2LNCA

Solution nmr structure of norwalk virus protease
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
188
structure length
188
Chain Sequence
b'MHHHHHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like protease
publication title Structural and dynamics characterization of norovirus protease.
pubmed doi rcsb
source organism Norovirus
molecule tags Hydrolase
total genus 16
structure length 188
sequence length 188
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2lncA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2lncA01
1W12U 1PPFE 3NPSA 2XCFA 1Z8RA 1NFXA 2Z9GA 3BSQA 1L0ZA 3ZZ5A 1D3QB 4TY6A 3T27A 3RU4E 1A46H 1V3XA 5JPMH 5L2YH 3MO9A 3DD2H 5JBCS 2H5CA 4FUBA 2F83A 3RXPA 1HFDA 1U6QA 3RXRA 1ZSJA 2YNAA 3ODFA 3SJKA 1TMUH 1C1SA 1HDTH 2IPHA 1GBHA 1UK4A 5DP5A 2GCHG 2PWXA 1EAIA 5C3NA 3O8DA 4HI3A 3QTVH 1ZMJA 4UONA 1V2JT 1AY6H 1O33A 1A5HA 2GX4A 2ALVA 3D65E 1J9CH 1ZHPA 1GMHF 1O2IA 1O38A 4O9VA 3FZDA 1GGDB 3A7VA 1BJUA 4ZHLU 1A61H 2PHBA 3PMHB 4LXBH 1LPZB 1P03A 3PMJA 1C5OH 3P8GA 2JETC 1OWJA 3UTUH 5E2OA 4A92A 1OKXA 3VB7A 2QXHA 2WV5A 3A8BA 3ZZ8A 1YYY1 3H7OA 2BXTH 2FOCA 2P16A 3KHVA 1O2ZA 2FX6A 1ZGIA 2Y6TA 1F7ZA 3SU4A 3URDA 5EPYA 3S9AA 3S0NA 3M7QA 2UWOA 3HPTB 1LHDH 4IC6A 5A8ZA 2SGEE 1JWTA 2A7CA 1SGTA 2HPPH 5C1XA 2VIPA 1J16A 2FZZA 1EKBB 1GMDG 2YNBA 1MTNC 1RRKA 1HAZB 3BTEE 2F9BH 5I25A 1TE0A 1DVAH 1ZJKA 2AH4X 2OBOA 3FVFB 1V2ST 1S6HA 4MPXA 5EQQA 3PO1C 2ODYB 1W10U 2TGPZ 3ZVAA 1H9LB 4ABDA 1IHSH 5AFZH 2BXUH 4D8NA 1GHZA 4MNWA 1AIXH 1YCPH 3CENA 2Y5GA 2PKSB 2BDHA 1CT2E 2WUBA 2PV9B 3EE0B 1O5AB 2BD3A 1BCUH 3MNXA 4FUJA 1LVOA 1PPCE 1Q31A 4WVPE 1GBFA 5BRRE 2A1DB 1UTJA 5FBIA 1O2WA 2TIOA 4ISNA 