VITG 5TJXA 2KCYA 3SJOA 1IQNA 2PGBB 2ULLA 3ZZ5A 2PLXA 1M9UA 2V7QD 2J92A 1SG8B 1YC0A 2J4IA 1RGQA 2KX4A 1LQEA 1KLIH 4X8UH 1NM6A 5CHBA 1QJ7B 3A8DA 4CR9A 2J98A 3MU1A 4H4FA 1T4VH 2BY8X 2PKAA 5GCHF 4UE7H 3BTKE 4NFFA 5EPNA 1AE8H 1AI8H 2HGTH 1MQ5A 1O0DH 1CHGA 3RMNH 1DT2A 1SGFA 1YP9A 2IPHA 4ABBA 4ASHA 1V6DA 2A5AA 3A7VA 2YMSC 2RDLA 3RM0H 4GSOA 3BTWE 2R2WU 3LC3A 3GY2A 3RMMH 3SV2H 1A7SA 3PLBA 1O2GH 1ZLRA 1C1QA 3SU4A 3ZYEA 2FOBA 3VEQB 3T25A 1OSSA 3RC6A 1TPAE 2I6SA 4ZXXH 2ZP0H 1SFIA 1C5SA 4BAKB 3LGIA 4FUFA 2KM0A 3VB7A 5EXNA 3V3MA 1UVSH 5FAHA 5A0CA 3ENSB 1P09A 3RLWH 4ABDA 1DLEA 1MTUA 1O5CB 2BDHA 3FP7E 4YT7H 3F2FA 4AG1A 4ZKOU 1HAOH 1SGYE 3C1KA 1GJ4H 1C2GA 1V2TT 1CT4E 1GBDA 2BQWB 5K7RA 2BY6X 1FY8E 3MQKC 1CA0C 1C5YB 4RN6A 2BY7X 3RXTA 3ESTA 4DIIH 6LPRA 1RS0A 1EPTB 4IBLH 1Q31A 4JZ1A 4AFSA 3MU8A 1H8HD 1C5UA 1SGRE 8LPRA 2XC0A 1TWXB 1FX0B 3PLKA 2WSSD 1AHTH 1C5VA 1GL0E 1JIRA 4TWWA 3P17H 4O03A 2V3HH 1Z8JB 2AEIH 1FJSA 1IHTH 2P95A 3VB6A 3VB3A 4WVPE 4F49A 3BEUA 1YCPH 3M61U 2GCTB 4M7GA 1Z1JA 2BLOA 1NO9H 1C9TA 5A2MH 1EKBB 3D23A 4ZH8A 1HIAA 1GI7B 1GVKB 3PMAB 5C17A 1V2LT 3RXBA 3IITA 1F0SA 2EI8A 4MPWA 4U32A 1OP8A 4FOUC 4ABAA 1ACBE 1LHEH 1PQ5A 1DS2E 3RXJA 4CHAC 5PTPA 5EXLA 3MO6A 3SZEA 1AWHB 1ZHPA 1EP6A 1QL8A 1CHOG 1TB6H 3SI3H 2BX3A 5AFZH 4FUBA 1GHXH 1NFYA 1AWFH 1O2JA 3MU0A 2ESTE 5ESTE 1NRNH 3QX5H 1O38A 3MH5A 3RU4E 1NC6A 3EDXB 4KP0A 2C3SA 3B23B 5EJ1A 4K8BA 4MDSA 2AHME 2HLDD 2B8OH 4BXSA 2F9PA 1QURH 1LPGB 3ATIA 4XD7D 3SJKA 3A8CA 4FU8A 4JZDH 1MU8B 2FS8A 3NRLA 2A4QA 1XVOA 2Y5FA 1WAYB 1XKBC 3A7XA 4U01A 1BMMH 1JRSA 1NRPH 2BDAA 2NU4E 1PFXC 4MQAA 1BJVA 1A2CH 1DITH 3PO1C 4AB9A 2FTMA 5HYOA 1T8NA 2ZHDA 2ZI2H 1GHAG 4JYVH 5T1VA 3DSGA 1S6HA 1T31A 2ZFQH 4YESB 1H1BA 2XTTB 4KTSA 1LKBA 1SGFG 3A83A 3MWIU 5EGMA 3KNXA 4A1TA 3SJ9A 5KGOA 1F0RA 3WWBA 2DUCA 2Z94A 4X1NU 1SMFE 5CDFE 2ZQ1A 5C2ZA 2GCHF 1FMGA 1QRWA 4ABEA 4IC5A 4KKDA 3SNBA 4H42U 2RCEA 1HLTH 1S6LA 2FLRH 4WH6A 3OE7D 1TE0A 2BM2A 3IG6B 1NY22 2DE8A 3HK6B 1D6RA 5C1YA 1JBUH 3V0XA 4U30A 5C1UA 2A45B 1WTHD 1SQRA 1AMHA 1AVXA 3RXMA 1GMDF 3OX7U 1PPCE 1W10U 3UR6A 1V2WT 4NA7A 2ZGBH 1AFEH 2ZHQH 4LOYH 3ZZCA 1DOJA 2VGCC 1THSH 5C1XA 1C5TA 1YCPM 3KL6A 4UEHH 2QN5T 4FU7A 5EG4A 1AUJA 1NROH 2XYAA 4FUEA 2TGAA 2WINI 1V2UT 4D9RA 1K1MA 3RXKA 2GMTC 3S7HB 2TGPZ 2A2QH 1MAXA 2VWOA 4SGBE 2EI6A 2VJ1A 5T3HA 4JK6A 1C1MA 3VFEA 