1UHBB

Crystal structure of porcine alpha trypsin bound with auto catalyticaly produced native peptide at 2.15 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
SSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Trypsin activity reduced by an autocatalytically produced nonapeptide
pubmed rcsb
total genus 19
structure length 98
sequence length 98
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uhbB00
2A7HA 1EAUA 1MU6B 1PPHE 4WY3A 4BAKB 2GGVB 2VWNA 2PSXA 1OOKB 5C67A 1MKXK 3MNBA 1GVLA 4K8YA 2XBXA 3TITA 3PMAB 2ZCHP 3QGJA 4JMYA 4AFQA 1H9LB 1CGHA 2OBOA 4E06H 1V2UT 4J1YA 1BZXE 1EKBB 2ZFSA 4JZEH 4O03A 1W7GH 2BB4A 1HAHH 1O5BB 2XCFA 3ZVFA 3OSYA 3RC5A 3UNSA 8GCHG 5EG4A 2A2XH 1GJ4H 1V2NT 1Y3YA 3CS0A 4O9VA 4DG4A 5G4BA 2BY7X 2H2ZA 2PUXB 1DXWA 1ABIH 1PPBH 3SNEA 2GCTC 1F0UA 3TU7H 2QXIA 2VGCC 3TVJB 1YYY1 4CR9A 1ZMJA 4I7YH 2ZGJA 1MD8A 1EJMA 4Y0YE 1A3BH 5DP8A 1Z6EA 1S6FA 5AFZH 4ZHAA 1A1RA 1Z8RA 2ZFPH 1YBWA 2OC7A 2QA9E 1ZTLA 2W3IA 1O39A 1GG6B 2Y5FA 1B7XB 1J8AA 2G52A 1ELTA 1CHOG 5DGJA 1YCPH 1C2HA 2OBQA 2VVCA 2VWOA 5GDSH 1O2KA 1YPJH 1FJSA 2FI3E 3TK6A 1LVMA 4ISLA 1LQEA 1ZTKA 5DP9A 2ZKSA 1O3CA 1P2KA 5TCAA 7LPRA 2WPJS 4B2AA 1V2ST 2A31A 2BDIA 2TGPZ 6CHAB 3TJOA 2BDYA 1NESE 4DY7B 3SNAA 2EI7A 2GD4B 2FS8A 3TJNA 4DIHH 5E2PA 1QRXA 1S84A 1Y3XA 3MO3A 2GZ9A 3URCA 1D4PB 1ZMNA 1FPHH 1GGDB 1SGDE 1IAUA 3VB4A 5FBEA 1GDUA 2GTBA 1MKXH 2PHBA 3AW0A 3DT0H 3E16B 4AG2A 2BDBA 2Z3EA 1DLKB 1GI4A 1BTWA 5CMXH 1O2QA 1O3KA 2BQ7B 1OWHA 2AGIX 3F9EA 5J4SA 3CENA 2D8WA 4AFZA 1KSNA 3MFJA 1ZSKA 5A0BA 3GY2A 4BAOB 3PMBB 1EPTC 2C90B 2NU4E 4GSOA 3SNDA 4NIWA 1PQAA 5HMAA 2AIPA 4AB8A 3GCHB 5C1YA 4WF8A 3WY8A 1ETSH 2FX4A 1BCUH 4AB9A 1BRAA 1ELEE 2FDAA 1ZRKA 4K60A 5CHAC 1P9UA 5JBCS 1T8LA 2VJ1A 1TAWA 2W5EA 4ZKRU 2BD2A 1N1LA 1EPTA 4B75A 4K1EA 5EGMA 1SGNE 1HAVB 1AI8H 4JZFH 5H4IB 2FYQA 3EDXB 4I32A 4B74A 2ZHDA 1ARBA 3KIDU 1EX3A 1HAIH 3NZIA 4TPIZ 2G4UA 1T4UH 3A7XA 1RTKA 1FY1A 4K5ZA 5GJ4B 2ZDKA 2TPIZ 2TGDA 4OGXA 1FXYA 3E6PH 3EA9A 3F1SB 1TALA 5DP3A 2FX6A 1GJ8B 1C9PA 1JIMA 3MH5A 1NU7B 1HFDA 1F5LA 1THPB 2GV7A 1SGTA 3SV8A 1FY3A 3VB3A 5A09A 3U1JB 2GCHG 1S85A 1UVUH 3S9BA 1UTJA 1Y3VA 2SGFE 3ZVDA 4BNRA 1Y59T 1DWBH 1GBIA 2O8MA 1AQ7A 1MQ5A 4ISIH 1XM1A 2A1DB 2GCTB 1W0ZU 1KXEA 4WXIA 1ETRH 2HWLB 3ATWA 1V2PT 2VGCB 1P11E 1K2I1 2C8ZB 2VIQA 1KLTA 1CHGA 2HPPH 2ZU1A 2A0QB 3FANA 4GHTA 3ZVBA 1TE0A 1T7CA 2PWXA 4UD9H 1ESTA 1DICA 2ODPA 1ELCA 3FP8E 1EATA 1O5EH 1DM4B 1IQKA 2BQ6B 3SGQE 1LVYA 2ZPRA 3MHWU 3RUOA 1ZJDA 1JMOH 2BLOA 3Q3XA 4BAQB 3M5LA 1IQIA 5A2MH 5LPEA 4XDEA 1AVGH 5F8TA 3A7ZA 2AERH 1HGTH 9LPRA 1SGEE 3RM0H 2GKVE 2WUCA 3V7TA 4MDSA 4X2WA 1C5TA 3V3MA 1NN6A 3RXLA 1O5DH 1P8VC 2VB0A 4CR5A 1CO7E 2UUYA 4XSKU 3MWIU 2ZCKP 3GY7A 1SGRE 3SNBA 4KGAA 4YZUA 3W94A 4XE4A 1B5GH 1ESAA 4UFFH 3GY4A 1TNIA 1QA0A 4WXVA 1HJ8A 1GI0A 2Q6FA 1GBCA 3A7YA 3TIUA 1OKXA 3SUFA 4DOQA 1NC6A 5EQQA 1O3DA 1QL8A 7KMEH 1V2MT 3NWUA 4B1TA 1ZGVA 1DSUA 1ZPCA 1WSSH 2BX4A 4Q80A 1GBHA 4R8TB 1HDTH 2ANMH 3RU4D 4K1TA 4XOJA 1TLDA 1O2LA 2BOKA 3K2UA 3U9AH 4X8SH 1W7XH 1EPTB 1GI5A 2GX4A 1W8BH 1V2JT 2B5TB 1KXCA 3VGCC 4K1SA 1BDAA 1OP0A 4X2XA 1AN1E 1SGIB 2ALVA 4X8UH 1EP6A 4BXWA 3BEIB 2ZDAH 2Z9IA 2XC5A 4I8LA 1GHAF 4I33A 4TY6A 3MI4A 3PTBA 3S69A 1WCZA 5EU8A 3BSQA 1AIXH 1QB1A 4B2BA 1EP5A 2C8YB 3S0NA 2RA3A 4WH6A 1C4Y2 2Z3DA 3GOVB 3AVZA 2PW8H 4B2CA 4ABJA 1W2KH 2TGTA 1O38A 3BTTE 1CBWC 1MTNC 3LGIA 1ZYOA 2IJOB 3FP7E 4Q7ZA 1YPKH 3QDZB 4FU9A 3JZ2B 4Y7AA 1EJNA 2HLCA 1GBTA 5EXLA 3T27A 4A1TA 3ENSB 1GBLA 1FV9A 2KAIA 1T8NA 1TMUH 3D62A 1UTPA 1YPLH 4ISHH 1HAZB 3QTOH 3A8DA 3U8TH 1F92A 3RXKA 1YPGH 3PB1E 3BTKE 1RFNA 5F6MA 1CE5A 1P2IA 1O3OA 1VITH 1FUJA 3A82A 1ZHPA 1CVWH 2Y7ZA 2G5VA 2IOTA 2HALA 2QC2A 4MPUA 3GCTF 2CF8H 1EAXA 1E37B 1TX7A 1EZSC 2ZU5A 1TNLA 3HKIB 3PLKA 5C5NA 5J4QA 3M7TA 1TA6A 1JWTA 1TRMA 3SU5A 2DE8A 4NWLA 3A8CA 1TBZH 1AGJA 1T32A 1MUEB 2XWAA 4E7RG 1C2LA 1VJ9U 1TOCB 4XFQA 1GI8B 1TNGA 1BQYA 1SLXB 1HIAB 4M7GA 1GI1A 1P03A 1UK3A 4TWWA 2PV9B 1GJCB 3STIA 1W10U 1C5RA 1UJ1A 3QWCH 1PPEE 4D7FA 2OC0A 3TNTA 3EA8A 3LC5A 1BTHH 3V12A 2FOGA 5BPEA 1GVZA 3UR9A 2YNAA 1LPKB 2Y6TA 3SUDA 1GMDG 2A5IA 2OXSA 1O2PA 2GZ7A 3V0XA 1QGFA 4H6TA 1CT4E 1C2KA 1C4U2 2I6QA 1BITA 3GDSA 1MKWK 3IWMA 1ZRBA 4MPXA 1P2OA 2BDAA 5DK1A 1C2GA 1C1UH 5HM2A 1FPCH 3A81A 4NCYA 1ABJH 1L1GA 3RDZA 1SPJA 4KTCA 4MPVA 1MTWA 1NPMA 1TQ7B 3SOSA 3RXJA 2BXTH 1THSH 3ZZ5A 2BOHB 2F83A 3P8FA 5EOKA 4OS5A 4CHAC 1N6XA 3VGCB 1C5YB 1O30A 1QB9A 1K1IA 1DS2E 2VH0A 1F0SA 2HGTH 2Z9KA 4UFEH 1LO6A 5LGOA 1NFWA 1C5ZB 5IDKA 4DGJA 4A7IB 2FIRH 2WPMS 4IC6A 4XBDA 4YM9A 1P04A 2BHGA 4UFGH 1EQ9A 3KGPA 4LZ4B 2YOLA 1QBOA 1QCPA 2NU3E 4AOQA 1N8OC 3GY8A 3MNCA 3RXAA 1GBAA 1GL0E 1FAXA 1VZQH 3KNXA 1QL9A 3E90B 1UVPA 3UR6A 2ZPQA 1NRRH 1ELGA 1AVWA 1O2IA 2KAIB 2FYRA 1H4WA 1ZTJA 2OLGA 4Z6AH 1CBWB 1MTNB 1EB2A 2O8UA 2J92A 1DX5M 1LHFH 2ZU4A 5T6DA 4Y76A 4FUIA 3DHKH 2G8TA 4AFSA 3F9HA 3U98H 4UE7H 3TGJE 2G4TA 3QX5H 5GXPA 3UOUA 3I77A 1T31A 2AMQA 1TGCA 3ZZ4A 3TK5A 3S7KB 3A86A 1YGCH 1ZJKA 2XC4A 1GPZA 1GHVH 1V2RT 2FOBA 4JZDH 3SBKA 1L4ZA 2C4FH 4NZQA 2ULLA 2VNTA 1MMJN 2FOAA 1Z7KA 4CRAA 1BUIA 