1UHBB

Crystal structure of porcine alpha trypsin bound with auto catalyticaly produced native peptide at 2.15 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
b'SSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Trypsin activity reduced by an autocatalytically produced nonapeptide
pubmed rcsb
molecule tags Hydrolase
total genus 19
structure length 98
sequence length 98
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uhbB00
2P8OC 1A0JA 1PPHE 4UONA 2SNWA 2QXIA 1V2JT 2ANKH 1K9OE 1IQEA 3EA9A 4IC5A 1T4UH 3PROA 4OS2A 2GCTC 1ELTA 4ZHAA 1H9LB 2SGPE 1O3LA 3QTVH 1SG8B 4HTCH 3RP2A 1GI4A 2BTCE 1GPZA 5A2MH 3T62A 2ZHFH 4UFFH 1C2KA 3ATWA 2Z9JA 3M3TA 3PWBA 3U98H 2ZGCA 4X1QU 3TLOA 1GJ4H 1BJUA 3PMHB 4LZ1H 2B8OH 3ZV9A 1TQ7B 4X2WA 4HFPB 1QB9A 5E0GA 4E7NA 1GCDA 4NA9H 2EI7A 4I8KA 3SZNA 1EZQA 1BTYA 3H5CB 4KKDA 1GJCB 1PFXC 1HAOH 1MUEB 3E16B 1HAXB 3A80A 3PB1E 1GJBB 1ACBE 3SJ8A 2M5TA 1HBTH 1P3CA 3BTEE 2ZCHP 1HXFH 4MPUA 1W0ZU 2BYAX 1NRNH 1TONA 2QXJA 3F9EA 1GGDC 3MYWA 4DGJA 2VVCA 4CHAB 1KYNA 7KMEH 1HLTH 2ZGBH 3LIWA 1GI9B 4E7RG 2P93A 1AWHB 3ZVAA 3F68H 4X1SU 2FOCA 1T31A 3HK3B 3GY8A 4OS6A 2ZA5A 4LK4A 5TJXA 3RXSA 1TPPA 2BDGA 3DFJA 1G37A 1GMHF 1C5ZB 3I29A 2WYJA 3ITIA 3AASA 1YCPM 3GISB 1KTTB 4NIWA 2OD3B 1FN8A 3OX7U 2BD4A 2GT7A 3SNAA 4ZH8A 1O3AA 4MPVA 1MAYA 3MNXA 1QCPA 2A5IA 3R3GB 4MPXA 1C2MA 3TGJE 5GJ4B 1LHFH 4GHTA 3MU1A 1GHAG 3TIUA 2OC8A 1TPSA 1C5WB 3LDXH 3RMMH 1O3GA 5GDSH 3KQCA 1O3BA 5DP4A 4YT6H 2GGVB 1PPZA 2RG3A 6LPRA 1GBCA 1W12U 1PYTC 4B2BA 4TPYA 4FUFA 1DY9A 1WTGH 2ZTZA 1KLIH 4K1TA 1E36B 3GCTF 1CA0C 4BXSA 2FX6A 3RXQA 1KLJH 3SI3H 2P95A 1V6DA 5FBEA 1IHTH 2ZKSA 2PUXB 1GHXH 4XE4A 3NXPA 2I6SA 1G3EA 4X1PU 1ZSJA 4WMFA 2BLVA 1GI5A 4OS7A 3U69H 1NS3A 4VGCC 5HMAA 1BTXA 2A4OA 2VIOA 3A7XA 5EQRA 4ZMAH 2XXLA 3GDSA 1A1RA 2DUCA 5EQSA 3SU5A 1ANDA 5GXPA 5AVDA 5EPNA 3T28A 1ELVA 2I6QA 2G4TA 1YPGH 4I33A 1EP6A 1NPMA 4ZUHA 1NU9A 4O9VA 1TOMH 1SGCA 1HAHH 1AFQC 3I77A 1A5IA 1AHTH 1OOKB 1MQ6A 1QL7A 2W7UA 3TJOA 1XUKA 1EOJA 2ZPQA 3BF6H 2F9NA 1AB9B 2XCFA 1C2HA 1QIXB 3EYDA 4FXGH 1HAIH 2VJ1A 1P2MA 2HOBA 1AQ7A 2QF3A 1C5QA 2WPHS 2Z9LA 4CR5A 2GMTC 2VVVA 3W94A 1TPAE 4SGAE 2BY9X 1RRKA 1C5NH 1E38B 3T26A 2H9TH 3GDUA 1TOCB 3F9GA 4I8JA 2BX3A 1GG6B 1P12E 1VCQA 3SJOA 5A0CA 2O8TA 4ISNA 5C3NA 3GYMA 1GHZA 1TLDA 3TNTA 1W0YH 5F8ZA 3D49H 1O2SA 1BHXF 3ATLA 4YTAA 1O2JA 2Y7XA 2OTVA 5I25A 1EJMA 2Q6FA 5IDKA 5DG6A 3RXGA 1EP5A 1FY1A 3TU7H 1GJAB 2R9PA 4U30A 3RDZA 3UFAA 1ZPBA 4ZAEA 1FONA 2GV7A 3RXLA 1TX8A 1LPKB 1JWTA 3RU4D 4AFQA 1WYKA 1P09A 4GVUA 4UDWH 3SNEA 4JYTA 3EAJA 4KTUA 4TWWA 4UE7H 1FN6A 2ZI2H 2NU2E 2VIDA 2ZIQH 1EB2A 1O3CA 3RXDA 2GZ9A 1RIWB 1AO5A 3B8JA 5F8TA 4SGBE 4AN7A 5AF9H 2LNCA 2ZWLH 4WWYA 5EODA 5C1XA 3VB7A 3SV8A 1O37A 1HAYB 2W5EA 1G9IE 4R0IA 5AFYH 4DW2U 1FIZA 2FOHA 2ALVA 2H6MA 3L3TA 1ZMNA 2A45B 1B0EA 2B5TB 3RLYH 2O8MA 5EU8A 1QRZA 1J15A 2NWNA 3A7WA 3CP7A 5DP8A 1RTFB 2F9PA 1HGTH 2C90B 2GD4B 1BMAA 2OQUA 3M5MA 1FPHH 2ZDLA 5DP3A 2BM2A 3LH1A 1HV7A 2BVSH 3A7VA 4Y0ZE 2ZQ1A 2B9LA 4NZLA 3RU4E 2F9UA 2FM2A 3IITA 1MTWA 3KQBA 1VITH 2Z9KA 1X7AC 3RXMA 3SN8A 4ASHA 2FX4A 2FMJA 1XUGA 1KXCA 1TNIA 1UTJA 3RXIA 1C5VA 3NZIA 1Z6EA 2ZQ2A 4WMDA 4BNRA 1O2NA 1QB6A 2QXHA 4CREA 1VZQH 4ABDA 4B2AA 1DANH 3A8DA 2TGPZ 4YLQH 1EASA 1DSTA 2ZDMA 1O3EA 2GDEH 4O3UA 3LC3A 4D9RA 2P8OB 2XBVA 5ESBA 3UUZA 2UUKB 1LVOA 1UTLM 2GCTB 1V2PT 4LOYH 1H9IE 2BB4A 1GHVH 1V2WT 2FP7B 1BT7A 3GY4A 1SR5C 3RU4T 9LPRA 1V2UT 4DVAU 1ESTA 1GBLA 2TIOA 3D62A 2J95A 2D26C 3PLPA 3VXFH 1SGIB 3SU0A 1O33A 1TA2A 5GIBA 1Z7KA 3KL6A 4PROA 1FV9A 1O38A 4DIHH 3MNBA 1WSSH 1JRTA 1Z8RA 1BTZA 3TH4H 2UWLA 1MCVA 1O35A 3PMBB 3M7TA 4I32A 1SGFA 1S0RA 2TGDA 1DUEA 2BD7A 3K2UA 1GVLA 3LC5A 4NA7A 3ATKA 3CENA 4HZHA 5EPYA 2XWBI 3ZZ6A 5ABWA 1LVMA 2FWWA 7ESTE 3BTQE 1DM4B 2FODA 2ZPSA 4K1EA 5EOKA 1SGRE 1GGDB 1PPFE 1NO9H 2BVXH 3UOPA 1YPHE 1C5YB 1EJNA 1GI0A 3TH3H 1GJ8B 5K0HA 1TBQH 5EXMA 1RXPA 1TX7A 3M3SA 4NIYA 3VFEA 4RSPA 1TA6A 1T8OA 4I31A 3M35A 1MKXH 1O0DH 1LQEA 3MU5A 3ZVFA 1GBIA 1UK4A 1AU8A 2ZU5A 5TCCA 5CMXH 1TGSZ 2SFAA 3URCA 1K1PA 2FDAA 1LQDB 2XNIA 2ZU1A 2P3UB 1QL9A 3LU9B 1L4DA 1Y3YA 1EZUC 4XBBA 2G51A 3NWUA 2VB0A 2ZCKP 1LCYA 4CRFA 4NSVA 3G01A 4Q2KA 4NIXA 1FY8E 2A7JA 5E0HA 3VB6A 1P2KA 4ZKRU 1ORFA 1YPMH 4AOQA 1SHHB 1ZR0A 3GDVA 1KLTA 2VH6A 3GCTG 2PUQH 1AVGH 1G32B 1PPBH 1Y8TA 3ATMA 1GHBG 1GBHA 3PTBA 4HI3A 2VWMA 4DG4A 2ZGHA 1O5AB 3Q76A 1A61H 1ZGVA 3ATIA 2FOFA 4X2VA 2EA3A 2GP9B 5L6NH 1CA0B 1AMHA 1O2TA 2A1DB 1ZMLA 3E90B 2XC4A 4XSKU 3EA8A 4GAWA 2ZFQH 4GUXA 5IYTA 3GYLB 1TAWA 1V2NT 1GVZA 1K21H 4VGCB 1RS0A 1V2TT 4B73A 4XFQA 3D65E 4NZQA 4MQAA 4FUBA 1ZPCA 1Z6JH 1C5SA 2O8UA 1QBNA 5SGAE 2Z3DA 4JYVH 5I46H 3PO1C 1P3EA 1GL0E 1CT2E 5GCHG 1W11U 5HGGA 1DWDH 3DUXH 3RXHA 1MMJN 2Q1JA 2GCHF 4X2XA 4FUDA 1O5GH 1TNJA 4CH2B 3SO3A 1UCYK 1AFQB 1C1UH 1DE7H 1O2IA 5DK1A 2W26A 4MNWA 1A5GH 3OTJE 1AFEH 1ABJH 1DLKB 1LVBA 1SGEE 1H4WA 1QY6A 3P8OA 3TK9A 1SQTA 1UVPA 4INLA 2ZDVH 1HB0B 2AMDA 2F91A 5EW2H 2PWXA 3SU6A 5FBIA 2GMTB 1GMDG 4RKOB 1BRAA 3SV9A 2ALPA 3LGUA 4OGXA 1C1WH 3LOXA 1O2OA 3HGPA 1O5DH 4F4OC 1L1GA 1O30A 1OSSA 2D2DA 3UWJH 