1K22H 3AW0A 1OWJA 3OAAD 4IN2A 1E79D 5K0HA 1PJPA 1FUJA 1AE5A 1LDTT 3ZYDA 2A5KA 4GHTA 1Y8TA 3RXQA 1AIXH 2ZCLP 3A82A 2I6QA 3PRDA 3SORA 3Q3KA 1L0ZA 3RXRA 1GBTA 3RP2A 4OS5A 4Y10E 1XM1A 1W2KH 1UTQA 1IQMA 3F6UH 1NFUA 1QFKH 1SGIB 4X6NA 2ZPRA 1YLCA 1UTOA 1W8BH 3SJIA 3M5NA 1OP2A 3KN2A 4YOJA 1PPBH 2FDAA 1A46H 2TBSA 3SQEE 2EC9H 1V2MT 1O34A 2GGVB 2P3UB 1P2KA 3A86A 1A1RA 2ALPA 4O3TA 1W13U 2G55A 1P05A 1C1PA 1EZSC 3I29A 3D62A 1O3JA 2VIWA 4MNWA 3D49H 2BQ7B 1G30B 1UTNA 4WJG2 1OWDA 2R0LA 3AASA 2XWAA 1A5HA 1G2MA 1SB1H 1SGQE 2VWMA 4WMEA 4IMQA 1T8MA 5DGJA 1IQHA 3TJVA 3TVJB 1B7XB 3MO3A 3W95A 1FY3A 1UTLM 2SGEE 1G3DA 1GDUA 2OC7A 4AYVB 1SR5C 1OHHD 4UFEH 1HAHH 3UNSA 2J94A 1IQKA 1Y5BT 1W12U 1QQ4A 2HWLB 3SO3A 1GBFA 2WV9A 1P10A 2R3YA 3PYHA 3CS7A 1TX7A 1GBMA 1C5QA 2ALVA 1UCYH 2VINA 3ZIAD 1SQTA 1AD8H 3T62A 2AGGX 4D76A 1ESAA 1DANH 3GCHC 3GS9A 3ZZ7A 2R0KA 4ISHH 4NGAH 4Y0YE 2EEKA 1HAYB 1ANCA 1GDQA 1HB0B 3M37A 3S69A 2BXTH 2ZGJA 3ATMA 3C27B 5IDKA 1NFWA 2ZECA 1S84A 2P3TB 3LGYA 2AFQB 3MYWA 4XSKU 3GCTG 2W7UA 1L4DA 2QA9E 1KXCA 3SNAA 5DK1A 1HAIH 3OY6U 1ZMJA 1LVYA 3I77A 4NIVA 3A7WA 5EU8A 2OC0A 1EB2A 1QJ1B 4UFDH 3NPSA 2A4GA 3A8AA 1O2HA 1ZPZA 4K1EA 3ELAH 2ZTXA 1SC8U 2Z3EA 2BYAX 3MU5A 1L1JA 5GIBA 1S5SA 2ANWA 2LNCA 4FUGA 2B0FA 1XUIA 2YOLA 3BG4C 1SBWA 1V3XA 1GI0A 1BBRK 3GCNA 1MU6B 2RA3A 1SLUB 4HFPB 3ODDA 1VCWA 1TMBH 2FOAA 2VIPA 2K1QA 1AZ8A 1C5RA 1ZMNA 2VH6A 1XUFA 3MTYA 4ABJA 2QF0A 3HKJB 1GBEA 2JH6D 4ISIH 4IN1A 1ELAA 4ESTE 1V2VT 1BT7A 2TGTA 2P59A 1UMAH 1UTMA 1O2QA 3SU5A 4A1VA 2XRCA 3WW7A 2A7JA 1FIWA 2Q6FA 3GICB 1LQDB 4FVBA 5DJ7A 2BDCA 5GNDA 3ZVDA 3UB0A 1G3CA 5I46H 2G52A 2O9QA 2Q1JA 1MQ6A 1LO6A 1F0UA 1XXDA 1XUHA 3TH4H 3M35A 2Z6BD 4X8VH 1GJ6A 2F9VA 2ZFRH 1W11U 1CO7E 4WH8A 2CJIA 3UPEA 1K1JA 4KGAA 1XUKA 2V6NA 5HGGA 1HAVB 1GG6B 1YPGH 4YT6H 3QTVH 2J97A 3GY8A 4HTCH 1K1OA 3S9BA 1T7CA 3TK6A 1ABJH 1WV7H 1GBLA 1UTKA 1EPTA 1E0FD 1O3AA 4Z0KA 4VGCB 4CRGA 1SI5H 1TRMA 3B8JA 4E05H 1SGEE 1GI5A 1EATA 1MTNB 3S9CA 4I8KA 4AFQA 1XVMA 2PW8H 1O3BA 3GISB 2UUKB 1MCTA 3LU9B 2ANMH 2Q6GA 1ELVA 3M5LA 1GHVH 2W7SA 3F3BA 3MNSA 3GY4A 1PYTC 1KMHB 2FO9A 2SNWA 3T29A 3TH3H 1HPGA 2J5UA 2H9HA 1FPHH 3F1SB 5T6GA 3BIUH 1ZGVA 1Y59T 3FVFB 3IWMA 3ZVBA 1MMJN 2F3CE 3M3VA 2A7HA 5SGAE 3PO1B 1O5AB 1O2KA 1O3DA 1WSSH 4P00A 1K2I1 1TLDA 2BDIA 1G9IE 6GCHG 1O2TA 4NSVA 2XC4A 2IJD1 2VVUA 3L33A 