4AORA 1O3EA 2J95A 1DLEA 3DFJA 2ZQ2A 1MQ6A 1FAKH 3SV2H 1SGYE 1S6HA 1ZPZA 1BHXB 2AH4X 1CGIE 1SFIA 3NXPA 1BTUA 1A3EH 1GBEA 2BMGB 1E36B 2FZZA 2Q6DA 1XUHA 1ACBE 2ZTZA 5C1UA 1ZSJA 3K9XB 1ZHMA 4D9RA 2JKHA 1HUTH 1GHYH 3EE0B 1YCPK 1O3HA 1SGQE 4YOGA 3LDXH 4CRDA 1Y5AT 3BTQE 1SR5C 5EPNA 3SW2B 1HCGA 1P9SA 1C5LH 3SO3A 3GYMA 2ZTYA 1C1QA 1A7SA 1JRTA 1RTFB 4DT7B 4ZHMU 4ABFA 1O2JA 2QN5T 1XX9A 1EZXC 4RKJB 3U8OH 4GPGA 4NFEA 3BIVH 2W3KA 1UTLM 1H8IH 3LJOA 3QZQA 5DP5A 3T62A 2ZGCA 3SHCH 1P01A 1MTSA 4LXBH 2BD5A 1PYTD 2BVRH 1KDQA 1KY9A 2F9BH 2EI6A 2TIOA 3TGIE 1K1NA 1GJ7B 2P16A 5FX6A 5L2YH 3RXOA 4IBLH 5ESTE 1EZUC 4FUJA 3SGAE 1MZAA 1O5AB 4E05H 1KYNA 1P2NA 1C5NH 1O2HA 1OS8A 1GI3A 1MBQA 2A4RA 1XKAC 3ZVGA 1FZZA 1QR3E 2ZGBH 5LH8A 4BANB 4OS6A 5DP4A 5JBTA 1Z1IA 5I46H 3P6ZB 1NTPA 1A0JA 4JZ1A 1ZLRA 1W12U 2JETC 1UCYH 1ZSLA 1H9IE 4CHAB 2JH6D 4X8VH 1HLTH 3ZZ7A 1VCPA 1P12E 1AHTH 3FZDA 1KTSB 2OTVA 4X6PA 1F7ZA 1O3LA 2FPZA 1L1NA 3UNQA 5C20A 6GCHF 1IQEA 5L30H 5ESBA 2B9LA 4IN2A 1V2WT 1RS0A 1SGPE 1ZPBA 1N8OB 2H1UA 3OYPA 4Y8ZA 1TPAE 2BY9X 1LHGH 2GMTC 3GY3A 1EAWA 5JB8S 5DP7A 3MU8A 1O2ZA 1W0YH 3SU1A 1BBRH 3PWBA 1S81A 2ODYB 4AX9H 2TBSA 1QTFA 4NSVA 3RXGA 3KQEA 3SQHE 1MCTA 2XBVA 4Y10E 1IQNA 2H6MA 4ZMAH 2CMYA 1C5XB 5K0HA 1P3CA 1D9IA 1Q2WA 1WOFA 3BG4C 2ZDLA 2J2UA 3SU3A 1OXGA 2BD7A 2BM2A 1LQDB 6LPRA 2WYGA 1DY8A 4H4FA 2BX3A 1CT0E 2ZDNA 4OS4A 3EGKH 1NRPH 3MU5A 1O5CB 1XVMA 2PUQH 3E0PB 1F5RA 3F9FA 3RLYH 4B71A 1GMHF 1J17T 3T28A 1LMWB 1BRUP 5CE1A 2A4OA 1O2NA 3PWCA 3RXFA 3Q76A 1TWXB 4AN7A 4FVDA 1QJ6B 1GDQA 5E2OA 2ANWA 1LKAA 1AUTC 1C5PA 3HATH 4IC5A 3CS7A 1FY4A 3SUEA 1AE5A 3HPTB 1X7AC 3O8CA 4I8GA 1NT1A 2WUBA 2BYAX 2J34A 1QQUA 3PO1C 1GJ5H 2ZHFH 1Y3WA 3AW1A 1C5SA 1FNIA 3ATLA 3GCNA 1G2MA 1VJAU 3CP7A 2ZQ1A 2Z94A 1E0FD 3S9AA 3F68H 3LT3A 5JB9S 1GBBA 1IQMA 2ZECA 2QV1A 2QIQA 4NIVA 3U8RH 3MNXA 3B9FH 3VPKA 2B8OH 1O2XA 5HGGA 1NFXA 1V2VT 3RU4E 1PQ5A 3FZZA 2FOCA 3QLPH 1O2UA 3EA7A 1S82A 2F91A 1VITF 2Y7XA 3FAOA 2FS9A 4UEHH 3ATMA 1A0LA 1EB1H 2Z3CA 1G37A 6ESTA 5T6GA 4X1SU 2ZFTA 1TBRH 7GCHF 1INCA 1KIGH 1QJ7B 3SUGA 3A84A 1SI5H 3SZNA 3RXCA 4Y8XA 2BLVA 3LH3A 4CH2B 2BD9A 3NK8A 4LZ1H 3RMMH 4I8JA 4X2VA 1ELBA 1BMLA 2WPLS 8ESTE 4TPYA 5LPFA 1WV7H 5GWZA 1WUNH 2JETB 2THFB 4LOYH 3GDVA 1O2RA 4DURA 1GJ9B 1C9TA 1GHZA 1CSOE 4NA8A 1AFEH 2PLXA 1O3FA 1D3TB 4YESB 5F03A 3P95A 2ZCLP 4MPWA 4A6LA 1QBNA 1GHAG 3TLOA 2J38A 3AAUA 1AWFH 1Q31A 1LPZB 4INHA 2PR3A 2XYAA 3STJA 3FVFB 3SI3H 1TOMH 2BLQA 2SGDE 2GMTB 3ESTA 4YLQH 3Q77A 2FESH 1ESBA 1K28D 1Z1JA 2F9OA 2WINI 4JK6A 4AZ2B 1O37A 5A0AE 4FUGA 1PPCE 4MNVA 3LGVA 2A2QH 1O2TA 3E1XB 3HKJB 4IMZA 1ZGIA 2ZHEH 3M36A 1ZHRA 2BLWA 4NG9H 2OP9A 3NKKA 1A46H 1LHEH 3BG4B 1KXAA 2ZG0H 3SU2A 3MH6A 1FI8A 3UREA 3ATKA 3A87A 2BD8A 3TH3H 2P3FH 3RXIA 1W11U 1HAPH 1H8DH 4X2YA 2J4IA 1UHBA 2GT7A 3U1IB 2CGAA 2EI8A 1A4WH 3ZZ9A 4J2YB 1AKSA 4Z0KA 3A8AA 2SGAA 4YT7H 1SOTA 2SGQE 3GCTG 5SGAE 4FUBA 1OX1A 4Y79A 2C3SA 3T5FH 1NFUA 1G9IE 1ZZZA 1J15A 2D2DA 1NZQH 3A83A 3A7TA 1IQJA 1GHWH 1UCYE 2B7DH 1SLWB 1RIWC 2RDLA 5FAHA 2VIWA 1QBVH 3ITIA 3PO1B 3ZZCA 1TPOA 3TJVA 3B8JA 1K21H 3P8OA 1GI2A 5B6OA 1EJAA 1ELFA 4ZUHA 3SU6A 4WMEA 1HAOH 2I6SA 2QYIA 1LCYA 1O31A 4JCNA 3L33A 3BTFE 4YT6H 3GY6A 4KKDA 3URDA 1GCTC 2HPQH 3SJKA 2A45B 3M3TA 2ZF0H 2HVXA 1BTPA 4ZAEA 4AYVB 3OY6U 1MU8B 2AMDA 4ZH8A 1BBRE 3SN8A 1TRNA 3RXVA 1CU1A 2BTCE 2QXJA 1RTLA 1UTQA 2W7UA 3DFLA 2JH5D 2V6NA 3LIWA 1HPGA 1BMAA 2JH0D 1QA7A 3MYWA 4MTBA 4QT8C 1Y3UA 3O8BA 3SHAH 4ABIA 4NFFA 3JZ1B 3E8LA 3H5CB 1BTYA 2GV6A 5FPSA 2Y5HA 1D6WA 3D49H 1LPGB 2HNTE 2XBWA 3RXSA 3MH7A 1C2EA 3ODDA 1PJPA 1WTGH 3LU9B 1BTZA 2Y81A 2NU1E 1XUJA 3DUXH 5T6FA 1PQ7A 1GI6A 1UO6A 1Z8JB 3EQ0H 2V0BA 1SFQB 1TB6H 2Z6BD 2F3CE 4GUXA 3LKWA 5JBBS 1SLVB 2WV4A 1V2QT 2OUAA 2UUKB 4U32A 1K22H 1C5VA 4I8HA 1TFXA 2OQUA 2G51A 1EOJA 1FQ3A 1HV7A 5GCHF 1O32A 3MH4A 4CRBA 1L2EA 2P8OC 2PTCE 3ATIA 3PLPA 1O3GA 1TGTA 4Y71A 4BTTB 2VIVA 1HB0B 2FP7B 3VFEA 3MU0A 1YF4A 1FIWA 4KP0A 2FWWA 3BG8A 2AIQA 2ZGHA 1GHBF 2F9PA 2RA0A 1C1SA 1XKBC 5DO4H 1DSTA 1DUEA 3TJUA 2FOHA 1V2KT 5ABWA 4SGBE 2FXRA 1J9CH 1MAYA 1UHBB 2GP9B 3ZVAA 2Z9LA 1WU1A 2O9QA 2PKAA 1BMNH 2ESTE 2Z9GA 1YC0A 4BTIB 3M3SA 2VIPA 5DG6A 3M7UA 3GY5A 1QIXB 3A88A 1GDNA 2PGBB 1C2MA 3VB7A 3Q3KA 1H9HE 1OYTH 1KLIH 3B23B 1YPEH 2DE9A 1W13U 4LK4A 2FMJA 3RXBA 4B76A 3SI4H 1DPOA 1MCVA 1O3JA 3ZVCA 1GMCF 1GBJA 3QTVH 2OINA 2P93A 1SMFE 3PYHA 3RXPA 1DFPA 1TNJA 1FN8A 2P3UB 1D3PB 2HOBA 1C1TA 1IQHA 3KL6A 1ETTH 1QURH 2G81E 2FODA 3A7VA 1RIWB 5TJXA 4OGYA 1GHXH 2ZFFH 4DVAU 3C1KA 1JOUB 1JIRA 1G3BA 2EA3A 2H9HA 4MG3A 1V2LT 4I8KA 2D1JA 1K1LA 2TGAA 3VXEH 1EZQA 4FUEA 2F9NA 5F8ZA 1G3CA 2HNTF 1C5WB 1S5SA 3KF2A 1RJXB 2AEIH 4D7GA 1C1WH 1MBMA 4NWKA 2WYJA 2WPHS 1TYNA 5FXLA 3BTHE 8KME2 1GVKB 5E0JA 2R2MB 1GCTB 3T29A 1DDJA 3SU4A 3HK3B 5C5OA 5BRRE 4A92A 1SB1H 4ASHA 4ABHA 2H9EH 4JYUH 5K7RA 1G3EA 2D26C 1AVXA 1NU9A 2Z9JA 3GISB 1DITH 2ZZUH 1QL7A 4AGKA 1KLJH 1UK2A 1TPPA 2AS9A 3T26A 2A7CA 2XBYA 2GT8A 3ZZ6A 2VWMA 3BIUH 1GWAA 1A2CH 4NA9H 4JZIA 4ZXYH 1O5FH 1GBKA 1P02A 1XMNB 1UCYK 1DXPA 1J14A 1C1MA 1UVOA 1K1JA 1LTOA 5EQRA 1XUKA 1EUFA 4VGCC 4KTSA 1UTKA 