1SB1H 4AG1A 2FS8A 1OP0A 1V2RT 4A1TA 1T8NA 3E3TA 1E0FD 4ABFA 2OC7A 2ZGXH 3DHKH 1QBVH 2HNTE 2V0BA 1BRBE 4B74A 1KTSB 1RIWC 1WTHD 1DLEA 1GI3A 1OP8A 1UVUH 5EW1H 1BA8B 1FY3A 1NRRH 3BN9A 5HYOA 4K3JA 2BY5X 5L2YH 1O5BB 1NRPH 4CRBA 2Y5GA 1SFIA 1JMOH 4CRCA 1GBTA 1RD3B 1W3CA 1SLVB 2C8YB 1UTMA 3AW0A 3ODFA 4IBLH 2BD5A 5GWZA 3T2NA 3LGWA 2PR3A 4ESTE 4INHA 3ESTA 1KDQB 3E91A 1JIMA 1OYQA 4X6NA 3C1KA 2H9HA 4R8TB 5J4SA 3F1SB 1HAZB 4UEHH 5FCRA 5F03A 4X1RU 1ZJKA 1JBUH 5T3HA 3UQVA 3M7UA 4TY7A 3P8FA 1LTOA 2A32A 2UUJB 3TK6A 1FLEE 2G5VA 3FFGA 1ELFA 3VGCC 3PYHA 1AD8H 1FNIA 1O3HA 2OINA 2QA9E 3ZZ3A 1KXEA 2XBXA 2O8WA 3EDXB 3EQ0H 4ISIH 3UY9A 5GPIB 1F7ZA 4O3TA 1NTPA 3E0NB 4I8GA 2R3UA 2IN2A 3EA7A 1O39A 3EGKH 4H4FA 3A7YA 2C8WB 3SW2B 1LVYA 1ZHRA 5JB9S 1RGQA 2F3CE 2ZU4A 2XW9A 1VCPA 5AFZH 1K1MA 2FOEA 2HWLB 2V3OH 1SLUB 3BEUA 3ENSB 5LH8A 7LPRA 4FVBA 3TVJB 1PPGE 4JCNA 4FUHA 1C4U2 3A81A 2G00A 4TYDA 1QQ4A 4MNXA 2QV1A 1E35B 4GHQA 1KXAA 2BQ6B 4IMQA 4JK6A 1NZQH 1KDQA 3BTWE 2BDBA 1S5SA 2Z7FE 1Z8GA 1O2UA 1THSH 2EI6A 3TK5A 1C1RA 2VIQA 2PSXA 1J16A 2FESH 3RXUA 2ZPRA 5E2PA 4Z6AH 2ILNA 1IQGA 1C5TA 2PLXA 1OYTH 2ZG0H 3S9BA 2IOTA 3PM3A 3ZZ9A 1ELAA 3ODDA 4I8HA 1JIRA 2ZFTA 3DD2H 3MO6A 1DDJA 2ZHDA 1FJSA 1ZSKA 2AYWA 2PTCE 3SNDA 1O2WA 1O2ZA 4ZXYH 1YPHC 2BY7X 2BOKA 1MKXK 1W14U 1BTWA 3ZVCA 3UPEA 1C1SA 1F92A 4MLFB 2GTBA 4X0WU 1GJ6A 1XUHA 2THFB 1SGTA 1JOUB 1WV7H 1EUFA 1HCGA 1C1OA 5L30H 2W3KA 8GCHF 3U1IB 1BMLA 1G36A 3SU3A 3KGPA 1Z8IB 4U2WA 3RXTA 1C2LA 1BMMH 3AVZA 2TPIZ 1MTSA 1LHEH 1A3BH 1TMTH 3RXCA 4KP0A 2OBQA 5HM9A 3K9XB 3FP8E 3MH7A 1AVWA 2Z3EA 1L1NA 3RXOA 1VITF 1K1OA 4NWKA 1GDUA 4ABEA 3LT3A 1YPJH 5A8ZA 2TGTA 2BD8A 3RM0H 1QRWA 4ZKSU 2FOAA 8LPRA 1C5XB 1V2ST 1MBQA 2J92A 5JBCS 1P8VC 2SGFE 1HJ8A 4TY6A 1ZSLA 3O8CA 1KSNA 1YYY1 7GCHF 1O3PB 4ABJA 1Y5UT 4FUEA 1W7GH 5HXFA 2PGQB 3M36A 2GT8A 3UREA 3BIVH 1C5MD 2ZCLP 4NFEA 4U01A 3STIA 1EAWA 1LHCH 4YT7H 4WH8A 1L4ZA 1ZRBA 1YPKH 2QXGA 3A84A 5E8EH 2GZ8A 1OWDA 2WV4A 1SOTA 2A2QH 5A09A 1MZDA 1SI5H 4NGAH 3JZ2B 3P70B 1WCZA 3RXPA 1P0SH 3NPSA 2QYIA 4WXVA 1TNHA 3KHVA 1GWAA 4ZXXH 1ELBA 1FUJA 3U1JB 3QTOH 1UHBB 5JBBS 4TWYA 2A4GA 4WY3A 1UO6A 5DJ7A 3U8OH 3E6PH 2J34A 1GMCF 4NFFA 2PHBA 1Y3WA 1V2QT 2R2MB 4QT8C 1TGNA 1GI1A 3PO1B 3ZV8A 4GCHG 4BTTB 3QO6A 3QN7A 1TWXB 1O2MA 4YLUA 4IW4E 5FPTA 1GBEA 1UCYE 2P3TB 1AE8H 4NG9H 3T5FH 2V3HH 1GJ9B 2SGDE 1NT1A 4CR9A 1MH0A 4GSOA 2W3IA 4K8YA 4BANB 1OWJA 2HNTC 1TGBA 1CE5A 1A2CH 2UUFB 1HDTH 1ZZZA 1SQAA 1O5CB 1ZTJA 3DT0H 5DP5A 3UWIA 4DOQA 1OKXA 4FU9A 1SFQB 1QQUA 1FIWA 2ASUB 2ANMH 1PQ7A 4AB9A 1K1LA 3S0NA 1Z71A 3VB4A 1CGJE 2A4RA 1QJ6B 3HK6B 1C1PA 3FP6E 3UR9A 1EJAA 1Y3UA 2GV6A 2ZGJA 1C1VH 5JPMH 2VWLA 2ZO3H 2OC1A 3VPKA 4ABBA 1VGCC 4IGDA 1TGCA 5FXLA 1UHBA 2RDLA 4FU7A 1BBRH 1CSOE 2C93B 2OC0A 5L2ZH 1FDPA 1TYNA 4MNVA 1AWFH 1DPOA 2H5DA 1P9UA 1NESE 1MBMA 4WMEA 1UMAH 4INKA 3BV9B 1ELGA 1LMWB 1MTUA 1EB1H 3SI4H 1CQQA 1YCPH 5LPRA 2B0FA 1EPTC 3B23B 3TPIZ 1WOFA 1MKWH 2P94A 2SGAA 2QCYA 1ZOMA 4JMYA 4ISOA 1A0HB 4JZ1A 4A5TS 1F0SA 1ZPZA 3H7TA 3SGBE 4DT7B 1AUTC 1SGQE 3QZRA 3VGCB 1EKBB 1GI7B 3K6YA 4DJZB 2BVRH 2GVFA 1JRSA 4CRDA 5C5NA 1CHOF 1CU1A 3CS7A 2VIPA 1C1TA 1WU1A 4YOIA 1GJ7B 3KNXA 1O2VA 1TIOA 1YC0A 3PLBA 1H8DH 3FVFB 3OY5U 1O3NA 1F0RA 2Q6GA 3RUOA 4AFSA 1V2VT 4E05H 2BZAA 3M7QA 2FTMA 4Y8ZA 3TJVA 1UTKA 3V0XA 3A8AA 1GI8B 4KELA 5T6GA 4MTBA 9ESTA 5JDUB 1ID5H 1DVAH 3OU0A 4MNYA 1AZZA 2Y6TA 3MH4A 1QL8A 2BX4A 3RXEA 3MOCA 2JH0D 1QB1A 2AS9A 3SHCH 3ZVGA 4H42U 3ZVDA 2GKVE 4AFUA 1D3QB 2ZDNA 4Y76A 2V6NA 2FLRH 4M7GA 4Y7BA 1G2MA 4TPIZ 1IQLA 4CRAA 3Q00A 3UNQA 1DXPA 2DE9A 1UK3A 4Y0YE 3RC4A 1O36A 3LKWA 1O3JA 3Q3XA 2FPZA 3B9FH 3SUFA 2J9NA 1AGJA 3MNCA 2SGQE 5G4BA 3SV2H 1P2QA 3RMLH 1TALA 4D7GA 2Z9IA 2A7CA 1GI6A 1HIAB 2BZ6H 3LGTA 3SQEE 3QDZB 3M5NA 1SSXA 4ABIA 4IC6A 1J8AA 4JZEH 1GMHG 1FMGA 3QZQA 3JZ1B 1K1IA 1M9UA 3L33A 2FS9A 1GBBA 1IQIA 1Y59T 5ETXA 4BAOB 4DIIH 4XOJA 1C5PA 1YLDA 2BDIA 1MQ5A 3RLWH 4LXBH 1TB6H 4BTIB 3TGKE 5C20A 1XMNB 3S9CA 2AGGX 1A3EH 4D9QA 1O31A 1P01A 1PYTD 1GCTC 2ZU3A 1A0LA 3FANA 1ARBA 3MH6A 5DGJA 4O03A 1SGPE 1ANBA 2HRVA 1C1MA 4X8VH 3BG8A 2WPKS 1P02A 4B71A 2XC5A 4DY7B 2CF9H 4NSYA 4UFDH 4XBDA 3UIRA 1FAKH 2ZDAH 3Q3KA 2VWNA 4ISLA 4JZDH 3RXKA 4I7YH 1G30B 3O8DA 4YOJA 1GHAF 1TPOA 5FCKA 1D6RA 2O9QA 1SGFG 6CHAC 3TJNA 2ZHEH 4X6PA 1O2XA 5LGOA 1F5RA 8ESTE 5EG4A 2G81E 1DOJA 4CRGA 1HIAA 1NC6A 1P10A 1CO7E 2V35A 1BZXE 1CT0E 1CVWH 1EAIA 2ZECA 1HXEH 3MH5A 1V3XA 2G4UA 3FZDA 1EATA 4ZKNU 1T8LA 2GX4A 1ZRKA 1NRQH 4AORA 3H7OA 1TX6A 1DFPA 1GJDB 3K6ZA 1GBFA 2A0QB 4NA8A 1PPCE 3U9AH 2YNAA 1MTVA 1LPZB 1SBWA 2H1UA 3MMGA 5C1YA 1Z8JB 2BXTH 1K1NA 2ODYB 2FI5E 1B0FA 1YPEH 1EQ9A 4BAHB 2A5KA 2BY8X 5JYIA 1ESAA 4UFGH 2ODPA 1DWEH 1K22H 1J14A 1N6XA 2AH4X 1NROH 3TNSA 1W8BH 1EZXC 1P2OA 3HKIB 2ZNKH 2A7HA 4A92A 4B76A 5DKMA 4IN2A 4BOHA 5A0BA 1LDTT 3MNSA 2FOGA 2ZFRH 3E8LA 3OSYA 5DP9A 3A7TA 2WYGA 1BOQA 2TGAA 3U8RH 1G3CA 4GLYA 2FTLE 4ABGA 1D3TB 4WH6A 1XUJA 2J2UA 1GJ5H 4YESB 2VH0A 3URDA 1K2I1 5E2OA 2F9OA 1YLCA 2XTTB 3GY6A 2ZP0H 3HATH 1FQ3A 1BDAA 1D3DB 1O3FA 2Z6BD 2PKAB 1BITA 1FAXA 1P03A 5HM2A 1K1JA 1YPLH 3NKKA 4WF8A 1HPGA 