3A83A 4I8HA 1WCZA 3Q3XA 3LGUA 2W5EA 1QBVH 2FYQA 1B0FA 4GVUA 1EXFA 1AB9B 4I33A 1TPOA 4CBOA 1OWHA 3SV2H 1DLKB 1YPJH 1DWCH 5EXMA 1MTUA 1UVOA 1T8NA 3M3TA 5GIBA 1C2MA 3SZNA 3E16B 1P2QA 3SNCA 1G30B 3A8CA 4OGXA 1YF4A 4NZQA 2WYGA 4IMQA 2RA3A 2KAIB 2QA9E 3BTGE 1EP5A 1IOEA 2SGDE 3LGYA 1FMGA 3K9XB 2ZU3A 1OP0A 4YOGA 2WPIS 2ZC9H 3E90B 1QURH 4X6OA 2XNIA 4OS6A 5FBEA 1MZDA 3LJJA 3URCA 5EQSA 4CHAB 1DSTA 2G55A 1RFNA 1ELVA 3TNSA 8GCHG 1CGHA 1YKTA 4R0IA 3R3GB 1KYNA 2BQWB 2BDIA 1O3CA 2V3OH 2VH6A 3SNBA 1T32A 2PTNA 1XUKA 3PROA 1MBMA 2P8OC 1GG6B 5L6NH 2ZDKA 1N6XA 2OP9A 4Y76A 1TABE 2F9VA 1ZPCA 3TVJB 2AGGX 3B23B 4O03A 3ESTA 3UY9A 4AYVB 1HJ8A 2BZAA 1UTOA 2A45B 2G5NA 4JYTA 7KMEH 1HYLA 1TYNA 1T7CA 1THPB 4GHTA 4JK6A 5EXNA 5DP8A 2ZF0H 2UUKB 1ZTLA 1WU1A 1HAHH 5DO4H 4Y8XA 4DG4A 1ESBA 3TJUA 1ARCA 3QX5H 4GPGA 4X8TH 1UK3A 3SGBE 3UQVA 2EI7A 3SHCH 2BDCA 4BAOB 2PTCE 1QHRB 4X1QU 1SQAA 1L1JA 3GY8A 2JKHA 1C5UA 3EA9A 1C1PA 5TCAA 4DIIH 1SLVB 1EAXA 1C5NH 5AVDA 1IQEA 1NRQH 2P93A 2BX4A 2DE9A 4WF8A 2G5VA 1AVGH 5C1YA 1H9HE 1UTMA 2R2WU 1C5XB 1G32B 3TJVA 3LOXA 1GHBF 4UEHH 3SQHE 3JZ1B 4WXIA 4ZKRU 3SORA 3UPEA 3HKIB 5HGGA 1F0TA 4NSVA 1QB9A 3DFLA 3ATLA 1A1RA 1C4U2 1AZZA 5DPAA 5HM9A 3SV6A 5G4BA 1P3EA 3ATKA 4JZIA 1A4WH 1BBRE 1NFWA 1ZPBA 1FPHH 2BDBA 4F4OC 2CF9H 4JYVH 1DITH 3MNBA 5T6FA 6ESTA 4K60A 2VIQA 3AW0A 5GDSH 1BMAA 3SI3H 1KDQA 3IITA 2JH0D 5F03A 1YPMH 3VGCC 3ZZ9A 1F5KU 1GHVH 1O3OA 1EB2A 2J38A 3MI4A 4Y0YE 3MOCA 1P2KA 2ZPRA 1ELGA 1SGNE 3M5LA 3RXOA 2R0LA 3MFJA 2XWAA 2FI3E 3JZ2B 4R8TB 1L1NA 5C20A 1BA8B 3GY7A 1O2KA 1TBQH 6GCHG 1C9TA 1A3EH 1UCYE 3BTWE 1C4V2 1QIXB 1S81A 3MU5A 1C5SA 2BDAA 1FIZA 3L3TA 1BMLA 1QQ4A 1QR3E 3LT3A 1O2NA 1GJAB 2GT8A 