3P70B 3A88A 1NU7B 3K65B 4R8TB 5FPSA 1GGDB 1Y3UA 3DT0H 2VIOA 2AH4X 2ZQ2A 1TGNA 2OTVA 5TCAA 1Y3VA 1YPJH 5C0TA 3SNDA 1C2HA 3LDXH 2ZHWH 3PTBA 4K1TA 2VU8E 3RXOA 1SHHB 1CU1A 1VCQA 4GCHF 2Y7XA 3RDZA 4DIHH 1YBWA 4X1RU 2M2AA 4FXGH 1WCZA 4JZEH 3VPKA 2F9NA 7LPRA 3RXVA 1Y3XA 1C2IA 3ODFA 1O2LA 5JBAS 4Y8YA 4B71A 1FQ3A 1TALA 1TX8A 8KME2 4LZ1H 1DFPA 2QXIA 1YPMH 4LXBH 2XNIA 1C1WH 1TGCA 1SQAA 1AO5A 1FNIA 1SOZA 3FN8A 4K3JA 4BNRA 1E38B 5GPIB 3BN9A 2R3UA 1MKWH 1GWAA 1FONA 1WYKA 1BRAA 2PUXB 3SGQE 4AFUA 1PPZA 2C8WB 1ETRH 4CRCA 3F0OA 5FBEA 4Y71A 3GY7A 1DE7H 1HDTH 2HPPH 1Z71A 2HNTC 1MZAA 1FN8A 2G4UA 3D65E 1YPLH 1VCPA 1HFDA 2ZWLH 3E90B 2F43B 4YLQH 1P57B 3T27A 4MPXA 2Z9GA 1S83A 4X1PU 3I78A 3A7ZA 4JMYA 5GCHG 1D9IA 1TNHA 1THPB 4YLUA 1EZXC 3KHVA 1ELTA 1LPKB 3VG8A 3P8OA 3DFLA 3OU0A 4H6SB 3BTEE 3RC5A 2ZZUH 4UONA 2BLWA 1AB9B 1PPEE 2BVRH 4DT7B 3TJUA 1C4Y2 4A1XA 1TPPA 1GI4A 2ZPSA 5T6DA 4MNVA 2FOHA 2WYGA 2ZDNA 3HATH 1MBMA 1YLNA 1ANEA 1AQ7A 3LIWA 1AFQC 2WZQA 3F68H 3SU6A 1DWBH 1TGTA 4KELA 2CN0H 2RDEA 5EQRA 1HAGE 2FOGA 4NA9H 2C93B 1FAKH 2EY4C 2YMSD 5JYIA 1GMDG 5DSFA 3SU1A 1F5LA 2V35A 3EQ0H 2W6ID 4X0WU 3BF6H 3TPIZ 2HNTF 1YY3A 2TPIZ 3F2HA 2STBE 3L6PA 1TFXA 2WPIS 1TNIA 1C2DA 1ETSH 3EE7A 2JJ2D 1C1UH 1SGCA 4NFEA 3SQHE 4R0IA 1GMHF 4SGAE 1UK2A 2OQUA 4TPYA 5F8TA 5IYTA 3URDA 2BD3A 1ZSKA 2ILNA 5ETXA 1ZGIA 2XBVA 2A7CA 1SKYE 1MTWA 2AMDA 5EPYA 2UUJB 4I32A 2GV6A 1BZXE 4DURA 3SJ8A 1GCTC 2BD5A 2KFWA 1ZJKA 5AFYH 1MABB 1XXFA 1TONA 3AAVA 3SW2B 2IOTA 3FFGA 3WWFA 2ZHFH 1C9PA 3NZIA 2PR3A 4BTTB 1KXEA 4Q80A 2XBXA 4ISNA 5A8XA 1LTOA 1A4WH 1QL7A 3M36A 4ZHLU 5C94A 2O8LA 2K8IA 2UUFB 4X2YA 2VIQA 3TLOA 1MTNC 2UWOA 3QK1A 1O3HA 1NBMD 4O3UA 1EP5A 3MHWU 1DWCH 1CBWC 3BSQA 5C20A 3S9AA 1LVMA 3BTME 4F55A 3MFJA 2GZ7A 2HVXA 2M5TA 1DPOA 1YCPK 4GUXA 1SQOA 1DWDH 1MH0A 1NFXA 5B6OA 4CRAA 2ZU3A 1MKXH 4MNYA 4O97A 3P8NA 1EJNA 1CGHA 2P16A 1UVUH 2NU0E 3OYPA 3URCA 3PB1E 5LH8A 3A84A 7KMEH 2HVYB 2CMYA 5LGOA 1P3EA 4WF8A 5E2PA 3S7KB 2PTNA 4NCYA 3MNBA 3EGKH 2BHGA 5DP4A 1UVOA 2SGAA 4IC6A 1OXGA 1F92A 1Z6EA 4F4OC 1BTHH 4DJZB 1J15A 1QBNA 3GY5A 4YTAA 1AGJA 1HIAB 1UVTH 3BG8A 5CHAC 2A0QB 4AYYB 1JOUB 3M7QA 4FUIA 4XBDA 1KLJH 2KZ4A 5F8XA 1O2SA 1GBIA 1MCVA 4KTUA 1KY9A 1K1NA 1V2RT 1YPKH 3ATKA 3GYMA 1BBRE 1O2ZA 4I7YH 2CXVA 2A2XH 1GL1A 4FUHA 1U6QA 4UD9H 2W6JD 1UHBA 2PFEA 3UUZA 2GD4B 2TGDA 1GGDC 