2AMQA 2IPHA 1IOEA 4CBOA 4RN6A 3BTTE 1ANEA 4D76A 2R3YA 1BBRK 1W2KH 3GY2A 1BMNH 1O2PA 2A5AA 3ZZ4A 2UUYA 3SNCA 1SPJA 5EXNA 2VGCC 3PTNA 4A6LA 5DP7A 4D8NA 1VR1H 1MD8A 3QGJA 3MFJA 4X6OA 1O2RA 1P06A 1CBWC 2PFEA 1HAGE 1F5KU 3SU4A 2BOHB 1MKWK 2KAIB 3KEEA 1UVSH 2XCNA 3F9FA 2FEQH 4MDSA 1XXDA 3LGIA 4ABAA 3UTUH 1VGCB 1C2IA 3SBKA 2JKHA 5F6MA 1MZAA 1A4WH 3TJUA 3NCLA 3M61U 1WQVH 2P3FH 4YOGA 3M37A 1TBZH 2ANWA 1O2GH 2F9BH 2HPPH 2Y5HA 3SQHE 2STAE 2BQWB 1O2QA 1MAXA 4AFZA 3ZZ5A 3A83A 3WY8A 1EPTB 1QRXA 2Y82A 1S83A 2EI8A 2BHGA 3A8BA 2OXSA 4WVPE 1Q3XA 1QA0A 3ZYDA 4A7IB 1HNEE 5ESTE 2PKAA 1N6YA 1TNKA 1GBDA 1SL3A 2H9EH 3BSQA 1YF4A 1PQAA 1QTFA 1UK2A 3RMOH 5T6FA 1C2GA 2P59A 1TRMA 2CGAA 4K2YA 3ZZAA 1H1BA 3NK8A 1B7XB 5DP6A 4AYVB 3M5LA 1DITH 1VCWA 1FY4A 2G5NA 3QGNB 5CHAC 1TRNA 2FO9A 3UOUA 1KY9A 2OBOA 3HPTB 2KAIA 4ZKOU 4BXWA 5A0AE 2YNBA 3K65B 2AIPA 2H2ZA 2OCVB 2FI3E 1C2EA 3MWIU 3ZYEA 4JZFH 3HKJB 4CH8B 5B6OA 3PLKA 2NU3E 1SGDE 2FYQA 1IQMA 4IS5A 3LGVA 1EAUA 3OY6U 3GY7A 1IAUA 1OWEA 2EEKA 4DCDA 1A5HA 2HLCA 3RXAA 1WQSA 3RC6A 1QFKH 3MU8A 1OXGA 4Y7AA 2ZTYA 1EPTA 3QK1A 2PSYA 1T4VH 4K69A 3ZZ8A 4OS5A 3M3VA 3MTYA 2XBWA 3BTHE 3SV6A 5K7RA 4Y8YA 5JBTA 1ZHPA 2WUBA 1IHSH 3GCOA 4AGJA 2C4FH 3IWMA 3V3MA 1GL1A 2VVUA 3P8GA 1FI8A 4THNH 1SMFE 4Q7YA 2JH6D 4K60A 2ZTXA 4A1XA 3SJIA 3BIUH 3O8BA 1E37B 3PV4A 1BIOA 4ZROA 4CBNA 4U32A 1MD7A 1O3IA 1DICA 2FOMB 4Y10E 1P11E 1BRCE 2BD9A 2BY6X 1TGTA 2HALA 4AYYB 1TMUH 1O32A 2JETB 4X6MA 3BTGE 2CHAC 1GCTB 1A7SA 1DUAA 3U8TH 3RXJA 1IQKA 3GCHC 3RXFA 5AHGH 2F83A 2ZFPH 4K5ZA 5C2ZA 1BB0B 2VIVA 3RMNH 4BAKB 1Z1IA 4OGYA 4O97A 2PTNA 1BTUA 4X8SH 2QGRA 3A88A 2ZC9H 1FPCH 3RC5A 4KTSA 3L6PA 2WPLS 1NRSH 2PW8H 1P57B 2D8WA 2OUAA 1BRUP 4MVNA 2RCEA 1CA8B 3SUEA 1GHWH 1C9TA 3A8CA 4IN1A 3SGAE 3R0FA 2ZZUH 6CHAB 3UNRA 3SORA 2ANYA 1GHBF 5JBAS 1ZMJA 1UVOA 1D3PB 1QHRB 4YO9A 2BLOA 2Y7ZA 4OS1A 1C5UA 1ZHMA 3LH3A 3PMJA 3F9HA 3UR6A 1XVOA 4AGKA 3RXVA 1DXWA 3SNBA 1TNGA 2BDCA 4FUGA 3P92A 5EQQA 2BD2A 5EGMA 3A7ZA 5FX5A 1C5RA 1WAYB 2ZDKA 1EZSC 3TH2H 3GY5A 1HJ9A 2VU8E 4F49A 1TABE 3AW1A 4JK5A 4I8LA 1LHGH 2B7DH 4AG2A 1C1QA 4BTUB 2GCHG 1HJAC 1THPB 1EOLA 5DPAA 1OWKA 3TGIE 3UNSA 2GDDA 1AN1E 1P05A 1O2YA 1IQJA 4ABHA 4BAQB 2FYRA 5GCHF 2WV5A 1ANCA 1SGYE 1EXFA 1D4PB 1V2OT 2EC9H 3BTDE 3LJJA 2WPMS 1XKAC 1AI8H 2QF0A 4X1NU 3RM2H 3ZZDA 1NY22 1TQ0B 4X2YA 3SU2A 1T8MA 1YGCH 1P9SA 1TRYA 2DE8A 3F6UH 4J1YA 4XBCA 2ZFFH 1V2MT 5T6DA 4AB8A 1S0QA 4XDEA 2Y5FA 4X8TH 3BG4B 2CF8H 3P17H 1GMDF 3GOVB 3V13A 1CHGA 1L2EA 2AMPA 1FXYA 1BTPA 1UCYH 2NU0E 4Y8XA 1XM1A 1AIXH 1UTPA 2J38A 1VJ9U 2BDHA 3P6ZB 3E0PB 1DX5M 1HRTH 1RJXB 5FX6A 3SUGA 2XWAA 2ZFSA 1O5FH 4FVDA 4MPWA 1TE0A 1J17T 2CN0H 2C8XB 1N8OC 1C2JA 4JYUH 1TMBH 1Y3VA 4WXIA 2G55A 1F2SE 1ARCA 2PKSC 1AVXA 1OWHA 1MTNC 1ESBA 1W13U 3MU0A 1EAXA 1LO6A 1H9HE 1O2LA 1BBRE 1XX9A 1LKAA 2VGCB 2BQ7B 2QIQA 1PPEE 2WPJS 3FAOA 1UTNA 3STJA 2Q6DA 1C5LH 2QAAA 6GCHF 4Y6DA 3VB3A 1C5OH 3C27B 2BDAA 3FZZA 1CBWB 4K8BA 3VXEH 2ZEBA 4FUCA 2XRCA 3SU1A 1CGIE 1SC8U 2K1QA 4ZHLU 1ELEE 2BLQA 5C5OA 2VINA 1QJ1B 1HYLA 3S69A 1O5EH 2AERH 1Q31A 2SGEE 2RA3A 3SV7A 1GBJA 4LZ4B 3LPRA 3W95A 2C8ZB 2XYAA 4A1VA 1IQHA 3KQDA 2PGBB 2XC0A 3S9AA 2STBE 3SUDA 2AEIH 1LKBA 3DFLA 1ZYOA 1C4V2 3DA9B 3MHWU 1DSUA 1DWBH 2RA0A 1UVTH 1QA7A 1IQNA 1P04A 1THRH 4RKJB 1ZGIA 3EE0B 1J9CH 4J2YB 1YBWA 2YOLA 1HFDA 4H6SB 2WINI 1T32A 3SHAH 3T29A 1AZ8A 2HGTH 2HVXA 4IMZA 4Q7ZA 1FY5A 1QNJA 1NFUA 2FLBH 1S84A 2P16A 1KXFA 2SNVA 5TCAA 3A86A 4MG3A 1OP2A 1RTLA 2VWOA 2VIWA 3GICB 1C4Y2 2O8LA 3LONA 2C3SA 3MI4A 3E1XB 1PJPA 1G3BA 3GY3A 1ZTKA 1AUJA 5CHAB 1S82A 3KN2A 3LJOA 3SOSA 2BMGB 4KTCA 5C1UA 1XVMA 4CHAC 1B5GH 2TRMA 1XKBC 4FUIA 1IQFA 1CGHA 1CT4E 1O2KA 1WUNH 1QJ7B 3OYPA 3TITA 3A89A 3QLPH 4OS4A 3I78A 1ZJDA 2HNTF 1BHXB 2R0KA 1Q2WA 2Z94A 5FPSA 3ZVEA 3SGQE 1L1JA 1NM6A 1Z1JA 1KIGH 2ZHQH 1SLWB 8GCHG 5DO4H 1ETTH 2A2XH 1F0UA 5CE1A 1DY8A 1UTOA 1AE5A 3S7HB 2JETC 1UJ1A 2AFQB 2FIRH 2Y80A 5EXLA 1W7XH 1SGNE 2R0LA 2XBYA 1BUIA 4B1TA 3QX5H 1C9PA 1QURH 4B2CA 1AY6H 2CMYA 3MO3A 2FZZA 4NCYA 4FUJA 1VITG 1GBAA 3A85A 5F8XA 1C2FA 1Y5AT 1KXDA 1DT2A 2OP9A 3BTKE 3NUMA 4UD9H 1T7CA 1S81A 1O3OA 4AZ2B 1HAVB 4YZUA 3HGNA 1SVPA 1HAPH 1K28D 4Y79A 1U6QA 1AKSB 2HPQH 1UTQA 3BEFB 2CHAB 1MU6B 1SQOA 4FU8A 2CXVA 1E34B 2PV9B 4YM9A 2QC2A 1C2DA 3KIDU 2BXUH 3GCHB 3A87A 1NFYA 5J4QA 4Y71A 2Z9GA 7GCHG 3ZVBA 2AIQA 2WPIS 2FOBA 1BQYA 2UWPA 1BCUH 5FHTA 1S6FA 3MU4A 1ETSH 1L0ZA 1NU7B 1Y3XA 2J94A 5JB8S 2TBSA 2BLWA 1S85A 3P8NA 2WUCA 3PWCA 4KGAA 2FI4E 2ULLA 2J4IA 1MU8B 1INCA 1XUFA 3T25A 3SJKA 2AGIX 2LPRA 2AGEX 1NN6A 1F5LA 2NU1E 5PTPA 3MO9A 1VJAU 4D7FA 3O8RA 1AB9C 2GZ7A 1YKTA 3CS0A 2A31A 3GCNA 4K1SA 2QN5T 1GBMA 2CJIA 1GMCG 2ZHWH 1SLXB 1GDQA 5FPYA 1YM0A 2D1JA 1O3MA 1RFNA 1PQ8A 3Q3YA 5A8YA 1GG6C 1DS2E 4Q80A 3IG6B 1HJAB 3BG4C 4UFEH 1TBRH 1H8IH 2ZU2A 1P2NA 1V2LT 1HAVA 3N7OA 1D9IA 1RTKA 1N1LA 3KF2A 3RXRA 2W7SA 1AKSA 1D6WA 5A8XA 2BDYA 3VEQB 1FZZA 4GCHF 1O3DA 1NFXA 1QGFA 1OX1A 4WJG2 1JXPA 5C67A 4NWLA 5BPEA 3QWCH 1YP9A 4Q7XA 1GBKA 2ESTE 4B75A 1SHYA 1W10U 5E0JA 1TFXA 1XUIA 3UQOA 3BTME 1TNLA 4GPGA 3P95A 4ZHMU 1OWIA 4HGCA 5FAHA 2BD3A 1ZTLA 1P2JA 3PMAB 3V12A 3AAVA 2R2WU 3ZZCA 3T27A 2OLGA 1DWCH 4NIVA 1QBOA 3D23A 8KME2 1BTHH 1ZLRA 2G8TA 1N8OB 1LPGB 4H6TA 1Y5BT 1YCPK 1O34A 1QR3E 1P2IA 2G52A 2PKSB 1WBGB 1OS8A 3ELAH 4AX9H 1MTNB 1OPHB 2Z3CA 1ETRH 1G2LA 2FXRA 2H5CA 2Y81A 4Z0KA 3SJ9A 2VNTA 2A4QA 1C1NA 1EX3A 4X8UH 1GI2A 6GCHG 3S7KB 6ESTA 1O2HA 3VB5A 1SOZA 1O3KA 2IJOB 1ELDE 4JZIA 2UWOA 3BTFE 2NU4E 3RXBA 5LPEA 1BJVA 4ISHH 2ZF0H 3A82A 3ZZ7A 1GHYH 1F0TA 5BRRE 1GDNA 1A46H 3FP7E 3BEIB 1XXFA 1GVKB 4DURA 1ABIH 3QUMP 1ELCA 4Y11E 5H4IB 1CHOG 2F9VA 1LHDH 1V2KT 2QY0B 3ZZBA 1HUTH 2JH5D 2OQ5A 3V7TA 4BAMB 1G3DA 1PQ5A 2ODQA 2CV3A 1S6HA 4E06H 3Q77A 3AAUA 5LPFA 3KCGH 1NFWA 1KXBA 3KQEA 3LGYA 1MCTA 3M5OA