2GD4B 2SGFE 4OGYA 2BHGA 2J94A 4A7IB 4ZUHA 2A4QA 4FUDA 5J4SA 4Y7AA 3T28A 2FPZA 1GDQA 3LH1A 1SB1H 1ZHMA 2QF0A 1O5CB 4BXSA 5CE1A 1CA8B 4MNXA 1ZRKA 1O30A 2FS9A 3MO6A 1SFQB 4SGBE 3CS7A 1VITF 2WPKS 1YPKH 2EEKA 1AWFH 2XC4A 1RIWC 1UHBB 1WAYB 4Q7YA 2UWPA 1C2IA 4AG2A 2BY9X 4WJG2 4K5ZA 3TH4H 4IN2A 1AFQB 3HATH 4JK5A 1QB1A 1QJ7B 1NZQH 2WPLS 1NC6A 1OX1A 1W14U 2R3UA 1QRWA 2FM2A 8LPRA 4YZUA 3RXEA 4B2CA 1MD8A 1MQ5A 1F0UA 5FPYA 5HM2A 1GBBA 5JBTA 2FOAA 2AMQA 2W26A 2ZFTA 4AFUA 1O3AA 3ATMA 3RXQA 2F9OA 3SHAH 3SNEA 2ZDNA 1V2OT 1PYTC 2VVCA 4B71A 5CHAC 3MH5A 1NESE 1AWHB 1GI8B 3ZV8A 2HALA 3EYDA 1C5PA 4YT6H 3VB5A 1TGNA 1NM6A 1VZQH 1TWXB 4X1RU 2G4UA 1LVYA 3RMLH 1RGQA 3EA7A 3PMBB 1K2I1 1DICA 1FLEE 1BTZA 5GCHG 1AO5A 1EZSC 1CHOG 1O2YA 2QYIA 3MH6A 4YLUA 3SW2B 4AGKA 2OCVB 2V6NA 3KF2A 3TJOA 3LIWA 3FFGA 1AQ7A 4J2YB 1GBKA 1C2FA 1GJ6A 3M7UA 3AAVA 2CJIA 3SNDA 2ZHQH 4KELA 1TX8A 4CREA 1C1TA 4Q7ZA 4UFDH 1TNIA 3A87A 3BG4B 1XKBC 1N8OC 3GDUA 4ISLA 2XYAA 1PJPA 1GI7B 1G3EA 2IN2A 1GI9B 1Y3WA 4VGCC 1LPKB 3KCGH 5IDKA 2PGQB 7GCHF 3RMMH 5DGJA 4FU9A 3SU6A 2PKAB 4X6NA 1W7GH 3BEUA 1DUEA 2ZFFH 1G37A 1B7XB 1FONA 3SBKA 1L4DA 1SMFE 1D3TB 3A86A 3LH3A 1C9PA 1WBGB 2B5TB 1UTPA 3OTJE 4RN6A 1TNJA 1T8OA 1HAOH 1GBCA 1LMWB 4CRBA 9LPRA 5HMAA 1A7SA 2GVFA 4B1TA 3QWCH 1IQJA 3SGQE 2ZGJA 3ZZ7A 3U9AH 1QJ1B 4FXGH 2Z94A 1A0JA 1P3CA 3QUMP 4ZXXH 1P01A 3S7KB 6LPRA 3QN7A 1ELAA 1GI3A 3GCHB 2C3SA 1O2XA 5ETXA 1TAWA 1QL9A 1P11E 2RCEA 1Y3VA 1VR1H 7ESTE 1L4ZA 1TRMA 5C5NA 2F9PA 1LVMA 3MNSA 1XVMA 1X7AC 1C1QA 3EQ0H 3NCLA 1TRNA 1Z1IA 2ALPA 3FP7E 4ABFA 1GCTB 4INHA 1GHXH 3E0NB 4X6MA 1EPTC 5FPSA 1MU6B 1AKSB 1FY4A 1KTSB 1BDAA 3F6UH 4FU7A 2VWNA 4NGAH 5JB8S 3D49H 3P95A 3V3MA 