2XC0A 2K1QA 2V3HH 3M7QA 3QN7A 1GJBB 1OWIA 4IMQA 3RU4T 1NO9H 2XTTB 2J9NA 4R0IA 1P0SH 4HI3A 4JYVH 3RXDA 5EPYA 4GHQA 6GCHG 2G5NA 1VCWA 2ODQA 4YO9A 4RSPA 1GCDA 3ZVEA 2P8OB 3ZYEA 1C2FA 1JRSA 2IPHA 5A0CA 5F8XA 1BRCE 2BZAA 1F0RA 3A8BA 3UNRA 3NUMA 2P59A 3MU1A 1KXDA 5E0HA 3E3TA 5EQSA 1BBRK 1LKBA 2UUFB 1TGSZ 1D3QB 5A8YA 1OWDA 2BVSH 4O97A 2AYWA 2YNBA 1GI9B 1QB6A 2CHAC 2OC1A 2SGEE 2BD4A 1MH0A 5EXMA 1AD8H 2NU2E 3DA9B 3P8NA 3MNSA 5HM9A 1Y8TA 4WJG2 3MO9A 1DWEH 3RXEA 2G55A 2ZWLH 4F4OC 1V6DA 4WWYA 1GJ6A 2VIDA 4D8NA 4Y6DA 1D3DB 3UIRA 3KEEA 2VH6A 4IW4E 4ZKOU 1ANDA 4GCHF 1A61H 4CRGA 3NCLA 1DY9A 2Y5GA 1TGBA 1C5MD 4OS7A 1SGFA 1UK4A 1BTXA 5AF9H 4INLA 2XRCA 1SHYA 1GMHG 4YOJA 1PQ8A 2FOEA 1E34B 2P95A 3P70B 3R0FA 5DP6A 1O3IA 4SGAE 3SJIA 1BOQA 1MZDA 1HAVA 2AGEX 3BV9B 1FY8E 3BN9A 2PGQB 1AY6H 1SHHB 4KELA 3EYDA 3RMOH 3RXHA 4GAWA 1YPHC 3PROA 5JDUB 1ZR0A 2SGPE 5ETXA 5AHGH 5FHTA 1OWJA 2FTMA 1ELAA 2STAE 1JBUH 1SGCA 1WQVH 3QK1A 4NSYA 4MLFB 3RLWH 1SOZA 4FUFA 3UUZA 3BEFB 4ESTE 5FX5A 2BDCA 1DVAH 1WQSA 1L0ZA 2CXVA 1AFQC 1BRBE 1QHRB 1V3XA 1QRWA 1FY5A 3RXUA 2RG3A 3U69H 5L2ZH 5E8EH 1F2SE 2XNIA 1XVOA 4HGCA 1GBMA 2FTLE 2RCEA 1K1PA 1W14U 1VITG 4A5TS 3RMNH 4HZHA 3BTEE 3GICB 1HXFH 2NWNA 2V35A 3UPEA 5A8XA 2BDGA 5FCKA 1UTNA 1XXDA 2VIOA 7GCHG 4U01A 4DCDA 3BF6H 1AWHB 4K2YA 1NROH 1EOLA 1NY22 3EAJA 1O35A 4K69A 3SNCA 3RXTA 2PKSC 5GPIB 2ZU3A 1XUFA 3M61U 2BXUH 3HK6B 4CBOA 1J16A 1NM6A 1IOEA 2PSYA 3Q3YA 4FU7A 1BT7A 1XUIA 5I25A 3PM3A 3BEUA 2ZHQH 2CV3A 2QF0A 1EASA 1IHSH 1SSXA 4VGCB 1DE7H 1W3CA 2ZTXA 5AVDA 4TYDA 2Q1JA 1VGCC 3TK9A 1NRSH 4NIYA 2FI4E 1OP2A 1ZOMA 3BTDE 1HNEE 3SORA 2WV5A 5FPTA 2ZC9H 3LC3A 2QAAA 2QY0B 3SV9A 1IHTH 1V2OT 1P2MA 1UMAH 3A89A 1LVBA 1CGJE 2G00A 3BTWE 4F49A 4MVNA 2XWBI 1YLDA 8GCHF 2CF9H 4CREA 1KTTB 4O3UA 1O2GH 1HAGE 4DW2U 4HFPB 2GDDA 3OY5U 1XUGA 2A5AA 2FLBH 1ARCA 3ZZ3A 1KDQB 5DKMA 1SQOA 2CHAB 1T8MA 2AMPA 1HXEH 3G01A 3RC6A 4FVBA 3FP6E 1OWKA 3FFGA 3H7OA 1ID5H 2R3UA 2M5TA 1L1JA 3ZZAA 1SL3A 2W7SA 1HAYB 3HGNA 1O2YA 1QY6A 4XBBA 2FI5E 3SJOA 3RXRA 1SQAA 3N7OA 4AG1A 1O0DH 2BD3A 3F9GA 3P92A 3UFAA 3GDUA 1CHOF 5T3HA 1ANCA 1UVSH 4K3JA 3QZRA 1SQTA 1FDPA 3RXMA 4RN6A 2XW9A 1P3EA 2FM2A 1O3MA 4ZKNU 4NIXA 1L4DA 3VEQB 4MNXA 1RRKA 1YM0A 3SV6A 3MOCA 1P09A 3S9CA 1QNJA 1NRNH 4WMDA 4FU8A 1O2OA 2OCVB 5FCRA 1GL1A 2F9UA 4PROA 3TNSA 4A1XA 4YTAA 4RKOB 1S0QA 2Z7FE 4X1NU 2ZI2H 1G2LA 1NS3A 1OSSA 2SFAA 3QO6A 3C27B 4GVUA 3RXQA 4FUDA 4CBNA 4FUHA 1FN6A 2QCYA 2A32A 1BB0B 4A1VA 1NRQH 1BMMH 2BQWB 3UWJH 1V2TT 5EW2H 2Y80A 3A85A 1K1MA 1QFKH 1ZMLA 2BVXH 1A5HA 1FIZA 1AFQB 3UTUH 2H5DA 1K1OA 5E0GA 1YKTA 4X1PU 4D9QA 2CJIA 1GI7B 1BJUA 3KQDA 2PFEA 1AUJA 4X6OA 1C5OH 4WH8A 1HJ9A 2XXLA 3UQVA 1ANBA 3NPSA 5DPAA 4IS5A 1Z6JH 4NA7A 1AZZA 1HJAC 1K9OE 2A5KA 2IN2A 1P10A 2O8TA 3ZZ8A 1GJDB 1YP9A 3KQCA 2R2WU 3GYLB 4YLUA 2F9VA 2W26A 2PKSB 3I78A 3MMGA 5EXNA 1PPGE 1O3BA 3P8GA 3TH2H 1PPFE 2ZEBA 1Y5BT 1QJ1B 3M35A 4TWYA 1TMTH 3LH1A 4X6MA 1AB9C 5AFYH 3SJ8A 1HIAA 2B0FA 4BOHA 4MNYA 1TPSA 1VGCB 4Q7YA 3IITA 1C1RA 4UDWH 1LHCH 4BTUB 2VINA 1TONA 3KQBA 4CH8B 1O2MA 3M5OA 1O3NA 4I31A 1LDTT 4ZXXH 5GCHG 2BY6X 4ISNA 1SBWA 2GCHF 4MQAA 4UFDH 5C3NA 1G3DA 2BDHA 2PTNA 3A80A 5HXFA 1C5UA 2AFQB 3K6YA 2A7JA 4IN1A 1THRH 1GHBG 1AZ8A 3IG6B 4ABAA 3LGTA 1LHDH 2H5CA 1A5GH 1Z8GA 3PMHB 1IQLA 3T25A 4BAHB 4ABEA 2UUJB 5CHAB 4HTCH 3TH4H 1CT2E 2R9PA 5EODA 1HBTH 5A8ZA 3ZV8A 1UTOA 1DANH 4X1QU 1PFXC 4AGJA 5IYTA 2V3OH 3D23A 3GCOA 1JXPA 1TRYA 1P57B 3E0NB 3O8DA 2TRMA 1PPZA 1O2SA 1YCPM 2BY5X 7ESTE 3KHVA 2NU0E 4MNWA 2H9TH 1GMCG 2BY8X 3OU0A 1C1OA 3TPIZ 2R0KA 3MTYA 1MD7A 2ZDMA 4DIIH 2EC9H 3R3GB 1TABE 1MTVA 4XBCA 4ZHLU 4ABDA 2WPKS 5DJ7A 2FO9A 2ZNKH 3HGPA 1QRZA 1A5IA 1ANEA 1TIOA 2VWLA 1O2WA 4BXSA 1C1NA 1AMHA 1HRTH 3DD2H 2VVUA 3PV4A 1G32B 2QF3A 1C1PA 2ZHWH 2P94A 2QXHA 1O5GH 1P2JA 4H42U 5JPMH 1Q3XA 4Y7BA 2A4QA 1C1VH 1T4VH 1ORFA 1P05A 2DUCA 3ELAH 2O8WA 1B0EA 1EAIA 5HYOA 1SG8B 3AASA 5TCCA 2WPIS 3UWIA 2ILNA 2ZGXH 4FXGH 1F5KU 1XXFA 3L3TA 1WAYB 3LJJA 1FMGA 1TMBH 3H7TA 2ZU2A 3RMLH 2ZPSA 4JK5A 1GJAB 1HJAB 5FPYA 2SNVA 5FBIA 1AU8A 3QGNB 4JYTA 2ZP0H 1CQQA 3LGWA 1MAXA 3M3VA 3M5MA 3VXFH 2A4GA 1WYKA 2QXGA 4Y11E 4D76A 4Y0ZE 1UVTH 2FOMB 1AKSB 2R3YA 1CA0C 5C2ZA 1BHXF 3ODFA 4DJZB 3Q00A 3F6UH 1TGNA 4FUCA 1HYLA 2C93B 5GIBA 1AB9B 2UWLA 4X0WU 3KCGH 3M37A 2HNTC 1TX8A 3AAVA 1Y5UT 2STBE 3SV7A 3T2NA 3PMJA 3BTGE 1C2IA 2CN0H 1C5QA 3VB6A 2GDEH 3S7HB 1LVOA 1GBDA 1UTMA 4O3TA 1NFYA 8LPRA 1TQ0B 1Z71A 1KXFA 2XCNA 4THNH 3SQEE 3RM2H 1C4V2 4GLYA 3O8RA 2Y82A 1G30B 3MO6A 4ZROA 1WTHD 1MTUA 1VR1H 1TNKA 2QGRA 3KN2A 3SU0A 2UWOA 1O33A 3L6PA 2HRVA 3TGKE 2LPRA 4OS1A 1TNHA 4ABBA 1S0RA 1DUAA 3OX7U 4KTUA 4E7NA 1O3PB 3K65B 1TA2A 3K6ZA 1TX6A 4WVPE 1OYQA 3E91A 1VCQA 1P06A 1O36A 2ZA5A 4ISOA 5L6NH 2R0LA 2FLRH 4AFUA 4NZLA 2FOFA 3LONA 4Q7XA 4X1RU 2ZFQH 4GCHG 1GG6C 3I29A 3LPRA 4INKA 4YOIA 1SLUB 2C8XB 1BJVA 1EXFA 3UQOA 2ASUB 2ZDVH 1BA8B 3LOXA 1C2JA 1O34A 2J94A 1OWEA 4Y8YA 1BIOA 1TBQH 2GVFA 3MU4A 3A7WA 3OTJE 3ZZBA 1DWCH 1AE8H 4X8TH 1P2QA 3RC4A 3V13A 1OP8A 1SGFG 2OQ5A 1B0FA 3UY9A 1E35B 1IQFA 1RGQA 6CHAC 1YLCA 2GZ8A 3BTME 1C2DA 3QUMP 1WBGB 4Q2KA 1F0TA 1ELVA 4B73A 4H6SB 4OS2A 4TY7A 4CRFA 1GMDF 3ZYDA 1AO5A 1PYTC 1GGDC 4X6NA 2VU8E 3LGUA 4AYYB 5C1XA 9ESTA 2ZIQH 1OPHB 4U2WA 3ZV9A 4NGAH 1ELDE 2BZ6H 1GBFA 1O3AA 3PLBA 1FLEE 1MKWH 4BAMB 2UWPA 1Z8IB 1DOJA 2OC8A 4ZKSU 5EW1H 1M9UA 1DWDH 2AGGX 1U6QA 5JYIA 2PKAB 5PTPA 3SJ9A 1IQGA 1YPHE 4K8BA 1KXBA 3W95A 3LGYA 3ZZDA 2P3TB 1O2VA 2C8WB 1T8OA 2Q6GA 2LNCA 3SGBE 2SNWA 2O8LA 1SC8U 2FEQH 1G36A 3RP2A 3GCHC 1N6YA 1HAXB 1YPMH 4U30A 1RD3B 4IGDA 1E38B 1QQ4A 5LPRA 2EEKA 3PTNA 4ABGA 5JBAS 3UOPA 2VVVA 4CRCA 2OD3B 3P17H 1D6RA 1RXPA 1S83A 4WMFA 4UONA 1H1BA 1DT2A 1CA0B 2ZFRH 2ANYA 1SVPA 2ALPA 1A0HB 2ZO3H 3VB5A 3M5NA 3D65E 1FONA 1CA8B 2ANKH