chains in the Genus database with same CATH superfamily
2P8OC 1A0JA 1PPHE 4UONA 2SNWA 2QF5A 2QXIA 1V2JT 4F48B 2ANKH 1K9OE 1IQEA 3EA9A 3MQKC 4IC5A 1T4UH 3PROA 4OS2A 2GCTC 1ELTA 4ZHAA 1H9LB 2SGPE 1O3LA 3QTVH 1SG8B 4HTCH 3RP2A 1GI4A 2BTCE 3PRBA 2LELA 1GPZA 5A2MH 3T62A 2ZHFH 4UFFH 1C2KA 3ATWA 2JIZD 2Z9JA 3M3TA 3OEHD 5B6LA 3PWBA 3U98H 2ZGCA 4X1QU 3TLOA 1GJ4H 1BJUA 3PMHB 4LZ1H 2B8OH 3ZV9A 1TQ7B 4X2WA 4HFPB 1QB9A 5E0GA 4E7NA 1GCDA 4NA9H 3F2GA 2EI7A 4I8KA 3SZNA 1EZQA 1BTYA 3H5CB 3OFND 1GJCB 1PFXC 4KKDA 1HAOH 1MUEB 3E16B 1HAXB 3A80A 3PB1E 1GJBB 1ACBE 3SJ8A 2M5TA 1HBTH 1P3CA 3BTEE 2ZCHP 1HXFH 4MPUA 1W0ZU 2BYAX 1NRNH 1TONA 2QXJA 3F9EA 1GGDC 3MYWA 4DGJA 2VVCA 4CHAB 1KYNA 7KMEH 1HLTH 2ZGBH 3LIWA 1GI9B 4E7RG 2P93A 1AWHB 3ZVAA 3F68H 4X1SU 2FOCA 1T31A 3HK3B 3GY8A 4OS6A 2ZA5A 4LK4A 5TJXA 3RXSA 1TPPA 3NRLA 2BDGA 3DFJA 1G37A 1GMHF 1C5ZB 3I29A 2WYJA 3ITIA 3AASA 1YCPM 3GISB 1KTTB 2HLDD 4NIWA 2QF4A 2OD3B 1FN8A 3OX7U 2BD4A 2GT7A 3SNAA 4ZH8A 1O3AA 4MPVA 1MAYA 3MNXA 1QCPA 2A5IA 3R3GB 4MPXA 1C2MA 3TGJE 5GJ4B 1LHFH 4GHTA 3MU1A 2PP6A 1GHAG 3TIUA 2OC8A 1TPSA 1C5WB 2YMSB 3LDXH 1O3GA 3RMMH 5GDSH 3KQCA 1O3BA 5DP4A 4YT6H 2GGVB 1PPZA 2RG3A 6LPRA 1GBCA 1W12U 1PYTC 4B2BA 4TPYA 4FUFA 1DY9A 1WTGH 2ZTZA 1KLIH 4K1TA 1E36B 3GCTF 1CA0C 4BXSA 2FX6A 3RXQA 1KLJH 3SI3H 2P95A 2XOKD 1V6DA 5FBEA 1IHTH 2ZKSA 2PUXB 1GHXH 4XE4A 3NXPA 2I6SA 1G3EA 3WWBA 4X1PU 1ZSJA 4WMFA 2BLVA 1GI5A 4OS7A 3U69H 1NS3A 4VGCC 5HMAA 1BTXA 2A4OA 2VIOA 3A7XA 5EQRA 4ZMAH 2XXLA 3GDSA 1A1RA 2DUCA 5EQSA 3SU5A 1ANDA 5GXPA 1YY3A 5AVDA 5EPNA 3T28A 1ELVA 2I6QA 2G4TA 2K8IA 1YPGH 4I33A 1EP6A 1NPMA 4ZUHA 1NU9A 4O9VA 1TOMH 1QZ8A 1SGCA 1HAHH 1AFQC 3I77A 1A5IA 1AHTH 1OOKB 1MQ6A 1QL7A 2W7UA 3TJOA 1XUKA 1EOJA 2ZPQA 3BF6H 2F9NA 1AB9B 2XCFA 1C2HA 1QIXB 3EYDA 4FXGH 1HAIH 2VJ1A 1P2MA 2HOBA 1AQ7A 2QF3A 1C5QA 2WPHS 2Z9LA 4CR5A 2GMTC 2VVVA 3W94A 1TPAE 4SGAE 2BY9X 1RRKA 1C5NH 1E38B 3T26A 2H9TH 3GDUA 1TOCB 3F9GA 4I8JA 2BX3A 1GG6B 1P12E 1VCQA 3SJOA 5A0CA 2O8TA 4ISNA 5C3NA 3GYMA 1GHZA 1TLDA 3TNTA 1W0YH 5F8ZA 3D49H 1O2SA 1BHXF 3ATLA 4YTAA 1O2JA 2Y7XA 2OTVA 1EFRD 5I25A 1EJMA 2Q6FA 5IDKA 5DG6A 3RXGA 1EP5A 1FY1A 3TU7H 1GJAB 2R9PA 4HG6A 4U30A 3RDZA 3UFAA 1ZPBA 4ZAEA 1FONA 2GV7A 3RXLA 1TX8A 1LPKB 1JWTA 3RU4D 4AFQA 1WYKA 1P09A 4GVUA 4UDWH 3SNEA 4JYTA 3EAJA 4KTUA 4TWWA 4Q4LA 4UE7H 1FN6A 2ZI2H 2NU2E 2VIDA 2ZIQH 1EB2A 1O3CA 3RXDA 2GZ9A 1RIWB 1AO5A 3B8JA 5F8TA 4SGBE 4AN7A 4B6EA 5AF9H 2LNCA 2ZWLH 4M9FA 4WWYA 5EODA 5C1XA 3VB7A 1SKYE 3SV8A 1O37A 1HAYB 2W5EA 1G9IE 4R0IA 5AFYH 4DW2U 1FIZA 2FOHA 2ALVA 2H6MA 3L3TA 1ZMNA 2V7QD 2IJD1 2A45B 1B0EA 2B5TB 3RLYH 2O8MA 5EU8A 1QRZA 1J15A 2NWNA 3A7WA 3CP7A 5DP8A 1RTFB 2F9PA 1HGTH 2C90B 2GD4B 1BMAA 2OQUA 3M5MA 1FPHH 1MABB 2ZDLA 5DP3A 4AC9A 2BM2A 3LH1A 3WW7A 1HV7A 2BVSH 3A7VA 4Y0ZE 2ZQ1A 2B9LA 4NZLA 3RU4E 2F9UA 2FM2A 3IITA 1MTWA 3KQBA 1VITH 2Z9KA 1X7AC 3RXMA 3SN8A 4ASHA 2EY4C 2M2AA 2FX4A 2FMJA 1XUGA 1KXCA 1TNIA 1UTJA 3RXIA 1C5VA 3NZIA 1Z6EA 2ZQ2A 4WMDA 4BNRA 1O2NA 1QB6A 2QXHA 3DCLA 5CHBA 4CREA 1VZQH 4ABDA 4B2AA 1DANH 3A8DA 2TGPZ 4YLQH 1EASA 1DSTA 2ZDMA 1O3EA 2GDEH 4O3UA 3LC3A 4D9RA 2P8OB 2XBVA 5ESBA 3UUZA 2UUKB 1LVOA 5IK2D 1UTLM 2GCTB 1V2PT 4LOYH 1H9IE 2BB4A 1GHVH 1V2WT 2FP7B 1BT7A 3GY4A 1SR5C 3RU4T 9LPRA 1V2UT 4DVAU 1ESTA 1GBLA 2TIOA 3D62A 2J95A 2D26C 3PLPA 3VXFH 1SGIB 3SU0A 1O33A 1TA2A 5GIBA 1Z7KA 3KL6A 4PROA 1FV9A 1O38A 3W1EA 4DIHH 3MNBA 1WSSH 1JRTA 1H8HD 1Z8RA 1BTZA 3TH4H 2UWLA 2L6OA 1MCVA 1O35A 3PMBB 1UW7A 3M7TA 4I32A 1SGFA 1S0RA 2TGDA 1DUEA 2BD7A 3K2UA 1GVLA 3LC5A 4NA7A 1WXRA 3ATKA 3CENA 4HZHA 5EPYA 2XWBI 3ZZ6A 5ABWA 1LVMA 2FWWA 7ESTE 4RT1A 3BTQE 1DM4B 2FODA 2ZPSA 4K1EA 5EOKA 1SGRE 1GGDB 1PPFE 1NO9H 2BVXH 3UOPA 1YPHE 1C5YB 1EJNA 1GI0A 3TH3H 1GJ8B 5K0HA 2WV9A 1TBQH 5EXMA 1RXPA 1TX7A 3M3SA 4NIYA 1NBMD 4RSPA 3VFEA 1TA6A 1T8OA 4I31A 3M35A 1MKXH 1O0DH 1LQEA 3MU5A 3ZVFA 1GBIA 1UK4A 1AU8A 2ZU5A 5TCCA 3ZIAD 5CMXH 1TGSZ 2SFAA 3URCA 1K1PA 2FDAA 1LQDB 2XNIA 2ZU1A 2P3UB 1QL9A 3LU9B 1L4DA 1Y3YA 1EZUC 4XBBA 2G51A 3NWUA 2VB0A 2ZCKP 1LCYA 4CRFA 4NSVA 3G01A 4Q2KA 4NIXA 1FY8E 2A7JA 5E0HA 3VB6A 1P2KA 4ZKRU 2CK3D 1ORFA 1YPMH 4AOQA 1SHHB 1ZR0A 3GDVA 1KLTA 2VH6A 3GCTG 2PUQH 1AVGH 1G32B 1PPBH 1Y8TA 3ATMA 1GHBG 1GBHA 3PTBA 4HI3A 2VWMA 4DG4A 2ZGHA 1O5AB 1NBME 3Q76A 1A61H 1ZGVA 3ATIA 2FOFA 4X2VA 2EA3A 2GP9B 5L6NH 1CA0B 1AMHA 1O2TA 1WDIA 2A1DB 1ZMLA 3E90B 2XC4A 4XSKU 3EA8A 4GAWA 2ZFQH 4GUXA 2WZQA 