3GYLB 1GBIA 2R2MB 2OINA 4YTAA 2CHAC 3ZVDA 2Y82A 3I29A 4ISHH 3PTNA 3CP7A 1GCDA 3UQOA 4CRGA 2ODPA 2CMYA 2Z3DA 1XUGA 2ZI2H 1FJSA 2Z9KA 3V0XA 2PLXA 3VFEA 4ABEA 4U32A 5AFYH 1GI2A 1ID5H 1KTTB 1AI8H 1C2LA 1YPEH 5LH8A 2FLRH 4O3UA 4Y10E 1NROH 1OYQA 1HAVB 2HOBA 1UTKA 4MNVA 4WMEA 2GT7A 3P70B 1C1RA 1ETSH 2BQ6B 3UR9A 1B5GH 2QIQA 2A4GA 1VGCC 1PQ5A 1O2VA 3V12A 1GVZA 4A1XA 2RDLA 4WH6A 2A32A 2BVSH 2BDYA 3GDSA 2Y7XA 2FOBA 2I6QA 4YESB 5CHAB 3RXGA 1LO6A 1BTHH 3PLPA 1O3IA 3A82A 4BTTB 4HGCA 1J14A 3TGKE 3VXEH 1B0EA 1KIGH 2J2UA 2AEIH 4FVDA 1KY9A 3PWCA 3F9GA 1ZTKA 3F68H 2NU2E 3MH4A 1EZXC 3I78A 2FOFA 1O3PB 1O2JA 2BVRH 2ILNA 2KAIA 2WPMS 1MAYA 3S7HB 1ELDE 1DWBH 4DW2U 1D3PB 3MMGA 4M7GA 3M3VA 1ESTA 3MWIU 3ZZDA 1NS3A 1O3GA 4B76A 2BTCE 2VWLA 1SGRE 1HJ9A 3NWUA 4TY7A 4NA7A 1OSSA 1PYTD 1PFXC 1MTSA 3OY6U 1QJ6B 2BOHB 1G36A 3SU1A 4H6TA 1ESAA 1N8OB 3K6ZA 2C4FH 4ESTE 1K1OA 2OC0A 3T62A 1BRAA 1SLWB 1UVTH 1Z7KA 1FUJA 1ZTJA 3Q77A 1QA0A 3RLYH 4Z0KA 2FESH 3A81A 1FQ3A 1GHAF 1GMCF 1GI1A 2OBQA 2XBVA 3RXSA 3RUOA 3ZZAA 3KQEA 1PQ8A 1CGIE 2F9UA 1IQNA 4MG3A 1THSH 2FTMA 1BMMH 1FZZA 3TITA 3HK3B 2ZHWH 1C5MD 1MMJN 1HRTH 4K3JA 1BTPA 1QA7A 4WWYA 2P94A 3LDXH 3ELAH 4OS7A 2YOLA 4YM9A 3BTFE 5IYTA 1O3NA 2UWLA 3E0PB 3VB6A 1C2KA 2G8TA 2H2ZA 4X8VH 4BAQB 2ZFRH 4D76A 1HAYB 1P02A 1P9UA 2Z3EA 3GDVA 1MD7A 1DE7H 1S5SA 3ZVCA 1D6WA 2AGEX 2OC1A 1SGPE 2BLQA 2HRVA 1C1NA 4OS4A 1EZUC 2VIOA 1A5IA 3RXVA 4QT8C 2ZDAH 1YLCA 4O3TA 1V2VT 1CHGA 1H1BA 1K1MA 1PPBH 1XUIA 3RXMA 1CA0B 3RXFA 5EXLA 1FN8A 5L2ZH 2C8WB 1WQSA 4MLFB 1YCPK 1THRH 1F0SA 1QRXA 1BOQA 2K1QA 1ZOMA 1SGEE 1C5LH 2V35A 2VU8E 4MPWA 3BTDE 2A7HA 1V2TT 2ODQA 3E6PH 2QGRA 3F1SB 1GJ5H 3M35A 1O2PA 2ZCHP 1EOJA 