chains in the Genus database with same CATH superfamily
1H8HD 2A7HA 1EAUA 1MU6B 1PPHE 5EJ1A 4WY3A 2KCAA 2PP6A 4BAKB 2GGVB 2VWNA 2PSXA 1OOKB 5C67A 1MKXK 3MNBA 1GVLA 4K8YA 2XBXA 3TITA 3PMAB 2ZCHP 3QGJA 4JMYA 4AFQA 1H9LB 1CGHA 2OBOA 4E06H 1V2UT 4J1YA 1BZXE 1EKBB 2ZFSA 3W1EA 4JZEH 5C94A 4O03A 1W7GH 2BB4A 1HAHH 1O5BB 2XCFA 3ZVFA 3OSYA 3RC5A 3UNSA 8GCHG 5EG4A 2A2XH 1GJ4H 1V2NT 1Y3YA 3CS0A 4O9VA 3ZIAD 4DG4A 5G4BA 2BY7X 2H2ZA 2PUXB 1DXWA 1ABIH 1PPBH 3SNEA 2GCTC 1F0UA 3TU7H 2QXIA 2VGCC 3TVJB 1YYY1 4CR9A 1ZMJA 4I7YH 2ZGJA 1MD8A 1EJMA 4Y0YE 1A3BH 5DP8A 1Z6EA 1S6FA 5AFZH 4ZHAA 1A1RA 1Z8RA 2L6OA 2ZFPH 1YBWA 2CK3D 2OC7A 2QA9E 1ZTLA 2W3IA 1O39A 1GG6B 2Y5FA 1B7XB 1J8AA 2G52A 1ELTA 3PV2A 1CHOG 5DGJA 1YCPH 1C2HA 2OBQA 2VVCA 2VWOA 5GDSH 1O2KA 1YPJH 1FJSA 1NBME 2FI3E 3TK6A 1LVMA 3NRLA 4B6FA 4ISLA 1LQEA 1ZTKA 5DP9A 2ZKSA 1O3CA 1P2KA 5TCAA 7LPRA 2WPJS 4B2AA 1V2ST 2A31A 2BDIA 2TGPZ 6CHAB 3TJOA 2BDYA 1NESE 4DY7B 3SNAA 2EI7A 2GD4B 2FS8A 3TJNA 4DIHH 5E2PA 1QRXA 2KX4A 2HLDD 1S84A 1Y3XA 3MO3A 2GZ9A 3URCA 1D4PB 1ZMNA 1FPHH 1GGDB 1SGDE 1IAUA 3VB4A 5FBEA 1GDUA 2GTBA 1MKXH 4XRNA 2PHBA 3AW0A 3DT0H 3E16B 3F3BA 4AG2A 2BDBA 2VBCA 5EIYA 2Z3EA 1DLKB 1GI4A 1BTWA 5CMXH 1O2QA 1O3KA 2BQ7B 1OWHA 2AGIX 3F9EA 5J4SA 3CENA 2D8WA 4AFZA 1KSNA 4Q4LA 3MFJA 1ZSKA 5A0BA 3GY2A 4BAOB 3PMBB 1EPTC 2KCPA 2C90B 2NU4E 4GSOA 3EE7A 3SNDA 3OEED 4NIWA 1PQAA 5HMAA 2AIPA 4AB8A 3GCHB 5C1YA 4WF8A 3WY8A 1ETSH 2FX4A 1BCUH 4AB9A 1BRAA 1ELEE 2FDAA 1ZRKA 3PV5A 4K60A 5CHAC 1P9UA 5JBCS 1T8LA 2VJ1A 1TAWA 2W5EA 4ZKRU 2BD2A 1N1LA 1EPTA 4B75A 4K1EA 5EGMA 1SGNE 1HAVB 1AI8H 4JZFH 5H4IB 2FYQA 3EDXB 4OM9A 4I32A 4B74A 2ZHDA 1ARBA 3KIDU 1EX3A 1HAIH 3NZIA 4TPIZ 5T1VA 2G4UA 1T4UH 3A7XA 1RTKA 5KGOA 1FY1A 4K5ZA 5GJ4B 2ZDKA 2TPIZ 2TGDA 3OAAD 2JJ1D 4OGXA 1FXYA 3E6PH 3EA9A 3F1SB 1TALA 5DP3A 2FX6A 1GJ8B 1C9PA 1JIMA 2WPDD 3MH5A 1NU7B 1HFDA 1F5LA 1THPB 2GV7A 3AK5A 1SGTA 3SV8A 1FY3A 3VB3A 1S6LA 2EQNA 5A09A 3U1JB 2GCHG 1MABB 1S85A 2W6JD 1UVUH 3S9BA 1UTJA 1Y3VA 2SGFE 3ZVDA 4BNRA 1Y59T 1DWBH 1GBIA 2O8MA 1AQ7A 4TT3D 1MQ5A 4ISIH 1XM1A 2A1DB 2GCTB 1W0ZU 1KXEA 4WXIA 1ETRH 2HWLB 3ATWA 1V2PT 2VGCB 1P11E 1K2I1 2C8ZB 2VIQA 1KLTA 1CHGA 2HPPH 2ZU1A 2A0QB 3FANA 4GHTA 3ZVBA 1TE0A 1T7CA 2PWXA 4RI0A 4UD9H 1ESTA 1DICA 2ODPA 1ELCA 3FP8E 1EATA 1O5EH 1DM4B 1IQKA 2BQ6B 3FKSD 3SGQE 1LVYA 2ZPRA 3MHWU 3RUOA 1ZJDA 1JMOH 2BLOA 3Q3XA 4BAQB 3M5LA 1OHHD 1IQIA 5A2MH 5LPEA 4XDEA 1AVGH 5F8TA 3A7ZA 2AERH 1HGTH 9LPRA 1SGEE 3RM0H 2GKVE 2WUCA 3V7TA 4MDSA 4X2WA 1C5TA 3V3MA 1NN6A 3RXLA 4F48B 1O5DH 1P8VC 2VB0A 4CR5A 1CO7E 2UUYA 4XSKU 3MWIU 3WWBA 2ZCKP 3GY7A 1SGRE 3SNBA 4KGAA 4YZUA 3W94A 4XE4A 1B5GH 1ESAA 4UFFH 3GY4A 1TNIA 1QA0A 4WXVA 1HJ8A 2WV9A 1GI0A 3PRDA 2Q6FA 1GBCA 3A7YA 3TIUA 1OKXA 3SUFA 4DOQA 1NC6A 5EQQA 1O3DA 1QL8A 7KMEH 1V2MT 3NWUA 4B1TA 1ZGVA 1DSUA 1ZPCA 1WSSH 2BX4A 4Q80A 1GBHA 2JIZD 4R8TB 1HDTH 2ANMH 3RU4D 4K1TA 4XOJA 1TLDA 1O2LA 2BOKA 3K2UA 3U9AH 4X8SH 1W7XH 5IK2D 1EPTB 1GI5A 2GX4A 1W8BH 1V2JT 2B5TB 2F43B 1KXCA 3VGCC 4K1SA 1BDAA 1OP0A 4X2XA 1AN1E 1SGIB 2ALVA 4X8UH 1EP6A 1E79D 3BEIB 4BXWA 2ZDAH 2Z9IA 2XC5A 4I8LA 1E1QD 1GHAF 4I33A 3KQ5A 3MI4A 4TY6A 3PTBA 3S69A 1WCZA 5EU8A 3BSQA 3N7EA 1AIXH 1QB1A 4B2BA 4HG6A 1EP5A 2C8YB 3S0NA 2RA3A 4WH6A 1C4Y2 5B6LA 2Z3DA 3GOVB 3AVZA 2PW8H 4B2CA 2JDID 4ABJA 1W2KH 2TGTA 1O38A 3BTTE 1CBWC 1MTNC 3LGIA 1ZYOA 2IJOB 3FP7E 4Q63A 3WW7A 5HIYA 4Q7ZA 1YPKH 3QDZB 4FU9A 3JZ2B 4Y7AA 1EJNA 2HLCA 1GBTA 5EXLA 3T27A 4A1TA 3ENSB 1GBLA 1FV9A 2KAIA 1T8NA 1TMUH 3D62A 1UTPA 1YPLH 4ISHH 1HAZB 3QTOH 3A8DA 3U8TH 1F92A 3RXKA 1YPGH 3PB1E 3BTKE 1RFNA 5F6MA 1CE5A 1P2IA 1O3OA 1VITH 1FUJA 3A82A 1ZHPA 4P00A 1CVWH 2Y7ZA 2G5VA 2IOTA 2HALA 2QC2A 4MPUA 3GCTF 2CF8H 1EAXA 1E37B 1TX7A 1EZSC 2ZU5A 1TNLA 3HKIB 3PLKA 5C5NA 5J4QA 3M7TA 1TA6A 1JWTA 1TRMA 2WHXA 2DE8A 3SU5A 4NWLA 3A8CA 1TBZH 1AGJA 1T32A 1MUEB 2XWAA 4E7RG 1C2LA 1VJ9U 1TOCB 4XFQA 1GI8B 1TNGA 2J5UA 1BQYA 1SLXB 1HIAB 4M7GA 1GI1A 1P03A 1UK3A 4TWWA 2PV9B 1GJCB 3STIA 1W10U 1C5RA 1UJ1A 3QWCH 1PPEE 1BMFD 4D7FA 2OC0A 3TNTA 3EA8A 3N99A 3LC5A 1BTHH 3V12A 2FOGA 3U28C 5BPEA 1GVZA 3UR9A 2YNAA 1LPKB 2Y6TA 3SUDA 1GMDG 2A5IA 2OXSA 2KZ4A 1O2PA 2GZ7A 4P02A 3V0XA 1QGFA 4H6TA 1CT4E 1C2KA 1C4U2 2I6QA 1BITA 3GDSA 1MKWK 3IWMA 1ZRBA 4MPXA 1P2OA 2BDAA 5DK1A 1C2GA 1C1UH 5HM2A 1FPCH 3A81A 4NCYA 1ABJH 1L1GA 3RDZA 1SPJA 4KTCA 4MPVA 1MTWA 1NPMA 1TQ7B 3SOSA 3RXJA 2BXTH 1THSH 3ZZ5A 2BOHB 2F83A 3P8FA 5EOKA 4OS5A 