2BDYA 3E91A 3SI4H 4RT1A 2JJ1D 1O2MA 1ZTKA 1O3LA 4TT3D 3N99A 1TA6A 1EUFA 3O8CA 2ZGCA 1GJ9B 1O5BB 1S0QA 3HPTB 3MO9A 5GDSH 3ZZ6A 1ZTLA 3E1XB 1Z8RA 1RTKA 4E7NA 1AZZA 2KCAA 2NWNA 1T4UH 1FZZA 2FOCA 5J4SA 1BITA 1THRH 1O2RA 5JBTA 1BIOA 5FPTA 5FBIA 5F8ZA 1TA2A 1KXAA 2ZGHA 1EAIA 3SU2A 5A8ZA 1Y5UT 1QHRB 1CVWH 1HAXB 1OP0A 1Z8GA 1N6XA 4NA8A 1ESBA 3LJOA 5JBBS 2XW9A 4X2XA 1BBRH 4AORA 2HRVA 4NZQA 5L2YH 4ABFA 1ELEE 2VWNA 2ZPQA 2GX4A 2H5DA 5AVDA 1GHZA 2GV7A 1EZUC 5E0JA 1SFQB 2Y5GA 3U8OH 4AX9H 1GDNA 2OBOA 1QGFA 1QR3E 2UWPA 1AFQB 2PGQB 3KYGA 3KQCA 3P95A 1ZHRA 4K1SA 2ZTZA 2OINA 3PWCA 3G01A 1ARCA 2BD7A 1BMNH 3TK9A 1KYNA 2P8OB 4ACBA 1MTSA 3P8GA 2FOMB 2V0BA 4D8NA 3E0NB 2ZKSA 1ZHMA 2AYWA 1C5XB 3KYFA 2Z3CA 5EW2H 3QGNB 1GJCB 3DSOA 5EW1H 3F9HA 2RFKC 1P04A 1TOMH 1V2JT 3DCLA 5F03A 2LPRA 4PROA 5DN6D 5HIYA 4B75A 4RKJB 2OUAA 4XE4A 1GBBA 1P2NA 4AG2A 2D2DA 1V2QT 2W26A 5JDUB 1V2KT 2BZ6H 1EPTC 1E34B 1O32A 1GBCA 1O36A 1GCTB 1NTPA 3F9EA 2F9BH 2QAAA 4H6TA 1GBJA 3AW1A 5BPEA 1TGBA 1O3CA 2Y80A 1G32B 2H6MA 3QDZB 1KXBA 4ABIA 1YKTA 1CSOE 3MNCA 1IQJA 1K21H 1K1LA 3N7OA 1O3MA 1A5IA 2GCHG 1G2LA 1GCDA 3VXEH 1P0SH 2WV5A 4Z6AH 3DFJA 4X1QU 1OPHB 3U28C 3ZZ3A 1RXPA 2VVCA 2KCPA 1SLWB 5H4IB 3P92A 3ITIA 2ZEBA 5BRRE 1C2EA 1C5NH 4Q2KA 2IJOB 4CRDA 2SGQE 1ZJDA 1NPMA 1OOKB 5JB9S 1ELFA 1Z8IB 2BXUH 3K6YA 1ETTH 3UY9A 1ELGA 2ODPA 1W0KD 2NU2E 2BY9X 3BTGE 4RT0A 1QL9A 5HKKD 4B2CA 3T5FH 2ZTYA 1O2WA 1GI9B 1BMFD 3FP6E 4WMFA 5GWZA 2ANKH 1G3EA 1QBVH 2O8WA 1RRKA 1OWKA 3LKWA 3GCTF 1W0JD 2G5VA 4OS2A 5A09A 4X2WA 3RMLH 3SU3A 4MLFB 4OS6A 1E37B 2AMPA 1L4ZA 1C5WB 2ZDAH 5CHAB 2QXHA 1CA8B 2IPQX 3A85A 3VXFH 2AS9A 3K9XB 5LPRA 3VGCC 1SPJA 3LOXA 4I31A 4NSYA 4Q7XA 1Q3XA 1TNKA 1EAWA 3R3GB 2JETC 3GDUA 1N8OB 1FLEE 3MI4A 2Q6DA 4K5ZA 3RXGA 3F2GA 1HBTH 1YWUA 2OK5A 1D3PB 1S82A 3RXCA 1C5MD 2B7DH 2WPLS 1UJ1A 5HM9A 5ABWA 4JCNA 2XCFA 1SGDE 1DY8A 2JH5D 1GBKA 3KEEA 3A7YA 3A7TA 1C1VH 1S6FA 5DG6A 1L1GA 1OS8A 2VBCA 2B5TB 1OKXA 2AGIX 4TWYA 1CHOF 1ZOMA 5DPAA 1UTJA 2ZDMA 1GBAA 1FY5A 2WPDD 1P9UA 1LMWB 2PUQH 1EFRD 2FIRH 1WBGB 2D26C 5DP9A 8GCHF 1FV9A 1OX1A 1RJXB 7GCHF 4ASUD 5LPFA 3QO6A 1QRXA 3EA8A 3U69H 4YM9A 2XWBI 3NWUA 3TGIE 3QN7A 3SUDA 5L30H 3FANA 4O9VA 4XRNA 4INKA 3T28A 1TQ0B 1BRCE 1ZPCA 1ZTJA 1YYY1 3M5MA 5DP7A 1GI6A 4TY6A 1EQ9A 1ZSLA 2VB0A 2OQ5A 5ESBA 3RMOH 4KTCA 1OYTH 1RTLA 2ASUB 4ZUHA 1SVPA 2OCVB 