3GYLB 5IYTA 1TAWA 1V2NT 1GVZA 1K21H 4VGCB 1RS0A 1V2TT 4B73A 4XFQA 3D65E 4NZQA 4MQAA 4FUBA 1ZPCA 1Z6JH 1C5SA 2O8UA 1QBNA 5SGAE 2Z3DA 4JYVH 5I46H 3PO1C 1P3EA 1GL0E 1CT2E 5GCHG 1W11U 5HGGA 1DWDH 3DUXH 3RXHA 1MMJN 2Q1JA 2GCHF 3FN8A 4X2XA 4FUDA 1O5GH 1TNJA 5DSFA 4CH2B 3SO3A 1UCYK 1AFQB 1C1UH 1DE7H 1O2IA 5DK1A 2W26A 4MNWA 1A5GH 3OTJE 1AFEH 1ABJH 1DLKB 1LVBA 1SGEE 1H4WA 1QY6A 3P8OA 3TK9A 1SQTA 1UVPA 4INLA 2ZDVH 1HB0B 2AMDA 2F91A 5EW2H 2PWXA 3SU6A 5FBIA 2GMTB 1GMDG 4RKOB 1BRAA 3SV9A 2ALPA 3LGUA 4OGXA 1C1WH 3LOXA 1O2OA 3HGPA 1O5DH 3N7EA 4RT0A 4F4OC 1L1GA 1O30A 1OSSA 2D2DA 3UWJH 1SB1H 4AG1A 2FS8A 1OP0A 1V2RT 4A1TA 1T8NA 3OEED 3E3TA 1W0JD 1E0FD 4ABFA 2OC7A 2ZGXH 1FX0B 5HKKD 3DHKH 1QBVH 2HNTE 2V0BA 1BRBE 4B74A 1KTSB 1RIWC 1WTHD 1DLEA 1GI3A 2L74A 1OP8A 1UVUH 5EW1H 1BA8B 1FY3A 1NRRH 3BN9A 5HYOA 4K3JA 2BY5X 5L2YH 1O5BB 1NRPH 4CRBA 2Y5GA 1SFIA 1JMOH 4CRCA 1GBTA 1RD3B 1W3CA 1SLVB 2C8YB 1UTMA 3AW0A 3ODFA 2V3MA 2BD5A 4IBLH 3T2NA 3LGWA 2PR3A 4ESTE 5GWZA 4INHA 3ESTA 1KDQB 3E91A 1JIMA 1OYQA 4X6NA 3C1KA 2H9HA 4R8TB 5J4SA 3F1SB 1HAZB 1OHHD 4UEHH 5FCRA 5F03A 4X1RU 1ZJKA 1JBUH 5T3HA 3UQVA 3M7UA 4TY7A 3P8FA 1LTOA 2A32A 2UUJB 3TK6A 1FLEE 2G5VA 3FFGA 1ELFA 3VGCC 3PYHA 1AD8H 1FNIA 1O3HA 2OINA 2QA9E 3ZZ3A 1KXEA 2XBXA 2O8WA 3EDXB 3EQ0H 4ISIH 3UY9A 5GPIB 1F7ZA 4O3TA 1NTPA 3E0NB 4I8GA 2R3UA 2IN2A 3EA7A 1O39A 3EGKH 4H4FA 3A7YA 2C8WB 3SW2B 1LVYA 1ZHRA 5JB9S 4I86A 1RGQA 2F3CE 2ZU4A 3KYFA 2XW9A 1VCPA 5AFZH 1K1MA 2FOEA 2HWLB 2V3OH 1SLUB 3KYGA 3BEUA 3ENSB 5LH8A 7LPRA 4FVBA 3TVJB 1PPGE 4JCNA 4FUHA 1C4U2 3A81A 2G00A 4TYDA 1QQ4A 4MNXA 2QV1A 1E35B 4GHQA 3F2FA 2RDEA 1KXAA 2BQ6B 4IMQA 4JK6A 1NZQH 1KDQA 3BTWE 2BDBA 1S5SA 2Z7FE 1Z8GA 1O2UA 1THSH 2EI6A 3TK5A 1C1RA 2VIQA 2PSXA 1J16A 2FESH 3RXUA 2ZPRA 5E2PA 4Z6AH 2ILNA 1IQGA 1C5TA 2PLXA 3FKSD 1OYTH 2ZG0H 3S9BA 2IOTA 3PM3A 3ZZ9A 1ELAA 3ODDA 4I8HA 5EJLA 1JIRA 2ZFTA 3DD2H 3MO6A 1SQRA 1DDJA 2ZHDA 1FJSA 1YWUA 1ZSKA 2AYWA 2PTCE 2JJ2D 3SNDA 1O2WA 1O2ZA 4ZXYH 1YPHC 2BY7X 2BOKA 5C94A 1MKXK 1W14U 1BTWA 3ZVCA 3UPEA 1C1SA 2YMSD 1F92A 4MLFB 2GTBA 4X0WU 1GJ6A 1XUHA 2THFB 1SGTA 3WWFA 1JOUB 1WV7H 1EUFA 1HCGA 1C1OA 5L30H 2W3KA 8GCHF 3U1IB 1BMLA 1G36A 3SU3A 3KGPA 1Z8IB 4U2WA 3RXTA 1C2LA 1BMMH 3AVZA 2TPIZ 1MTSA 1LHEH 1A3BH 1TMTH 3FOAA 3RXCA 4KP0A 2OBQA 5HM9A 3K9XB 3FP8E 3MH7A 1AVWA 2Z3EA 1L1NA 3RXOA 1VITF 1K1OA 4NWKA 1GDUA 4ABEA 3LT3A 1YPJH 5A8ZA 2TGTA 2BD8A 3RM0H 1QRWA 4ZKSU 2FOAA 8LPRA 1C5XB 1V2ST 1MBQA 2J92A 5JBCS 1P8VC 2SGFE 4TT3D 3AK5A 1HJ8A 3OAAD 4TY6A 1ZSLA 3O8CA 1KSNA 1YYY1 7GCHF 1O3PB 4ABJA 1Y5UT 4FUEA 1W7GH 5HXFA 2PGQB 3M36A 2GT8A 3UREA 3BIVH 1C5MD 2ZCLP 4NFEA 4U01A 3STIA 1EAWA 1LHCH 4ACAA 4YT7H 4WH8A 1L4ZA 1ZRBA 1YPKH 2QXGA 3A84A 5E8EH 2GZ8A 5C0TA 1OWDA 2WV4A 2KCOA 1SOTA 2A2QH 5A09A 1MZDA 1SI5H 4NGAH 3JZ2B 3P70B 1WCZA 3RXPA 1P0SH 3NPSA 2QYIA 4WXVA 1TNHA 3KHVA 1GWAA 4ZXXH 1ELBA 1FUJA 2WHXA 3UAIC 3U1JB 3QTOH 1UHBB 5JBBS 1COWD 2A4GA 4TWYA 1UO6A 4WY3A 5DJ7A 3U8OH 3E6PH 2J34A 1GMCF 4NFFA 2PHBA 1Y3WA 1V2QT 2R2MB 4QT8C 1TGNA 1GI1A 3PO1B 3ZV8A 4GCHG 4BTTB 3QO6A 3QN7A 1TWXB 1O2MA 4YLUA 4IW4E 5FPTA 1GBEA 1UCYE 2P3TB 1AE8H 4NG9H 3T5FH 2V3HH 1GJ9B 2SGDE 1NT1A 4CR9A 1MH0A 4GSOA 2W3IA 4K8YA 4BANB 1OWJA 2HNTC 3OTPA 1TGBA 1CE5A 1A2CH 2UUFB 1W0KD 3SZEA 4XRNA 1HDTH 1ZZZA 1SQAA 1O5CB 1ZTJA 3DT0H 5DP5A 3UWIA 4DOQA 1OKXA 4FU9A 1SFQB 1QQUA 1FIWA 2ASUB 2ANMH 1PQ7A 4AB9A 1K1LA 3S0NA 1Z71A 3VB4A 1S6LA 1CGJE 2A4RA 1QJ6B 2W6ID 3HK6B 1C1PA 3FP6E 3UR9A 1EJAA 1Y3UA 2GV6A 2ZGJA 1C1VH 5JPMH 2JJ1D 2VWLA 2ZO3H 2OC1A 3VPKA 4ABBA 1VGCC 4IGDA 1TGCA 5FXLA 1UHBA 2RDLA 4FU7A 1BBRH 1CSOE 2C93B 2OC0A 5L2ZH 1FDPA 1TYNA 4MNVA 1AWFH 1DPOA 2H5DA 1P9UA 1NESE 1MBMA 4WMEA 1UMAH 4INKA 3BV9B 1ELGA 1LMWB 3KQ5A 1MTUA 1EB1H 3SI4H 1CQQA 1YCPH 5LPRA 2B0FA 1EPTC 3B23B 3TPIZ 1WOFA 1MKWH 2P94A 2QE7D 2SGAA 2QCYA 1ZOMA 4JMYA 4ISOA 4Q63A 1A0HB 2F43B 4JZ1A 4A5TS 1F0SA 1ZPZA 3H7TA 3SGBE 4DT7B 1AUTC 1SGQE 3QZRA 3VGCB 1EKBB 1GI7B 3K6YA 4DJZB 2BVRH 2GVFA 1JRSA 4CRDA 5C5NA 1CHOF 1CU1A 3CS7A 2VIPA 1C1TA 1WU1A 4YOIA 1GJ7B 3KNXA 1O2VA 1TIOA 1YC0A 3PLBA 1H8DH 3FVFB 3OY5U 1O3NA 4XD7D 1F0RA 2Q6GA 3RUOA 4AFSA 1V2VT 4E05H 2BZAA 3M7QA 2KZ4A 4B6FA 2FTMA 4Y8ZA 3TJVA 1UTKA 3V0XA 3A8AA 1GI8B 4KELA 5T6GA 4MTBA 3N7DA 9ESTA 5JDUB 5C17A 1ID5H 1DVAH 3OU0A 4MNYA 1AZZA 2Y6TA 3MH4A 1QL8A 5T1VA 2BX4A 3RXEA 3MOCA 2JH0D 1QB1A 2AS9A 3SHCH 3ZVGA 4H42U 3ZVDA 2GKVE 4AFUA 1D3QB 2ZDNA 4Y76A 2V6NA 2FLRH 4M7GA 4Y7BA 1G2MA 4TPIZ 1IQLA 4CRAA 2F4LA 3Q00A 3UNQA 1DXPA 2DE9A 1UK3A 4Y0YE 3RC4A 1O36A 3LKWA 1O3JA 3Q3XA 2FPZA 3B9FH 3SUFA 2J9NA 1AGJA 3MNCA 2SGQE 5G4BA 3SV2H 1P2QA 3RMLH 1TALA 4ACBA 4D7GA 2Z9IA 2A7CA 1GI6A 1HIAB 5C0UA 2BZ6H 3LGTA 3SQEE 3QDZB 3M5NA 1SSXA 4ABIA 4IC6A 1J8AA 4JZEH 1GMHG 1FMGA 3QZQA 3JZ1B 1K1IA 1KMHB 1M9UA 3L33A 2FS9A 1GBBA 1IQIA 1Y59T 5ETXA 4BAOB 4DIIH 4XOJA 1C5PA 1YLDA 2BDIA 1MQ5A 3RLWH 5EIYA 4LXBH 1TB6H 4BTIB 3TGKE 5C20A 1XMNB 3S9CA 2AGGX 1A3EH 4D9QA 4Z1MD 1O31A 1P01A 1PYTD 1GCTC 2ZU3A 1A0LA 3FANA 4P00A 1ARBA 3MH6A 5DGJA 4O03A 1SGPE 1ANBA 2HRVA 4P02A 1C1MA 4X8VH 3BG8A 2WPKS 3UB0A 2IPQX 1P02A 4B71A 2XC5A 4DY7B 2CF9H 