4CHAC 1N6XA 3VGCB 1C5YB 1O30A 1QB9A 1K1IA 1DS2E 2VH0A 1F0SA 2HGTH 2Z9KA 4UFEH 1LO6A 5LGOA 2GJGA 1NFWA 1C5ZB 5IDKA 4DGJA 2KR7A 4A7IB 2FIRH 2WPMS 4IC6A 4XBDA 4YM9A 1P04A 2BHGA 4UFGH 1EQ9A 3KGPA 4LZ4B 2YOLA 1QBOA 1QCPA 2NU3E 4AOQA 1N8OC 3GY8A 3MNCA 3RXAA 1GBAA 1GL0E 1FAXA 1VZQH 3KNXA 1QL9A 3E90B 1UVPA 3UR6A 2ZPQA 1NRRH 1ELGA 1AVWA 1EFRD 1O2IA 2KAIB 2FYRA 1H4WA 1ZTJA 2OLGA 4Z6AH 1CBWB 1MTNB 1EB2A 2O8UA 2J92A 4DT4A 1DX5M 1LHFH 2ZU4A 5T6DA 4Y76A 4FUIA 3DHKH 2G8TA 4AFSA 3F9HA 3U98H 3F0PA 4UE7H 3TGJE 2G4TA 3QX5H 5GXPA 3UOUA 3I77A 1T31A 2AMQA 1TGCA 3ZZ4A 1UW7A 3TK5A 3S7KB 3A86A 1YGCH 1ZJKA 2XC4A 1GPZA 1GHVH 1V2RT 2FOBA 4JZDH 3SBKA 1L4ZA 2C4FH 4NZQA 2ULLA 2VNTA 1MMJN 2FOAA 1Z7KA 4CRAA 1BUIA 4AORA 1O3EA 2J95A 1DLEA 3DFJA 2ZQ2A 2F4LA 1YY3A 5CHBA 1MQ6A 1YWUA 1E1RD 1FAKH 3SV2H 1SGYE 1S6HA 1ZPZA 1BHXB 2AH4X 1CGIE 2XOKD 1SFIA 3NXPA 1BTUA 1A3EH 1GBEA 2BMGB 1E36B 2FZZA 2Q6DA 1XUHA 1ACBE 2ZTZA 2QE7D 5C1UA 1ZSJA 3K9XB 1ZHMA 4D9RA 2JKHA 1HUTH 1GHYH 3EE0B 1YCPK 1O3HA 1SGQE 4YOGA 3LDXH 4CRDA 1Y5AT 3BTQE 1SR5C 5EPNA 3SW2B 1HCGA 1P9SA 1C5LH 4TSFD 2J98A 3SO3A 3GYMA 2ZTYA 1C1QA 1A7SA 1JRTA 1RTFB 4DT7B 4ZHMU 4ABFA 1O2JA 2QN5T 1XX9A 1EZXC 4RKJB 3U8OH 4GPGA 4NFEA 3BIVH 2W3KA 3DSGA 1UTLM 1H8IH 3LJOA 3QZQA 5DP5A 5GNDA 3T62A 2ZGCA 3DCLA 3SHCH 1P01A 1MTSA 4LXBH 2BD5A 1PYTD 2BVRH 1KDQA 1KY9A 2F9BH 2EI6A 5F53A 2TIOA 1COWD 3TGIE 1K1NA 1GJ7B 2P16A 5FX6A 5L2YH 3RXOA 4IBLH 5ESTE 1EZUC 4FUJA 3SGAE 1MZAA 1O5AB 4E05H 1KYNA 1P2NA 1C5NH 1O2HA 1OS8A 2KCOA 1GI3A 1MBQA 2A4RA 1XKAC 3ZVGA 1FZZA 1QR3E 1QZ8A 2ZGBH 5LH8A 4BANB 4OS6A 5DP4A 5JBTA 1Z1IA 5I46H 3P6ZB 1NTPA 1A0JA 4JZ1A 1ZLRA 1W12U 2JETC 1UCYH 1ZSLA 1H9IE 4CHAB 2JH6D 4X8VH 1HLTH 3ZZ7A 1VCPA 1P12E 1AHTH 3FZDA 1KTSB 2OTVA 4X6PA 1F7ZA 1O3LA 2FPZA 1L1NA 3UNQA 5C20A 6GCHF 1IQEA 5L30H 5ESBA 2B9LA 4IN2A 1V2WT 1RS0A 1SGPE 1ZPBA 1N8OB 2H1UA 3OYPA 4Y8ZA 1TPAE 2BY9X 1LHGH 2GMTC 3GY3A 1EAWA 5JB8S 5DP7A 3MU8A 1O2ZA 1W0YH 3SU1A 1BBRH 3PWBA 1S81A 2ODYB 4AX9H 2TBSA 1QTFA 4NSVA 3RXGA 3KQEA 3SQHE 1MCTA 2XBVA 4Y10E 1IQNA 2H6MA 4ZMAH 2CMYA 1C5XB 3N7DA 5K0HA 1P3CA 1D9IA 1Q2WA 1WOFA 3BG4C 2ZDLA 2J2UA 3SU3A 1OXGA 2BD7A 2BM2A 1LQDB 6LPRA 2WYGA 1DY8A 4H4FA 2BX3A 1CT0E 2ZDNA 4OS4A 3EGKH 1NRPH 3MU5A 1O5CB 1XVMA 2PUQH 3E0PB 1F5RA 3F9FA 3RLYH 4B71A 1GMHF 1J17T 3T28A 1LMWB 1BRUP 5CE1A 2A4OA 5C0UA 1O2NA 3PWCA 3RXFA 3Q76A 2K0QA 1TWXB 4AN7A 4FVDA 1QJ6B 1GDQA 5E2OA 2ANWA 1LKAA 1AUTC 1C5PA 3HATH 4IC5A 3CS7A 1FY4A 3SUEA 1AE5A 3SZEA 3HPTB 1X7AC 3O8CA 4I8GA 1NT1A 2WUBA 2BYAX 2J34A 1QQUA 3PO1C 1GJ5H 2ZHFH 1Y3WA 3AW1A 1C5SA 1FNIA 3ATLA 3GCNA 1G2MA 1VJAU 3CP7A 2WSSD 2ZQ1A 2Z94A 1E0FD 3S9AA 3F68H 3LT3A 5JB9S 1GBBA 1IQMA 2ZECA 2QV1A 2QIQA 4NIVA 3U8RH 3MNXA 3B9FH 3VPKA 2B8OH 1O2XA 5HGGA 1NFXA 1V2VT 3RU4E 1PQ5A 3FZZA 2FOCA 3QLPH 1O2UA 3EA7A 1S82A 2F91A 1VITF 2Y7XA 3FAOA 2FS9A 4UEHH 3ATMA 1A0LA 1EB1H 2Z3CA 1G37A 6ESTA 5T6GA 4X1SU 2ZFTA 1TBRH 7GCHF 1FX0B 1INCA 1KIGH 1QJ7B 3SUGA 3A84A 1SI5H 3SZNA 3RXCA 4Y8XA 2BLVA 3LH3A 4CH2B 2KM0A 2BD9A 3NK8A 4LZ1H 3RMMH 4I8JA 4X2VA 1ELBA 1BMLA 2WPLS 8ESTE 4TPYA 5LPFA 1WV7H 5GWZA 1WUNH 2JETB 2THFB 4LOYH 3GDVA 1O2RA 4DURA 1GJ9B 1C9TA 1GHZA 1CSOE 4NA8A 1AFEH 2PLXA 1O3FA 1D3TB 4YESB 5F03A 3P95A 5CDFE 2ZCLP 4MPWA 4A6LA 1QBNA 1GHAG 3TLOA 2J38A 3AAUA 1AWFH 1Q31A 1LPZB 4INHA 2PR3A 2XYAA 3STJA 3CNRA 3FVFB 4XD7D 3SI3H 1TOMH 2BLQA 2SGDE 2GMTB 3ESTA 4YLQH 3Q77A 2FESH 1ESBA 1K28D 1Z1JA 2F9OA 3DSPA 2WINI 4JK6A 4AZ2B 1O37A 5A0AE 4FUGA 1PPCE 4MNVA 3LGVA 2A2QH 1O2TA 3E1XB 3FOAA 3HKJB 4IMZA 1ZGIA 2ZHEH 3M36A 1ZHRA 2BLWA 4NG9H 2OP9A 3NKKA 1A46H 1LHEH 3BG4B 1KXAA 2ZG0H 3SU2A 3MH6A 1FI8A 1SQRA 3UREA 3ATKA 3A87A 3UAIC 2BD8A 3TH3H 2P3FH 3RXIA 1W11U 1HAPH 1H8DH 4X2YA 2J4IA 1UHBA 2GT7A 3U1IB 2CGAA 2EI8A 1A4WH 2LELA 3ZZ9A 4J2YB 1AKSA 4Z0KA 3A8AA 2SGAA 4YT7H 1SOTA 2SGQE 3GCTG 5SGAE 4FUBA 1OX1A 4Y79A 2C3SA 3T5FH 1NFUA 1G9IE 1ZZZA 1J15A 2D2DA 1NZQH 3A83A 3A7TA 1IQJA 1GHWH 1UCYE 2B7DH 1SLWB 1RIWC 2RDLA 5FAHA 2VIWA 1QBVH 3ITIA 3PO1B 3ZZCA 1TPOA 3TJVA 3B8JA 1K21H 3P8OA 1GI2A 5B6OA 1EJAA 1ELFA 4ZUHA 1WXRA 3SU6A 4WMEA 1HAOH 2I6SA 2QYIA 1LCYA 1O31A 4JCNA 3L33A 3BTFE 4YT6H 3GY6A 4KKDA 3URDA 1GCTC 2HPQH 3SJKA 2A45B 3M3TA 2ZF0H 2HVXA 1BTPA 4ZAEA 4AYVB 3OY6U 1MU8B 2V7QD 2AMDA 4ZH8A 1BBRE 3SN8A 1TRNA 3RXVA 1CU1A 2BTCE 1W0KD 2QXJA 1RTLA 1UTQA 2W7UA 4ACBA 3DFLA 2JH5D 2V6NA 3LIWA 1HPGA 1BMAA 3UB0A 2JH0D 1QA7A 3MYWA 4MTBA 4QT8C 1Y3UA 3O8BA 3SHAH 4ABIA 4NFFA 3JZ1B 3E8LA 3F0OA 3H5CB 1BTYA 2GV6A 5FPSA 2Y5HA 1D6WA 3D49H 1LPGB 2HNTE 2XBWA 3RXSA 3MH7A 1C2EA 3ODDA 1PJPA 1WTGH 3LU9B 1BTZA 2Y81A 2M2AA 2NU1E 1XUJA 3DUXH 5T6FA 5DN6D 1PQ7A 1GI6A 1UO6A 1Z8JB 2OK5A 3EQ0H 2V0BA 1SFQB 1TB6H 2Z6BD 2F3CE 4GUXA 3LKWA 5JBBS 3SYJA 1SLVB 2WV4A 1V2QT 2KCYA 2OUAA 2UUKB 4U32A 1K22H 5DSFA 1C5VA 4I8HA 1TFXA 2OQUA 2G51A 1EOJA 1FQ3A 1HV7A 2JJ2D 1O32A 3MH4A 5GCHF 4CRBA 5KECA 1L2EA 2P8OC 2PTCE 3ATIA 3PLPA 1O3GA 1TGTA 4Y71A 4BTTB 2VIVA 1HB0B 2FP7B 3VFEA 3MU0A 1YF4A 1FIWA 4KP0A 2FWWA 3BG8A 2AIQA 2ZGHA 1GHBF 2F9PA 2RA0A 1C1SA 1XKBC 5DO4H 1DSTA 1DUEA 3TJUA 2FOHA 1V2KT 5ABWA 4SGBE 2FXRA 1J9CH 1MAYA 1UHBB 2GP9B 