1B0EA 3ZZDA 1BMAA 4XFQA 3SHAH 1DSUA 3HGNA 2QGRA 4CRBA 5FL7D 3PM3A 1UW7A 2G8TA 3UWJH 4GLYA 4Y79A 2BDGA 4XOJA 4CBNA 2KCOA 1QY6A 2XOKD 1TPSA 3Q3XA 2HNTE 2P8OC 4HG6A 1ANDA 1BRUP 1EZQA 1ANBA 4FU9A 2WUBA 4Y7AA 2QYIA 1FPCH 3JZ1B 1BA8B 3OEED 5A0AE 1BUIA 2ZU4A 1G37A 1O5FH 3MH6A 4ZKNU 2SNVA 5JPMH 4U2WA 1SGTA 5E2OA 2VIVA 1LHCH 3FZDA 2R2MB 3TIUA 2TRMA 1T8LA 4YOGA 4HZHA 1DVAH 5FX6A 3UNRA 4RSPA 1MD8A 2PSXA 2BMGB 4DCDA 3EE0B 1GPZA 3AAUA 1DY9A 4OGXA 4ABHA 3ZZ9A 4E7RG 4VGCC 2OLGA 1MKWK 1O2UA 1L1NA 2VWLA 1AVWA 1A0HB 3N7EA 2FTLE 3T2NA 4K60A 2JKHA 1NRRH 1LKAA 1UTPA 5DO4H 3NK8A 3OY5U 1LHDH 1A0LA 4I86A 3KIDU 2O8UA 2AGEX 3DHKH 3QGJA 3E16B 3A89A 2BQ6B 2FM2A 1O3PB 1WDIA 4Y11E 2GZ9A 3BTTE 1QBOA 4JYUH 5EOKA 4RKOB 1QB9A 5DKMA 3TJNA 1NN6A 1EAXA 3RM2H 7GCHG 2BB4A 3MMGA 4ZXYH 1C1RA 4DW2U 1DXWA 1N6YA 2KR7A 3WY8A 2F83A 1QA0A 2GDDA 3SZNA 1EB1H 3UTUH 3UWIA 4I8LA 1XMNB 1O31A 4NIXA 5F6MA 1AUTC 1UHBB 5IK2D 4JYTA 1YGCH 3BTHE 2JDID 5FPYA 4Y7BA 2SGFE 4BTUB 1BQYA 4IMZA 2F4LA 1LPZB 1EJMA 1A61H 1C1OA 1WTGH 3LPRA 1C2FA 4AGKA 1ZZZA 3BV9B 1C1TA 3RXLA 2XBWA 1PQ7A 1A0JA 1SGPE 1P2JA 1KLTA 4GAWA 5CE1A 3Q76A 1E1RD 4JZIA 5FCKA 3W1EA 2PKAB 2Y81A 2GVFA 3Q77A 5CMXH 3P8FA 1BHXB 3R0FA 1O37A 3CNRA 3SUEA 1P02A 3VGCB 1BTUA 3DD2H 2H2ZA 1HUTH 1VJAU 3DUXH 6CHAB 3RXIA 1N8OC 2CV3A 3GYLB 5KECA 1SL3A 4ZKRU 5C67A 1NRQH 1BTYA 1C2KA 2D1JA 4F48B 1OWHA 3U98H 1IOEA 2FYQA 2H9EH 3O8BA 2WPHS 1D3DB
chains in the Genus database with same CATH topology
1S0RA 2SFAA 1GVZA 1A5GH 3M7TA 3TGJE 1GJ5H 2FMJA 1ZPBA 3UOUA 3ZV9A 5L6NH 4AOQA 2PKSB 2FP7B 1O3GA 3A80A 3RXHA 1DUEA 2SGPE 5E0HA 3U1JB 1TMTH 3CP7A 4BTIB 3LH1A 2D8WA 3NUMA 1HJAB 2BX4A 2J34A 1K28D 1C4V2 2FI4E 2WUCA 3V7TA 1NZQH 1DICA 1MAYA 1HRTH 1Q2WA 2ODYB 1GMHG 5E0GA 4CRFA 3UREA 1TABE 1RIWB 2QXJA 1S85A 2O8TA 3E8LA 4X6MA 4AB8A 1FIZA 1FI8A 2PWXA 2XC5A 3A8BA 4ZMAH 2F91A 1BTXA 1P03A 2KAIB 1QA7A 4YO9A 2ZIQH 1FAXA 1EAUA 4B1TA 4I8HA 1QTFA 1BDAA 4DGJA 3LGVA 1O3KA 1O2YA 1FDPA 3M3SA 5FXLA 3BTQE 1INCA 3PMBB 1PPFE 2AIQA 2GP9B 4UDWH 4THNH 5A0BA 5J4QA 1HXFH 5L2ZH 3QLPH 3A81A 1JRTA 1O5EH 4AGJA 3RLYH 1TNGA 2C8YB 3RXSA 1H9IE 3M3TA 1CGJE 3EA7A 4TY7A 3S0NA 1C5LH 1N1LA 1EX3A 2GMTB 2A4RA 1AVGH 3ZV8A 3MNXA 5FX5A 7ESTE 2W5EA 1SHYA 2FYRA 3GY6A 1A3BH 1C1NA 1PPHE 3RC4A 1YLDA 5T6FA 2JETB 1PYTD 3O8RA 4JZFH 2ZDKA 2OP9A 2FX4A 3F9GA 2ZFPH 1UO6A 2ZO3H 2WV4A 