2Y7ZA 3A84A 3P8FA 1OPHB 1VCPA 2P3UB 1ZSLA 1YC0A 4KTCA 3BEFB 1EATA 1OP2A 4OS2A 2GGVB 4X2VA 3M61U 1GMDF 1OWDA 3LGWA 2GDEH 1AN1E 4HTCH 1RS0A 2ZGBH 3NK8A 4ISOA 1P57B 6CHAB 1C2HA 1H8DH 4YOIA 2V0BA 2ZGCA 1K1JA 2ZDVH 1LHCH 2BYAX 2FS8A 4E7RG 3M3SA 5C1UA 1LVBA 3QZQA 5ESTE 2ZTXA 1IHTH 1DUAA 3Q3YA 1GL0E 1EJMA 4CR5A 1RTLA 1XX9A 1TONA 1CO7E 1YPLH 2OC8A 2VIDA 1SQTA 1HXEH 1QB6A 2ANWA 3UNQA 1QTFA 4AZ2B 1AGJA 1UHBA 5C5OA 1TNHA 4X2XA 1H4WA 1KXBA 1PPHE 4MTBA 2ZHDA 2CXVA 3PWBA 4ABAA 5F8XA 2CN0H 4UFFH 2BVXH 1K1LA 1LPGB 2I6SA 2O8WA 3GCNA 1FI8A 1SL3A 4Y8ZA 3UOPA 5SGAE 1QCPA 5A2MH 2C8XB 2D26C 1TGSZ 5F8ZA 3RXLA 4DOQA 1HJAC 4IGDA 3MHWU 2Y81A 2ZCKP 3Q76A 5DP9A 1ZPZA 5LPFA 2OTVA 1ZMLA 1C1VH 1ZHRA 1ACBE 1UJ1A 1SGDE 1V2QT 1SHYA 3RM2H 1NRRH 4FUFA 2FI4E 2BD2A 3GICB 3QO6A 1TOCB 2W7UA 2ZQ2A 1PPZA 1MAXA 4Y11E 1W2KH 1C1MA 5GJ4B 4LOYH 1C2EA 1Z8GA 1O2OA 2FO9A 2A5KA 1UTLM 2ZU2A 2ZA5A 2GZ9A 3CS0A 4FUCA 4HFPB 1XXDA 2ULLA 1TGBA 2ZNKH 1GVKB 1V2UT 3I77A 4ZKSU 1WYKA 4ABGA 8GCHF 3TIUA 3P6ZB 4GSOA 3L33A 5C2ZA 2GDDA 1LHGH 3HK6B 3PLBA 1G3CA 4JYUH 2WPHS 4BXWA 1GBDA 4AYYB 1FAKH 1HGTH 2CF8H 5A8YA 1QBNA 1GJ8B 4X6PA 4H42U 1MH0A 4ISIH 4D9QA 1C5ZB 3T25A 1JXPA 3AAUA 3NKKA 1ZMNA 2JETB 1BRUP 4K8YA 5DP4A 3KEEA 3GCTG 1IAUA 1T8LA 3A88A 1FXYA 1GJBB 3GY3A 4WMDA 1HAIH 3RM0H 3KL6A 1TBZH 4I8JA 4GLYA 4K8BA 4XDEA 3GYMA 1FY3A 4PROA 5C67A 3GCOA 2ZO3H 4CRFA 1E37B 1W3CA 3F9FA 2G52A 2ZZUH 3F9EA 3PV4A 2OD3B 1QL7A 2FOGA 5J4QA 2PKAA 1SBWA 4Y71A 1F2SE 1S6FA 3E3TA 1O39A 3KGPA 3V13A 1EOLA 1T4VH 2GMTC 1MTNB 1TX6A 1NRSH 3RC6A 5E2PA 5A0AE 2PR3A 3ATWA 1INCA 3PO1B 1E38B 1NO9H 1ZSKA 1CSOE 1F92A 1HAGE 1VJAU 1NFYA 2AERH 2RG3A 1QQUA 1RD3B 2DUCA 4AORA 1O2QA 4XBCA 3TNTA 