3ZVAA 2Z9LA 1WU1A 2O9QA 2PKAA 1BMNH 2ESTE 2Z9GA 1YC0A 4BTIB 1SKYE 3M3SA 2VIPA 5DG6A 3M7UA 3GY5A 1QIXB 3A88A 1GDNA 2PGBB 1C2MA 3VB7A 3Q3KA 1H9HE 1OYTH 1KLIH 3B23B 1YPEH 2DE9A 1W13U 4LK4A 2FMJA 3RXBA 4B76A 3SI4H 1DPOA 1MCVA 1O3JA 3ZVCA 1GMCF 1GBJA 3QTVH 2OINA 2P93A 1SMFE 3PYHA 3RXPA 4ACAA 2K8IA 1DFPA 1TNJA 1KMHB 1FN8A 2P3UB 1D3PB 2HOBA 2WZQA 4B6EA 1C1TA 1IQHA 3KL6A 1ETTH 1QURH 2G81E 2FODA 3A7VA 1RIWB 5TJXA 4OGYA 1GHXH 2ZFFH 4DVAU 3C1KA 1JOUB 1JIRA 1G3BA 2EA3A 2H9HA 4MG3A 1V2LT 4I8KA 2D1JA 1K1LA 2TGAA 3VXEH 1EZQA 4FUEA 2F9NA 5F8ZA 1G3CA 2HNTF 1C5WB 1S5SA 3KF2A 1RJXB 2AEIH 4D7GA 1C1WH 1MBMA 4NWKA 2WYJA 2WPHS 1TYNA 5FXLA 3BTHE 8KME2 2LP6A 1GVKB 5E0JA 2R2MB 1GCTB 3T29A 1DDJA 3SU4A 3HK3B 2RFKC 5C5OA 5BRRE 4A92A 1SB1H 4ASHA 4ABHA 4RT1A 2H9EH 4JYUH 5C17A 3KYFA 5K7RA 1G3EA 2D26C 1AVXA 1NU9A 2Z9JA 3GISB 1DITH 2ZZUH 1QL7A 4AGKA 1KLJH 1UK2A 1TPPA 2AS9A 3T26A 2A7CA 2XBYA 2GT8A 3ZZ6A 2VWMA 3BIUH 1GWAA 1A2CH 4NA9H 4JZIA 4ZXYH 1O5FH 1GBKA 1P02A 1XMNB 1UCYK 1DXPA 1J14A 1C1MA 1UVOA 1K1JA 1LTOA 5EQRA 1XUKA 1EUFA 4VGCC 4KTSA 1UTKA 2XC0A 2K1QA 2V3HH 3M7QA 3QN7A 1GJBB 1OWIA 4IMQA 3RU4T 3WWFA 1NO9H 2XTTB 2J9NA 4R0IA 1P0SH 4HI3A 2AHME 4JYVH 3RXDA 5EPYA 4GHQA 6GCHG 2G5NA 1VCWA 2ODQA 4YO9A 4RSPA 1GCDA 3ZVEA 2P8OB 3ZYEA 1C2FA 1JRSA 2IPHA 5A0CA 5F8XA 1BRCE 2BZAA 1F0RA 3A8BA 3UNRA 3NUMA 2P59A 3MU1A 1KXDA 5E0HA 3E3TA 5EQSA 1BBRK 1LKBA 2UUFB 1TGSZ 1D3QB 5A8YA 1OWDA 2BVSH 4O97A 2AYWA 2YNBA 1GI9B 1QB6A 2CHAC 2OC1A 2SGEE 2BD4A 1MH0A 5EXMA 1AD8H 2NU2E 3DA9B 3P8NA 3MNSA 5HM9A 1Y8TA 4WJG2 3MO9A 1DWEH 3RXEA 3PRBA 2G55A 2ZWLH 4F4OC 1V6DA 4WWYA 1GJ6A 2VIDA 4D8NA 4Y6DA 1D3DB 3UIRA 3KEEA 2VH6A 4IW4E 4ZKOU 1ANDA 4GCHF 3GS9A 1A61H 4CRGA 3NCLA 1DY9A 2Y5GA 1TGBA 1C5MD 4OS7A 1SGFA 1UK4A 1BTXA 5AF9H 4INLA 2XRCA 1SHYA 1GMHG 4YOJA 1PQ8A 2FOEA 1E34B 2P95A 3P70B 3R0FA 5DP6A 1O3IA 4SGAE 3SJIA 1BOQA 1MZDA 1HAVA 1H8ED 2AGEX 3BV9B 1FY8E 3OE7D 3BN9A 2PGQB 1AY6H 1SHHB 4KELA 3EYDA 3RMOH 3RXHA 4GAWA 1YPHC 3PROA 5JDUB 1ZR0A 2SGPE 5ETXA 5AHGH 5FHTA 1OWJA 2FTMA 1ELAA 2STAE 1JBUH 1SGCA 1WQVH 3QK1A 4NSYA 4MLFB 3RLWH 1SOZA 4FUFA 3UUZA 3BEFB 4ESTE 5FX5A 2BDCA 1DVAH 1WQSA 1L0ZA 2CXVA 2V3MA 1AFQC 1BRBE 1QHRB 1V3XA 1QRWA 1FY5A 1W0JD 3RXUA 2RG3A 3U69H 3VG8A 5L2ZH 5E8EH 1F2SE 2XNIA 1XVOA 4HGCA 1GBMA 2FTLE 2RCEA 1K1PA 1W14U 1VITG 4A5TS 3RMNH 2YMSC 4HZHA 4AC9A 3BTEE 3GICB 1HXFH 2NWNA 2V35A 3UPEA 5A8XA 2BDGA 5FCKA 1UTNA 1XXDA 2VIOA 7GCHG 4U01A 2W6ID 4DCDA 3BF6H 1AWHB 4K2YA 1NROH 1EOLA 1NY22 3EAJA 1O35A 4K69A 3SNCA 3RXTA 2PKSC 5GPIB 2ZU3A 1XUFA 5HKKD 3M61U 2BXUH 3HK6B 4CBOA 1J16A 1NM6A 1IOEA 2PSYA 3Q3YA 4FU7A 1BT7A 1XUIA 5I25A 3PM3A 3BEUA 2ZHQH 2CV3A 2QF0A 1EASA 1IHSH 1SSXA 4VGCB 5FL7D 1DE7H 1W3CA 2ZTXA 5AVDA 4TYDA 2Q1JA 1VGCC 3TK9A 1NRSH 4NIYA 2FI4E 1OP2A 1ZOMA 2J98B 3BTDE 1HNEE 3SORA 2WV5A 5EJZA 5FPTA 2ZC9H 3LC3A 2QAAA 2QY0B 3SV9A 1IHTH 1V2OT 1P2MA 4ASUD 1UMAH 3A89A 1LVBA 1CGJE 2G00A 3BTWE 4F49A 4MVNA 2XWBI 1YLDA 8GCHF 2CF9H 4CREA 3MQKC 1KTTB 2YMSD 4ZCNA 4O3UA 1O2GH 1HAGE 4DW2U 4HFPB 2GDDA 3OY5U 1XUGA 2A5AA 2FLBH 1ARCA 3ZZ3A 1KDQB 5DKMA 1SQOA 2CHAB 1T8MA 2AMPA 1HXEH 3G01A 3RC6A 4FVBA 4I86A 3FP6E 1OWKA 2QF4A 3FFGA 3H7OA 1ID5H 2R3UA 2M5TA 3F2FA 1L1JA 3ZZAA 1SL3A 2W7SA 1HAYB 3HGNA 3OTPA 1VKYA 3F2GA 1O2YA 1QY6A 4XBBA 2FI5E 3SJOA 3RXRA 1SQAA 3N7OA 4AG1A 1O0DH 2BD3A 3F9GA 3P92A 3UFAA 3GDUA 1CHOF 5T3HA 1ANCA 1UVSH 4K3JA 3QZRA 1SQTA 1FDPA 3RXMA 3FO8D 4RN6A 2XW9A 1P3EA 2FM2A 1O3MA 4ZKNU 4NIXA 1L4DA 3VEQB 4MNXA 1RRKA 1YM0A 3SV6A 3MOCA 1P09A 3S9CA 1QNJA 1NRNH 4WMDA 4FU8A 1O2OA 2OCVB 5FCRA 1GL1A 2F9UA 4PROA 3TNSA 4A1XA 5C0TA 4YTAA 4RKOB 1S0QA 2Z7FE 4X1NU 2ZI2H 1G2LA 1NS3A 1OSSA 2SFAA 3QO6A 5HIZA 3C27B 4GVUA 3RXQA 2QF5A 4FUDA 4CBNA 4FUHA 1FN6A 2QCYA 2A32A 1BB0B 4A1VA 1NRQH 1BMMH 2BQWB 3UWJH 1V2TT 5EW2H 2Y80A 3A85A 1K1MA 1QFKH 1NBMD 1ZMLA 2BVXH 1A5HA 1FIZA 1AFQB 3UTUH 2H5DA 1K1OA 5E0GA 1YKTA 4X1PU 4D9QA 2CJIA 1GI7B 1BJUA 3KQDA 2PFEA 1AUJA 4X6OA 1C5OH 4WH8A 1HJ9A 2XXLA 2YMSB 3UQVA 1ANBA 4YXWD 3NPSA 5DPAA 4IS5A 1Z6JH 4NA7A 1AZZA 1HJAC 1K9OE 2A5KA 2IN2A 2KFWA 1P10A 2O8TA 3KYGA 3ZZ8A 1GJDB 1YP9A 4F55A 3KQCA 2R2WU 3GYLB 4YLUA 2F9VA 2W26A 2PKSB 3I78A 3H09A 3MMGA 5EXNA 1PPGE 1O3BA 3P8GA 3TH2H 1PPFE 2ZEBA 2EY4C 1Y5BT 1QJ1B 3M35A 4TWYA 1TMTH 3LH1A 4X6MA 1AB9C 5AFYH 3SJ8A 1HIAA 2B0FA 4BOHA 4MNYA 1TPSA 1VGCB 4Q7YA 3IITA 1C1RA 4UDWH 1LHCH 4BTUB 2VINA 1TONA 3KQBA 4CH8B 1O2MA 1WDIA 3M5OA 1O3NA 4I31A 1LDTT 4ZXXH 5GCHG 2BY6X 4ISNA 1SBWA 2GCHF 4MQAA 4UFDH 5C3NA 1G3DA 2BDHA 2PTNA 5KEDA 3A80A 5HXFA 1C5UA 2AFQB 3K6YA 2A7JA 4IN1A 1THRH 1GHBG 1AZ8A 3IG6B 4ABAA 5EJLA 3LGTA 1LHDH 2H5CA 1A5GH 1Z8GA 3PMHB 1IQLA 3T25A 4BAHB 4ABEA 2UUJB 5CHAB 4HTCH 3TH4H 1CT2E 2IPQX 2R9PA 5EODA 1HBTH 5A8ZA 3ZV8A 1UTOA 1DANH 4X1QU 1PFXC 4AGJA 5IYTA 2V3OH 3D23A 3GCOA 1JXPA 1TRYA 1P57B 3E0NB 3O8DA 2TRMA 1PPZA 1O2SA 1YCPM 2BY5X 7ESTE 3KHVA 2NU0E 4MNWA 2H9TH 1GMCG 2BY8X 3F2HA 3OU0A 1C1OA 3TPIZ 2R0KA 4RT0A 3MTYA 1MD7A 2ZDMA 4DIIH 2EC9H 3R3GB 1TABE 1MTVA 4XBCA 4ZHLU 4M9FA 4ABDA 2WPKS 5DJ7A 2FO9A 2ZNKH 3OEHD 3HGPA 1QRZA 1A5IA 1ANEA 1TIOA 2VWLA 1O2WA 4BXSA 1C1NA 1AMHA 