1V2NT 2G4TA 4J2YB 3L3TA 1EASA 1IQIA 1ARBA 2A1DB 4MPVA 3GDVA 4AFZA 2P94A 4CH2B 1A3EH 3SBKA 2BLVA 3K6ZA 1UCYK 2FLBH 3ZZAA 1O3FA 1GJDB 4CBOA 1RFNA 2FEQH 2ZU1A 3NXPA 4INLA 2XXLA 1O2PA 2BTCE 2JH0D 1O3OA 1ID5H 1B0FA 1ELDE 3MU4A 1O3EA 1WQSA 2C4FH 2BOHB 1B5GH 1YPEH 5GJ4B 2BZAA 1QCPA 1TNJA 3U8TH 1J8AA 1PPGE 1LHGH 3PROA 2FZZA 1H4WA 3ATLA 1FY4A 5JBCS 4TPIZ 1WQVH 1O3NA 1Z6JH 2FOEA 5AF9H 1DXPA 5FHTA 4AZ2B 1KDQB 3RXFA 1HAZB 3EYDA 2BD9A 4ZHMU 4LZ4B 1LVOA 1T32A 3ZVEA 2FODA 1J9CH 2W3IA 4Y76A 3RXDA 3ZVFA 2VGCB 3TU7H 3UNQA 1LCYA 1TMUH 1ZSJA 1ZMLA 4BXWA 3LH3A 1HYLA 1GHWH 2O8MA 3HK3B 1IQGA 2J38A 3TJOA 3SNEA 1BCUH 3STJA 1BHXF 3V13A 1W14U 1UVPA 1VGCC 1Z1IA 4D7FA 1JXPA 3ZZBA 4WXIA 3TITA 1RD3B 2YNAA 1F7ZA 4D9QA 1D3TB 1YPHC 2PKSC 1ZYOA 4IGDA 1DSTA 1MZDA 5DP5A 4ZHAA 3ZVAA 3LGUA 2PHBA 4TYDA 4Y8XA 1V2PT 1K1IA 4E06H 4UFFH 1CQQA 2G51A 2Z7FE 5A8YA 4K8YA 5C3NA 3SGAE 1TNLA 4ZAEA 5C5NA 2NU3E 1ZRBA 2WPJS 5E8EH 2OXSA 2WYJA 3BEFB 1HJ9A 1CT0E 4MPUA 1GJ8B 4I8JA 2B9LA 2ZFSA 4D7GA 1TBZH 3GCHB 1RIWC 1D4PB 4MG3A 9ESTA 1IQLA 1TRNA 4X6OA 2V3OH 3TGKE 1TGSZ 5HM2A 1F5KU 4J1YA 3TK5A 1IAUA 2BD8A 5TCCA 1VITF 1H9LB 4B2AA 2CF8H 1IQFA 2HALA 1WU1A 5GXPA 3SV6A 1MUEB 1NT1A 2PTCE 3A87A 5LPEA 3SHCH 2A31A 2F9UA 1V2ST 1CT2E 1KTSB 2ODQA 4BOHA 4AN7A 1QJ6B 4X6PA 3UQOA 3RUOA 1C5PA 1RTFB 4NIWA 2CGAA 3SOSA 1K9OE 2CHAC 1HGTH 3GDSA 1CGIE 8ESTE 4DOQA 1P12E 3K2UA 1BOQA 4Q7ZA 4FVDA 5FCRA 3TH2H 1VJ9U 1L2EA 3PMHB 3BG4B 1GHBG 1HJAC 4GCHG 1C2LA 1BB0B 2AMQA 4ISOA 2F9OA 4XDEA 3GCOA 2QCYA 2ZNKH 3PLPA 2SGDE 1NESE 2CF9H 3DA9B 3PV4A 3MH7A 3O8DA 3VB5A 1F0TA 3LC5A 4BAMB 1O35A 2FPZA 2BLQA 1NU9A 1G36A 3E0PB 1GG6C 1PQ8A 4X2VA 2STAE 2OC8A 4MNXA 2H5CA 2UWLA 1J16A 2Z9JA 3CENA 4X8SH 1Y3YA 1ABIH 4Y0ZE 4B74A 2ZU2A 3EAJA 4A7IB 1PQAA 1AU8A 2AERH 1J14A 2QIQA 4GHQA 2C90B 2P3FH 1ORFA 2QC2A 1EOLA 2H9TH 2C8ZB 1QRZA 4K69A 1C5ZB 2WPMS 3U1IB 3KGPA 1P11E 2Y6TA 3SV7A 3LGTA 1G3BA 1NS3A 1P2OA 3AVZA 2A4OA 1HAPH 1VITH 4YZUA 1GJBB 4INHA 2UUYA 4GVUA 4K2YA 3B9FH 1GVLA 4QT8C 1XX9A 3HKIB 4ZKSU 2VVVA 1AN1E 1E35B 1TBQH 2A5IA 1ELBA 2G81E 2THFB 1YF4A 3ZVGA 4A6LA 4DVAU 2RA0A 4OS1A 4OS7A 5DP8A 1JMOH 4FUJA 1HNEE 4X1SU 1C5OH 1KXFA 1P2QA 1D3QB 1ZR0A 2FWWA 1HV7A 1S81A 1ESTA 1IHSH 2ZG0H 2IN2A 2ZA5A 2J9NA 3EA9A 1O5DH 1HJ8A 2ZGXH 2FI3E 4ABGA 2ZDLA 1TAWA 3LGWA 2BDBA 1O2VA 1FXYA 1DWEH 4GPGA 1GMCF 3U9AH 1TRYA 1O30A 