4ZKOU 1TNLA 2O8LA 2EI6A 1V2MT 3QGNB 1E36B 1A3BH 3SU3A 2QC2A 2GTBA 2BY8X 2ZKSA 1C1UH 1O37A 2OQUA 2XBWA 3A80A 2XXLA 1ORFA 2PSYA 4B73A 1NY22 1OWKA 1UMAH 3SJIA 2RA0A 2SNWA 4U2WA 1AMHA 1MCTA 4FUGA 1OP8A 2BX3A 3U98H 3RXCA 1VITH 5A09A 1AKSA 2B7DH 1AU8A 2FODA 5LPRA 1PQ7A 4CRDA 1ARBA 1Z71A 5DP3A 4K69A 1E35B 5T6DA 4ZKNU 1UO6A 3M5OA 2P59A 1TA6A 4KKDA 6GCHF 1CVWH 4X1PU 2FX4A 3RXBA 3QTOH 1JBUH 2Z9IA 1Y59T 1DXWA 3DUXH 3UREA 3K65B 3TK6A 1GWAA 2XCNA 2ZCLP 1GBEA 4XBDA 3VB3A 4JZ1A 1C2GA 1WTHD 3A7TA 1BIOA 3LC3A 4IN1A 1DANH 3NUMA 1F5RA 1EQ9A 4B2AA 4LZ1H 1YCPM 1HAVA 2VVUA 1TPPA 1EP6A 2XBYA 3TLOA 2AFQB 4IW4E 1O2RA 1Z6JH 3ZZCA 4Z6AH 1O2UA 2ZDLA 2G51A 3NXPA 1KSNA 1G9IE 1MZAA 2ZWLH 2P8OB 2FDAA 1TQ0B 2OUAA 2C90B 1O3BA 1GBMA 3SUFA 1O2SA 4THNH 1HIAB 5JBBS 4ZH8A 5A0CA 5JBAS 2AMPA 2XRCA 2HPQH 1EX3A 1MUEB 1MBQA 2C8ZB 2WUCA 4SGAE 4ASHA 2A5AA 4K2YA 3BIVH 2ZU1A 3BTQE 1EUFA 2UUYA 1E34B 2TPIZ 2SGQE 1NFUA 4IBLH 1K28D 1DWEH 1FNIA 1LHEH 1LHFH 1FY1A 1OOKB 2W7SA 3KNXA 1BRBE 5F6MA 5CMXH 1AE5A 1AVWA 1IQMA 2A2QH 1O3DA 5GXPA 1Z8JB 1TPSA 1YPHC 2BD8A 2FOEA 1C2DA 3A89A 4BANB 5GCHF 2D1JA 3IG6B 1AUTC 2DE8A 1SOZA 1TB6H 4U01A 1CHOF 1YGCH 2GZ7A 4Y0ZE 3BG8A 1S0RA 3E1XB 4AFZA 3OX7U 1ZR0A 2H9EH 3U8TH 4JZFH 4DURA 4INKA 1DT2A 1Y8TA 1W7XH 1Z1JA 1P09A 2Z7FE 1KLJH 2ANMH 3QLPH 5ABWA 1O2HA 3KIDU 2CV3A 2P3FH 3PTBA 3GISB 2SGAA 3VGCB 5DKMA 1CBWB 1JMOH 1SLUB 1P06A 4E7NA 3RDZA 3SJOA 1GGDC 4FUIA 1S0QA 2BD4A 2AIQA 3RU4T 2ZDMA 1JIMA 1CGJE 4BAKB 1P2NA 2O8UA 2BOKA 3HGPA 5FX5A 2HWLB 4A1TA 4MDSA 3KQCA 3DHKH 3LU9B 5FX6A 4CR9A 3MO3A 1G2LA 1VCWA 1ETTH 1KXFA 2VH0A 4K1TA 4RKJB 2WV4A 4TPYA 2J95A 2PGBB 1XM1A 3LGTA 1ABIH 1BTYA 5EQRA 1FY5A 1HB0B 4YLQH 3O8RA 