1HRTH 3DD2H 2VVUA 3PV4A 1G32B 2QF3A 1C1PA 2ZHWH 2P94A 2QXHA 1O5GH 1P2JA 4H42U 5JPMH 1Q3XA 4Y7BA 2A4QA 1C1VH 1T4VH 1ORFA 1P05A 2DUCA 3ELAH 2O8WA 1B0EA 1EAIA 5HYOA 1SG8B 3AASA 5TCCA 2WPIS 3UWIA 2ILNA 2ZGXH 4FXGH 1F5KU 1XXFA 3L3TA 1WAYB 3LJJA 1FMGA 1TMBH 3H7TA 2ZU2A 3RMLH 2ZPSA 4JK5A 1GJAB 1HJAB 5FPYA 2SNVA 5FBIA 1AU8A 3QGNB 4JYTA 2ZP0H 1CQQA 3LGWA 1MAXA 3M3VA 3M5MA 3VXFH 2A4GA 1WYKA 2QXGA 4FOUC 4Y11E 4D76A 4Y0ZE 1UVTH 2FOMB 1AKSB 2R3YA 1CA0C 5C2ZA 1BHXF 3ODFA 4DJZB 3Q00A 3F6UH 1TGNA 4FUCA 1HYLA 2C93B 5GIBA 1AB9B 2UWLA 4X0WU 3KCGH 3M37A 2HNTC 1TX8A 3AAVA 1Y5UT 2STBE 3SV7A 3T2NA 3PMJA 3BTGE 1C2IA 4FETA 2CN0H 1C5QA 3VB6A 4Z1MD 2GDEH 3S7HB 2J97A 1LVOA 1GBDA 1UTMA 4O3TA 1NFYA 8LPRA 1TQ0B 1Z71A 1KXFA 2XNDD 2XCNA 4THNH 3SQEE 3RM2H 1C4V2 2L74A 4GLYA 3O8RA 2Y82A 1G30B 3MO6A 4ZROA 1WTHD 1MTUA 1VR1H 1TNKA 2QGRA 3KN2A 3SU0A 2UWOA 1O33A 3L6PA 2HRVA 3TGKE 2LPRA 1K0HA 4OS1A 2HVYB 1TNHA 4ABBA 1S0RA 1DUAA 3OX7U 4KTUA 4E7NA 1O3PB 3K65B 1TA2A 3K6ZA 1TX6A 4WVPE 1OYQA 3E91A 1VCQA 1P06A 1O36A 2ZA5A 4ISOA 5L6NH 2R0LA 2FLRH 4AFUA 4NZLA 2FOFA 3LONA 4Q7XA 4X1RU 2ZFQH 4GCHG 1GG6C 3I29A 3LPRA 4INKA 4YOIA 1SLUB 2C8XB 1BJVA 1EXFA 3UQOA 2ASUB 2ZDVH 1BA8B 3LOXA 1C2JA 1O34A 2J94A 1OWEA 4Y8YA 1BIOA 1TBQH 2IJD1 2GVFA 3MU4A 3A7WA 3OTJE 3ZZBA 1DWCH 1AE8H 4X8TH 1P2QA 3RC4A 3V13A 1OP8A 1SGFG 2OQ5A 1B0FA 3UY9A 1E35B 1IQFA 1RGQA 6CHAC 1YLCA 2GZ8A 3BTME 1C2DA 3QUMP 1WBGB 4Q2KA 1F0TA 1ELVA 4B73A 4H6SB 4OS2A 4TY7A 4CRFA 1GMDF 3FN8A 3ZYDA 1AO5A 1PYTC 1GGDC 4X6NA 2VU8E 3LGUA 4AYYB 5C1XA 9ESTA 2ZIQH 1OPHB 4U2WA 3ZV9A 4NGAH 1ELDE 2BZ6H 1GBFA 1O3AA 3PLBA 1FLEE 1MKWH 4BAMB 2RDEA 2UWPA 1Z8IB 1DOJA 2OC8A 4ZKSU 5EW1H 1M9UA 1DWDH 2AGGX 1U6QA 5JYIA 2PKAB 5PTPA 3SJ9A 1IQGA 1YPHE 4K8BA 1KXBA 3W95A 3LGYA 3ZZDA 2P3TB 1O2VA 2C8WB 1T8OA 2Q6GA 3DSOA 2LNCA 3SGBE 2SNWA 2O8LA 1SC8U 2FEQH 1G36A 3RP2A 3GCHC 1YLNA 1N6YA 1HAXB 1YPMH 4U30A 1RD3B 3OFND 4IGDA 1E38B 1QQ4A 5LPRA 2EEKA 3PTNA 4ABGA 5JBAS 3UOPA 2VVVA 4CRCA 2OD3B 3P17H 1D6RA 1RXPA 1S83A 4WMFA 4UONA 1H1BA 1DT2A 1CA0B 2ZFRH 2ANYA 1SVPA 2ALPA 1A0HB 2ZO3H 3VB5A 3M5NA 3D65E 1FONA 1CA8B 2ANKH
chains in the Genus database with same CATH topology
2A7HA 1EAUA 1MU6B 1PPHE 4WY3A 4BAKB 2GGVB 2VWNA 2PSXA 1OOKB 5C67A 1MKXK 3MNBA 1GVLA 4K8YA 2XBXA 3TITA 3PMAB 2ZCHP 3QGJA 4JMYA 4AFQA 1H9LB 1CGHA 2OBOA 4E06H 1V2UT 4J1YA 1BZXE 1EKBB 2ZFSA 4JZEH 4O03A 1W7GH 2BB4A 1HAHH 1O5BB 2XCFA 3ZVFA 3OSYA 3RC5A 3UNSA 8GCHG 5EG4A 2A2XH 1GJ4H 1V2NT 1Y3YA 3CS0A 4O9VA 4DG4A 5G4BA 2BY7X 2H2ZA 2PUXB 1DXWA 1ABIH 1PPBH 3SNEA 2GCTC 1F0UA 3TU7H 2QXIA 2VGCC 3TVJB 1YYY1 4CR9A 1ZMJA 4I7YH 2ZGJA 1MD8A 1EJMA 4Y0YE 1A3BH 5DP8A 1Z6EA 1S6FA 5AFZH 4ZHAA 1A1RA 1Z8RA 2ZFPH 1YBWA 2OC7A 2QA9E 1ZTLA 2W3IA 1O39A 1GG6B 2Y5FA 1B7XB 1J8AA 2G52A 1ELTA 1CHOG 5DGJA 1YCPH 1C2HA 2OBQA 2VVCA 2VWOA 5GDSH 1O2KA 1YPJH 1FJSA 2FI3E 3TK6A 1LVMA 4ISLA 1LQEA 1ZTKA 5DP9A 2ZKSA 1O3CA 1P2KA 5TCAA 7LPRA 2WPJS 4B2AA 1V2ST 2A31A 2BDIA 2TGPZ 6CHAB 3TJOA 2BDYA 1NESE 4DY7B 3SNAA 2EI7A 2GD4B 2FS8A 3TJNA 4DIHH 5E2PA 1QRXA 1S84A 1Y3XA 3MO3A 2GZ9A 3URCA 1D4PB 1ZMNA 1FPHH 1GGDB 1SGDE 1IAUA 3VB4A 5FBEA 1GDUA 2GTBA 1MKXH 2PHBA 3AW0A 3DT0H 3E16B 4AG2A 2BDBA 2Z3EA 1DLKB 1GI4A 1BTWA 5CMXH 1O2QA 1O3KA 2BQ7B 1OWHA 2AGIX 3F9EA 5J4SA 3CENA 2D8WA 4AFZA 1KSNA 3MFJA 1ZSKA 5A0BA 3GY2A 4BAOB 3PMBB 1EPTC 2C90B 2NU4E 4GSOA 3SNDA 4NIWA 1PQAA 5HMAA 2AIPA 4AB8A 3GCHB 5C1YA 4WF8A 3WY8A 1ETSH 2FX4A 1BCUH 4AB9A 1BRAA 1ELEE 2FDAA 1ZRKA 4K60A 5CHAC 1P9UA 5JBCS 1T8LA 2VJ1A 1TAWA 2W5EA 4ZKRU 2BD2A 1N1LA 1EPTA 4B75A 4K1EA 5EGMA 1SGNE 1HAVB 1AI8H 4JZFH 5H4IB 2FYQA 3EDXB 4I32A 4B74A 2ZHDA 1ARBA 3KIDU 1EX3A 1HAIH 3NZIA 4TPIZ 2G4UA 1T4UH 3A7XA 1RTKA 1FY1A 4K5ZA 5GJ4B 2ZDKA 2TPIZ 2TGDA 4OGXA 1FXYA 3E6PH 3EA9A 3F1SB 1TALA 5DP3A 2FX6A 1GJ8B 1C9PA 1JIMA 3MH5A 1NU7B 1HFDA 1F5LA 1THPB 2GV7A 1SGTA 3SV8A 1FY3A 3VB3A 5A09A 3U1JB 2GCHG 1S85A 1UVUH 3S9BA 1UTJA 1Y3VA 2SGFE 3ZVDA 4BNRA 1Y59T 1DWBH 1GBIA 2O8MA 1AQ7A 1MQ5A 4ISIH 1XM1A 2A1DB 2GCTB 1W0ZU 1KXEA 4WXIA 1ETRH 2HWLB 3ATWA 1V2PT 2VGCB 1P11E 1K2I1 2C8ZB 2VIQA 1KLTA 1CHGA 2HPPH 2ZU1A 2A0QB 3FANA 4GHTA 3ZVBA 1TE0A 1T7CA 2PWXA 4UD9H 1ESTA 1DICA 2ODPA 1ELCA 3FP8E 1EATA 1O5EH 1DM4B 1IQKA 2BQ6B 3SGQE 1LVYA 2ZPRA 3MHWU 3RUOA 1ZJDA 1JMOH 2BLOA 3Q3XA 4BAQB 3M5LA 1IQIA 5A2MH 5LPEA 4XDEA 1AVGH 5F8TA 3A7ZA 2AERH 1HGTH 9LPRA 1SGEE 3RM0H 2GKVE 2WUCA 3V7TA 4MDSA 4X2WA 1C5TA 3V3MA 1NN6A 3RXLA 1O5DH 1P8VC 2VB0A 4CR5A 1CO7E 2UUYA 4XSKU 3MWIU 2ZCKP 3GY7A 1SGRE 3SNBA 4KGAA 4YZUA 3W94A 4XE4A 1B5GH 1ESAA 4UFFH 3GY4A 1TNIA 1QA0A 4WXVA 1HJ8A 1GI0A 2Q6FA 1GBCA 3A7YA 3TIUA 1OKXA 3SUFA 4DOQA 1NC6A 5EQQA 1O3DA 1QL8A 7KMEH 1V2MT 3NWUA 4B1TA 1ZGVA 1DSUA 1ZPCA 1WSSH 2BX4A 4Q80A 1GBHA 4R8TB 1HDTH 2ANMH 3RU4D 4K1TA 4XOJA 1TLDA 1O2LA 2BOKA 3K2UA 3U9AH 4X8SH 1W7XH 1EPTB 1GI5A 2GX4A 1W8BH 1V2JT 2B5TB 1KXCA 3VGCC 4K1SA 1BDAA 1OP0A 4X2XA 1AN1E 1SGIB 2ALVA 4X8UH 1EP6A 4BXWA 3BEIB 2ZDAH 2Z9IA 2XC5A 4I8LA 1GHAF 4I33A 4TY6A 3MI4A 3PTBA 3S69A 1WCZA 5EU8A 3BSQA 1AIXH 1QB1A 4B2BA 1EP5A 2C8YB 3S0NA 2RA3A 4WH6A 1C4Y2 2Z3DA 3GOVB 3AVZA 2PW8H 4B2CA 4ABJA 