4NSYA 4UFDH 4XBDA 3UIRA 1FAKH 2ZDAH 3Q3KA 2VWNA 4ISLA 4JZDH 3RXKA 4I7YH 1G30B 3O8DA 4YOJA 1GHAF 1TPOA 5FCKA 1D6RA 2O9QA 1SGFG 6CHAC 3TJNA 2ZHEH 5DN6D 4X6PA 1O2XA 5LGOA 1F5RA 8ESTE 5EG4A 2G81E 1DOJA 3PV2A 4CRGA 1HIAA 1NC6A 1P10A 1CO7E 2V35A 1BZXE 1CT0E 1CVWH 1EAIA 2ZECA 1HXEH 3MH5A 3H09A 1V3XA 2G4UA 3FZDA 1EATA 4ZKNU 4F55A 1T8LA 2GX4A 1ZRKA 1NRQH 4AORA 3H7OA 1TX6A 1DFPA 1GJDB 3K6ZA 1GBFA 2A0QB 4NA8A 1PPCE 3U9AH 2RFKC 2YNAA 1MTVA 2OK5A 1LPZB 1SBWA 2H1UA 3MMGA 5C1YA 1Z8JB 2BXTH 1K1NA 2ODYB 2FI5E 1B0FA 1YPEH 1EQ9A 4BAHB 2A5KA 2BY8X 5EJ1A 5JYIA 1ESAA 4UFGH 2ODPA 1DWEH 1K22H 1J14A 1N6XA 2AH4X 1NROH 3TNSA 1W8BH 1EZXC 1P2OA 3HKIB 2ZNKH 2A7HA 4A92A 4B76A 5DKMA 4IN2A 4BOHA 5A0BA 1LDTT 3MNSA 2FOGA 2ZFRH 3E8LA 3OSYA 5DP9A 3A7TA 2WYGA 1BOQA 2TGAA 3U8RH 1G3CA 4GLYA 2FTLE 4ABGA 1D3TB 4WH6A 1XUJA 3DSGA 2J2UA 1GJ5H 4YESB 2VH0A 3URDA 1K2I1 5E2OA 2F9OA 1YLCA 2XTTB 3GY6A 2ZP0H 4TSFD 3HATH 1FQ3A 1BDAA 1D3DB 1O3FA 2Z6BD 2PKAB 1BITA 1FAXA 1P03A 5HM2A 1K1JA 1YPLH 3NKKA 4WF8A 1HPGA 2AMQA 2IPHA 1IOEA 4CBOA 4RN6A 3BTTE 1ANEA 4D76A 2R3YA 1BBRK 1W2KH 3GS9A 3GY2A 1BMNH 1O2PA 2A5AA 1H8ED 3ZZ4A 2UUYA 3SNCA 1SPJA 5EXNA 2VGCC 3PTNA 4A6LA 5DP7A 3EE7A 4D8NA 1VR1H 1MD8A 3QGJA 3MFJA 4X6OA 1O2RA 1P06A 1CBWC 2PFEA 1HAGE 1F5KU 3SU4A 2BOHB 1MKWK 2KAIB 3KEEA 1UVSH 2XCNA 3F9FA 3F0OA 2FEQH 4MDSA 1XXDA 3LGIA 4ABAA 3UTUH 1VGCB 1C2IA 3SBKA 2JKHA 5F6MA 1MZAA 1A4WH 3TJUA 3NCLA 3M61U 1WQVH 2P3FH 4YOGA 3M37A 1TBZH 2ANWA 1O2GH 5HIYA 2F9BH 2HPPH 2KX4A 2Y5HA 3SQHE 1E79D 3PV5A 4FOUC 2STAE 2BQWB 3N99A 1O2QA 1MAXA 4AFZA 3ZZ5A 3A83A 3WY8A 1EPTB 1QRXA 2Y82A 1S83A 2EI8A 2BHGA 3A8BA 2OXSA 4WVPE 1Q3XA 1QA0A 3ZYDA 4A7IB 1HNEE 5ESTE 2PKAA 1N6YA 1TNKA 1GBDA 1SL3A 2H9EH 3BSQA 1YF4A 2VBCA 2HVYB 1PQAA 1QTFA 1UK2A 3RMOH 5T6FA 1C2GA 2P59A 3DSPA 1TRMA 2CGAA 4K2YA 3ZZAA 1H1BA 3NK8A 1B7XB 5DP6A 4AYVB 3M5LA 1DITH 1VCWA 1FY4A 2G5NA 3QGNB 5CHAC 1TRNA 3U28C 2FO9A 3UOUA 1KY9A 2OBOA 3HPTB 2KAIA 4ZKOU 4BXWA 5A0AE 2YNBA 3K65B 2AIPA 2H2ZA 3F0PA 2OCVB 2FI3E 1C2EA 3MWIU 3ZYEA 4JZFH 3HKJB 5KEDA 4CH8B 5B6OA 3PLKA 2NU3E 1SGDE 2FYQA 1IQMA 4IS5A 2K0QA 3LGVA 1EAUA 3OY6U 3GY7A 1IAUA 1OWEA 2EEKA 4DCDA 1A5HA 2HLCA 3RXAA 1WQSA 3RC6A 1QFKH 3MU8A 1OXGA 4Y7AA 2ZTYA 1EPTA 3QK1A 2PSYA 1T4VH 4K69A 3ZZ8A 4OS5A 3M3VA 3MTYA 2XBWA 3BTHE 3SV6A 5K7RA 4Y8YA 5JBTA 1ZHPA 2WUBA 1IHSH 3GCOA 4AGJA 2C4FH 3IWMA 3V3MA 1GL1A 2VVUA 3P8GA 1FI8A 4THNH 1SMFE 4Q7YA 2JH6D 4K60A 2ZTXA 4A1XA 3SJIA 3BIUH 3O8BA 1E37B 3PV4A 1BIOA 4ZROA 3F3BA 4CBNA 4U32A 1MD7A 1O3IA 5FL7D 1DICA 2FOMB 4Y10E 1P11E 1BRCE 2BD9A 2BY6X 1TGTA 2HALA 4AYYB 1TMUH 1O32A 2JETB 4X6MA 3BTGE 2CHAC 1GCTB 2WPDD 1A7SA 1DUAA 3U8TH 3RXJA 1IQKA 3GCHC 3RXFA 5AHGH 2F83A 2ZFPH 4K5ZA 5C2ZA 1BB0B 2VIVA 3RMNH 4BAKB 1Z1IA 4OGYA 4O97A 2PTNA 1BTUA 4X8SH 2QGRA 2XNDD 3A88A 2ZC9H 1FPCH 3RC5A 4KTSA 3L6PA 2WPLS 1NRSH 2PW8H 1P57B 2D8WA 2OUAA 1BRUP 4MVNA 2RCEA 1CA8B 3SUEA 1GHWH 1C9TA 3A8CA 1E1RD 4IN1A 3SGAE 3R0FA 2ZZUH 6CHAB 3UNRA 3SORA 2ANYA 1GHBF 5JBAS 1ZMJA 1UVOA 1D3PB 1QHRB 4YO9A 2BLOA 2Y7ZA 4OS1A 1C5UA 1ZHMA 3LH3A 3PMJA 3F9HA 2WSSD 3UR6A 1XVOA 4AGKA 3RXVA 1DXWA 3SNBA 1TNGA 2BDCA 4FUGA 3P92A 5EQQA 2BD2A 5EGMA 3A7ZA 5FX5A 1C5RA 3CNRA 1WAYB 2ZDKA 1EZSC 3TH2H 3GY5A 1HJ9A 2VU8E 4F49A 1TABE 3AW1A 4JK5A 4I8LA 1LHGH 2B7DH 4AG2A 1C1QA 4BTUB 2GCHG 1HJAC 1THPB 1EOLA 5DPAA 1OWKA 3TGIE 3UNSA 2GDDA 1AN1E 1P05A 1O2YA 1IQJA 4ABHA 4BAQB 2FYRA 5GCHF 2WV5A 1ANCA 2GJGA 1SGYE 1EXFA 1D4PB 1V2OT 2EC9H 2LP6A 3BTDE 2WPMS 3LJJA 4FETA 1XKAC 1AI8H 2QF0A 4X1NU 3RM2H 3ZZDA 1NY22 1TQ0B 4X2YA 2JDID 3SU2A 1T8MA 1YGCH 1P9SA 1TRYA 2DE8A 3F6UH 4J1YA 4XBCA 1E1QD 1V2MT 2ZFFH 5T6DA 4AB8A 1S0QA 4XDEA 2Y5FA 4X8TH 3BG4B 2CF8H 3P17H 1GMDF 3GOVB 3V13A 1CHGA 1L2EA 2AMPA 1FXYA 1BTPA 1UCYH 2NU0E 4Y8XA 1XM1A 1AIXH 1UTPA 2J38A 1VJ9U 2BDHA 3P6ZB 3E0PB 3OE7D 1DX5M 1HRTH 1RJXB 1BMFD 5FX6A 2J98B 3SUGA 2XWAA 2ZFSA 1O5FH 4FVDA 4MPWA 5CDFE 1TE0A 1J17T 2CN0H 2C8XB 1N8OC 1C2JA 4JYUH 1TMBH 1Y3VA 4WXIA 2G55A 1F2SE 1ARCA 2PKSC 1AVXA 1OWHA 1MTNC 1ESBA 1W13U 3MU0A 1EAXA 1LO6A 1H9HE 1O2LA 1BBRE 1XX9A 1LKAA 2VGCB 2BQ7B 2QIQA 1PPEE 2WPJS 3FAOA 1UTNA 3STJA 2Q6DA 1C5LH 2QAAA 6GCHF 4Y6DA 3VB3A 1C5OH 3C27B 2BDAA 3FZZA 1CBWB 4K8BA 3VXEH 2ZEBA 4FUCA 2KFWA 2XRCA 3SU1A 1CGIE 1SC8U 2K1QA 4ZHLU 1ELEE 2BLQA 5C5OA 3VG8A 2VINA 3F2HA 1QJ1B 1HYLA 3S69A 1O5EH 5F53A 2AERH 1Q31A 2SGEE 2RA3A 3SV7A 1GBJA 4LZ4B 3LPRA 3W95A 2C8ZB 2XYAA 2W6JD 4A1VA 1IQHA 3KQDA 2PGBB 2J98A 2XC0A 3S9AA 2STBE 3SUDA 2AEIH 1LKBA 3DFLA 1ZYOA 1C4V2 3DA9B 3MHWU 1DSUA 1DWBH 2RA0A 1UVTH 1QA7A 1IQNA 1P04A 1THRH 4RKJB 1ZGIA 3EE0B 3SYJA 1J9CH 4J2YB 1YBWA 2YOLA 1HFDA 4H6SB 2WINI 1T32A 3SHAH 3T29A 1AZ8A 2HGTH 2HVXA 4IMZA 4Q7ZA 1FY5A 1QNJA 1NFUA 2FLBH 1S84A 2P16A 1KXFA 2SNVA 5TCAA 3A86A 2KCPA 4MG3A 1OP2A 1RTLA 2VWOA 2VIWA 3GICB 1C4Y2 2O8LA 3LONA 2C3SA 3MI4A 3E1XB 1PJPA 1G3BA 3GY3A 1ZTKA 1AUJA 5CHAB 1S82A 1YLNA 3KN2A 3LJOA 3SOSA 2BMGB 4KTCA 5C1UA 1XVMA 4CHAC 1B5GH 2TRMA 1XKBC 4FUIA 1IQFA 1CGHA 1CT4E 3PRDA 1O2KA 1WUNH 1QJ7B 3OYPA 3TITA 3A89A 3QLPH 1VKYA 4OS4A 3I78A 1ZJDA 2HNTF 2AHME 1BHXB 2R0KA 1Q2WA 2Z94A 5FPSA 3ZVEA 3SGQE 