4NIYA 1BTZA 3QWCH 1EXFA 4B73A 2P93A 1MD7A 3TNTA 2PV9B 1NRSH 3Q00A 4FUCA 1F5RA 3V12A 3OTJE 1D6WA 2FS9A 4I8GA 3MH4A 1XUGA 4FUDA 5EQSA 1BTPA 4CH8B 5I25A 2ZU5A 4IS5A 2GT7A 3PMJA 2FESH 2VIDA 1LVBA 2Z9IA 3W94A 1O2XA 1X7AC 4XBCA 4NWKA 1GI8B 1HAVA 2GTBA 3UIRA 1LHFH 2FI5E 5HXFA 1TBRH 3SN8A 1W7GH 2HLCA 2OC1A 1EOJA 1EJAA 1XUJA 2OBQA 3SUFA 1V2OT 2EA3A 1OWEA 3STIA 1W3CA 3RXPA 1VGCB 1QB1A 3RXEA 1P3CA 4CR5A 2ZDVH 2ZCHP 1GHAF 3FAOA 2BOKA 2KAIA 1MTVA 2R9PA 3GY3A 3VB4A 8GCHG 1SLXB 1C4U2 2ZF0H 3KQBA 2PSYA 2QF3A 3NKKA 4ZROA 1ELCA 3BEIB 1UK4A 1IQEA 1MKXK 1P2MA 3KCGH 1AKSB 1AB9C 1P9SA 1OYQA 2J95A 2W3KA 4X8TH 1O2IA 3RXAA 1FY1A 4MVNA 3BTFE 4BAOB 3SGBE 2ZFTA 1E36B 3H7TA 5DP6A 1O2OA 4DY7B 3PWBA 1SGNE 3KQDA 1HXEH 4WY3A 2ZHEH 2QV1A 1BTWA 1TQ7B 2BY5X 1WOFA 1KTTB 1P01A 3OSYA 4NG9H 2Z3DA 1ZRKA 4Q7YA 4CREA 3E3TA 3LONA 1GI1A 3HGPA 2CHAB 2G5NA 3ZZ8A 3BIVH 3SV8A 4IW4E 1Y3WA 1Z7KA 1O5GH 2XBYA 2VNTA 1TIOA 4WXVA 3U8RH 1F2SE 1P2IA 4A92A 4OGYA 3FZZA 1BJUA 3SV9A 4ISLA 2TIOA 2VH0A 4OS4A 5DP3A 1VZQH 1KXDA 3SNCA 1QB6A 4Y6DA 3TNSA 1GMCG 2GZ8A 4NWLA 3QUMP 3F9FA 1KIGH 1DM4B 2DE9A 3RXUA 1CE5A 1CA0B 1VR1H 2XCNA 1C2MA 2ZCKP 1O3IA 1KSNA 4B2BA 2ZC9H 1H9HE 1DUAA 3UOPA 3UFAA 1T8OA 2GCTC 2Z9LA 1H8DH 1UCYE 1GI3A 5EQQA 1H8IH 3Q3YA 4UFGH 6ESTA 2ZFFH 1W0ZU 3MOCA 3ZVCA 5JB8S 3KF2A 2FOFA 4HI3A 4WWYA 1UK3A 1GHYH 2GDEH 3SU0A 1W7XH 2FXRA 1AY6H 1GHBF 3KQEA 1JIMA 3GOVB 1BMLA 2Y7ZA 3UR9A 4I33A 1GBHA 3PTNA 1KDQA 1HCGA 2HOBA 1K1PA 1YM0A 4BAHB 2HPQH 3NCLA 6GCHF 2AIPA 3ZZ4A 4BANB 2GKVE 3SUGA 4HGCA 2OD3B 1XKAC 4CHAB 1C1SA 1FN6A 5C5OA 1DLKB 2QXGA 2H1UA 1DDJA 2QY0B 1TPOA 1WUNH 2GT8A 1YPHE 1JWTA 4MTBA 2G00A 2Z9KA 3RU4D 1TX6A 4LK4A 2FX6A 1CBWB 1Y5AT 1J17T 3JZ2B 2Y82A 1QIXB 3H5CB 4DG4A 4YOIA 1W0YH 2YNBA 1O39A 5AHGH 2Y5HA 9LPRA 1GJ7B 1AKSA 3P6ZB 5EODA 2BVSH 4JK5A 1BRBE 3LT3A 1TYNA 2A32A 3QZRA 2BD4A 2RG3A 3LJJA 1MBQA 4NZLA 2BD2A 1QQUA 2ANYA 2J2UA 1GJAB 3FP8E 3T26A 2C8XB 5EXMA 3E6PH 1GI2A 1TOCB 4XBBA 1P06A 1QNJA 2EI7A 3QTOH 4BAQB 3RU4T 1P8VC 1DX5M 6CHAC 3CS0A 3H7OA 2WPKS 1O2NA 1SOTA 3M7UA 4WMDA 3QZQA 3M5OA 2NU1E 5G4BA 4Y8ZA 1OWIA 3ATWA 1C2JA 3UQVA 1SLVB 3BTDE 4A5TS 4B76A 1SSXA 1O33A 2BVXH 5HMAA 1VITG 5TJXA 3SJOA 1IQNA 2PGBB 2ULLA 3ZZ5A 2PLXA 1M9UA 2J92A 1SG8B 1YC0A 2J4IA 1RGQA 1LQEA 1KLIH 4X8UH 1NM6A 1QJ7B 3A8DA 4CR9A 3MU1A 4H4FA 1T4VH 2BY8X 2PKAA 5GCHF 4UE7H 3BTKE 