1W2KH 2TGTA 1O38A 3BTTE 1CBWC 1MTNC 3LGIA 1ZYOA 2IJOB 3FP7E 4Q7ZA 1YPKH 3QDZB 4FU9A 3JZ2B 4Y7AA 1EJNA 2HLCA 1GBTA 5EXLA 3T27A 4A1TA 3ENSB 1GBLA 1FV9A 2KAIA 1T8NA 1TMUH 3D62A 1UTPA 1YPLH 4ISHH 1HAZB 3QTOH 3A8DA 3U8TH 1F92A 3RXKA 1YPGH 3PB1E 3BTKE 1RFNA 5F6MA 1CE5A 1P2IA 1O3OA 1VITH 1FUJA 3A82A 1ZHPA 1CVWH 2Y7ZA 2G5VA 2IOTA 2HALA 2QC2A 4MPUA 3GCTF 2CF8H 1EAXA 1E37B 1TX7A 1EZSC 2ZU5A 1TNLA 3HKIB 3PLKA 5C5NA 5J4QA 3M7TA 1TA6A 1JWTA 1TRMA 3SU5A 2DE8A 4NWLA 3A8CA 1TBZH 1AGJA 1T32A 1MUEB 2XWAA 4E7RG 1C2LA 1VJ9U 1TOCB 4XFQA 1GI8B 1TNGA 1BQYA 1SLXB 1HIAB 4M7GA 1GI1A 1P03A 1UK3A 4TWWA 2PV9B 1GJCB 3STIA 1W10U 1C5RA 1UJ1A 3QWCH 1PPEE 4D7FA 2OC0A 3TNTA 3EA8A 3LC5A 1BTHH 3V12A 2FOGA 5BPEA 1GVZA 3UR9A 2YNAA 1LPKB 2Y6TA 3SUDA 1GMDG 2A5IA 2OXSA 1O2PA 2GZ7A 3V0XA 1QGFA 4H6TA 1CT4E 1C2KA 1C4U2 2I6QA 1BITA 3GDSA 1MKWK 3IWMA 1ZRBA 4MPXA 1P2OA 2BDAA 5DK1A 1C2GA 1C1UH 5HM2A 1FPCH 3A81A 4NCYA 1ABJH 1L1GA 3RDZA 1SPJA 4KTCA 4MPVA 1MTWA 1NPMA 1TQ7B 3SOSA 3RXJA 2BXTH 1THSH 3ZZ5A 2BOHB 2F83A 3P8FA 5EOKA 4OS5A 4CHAC 1N6XA 3VGCB 1C5YB 1O30A 1QB9A 1K1IA 1DS2E 2VH0A 1F0SA 2HGTH 2Z9KA 4UFEH 1LO6A 5LGOA 1NFWA 1C5ZB 5IDKA 4DGJA 4A7IB 2FIRH 2WPMS 4IC6A 4XBDA 4YM9A 1P04A 2BHGA 4UFGH 1EQ9A 3KGPA 4LZ4B 2YOLA 1QBOA 1QCPA 2NU3E 4AOQA 1N8OC 3GY8A 3MNCA 3RXAA 1GBAA 1GL0E 1FAXA 1VZQH 3KNXA 1QL9A 3E90B 1UVPA 3UR6A 2ZPQA 1NRRH 1ELGA 1AVWA 1O2IA 2KAIB 2FYRA 1H4WA 1ZTJA 2OLGA 4Z6AH 1CBWB 1MTNB 1EB2A 2O8UA 2J92A 1DX5M 1LHFH 2ZU4A 5T6DA 4Y76A 4FUIA 3DHKH 2G8TA 4AFSA 3F9HA 3U98H 4UE7H 3TGJE 2G4TA 3QX5H 5GXPA 3UOUA 3I77A 1T31A 2AMQA 1TGCA 3ZZ4A 3TK5A 3S7KB 3A86A 1YGCH 1ZJKA 2XC4A 1GPZA 1GHVH 1V2RT 2FOBA 4JZDH 3SBKA 1L4ZA 2C4FH 4NZQA 2ULLA 2VNTA 1MMJN 2FOAA 1Z7KA 4CRAA 1BUIA 4AORA 1O3EA 2J95A 1DLEA 3DFJA 2ZQ2A 1MQ6A 1FAKH 3SV2H 1SGYE 1S6HA 1ZPZA 1BHXB 2AH4X 1CGIE 1SFIA 3NXPA 1BTUA 1A3EH 1GBEA 2BMGB 1E36B 2FZZA 2Q6DA 1XUHA 1ACBE 2ZTZA 5C1UA 1ZSJA 3K9XB 1ZHMA 4D9RA 2JKHA 1HUTH 1GHYH 3EE0B 1YCPK 1O3HA 1SGQE 4YOGA 3LDXH 4CRDA 1Y5AT 3BTQE 1SR5C 5EPNA 3SW2B 1HCGA 1P9SA 1C5LH 3SO3A 3GYMA 2ZTYA 1C1QA 1A7SA 1JRTA 1RTFB 4DT7B 4ZHMU 4ABFA 1O2JA 2QN5T 1XX9A 1EZXC 4RKJB 3U8OH 4GPGA 4NFEA 3BIVH 2W3KA 1UTLM 1H8IH 3LJOA 3QZQA 5DP5A 3T62A 2ZGCA 3SHCH 1P01A 1MTSA 4LXBH 2BD5A 1PYTD 2BVRH 1KDQA 1KY9A 2F9BH 2EI6A 2TIOA 3TGIE 1K1NA 1GJ7B 2P16A 5FX6A 5L2YH 3RXOA 4IBLH 5ESTE 1EZUC 4FUJA 3SGAE 1MZAA 1O5AB 4E05H 1KYNA 1P2NA 1C5NH 1O2HA 1OS8A 1GI3A 1MBQA 2A4RA 1XKAC 3ZVGA 1FZZA 1QR3E 2ZGBH 5LH8A 4BANB 4OS6A 5DP4A 5JBTA 1Z1IA 5I46H 3P6ZB 1NTPA 1A0JA 4JZ1A 1ZLRA 1W12U 2JETC 1UCYH 1ZSLA 1H9IE 4CHAB 2JH6D 4X8VH 1HLTH 3ZZ7A 1VCPA 1P12E 1AHTH 3FZDA 1KTSB 2OTVA 4X6PA 1F7ZA 1O3LA 2FPZA 1L1NA 3UNQA 5C20A 6GCHF 1IQEA 5L30H 5ESBA 2B9LA 4IN2A 1V2WT 1RS0A 1SGPE 1ZPBA 1N8OB 2H1UA 3OYPA 4Y8ZA 1TPAE 2BY9X 1LHGH 2GMTC 3GY3A 1EAWA 5JB8S 5DP7A 3MU8A 1O2ZA 1W0YH 3SU1A 1BBRH 3PWBA 1S81A 2ODYB 4AX9H 2TBSA 1QTFA 4NSVA 3RXGA 3KQEA 3SQHE 1MCTA 2XBVA 4Y10E 1IQNA 2H6MA 4ZMAH 2CMYA 1C5XB 5K0HA 1P3CA 1D9IA 1Q2WA 1WOFA 3BG4C 2ZDLA 2J2UA 3SU3A 1OXGA 2BD7A 2BM2A 1LQDB 6LPRA 2WYGA 1DY8A 4H4FA 2BX3A 1CT0E 2ZDNA 4OS4A 3EGKH 1NRPH 3MU5A 1O5CB 1XVMA 2PUQH 3E0PB 1F5RA 3F9FA 3RLYH 4B71A 1GMHF 1J17T 3T28A 1LMWB 1BRUP 5CE1A 2A4OA 1O2NA 3PWCA 3RXFA 3Q76A 1TWXB 4AN7A 4FVDA 1QJ6B 1GDQA 5E2OA 2ANWA 1LKAA 1AUTC 1C5PA 3HATH 4IC5A 3CS7A 1FY4A 3SUEA 1AE5A 3HPTB 1X7AC 3O8CA 4I8GA 1NT1A 2WUBA 2BYAX 2J34A 1QQUA 3PO1C 1GJ5H 2ZHFH 1Y3WA 3AW1A 1C5SA 1FNIA 3ATLA 3GCNA 1G2MA 1VJAU 3CP7A 2ZQ1A 2Z94A 1E0FD 3S9AA 3F68H 3LT3A 5JB9S 1GBBA 1IQMA 2ZECA 2QV1A 2QIQA 4NIVA 3U8RH 3MNXA 3B9FH 3VPKA 2B8OH 1O2XA 5HGGA 1NFXA 1V2VT 3RU4E 1PQ5A 3FZZA 2FOCA 3QLPH 1O2UA 3EA7A 1S82A 2F91A 1VITF 2Y7XA 3FAOA 2FS9A 4UEHH 3ATMA 1A0LA 1EB1H 2Z3CA 1G37A 6ESTA 5T6GA 4X1SU 2ZFTA 1TBRH 7GCHF 1INCA 1KIGH 1QJ7B 3SUGA 3A84A 1SI5H 3SZNA 3RXCA 4Y8XA 2BLVA 3LH3A 4CH2B 2BD9A 3NK8A 4LZ1H 3RMMH 4I8JA 4X2VA 1ELBA 1BMLA 2WPLS 8ESTE 4TPYA 5LPFA 1WV7H 5GWZA 1WUNH 2JETB 2THFB 4LOYH 3GDVA 1O2RA 4DURA 1GJ9B 1C9TA 1GHZA 1CSOE 4NA8A 1AFEH 2PLXA 1O3FA 1D3TB 4YESB 5F03A 3P95A 2ZCLP 4MPWA 4A6LA 1QBNA 1GHAG 3TLOA 2J38A 3AAUA 1AWFH 1Q31A 1LPZB 4INHA 2PR3A 2XYAA 3STJA 3FVFB 3SI3H 1TOMH 2BLQA 2SGDE 2GMTB 3ESTA 4YLQH 3Q77A 2FESH 1ESBA 1K28D 1Z1JA 2F9OA 2WINI 4JK6A 4AZ2B 1O37A 5A0AE 4FUGA 1PPCE 4MNVA 3LGVA 2A2QH 1O2TA 3E1XB 3HKJB 4IMZA 1ZGIA 2ZHEH 3M36A 1ZHRA 2BLWA 4NG9H 2OP9A 3NKKA 1A46H 1LHEH 3BG4B 1KXAA 2ZG0H 3SU2A 3MH6A 1FI8A 3UREA 3ATKA 3A87A 2BD8A 3TH3H 2P3FH 3RXIA 1W11U 1HAPH 1H8DH 4X2YA 2J4IA 1UHBA 2GT7A 3U1IB 2CGAA 2EI8A 1A4WH 3ZZ9A 4J2YB 1AKSA 4Z0KA 3A8AA 2SGAA 4YT7H 1SOTA 2SGQE 3GCTG 5SGAE 4FUBA 1OX1A 4Y79A 2C3SA 3T5FH 1NFUA 1G9IE 1ZZZA 1J15A 2D2DA 1NZQH 3A83A 3A7TA 1IQJA 1GHWH 1UCYE 2B7DH 1SLWB 1RIWC 2RDLA 5FAHA 2VIWA 1QBVH 3ITIA 3PO1B 3ZZCA 1TPOA 3TJVA 3B8JA 1K21H 3P8OA 1GI2A 5B6OA 1EJAA 1ELFA 4ZUHA 3SU6A 4WMEA 1HAOH 2I6SA 2QYIA 1LCYA 1O31A 4JCNA 3L33A 3BTFE 4YT6H 3GY6A 4KKDA 3URDA 1GCTC 2HPQH 3SJKA 2A45B 3M3TA 2ZF0H 2HVXA 1BTPA 4ZAEA 4AYVB 3OY6U 1MU8B 2AMDA 4ZH8A 1BBRE 3SN8A 1TRNA 3RXVA 1CU1A 2BTCE 2QXJA