1L1JA 2KCAA 1NM6A 1Z1JA 1KIGH 2ZHQH 1SLWB 8GCHG 5DO4H 1ETTH 2A2XH 1F0UA 5CE1A 1DY8A 1UTOA 4RI0A 1AE5A 3S7HB 2JETC 1UJ1A 2AFQB 2FIRH 2Y80A 5EXLA 1W7XH 1SGNE 2R0LA 2XBYA 1BUIA 4B1TA 3QX5H 1C9PA 1QURH 4B2CA 1AY6H 2CMYA 2YMSC 3MO3A 2FZZA 4NCYA 4FUJA 1VITG 1GBAA 3A85A 5F8XA 1C2FA 1Y5AT 1KXDA 1DT2A 2J5UA 2OP9A 3BTKE 3NUMA 4UD9H 1T7CA 1S81A 1O3OA 4AZ2B 1HAVB 4YZUA 3HGNA 1SVPA 1HAPH 1K28D 4Y79A 1U6QA 1AKSB 2HPQH 1UTQA 3BEFB 2CHAB 1MU6B 1SQOA 4FU8A 2CXVA 1E34B 2PV9B 4YM9A 2QC2A 1C2DA 3DSOA 5EJZA 3KIDU 2BXUH 3GCHB 3A87A 4YXWD 1NFYA 5J4QA 4Y71A 2Z9GA 7GCHG 3ZVBA 2AIQA 2EQNA 2J97A 2FOBA 2WPIS 1BQYA 2UWPA 1BCUH 5FHTA 1S6FA 3MU4A 1ETSH 1L0ZA 1NU7B 1Y3XA 2J94A 5JB8S 2TBSA 2BLWA 1S85A 3P8NA 5GNDA 2WUCA 4ASUD 3PWCA 4KGAA 2FI4E 2ULLA 2J4IA 1MU8B 1INCA 1XUFA 3T25A 3SJKA 2AGIX 2LPRA 2AGEX 1NN6A 1F5LA 2NU1E 5PTPA 3MO9A 1VJAU 4D7FA 3O8RA 1AB9C 4ZCNA 2GZ7A 1YKTA 3CS0A 2A31A 3GCNA 4K1SA 2QN5T 1GBMA 2CJIA 1GMCG 2ZHWH 4DT4A 1SLXB 1GDQA 5FPYA 4OM9A 1YM0A 2D1JA 1O3MA 1RFNA 1PQ8A 3Q3YA 5A8YA 1GG6C 1DS2E 4Q80A 3IG6B 1HJAB 3BG4C 4UFEH 1TBRH 1H8IH 2ZU2A 1P2NA 1V2LT 5KECA 1HAVA 3N7OA 1D9IA 1RTKA 1N1LA 3KF2A 3RXRA 2W7SA 1AKSA 1D6WA 5A8XA 2BDYA 3VEQB 1FZZA 4GCHF 1O3DA 1NFXA 1QGFA 1OX1A 4WJG2 1JXPA 5C67A 4NWLA 5BPEA 3QWCH 1YP9A 4Q7XA 1GBKA 2ESTE 4B75A 2KR7A 1SHYA 1W10U 5E0JA 1TFXA 1XUIA 3UQOA 3FO8D 3BTME 1TNLA 4GPGA 3P95A 4ZHMU 1OWIA 4HGCA 5FAHA 2BD3A 1ZTLA 1P2JA 3PMAB 3V12A 3AAVA 2R2WU 3ZZCA 3T27A 2OLGA 1DWCH 4NIVA 1QBOA 3D23A 8KME2 2KM0A 1BTHH 1ZLRA 2G8TA 1N8OB 1LPGB 4H6TA 1Y5BT 1YCPK 1O34A 1QR3E 1P2IA 2G52A 1WBGB 2PKSB 1OS8A 3ELAH 4AX9H 1MTNB 1OPHB 2Z3CA 1ETRH 1G2LA 2FXRA 2H5CA 2Y81A 4Z0KA 3SJ9A 2VNTA 2A4QA 1C1NA 1EX3A 4X8UH 1GI2A 6GCHG 3S7KB 6ESTA 1O2HA 3VB5A 1SOZA 1O3KA 2IJOB 1K0HA 1ELDE 4JZIA 2UWOA 3BTFE 5HIZA 2NU4E 3RXBA 5LPEA 1BJVA 4ISHH 2ZF0H 3A82A 3ZZ7A 1GHYH 1F0TA 5BRRE 1GDNA 1A46H 3FP7E 3BEIB 1XXFA 1GVKB 4DURA 1ABIH 3QUMP 1ELCA 4Y11E 5H4IB 1CHOG 2F9VA 1LHDH 1V2KT 2QY0B 3ZZBA 1HUTH 2JH5D 2OQ5A 3V7TA 4BAMB 1G3DA 1PQ5A 2KCYA 2ODQA 2CV3A 1S6HA 4E06H 3Q77A 3AAUA 5LPFA 3KCGH 5KGOA 1NFWA 1KXBA 3KQEA 3LGYA 1MCTA 3M5OA
chains in the Genus database with same CATH topology
2P8OC 1A0JA 1PPHE 4UONA 2SNWA 2QXIA 1V2JT 2ANKH 1K9OE 1IQEA 3EA9A 4IC5A 1T4UH 3PROA 4OS2A 2GCTC 1ELTA 4ZHAA 1H9LB 2SGPE 1O3LA 3QTVH 1SG8B 4HTCH 3RP2A 1GI4A 2BTCE 1GPZA 5A2MH 3T62A 2ZHFH 4UFFH 1C2KA 3ATWA 2Z9JA 3M3TA 3PWBA 3U98H 2ZGCA 4X1QU 3TLOA 1GJ4H 1BJUA 3PMHB 4LZ1H 2B8OH 3ZV9A 1TQ7B 4X2WA 4HFPB 1QB9A 5E0GA 4E7NA 1GCDA 4NA9H 2EI7A 4I8KA 3SZNA 1EZQA 1BTYA 3H5CB 4KKDA 1GJCB 1PFXC 1HAOH 1MUEB 3E16B 1HAXB 3A80A 3PB1E 1GJBB 1ACBE 3SJ8A 2M5TA 1HBTH 1P3CA 3BTEE 2ZCHP 1HXFH 4MPUA 1W0ZU 2BYAX 1NRNH 1TONA 2QXJA 3F9EA 1GGDC 3MYWA 4DGJA 2VVCA 4CHAB 1KYNA 7KMEH 1HLTH 2ZGBH 3LIWA 1GI9B 4E7RG 2P93A 1AWHB 3ZVAA 3F68H 4X1SU 2FOCA 1T31A 3HK3B 3GY8A 4OS6A 2ZA5A 4LK4A 5TJXA 3RXSA 1TPPA 2BDGA 3DFJA 1G37A 1GMHF 1C5ZB 3I29A 2WYJA 3ITIA 3AASA 1YCPM 3GISB 1KTTB 4NIWA 2OD3B 1FN8A 3OX7U 2BD4A 2GT7A 3SNAA 4ZH8A 1O3AA 4MPVA 1MAYA 3MNXA 1QCPA 2A5IA 3R3GB 4MPXA 1C2MA 3TGJE 5GJ4B 1LHFH 4GHTA 3MU1A 1GHAG 3TIUA 2OC8A 1TPSA 1C5WB 3LDXH 3RMMH 1O3GA 5GDSH 3KQCA 1O3BA 5DP4A 4YT6H 2GGVB 1PPZA 2RG3A 6LPRA 1GBCA 1W12U 1PYTC 4B2BA 4TPYA 4FUFA 1DY9A 1WTGH 2ZTZA 1KLIH 4K1TA 1E36B 3GCTF 1CA0C 4BXSA 2FX6A 3RXQA 1KLJH 3SI3H 2P95A 1V6DA 5FBEA 1IHTH 2ZKSA 2PUXB 1GHXH 4XE4A 3NXPA 2I6SA 1G3EA 4X1PU 1ZSJA 4WMFA 2BLVA 1GI5A 4OS7A 3U69H 1NS3A 4VGCC 5HMAA 1BTXA 2A4OA 2VIOA 3A7XA 5EQRA 4ZMAH 2XXLA 3GDSA 1A1RA 2DUCA 5EQSA 3SU5A 1ANDA 5GXPA 5AVDA 5EPNA 3T28A 1ELVA 2I6QA 2G4TA 1YPGH 4I33A 1EP6A 1NPMA 4ZUHA 1NU9A 4O9VA 1TOMH 1SGCA 1HAHH 1AFQC 3I77A 1A5IA 1AHTH 1OOKB 1MQ6A 1QL7A 2W7UA 3TJOA 1XUKA 1EOJA 2ZPQA 3BF6H 2F9NA 1AB9B 2XCFA 1C2HA 1QIXB 3EYDA 4FXGH 1HAIH 2VJ1A 1P2MA 2HOBA 1AQ7A 2QF3A 1C5QA 2WPHS 2Z9LA 4CR5A 2GMTC 2VVVA 3W94A 1TPAE 4SGAE 2BY9X 1RRKA 1C5NH 1E38B 3T26A 2H9TH 3GDUA 1TOCB 3F9GA 4I8JA 2BX3A 1GG6B 1P12E 1VCQA 3SJOA 5A0CA 2O8TA 4ISNA 5C3NA 3GYMA 1GHZA 1TLDA 3TNTA 1W0YH 5F8ZA 3D49H 1O2SA 1BHXF 3ATLA 4YTAA 1O2JA 2Y7XA 2OTVA 5I25A 1EJMA 2Q6FA 5IDKA 5DG6A 3RXGA 1EP5A 1FY1A 3TU7H 1GJAB 2R9PA 4U30A 3RDZA 3UFAA 1ZPBA 4ZAEA 1FONA 2GV7A 3RXLA 1TX8A 1LPKB 1JWTA 3RU4D 4AFQA 1WYKA 1P09A 4GVUA 4UDWH 3SNEA 4JYTA 3EAJA 4KTUA 4TWWA 4UE7H 1FN6A 2ZI2H 2NU2E 2VIDA 2ZIQH 1EB2A 1O3CA 3RXDA 2GZ9A 1RIWB 1AO5A 3B8JA 5F8TA 4SGBE 4AN7A 5AF9H 2LNCA 2ZWLH 4WWYA 5EODA 5C1XA 3VB7A 3SV8A 1O37A 1HAYB 2W5EA 1G9IE 4R0IA 5AFYH 4DW2U 1FIZA 2FOHA 2ALVA 2H6MA 3L3TA 1ZMNA 2A45B 1B0EA 2B5TB 3RLYH 2O8MA 5EU8A 1QRZA 1J15A 2NWNA 3A7WA 3CP7A 5DP8A 1RTFB 2F9PA 1HGTH 2C90B 2GD4B 1BMAA 2OQUA 3M5MA 1FPHH 2ZDLA 5DP3A 2BM2A 3LH1A 1HV7A 2BVSH 3A7VA 4Y0ZE 2ZQ1A 2B9LA 4NZLA 3RU4E 2F9UA 2FM2A 3IITA 1MTWA 3KQBA 1VITH 2Z9KA 1X7AC 3RXMA 3SN8A 4ASHA 2FX4A 2FMJA 1XUGA 1KXCA 1TNIA 1UTJA 3RXIA 1C5VA 3NZIA 1Z6EA 2ZQ2A 4WMDA 4BNRA 1O2NA 1QB6A 2QXHA 4CREA 1VZQH 4ABDA 4B2AA 1DANH 3A8DA 2TGPZ 4YLQH 1EASA 1DSTA 2ZDMA 1O3EA 2GDEH 4O3UA 3LC3A 4D9RA 2P8OB 2XBVA 5ESBA 3UUZA 2UUKB 1LVOA 1UTLM 2GCTB 1V2PT 4LOYH 