2ZHEH 3A7ZA 4DY7B 1S83A 1TMBH 1S85A 3MNCA 4XBBA 4Y8YA 3D23A 1KXAA 4MNYA 2AIPA 1F0RA 1FPCH 2XC0A 4JZEH 1O2LA 3UR6A 4NA8A 4ABIA 1JOUB 1V2WT 4K1SA 3VB4A 4GCHG 1NRPH 5EU8A 1KXDA 1KXCA 1O3LA 4X0WU 5E0JA 1ELCA 1W0YH 3MU8A 1RIWB 2SFAA 1XUFA 2PW8H 5TJXA 2HNTC 3T2NA 3SUGA 5F8TA 1ELEE 1T8MA 1O34A 3G01A 1P2JA 2PKSC 1GBLA 3OYPA 1LKBA 4A6LA 4D7FA 4ZHMU 4FUEA 1GHWH 4KTUA 1O3MA 2AGIX 4OS1A 1P2OA 1C5WB 2QAAA 2AS9A 4BNRA 1SR5C 1OWEA 5LPEA 1A0HB 2PSXA 4BOHA 1O36A 1AB9C 3BTTE 4X8UH 1EAUA 3FP6E 4I32A 3EGKH 4A1VA 5A8XA 1FDPA 3OY5U 4MQAA 2WINI 3ZZ4A 3O8CA 4YOJA 1C1OA 2F9NA 3A8AA 2VIVA 4IS5A 3ZVFA 1K1NA 1O3KA 1SGCA 2FP7B 3H7TA 1OYTH 4DVAU 4RSPA 1QFKH 1H9IE 3C1KA 4Y79A 1O2TA 2QY0B 2BQ7B 2J9NA 4NIYA 4CHAC 1A5GH 3ODDA 3VPKA 1DX5M 1EJNA 1O2MA 1Q2WA 2FMJA 1CT0E 2XWBI 1CU1A 1O5EH 1SVPA 1XXFA 4VGCB 3M5MA 1GMHG 3RXJA 1GG6C 1YP9A 3ZV9A 5K7RA 5EODA 5DK1A 5FCRA 1KXEA 2TRMA 5K0HA 4UD9H 1G3DA 3KQBA 3TGIE 3AW1A 4ABHA 2B9LA 4JZDH 2HVXA 1HPGA 4FUHA 1GHYH 3BV9B 2ZFQH 3DA9B 3IWMA 3UOUA 1Z8IB 4CBNA 2BY7X 2ZTYA 3RXTA 1WUNH 1GI4A 2G00A 1GJ7B 1Y5UT 2ZFSA 3E8LA 3MH7A 1ELBA 4K1EA 1ANDA 3FAOA 2ZGHA 1MKXK 1HLTH 3QZRA 1ZGVA 3LKWA 1ETRH 1PQAA 1HUTH 1KLTA 3EA8A 1SOTA 2GCHF 3SV9A 2VINA 3LC5A 1P0SH 1HAPH 3SO3A 4I8GA 2M5TA 1SC8U 1MKXH 3F9HA 5TCCA 1O3HA 4O97A 5EG4A 3SV7A 3RXUA 1FY8E 1EPTB 4I8KA 1BBRK 3STIA 2STBE 4BAHB 2H9HA 1SI5H 2GZ8A 1EZQA 1JIRA 1SQOA 1BQYA 3OSYA 4TWYA 4TPIZ 3STJA 4ABBA 1Z6EA 2QCYA 3UFAA 2CHAB 1DS2E 2JH5D 4DJZB 1V2PT 1BBRH 3UUZA 1ANEA 1TLDA 3U69H 4CRCA 1GI6A 4GHQA 1WV7H 2V3HH 1GVLA 2XW9A 3O8BA 1SLXB 4AB9A 4H4FA 3RC4A 1UCYK 2W3KA 2BM2A 4KP0A 4UE7H 1TPAE 1DY9A 3OU0A 1XUHA 3UNRA 1TMTH 1J8AA 1TRYA 2VJ1A 3LJOA 2R0KA 2W3IA 