4NFFA 5EPNA 1AE8H 1AI8H 1MQ5A 2HGTH 1O0DH 1CHGA 3RMNH 1DT2A 1SGFA 1YP9A 2IPHA 4ABBA 4ASHA 1V6DA 2A5AA 3A7VA 2RDLA 3RM0H 4GSOA 3BTWE 2R2WU 3LC3A 3GY2A 3RMMH 3SV2H 1A7SA 3PLBA 1O2GH 1ZLRA 1C1QA 3SU4A 3ZYEA 2FOBA 3VEQB 3T25A 1OSSA 3RC6A 1TPAE 2I6SA 4ZXXH 2ZP0H 1SFIA 1C5SA 4BAKB 3LGIA 4FUFA 3VB7A 5EXNA 3V3MA 1UVSH 5FAHA 5A0CA 3ENSB 1P09A 3RLWH 4ABDA 1DLEA 1MTUA 1O5CB 2BDHA 3FP7E 4YT7H 4AG1A 4ZKOU 1HAOH 1SGYE 3C1KA 1GJ4H 1C2GA 1V2TT 1CT4E 1GBDA 2BQWB 5K7RA 2BY6X 1FY8E 1CA0C 1C5YB 4RN6A 2BY7X 3RXTA 3ESTA 4DIIH 6LPRA 1RS0A 1EPTB 4IBLH 1Q31A 4JZ1A 4AFSA 3MU8A 1C5UA 1SGRE 8LPRA 2XC0A 1TWXB 3PLKA 1AHTH 1C5VA 1GL0E 1JIRA 4TWWA 3P17H 4O03A 2V3HH 1Z8JB 2AEIH 1FJSA 1IHTH 2P95A 3VB6A 3VB3A 4WVPE 4F49A 3BEUA 1YCPH 3M61U 2GCTB 4M7GA 1Z1JA 2BLOA 1NO9H 1C9TA 5A2MH 1EKBB 3D23A 4ZH8A 1HIAA 1GI7B 1GVKB 3PMAB 1V2LT 3RXBA 3IITA 1F0SA 2EI8A 4MPWA 4U32A 1OP8A 4ABAA 1ACBE 1LHEH 1PQ5A 1DS2E 3RXJA 4CHAC 5PTPA 5EXLA 3MO6A 1AWHB 1ZHPA 1EP6A 1QL8A 1CHOG 1TB6H 3SI3H 2BX3A 5AFZH 4FUBA 1GHXH 1NFYA 1AWFH 1O2JA 3MU0A 2ESTE 5ESTE 1NRNH 3QX5H 1O38A 3MH5A 3RU4E 1NC6A 3EDXB 4KP0A 2C3SA 3B23B 4K8BA 4MDSA 2B8OH 4BXSA 2F9PA 1QURH 1LPGB 3ATIA 3SJKA 3A8CA 4FU8A 4JZDH 1MU8B 2FS8A 2A4QA 1XVOA 2Y5FA 1WAYB 1XKBC 3A7XA 4U01A 1BMMH 1JRSA 1NRPH 2BDAA 2NU4E 1PFXC 4MQAA 1BJVA 1A2CH 1DITH 3PO1C 4AB9A 2FTMA 5HYOA 1T8NA 2ZHDA 2ZI2H 1GHAG 4JYVH 1S6HA 1T31A 2ZFQH 4YESB 1H1BA 2XTTB 4KTSA 1LKBA 1SGFG 3A83A 3MWIU 5EGMA 3KNXA 4A1TA 3SJ9A 1F0RA 2DUCA 2Z94A 4X1NU 1SMFE 2ZQ1A 5C2ZA 2GCHF 1FMGA 1QRWA 4ABEA 4IC5A 4KKDA 3SNBA 4H42U 2RCEA 1HLTH 2FLRH 4WH6A 1TE0A 2BM2A 3IG6B 1NY22 2DE8A 3HK6B 1D6RA 5C1YA 1JBUH 3V0XA 4U30A 5C1UA 2A45B 1WTHD 1AMHA 1AVXA 3RXMA 1GMDF 3OX7U 1PPCE 1W10U 3UR6A 1V2WT 4NA7A 2ZGBH 1AFEH 2ZHQH 4LOYH 3ZZCA 1DOJA 2VGCC 1THSH 5C1XA 1C5TA 1YCPM 3KL6A 4UEHH 2QN5T 4FU7A 5EG4A 1AUJA 1NROH 2XYAA 4FUEA 2TGAA 2WINI 1V2UT 4D9RA 1K1MA 3RXKA 2GMTC 3S7HB 2TGPZ 2A2QH 1MAXA 2VWOA 4SGBE 2EI6A 2VJ1A 5T3HA 4JK6A 1C1MA 3VFEA 1K22H 3AW0A 1OWJA 4IN2A 5K0HA 1PJPA 1FUJA 1AE5A 1LDTT 3ZYDA 2A5KA 4GHTA 1Y8TA 3RXQA 1AIXH 2ZCLP 3A82A 2I6QA 3SORA 3Q3KA 1L0ZA 3RXRA 1GBTA 3RP2A 4OS5A 4Y10E 1XM1A 1W2KH 1UTQA 1IQMA 3F6UH 1NFUA 1QFKH 1SGIB 4X6NA 2ZPRA 1YLCA 1UTOA 1W8BH 3SJIA 3M5NA 1OP2A 3KN2A 4YOJA 1PPBH 2FDAA 1A46H 2TBSA 3SQEE 2EC9H 1V2MT 1O34A 2GGVB 2P3UB 1P2KA 3A86A 1A1RA