1H9IE 2BB4A 1GHVH 1V2WT 2FP7B 1BT7A 3GY4A 1SR5C 3RU4T 9LPRA 1V2UT 4DVAU 1ESTA 1GBLA 2TIOA 3D62A 2J95A 2D26C 3PLPA 3VXFH 1SGIB 3SU0A 1O33A 1TA2A 5GIBA 1Z7KA 3KL6A 4PROA 1FV9A 1O38A 4DIHH 3MNBA 1WSSH 1JRTA 1Z8RA 1BTZA 3TH4H 2UWLA 1MCVA 1O35A 3PMBB 3M7TA 4I32A 1SGFA 1S0RA 2TGDA 1DUEA 2BD7A 3K2UA 1GVLA 3LC5A 4NA7A 3ATKA 3CENA 4HZHA 5EPYA 2XWBI 3ZZ6A 5ABWA 1LVMA 2FWWA 7ESTE 3BTQE 1DM4B 2FODA 2ZPSA 4K1EA 5EOKA 1SGRE 1GGDB 1PPFE 1NO9H 2BVXH 3UOPA 1YPHE 1C5YB 1EJNA 1GI0A 3TH3H 1GJ8B 5K0HA 1TBQH 5EXMA 1RXPA 1TX7A 3M3SA 4NIYA 3VFEA 4RSPA 1TA6A 1T8OA 4I31A 3M35A 1MKXH 1O0DH 1LQEA 3MU5A 3ZVFA 1GBIA 1UK4A 1AU8A 2ZU5A 5TCCA 5CMXH 1TGSZ 2SFAA 3URCA 1K1PA 2FDAA 1LQDB 2XNIA 2ZU1A 2P3UB 1QL9A 3LU9B 1L4DA 1Y3YA 1EZUC 4XBBA 2G51A 3NWUA 2VB0A 2ZCKP 1LCYA 4CRFA 4NSVA 3G01A 4Q2KA 4NIXA 1FY8E 2A7JA 5E0HA 3VB6A 1P2KA 4ZKRU 1ORFA 1YPMH 4AOQA 1SHHB 1ZR0A 3GDVA 1KLTA 2VH6A 3GCTG 2PUQH 1AVGH 1G32B 1PPBH 1Y8TA 3ATMA 1GHBG 1GBHA 3PTBA 4HI3A 2VWMA 4DG4A 2ZGHA 1O5AB 3Q76A 1A61H 1ZGVA 3ATIA 2FOFA 4X2VA 2EA3A 2GP9B 5L6NH 1CA0B 1AMHA 1O2TA 2A1DB 1ZMLA 3E90B 2XC4A 4XSKU 3EA8A 4GAWA 2ZFQH 4GUXA 5IYTA 3GYLB 1TAWA 1V2NT 1GVZA 1K21H 4VGCB 1RS0A 1V2TT 4B73A 4XFQA 3D65E 4NZQA 4MQAA 4FUBA 1ZPCA 1Z6JH 1C5SA 2O8UA 1QBNA 5SGAE 2Z3DA 4JYVH 5I46H 3PO1C 1P3EA 1GL0E 1CT2E 5GCHG 1W11U 5HGGA 1DWDH 3DUXH 3RXHA 1MMJN 2Q1JA 2GCHF 4X2XA 4FUDA 1O5GH 1TNJA 4CH2B 3SO3A 1UCYK 1AFQB 1C1UH 1DE7H 1O2IA 5DK1A 2W26A 4MNWA 1A5GH 3OTJE 1AFEH 1ABJH 1DLKB 1LVBA 1SGEE 1H4WA 1QY6A 3P8OA 3TK9A 1SQTA 1UVPA 4INLA 2ZDVH 1HB0B 2AMDA 2F91A 5EW2H 2PWXA 3SU6A 5FBIA 2GMTB 1GMDG 4RKOB 1BRAA 3SV9A 2ALPA 3LGUA 4OGXA 1C1WH 3LOXA 1O2OA 3HGPA 1O5DH 4F4OC 1L1GA 1O30A 1OSSA 2D2DA 3UWJH 1SB1H 4AG1A 2FS8A 1OP0A 1V2RT 4A1TA 1T8NA 3E3TA 1E0FD 4ABFA 2OC7A 2ZGXH 3DHKH 1QBVH 2HNTE 2V0BA 1BRBE 4B74A 1KTSB 1RIWC 1WTHD 1DLEA 1GI3A 1OP8A 1UVUH 5EW1H 1BA8B 1FY3A 1NRRH 3BN9A 5HYOA 4K3JA 2BY5X 5L2YH 1O5BB 1NRPH 4CRBA 2Y5GA 1SFIA 1JMOH 4CRCA 1GBTA 1RD3B 1W3CA 1SLVB 2C8YB 1UTMA 3AW0A 3ODFA 4IBLH 2BD5A 5GWZA 3T2NA 3LGWA 2PR3A 4ESTE 4INHA 3ESTA 1KDQB 3E91A 1JIMA 1OYQA 4X6NA 3C1KA 2H9HA 4R8TB 5J4SA 3F1SB 1HAZB 4UEHH 5FCRA 5F03A 4X1RU 1ZJKA 1JBUH 5T3HA 3UQVA 3M7UA 4TY7A 3P8FA 1LTOA 2A32A 2UUJB 3TK6A 1FLEE 2G5VA 3FFGA 1ELFA 3VGCC 3PYHA 1AD8H 1FNIA 1O3HA 2OINA 2QA9E 3ZZ3A 1KXEA 2XBXA 2O8WA 3EDXB 3EQ0H 4ISIH 3UY9A 5GPIB 1F7ZA 4O3TA 1NTPA 3E0NB 4I8GA 2R3UA 2IN2A 3EA7A 1O39A 3EGKH 4H4FA 3A7YA 2C8WB 3SW2B 1LVYA 1ZHRA 5JB9S 1RGQA 2F3CE 2ZU4A 2XW9A 1VCPA 5AFZH 1K1MA 2FOEA 2HWLB 2V3OH 1SLUB 3BEUA 3ENSB 5LH8A 7LPRA 4FVBA 3TVJB 1PPGE 4JCNA 4FUHA 1C4U2 3A81A 2G00A 4TYDA 1QQ4A 4MNXA 2QV1A 1E35B 4GHQA 1KXAA 2BQ6B 4IMQA 4JK6A 1NZQH 1KDQA 3BTWE 2BDBA 1S5SA 2Z7FE 1Z8GA 1O2UA 1THSH 2EI6A 3TK5A 1C1RA 2VIQA 2PSXA 1J16A 2FESH 3RXUA 2ZPRA 5E2PA 4Z6AH 2ILNA 1IQGA 1C5TA 2PLXA 1OYTH 2ZG0H 3S9BA 2IOTA 3PM3A 3ZZ9A 1ELAA 3ODDA 4I8HA 1JIRA 2ZFTA 3DD2H 3MO6A 1DDJA 2ZHDA 1FJSA 1ZSKA 2AYWA 2PTCE 3SNDA 1O2WA 1O2ZA 4ZXYH 1YPHC 2BY7X 2BOKA 1MKXK 1W14U 1BTWA 3ZVCA 3UPEA 1C1SA 1F92A 4MLFB 2GTBA 4X0WU 1GJ6A 1XUHA 2THFB 1SGTA 1JOUB 1WV7H 1EUFA 1HCGA 1C1OA 5L30H 2W3KA 8GCHF 3U1IB 1BMLA 1G36A 3SU3A 3KGPA 1Z8IB 4U2WA 3RXTA 1C2LA 1BMMH 3AVZA 2TPIZ 1MTSA 1LHEH 1A3BH 1TMTH 3RXCA 4KP0A 2OBQA 5HM9A 3K9XB 3FP8E 3MH7A 1AVWA 2Z3EA 1L1NA 3RXOA 1VITF 1K1OA 4NWKA 1GDUA 4ABEA 3LT3A 1YPJH 5A8ZA 2TGTA 2BD8A 3RM0H 1QRWA 4ZKSU 2FOAA 8LPRA 1C5XB 1V2ST 1MBQA 2J92A 5JBCS 1P8VC 2SGFE 1HJ8A 4TY6A 1ZSLA 3O8CA 1KSNA 1YYY1 7GCHF 1O3PB 4ABJA 1Y5UT 4FUEA 1W7GH 5HXFA 2PGQB 3M36A 2GT8A 3UREA 3BIVH 1C5MD 2ZCLP 4NFEA 4U01A 3STIA 1EAWA 1LHCH 4YT7H 4WH8A 1L4ZA 1ZRBA 1YPKH 2QXGA 3A84A 5E8EH 2GZ8A 1OWDA 2WV4A 1SOTA 2A2QH 5A09A 1MZDA 1SI5H 4NGAH 3JZ2B 3P70B 1WCZA 3RXPA 1P0SH 3NPSA 2QYIA 4WXVA 1TNHA 3KHVA 1GWAA 4ZXXH 1ELBA 1FUJA 3U1JB 3QTOH 1UHBB 5JBBS 4TWYA 2A4GA 4WY3A 1UO6A 5DJ7A 3U8OH 3E6PH 2J34A 1GMCF 4NFFA 2PHBA 1Y3WA 1V2QT 2R2MB 4QT8C 1TGNA 1GI1A 3PO1B 3ZV8A 4GCHG 4BTTB 3QO6A 3QN7A 1TWXB 1O2MA 4YLUA 4IW4E 5FPTA 1GBEA 1UCYE 2P3TB 1AE8H 4NG9H 3T5FH 2V3HH 1GJ9B 2SGDE 1NT1A 4CR9A 1MH0A 4GSOA 2W3IA 4K8YA 4BANB 1OWJA 2HNTC 1TGBA 1CE5A 1A2CH 2UUFB 1HDTH 1ZZZA 1SQAA 1O5CB 1ZTJA 3DT0H 5DP5A 3UWIA 4DOQA 1OKXA 4FU9A 1SFQB 1QQUA 1FIWA 2ASUB 2ANMH 1PQ7A 4AB9A 1K1LA 3S0NA 1Z71A 3VB4A 1CGJE 2A4RA 1QJ6B 3HK6B 1C1PA 3FP6E 3UR9A 1EJAA 1Y3UA 2GV6A 2ZGJA 1C1VH 5JPMH 2VWLA 2ZO3H 2OC1A 3VPKA 4ABBA 1VGCC 4IGDA 1TGCA 5FXLA 1UHBA 2RDLA 4FU7A 1BBRH 1CSOE 2C93B 2OC0A 5L2ZH 1FDPA 1TYNA 4MNVA 1AWFH 1DPOA 2H5DA 1P9UA 1NESE 1MBMA 4WMEA 1UMAH 4INKA 3BV9B 1ELGA 1LMWB 1MTUA 1EB1H 3SI4H 1CQQA 1YCPH 5LPRA 2B0FA 1EPTC 3B23B 3TPIZ 1WOFA 1MKWH 2P94A 2SGAA 2QCYA 1ZOMA 4JMYA 4ISOA 1A0HB 4JZ1A 4A5TS 1F0SA 1ZPZA 3H7TA 3SGBE 4DT7B 1AUTC 1SGQE 3QZRA 3VGCB 1EKBB 1GI7B 3K6YA 4DJZB 2BVRH 2GVFA 1JRSA 4CRDA 5C5NA 1CHOF 1CU1A 3CS7A 2VIPA 1C1TA 1WU1A 4YOIA 1GJ7B 3KNXA 1O2VA 1TIOA 1YC0A 3PLBA 1H8DH 3FVFB 3OY5U 1O3NA 1F0RA 2Q6GA 3RUOA 4AFSA 1V2VT 4E05H 2BZAA 3M7QA 2FTMA 4Y8ZA 3TJVA 1UTKA 3V0XA 3A8AA 1GI8B 4KELA 5T6GA 4MTBA 9ESTA 5JDUB 1ID5H 1DVAH 3OU0A 4MNYA