3M36A 1VGCB 1UVUH 3RXIA 2ZTZA 2FOHA 2BLWA 1UCYH 2P3TB 4D7GA 1V6DA 2FWWA 5E0GA 2FOMB 3ZYEA 4AFSA 3SQEE 1LQDB 3GY6A 1VJ9U 2BLOA 3BTME 3P8NA 3W94A 3NZIA 1UTQA 1HBTH 1P05A 3Q00A 1TX7A 1NRNH 3A7XA 1T4UH 3SN8A 3RXKA 2OLGA 2EA3A 4DIHH 4Y7BA 2GP9B 4I8LA 1IQIA 2QF3A 1TA2A 3EAJA 1DWDH 1FIWA 3AVZA 3TJNA 2QXIA 2IOTA 3BEIB 3SNAA 2TGAA 2D8WA 2O8MA 1AFQC 1O5DH 4KGAA 1IQLA 2ANKH 3MTYA 1UVPA 1PPEE 4WXVA 5E0HA 4DT7B 1ELFA 5DG6A 4JCNA 1P8VC 1GPZA 1NU9A 1C5VA 3QGJA 1QGFA 1RTFB 3ZVBA 3SJ8A 1WTGH 2FYRA 1N6YA 4DGJA 1GBJA 2BZ6H 1NN6A 3GY4A 4AOQA 5EPNA 3MYWA 1QBOA 1TNKA 1VCQA 1C5QA 3ITIA 1O3EA 2ANYA 1BMNH 4AN7A 4X2WA 2ZU5A 2J92A 5JDUB 2ZPQA 1HIAA 1EAWA 4FVBA 4X1NU 3GY2A 2IJOB 3RXDA 1FN6A 3RXHA 2PUXB 3PLKA 1ZJDA 3SUDA 1TGCA 1K1IA 1GHBG 1NTPA 1ZZZA 3R0FA 4FU8A 4A5TS 2A31A 2PFEA 4NSYA 3K2UA 1V2KT 1GDUA 1O35A 1M9UA 5FXLA 1QRZA 2HGTH 1L2EA 2H9TH 3ZZ3A 1O2GH 3BTKE 4CH2B 1TQ7B 1BHXB 1TFXA 1DDJA 2ZP0H 3MU1A 5A0BA 1S84A 3BG4C 2D2DA 5DP7A 4UFGH 2A5IA 2BLVA 1UTNA 4E05H 1GJ4H 2VWMA 1DFPA 1V2LT 3L6PA 2BMGB 1N1LA 4NIWA 4X8SH 3U1JB 1O5BB 1W8BH 2NWNA 2HNTF 4B2BA 4BTUB 1DOJA 1SGIB 1W0ZU 1SHHB 2P95A 2ZECA 5HXFA 3PB1E 4NZLA 4ZHAA 2VGCC 1G3BA 3A8DA 1C4Y2 2VWOA 1ZLRA 4LK4A 1YLDA 2FEQH 3SUEA 4AB8A 2QXGA 3HGNA 3LGIA 1LCYA 1RTKA 2FXRA 4F49A 2XBXA 3GCTF 1JRSA 1LTOA 1RXPA 4OS5A 2TGTA 2BY6X 1V2NT 2A7JA 2STAE 5GWZA 3ATIA 1MTWA 2QXJA 2B8OH 1SGFA 4NWKA 1LKAA 3P8OA 1FV9A 2ZIQH 1YBWA 1ABJH 1NT1A 3GCHC 3A7WA 1IQFA 4INLA 1GJDB 1YPHE 1D6RA 1VITG 1Y5BT 2NU4E 1WSSH 3SOSA 3SU2A 3ENSB 3H5CB 1MTVA 4YO9A 1HXFH 1LQEA 3Q3KA 1EASA 4NIXA 1GCTC 5FPTA 3SI4H 3FANA 3PMAB 7LPRA 2Y80A 4WMFA 1CQQA 1GDNA 3M37A 1QNJA 4LZ4B 4B74A 4MPVA 1IQKA 1Y3YA 1D4PB 1DY8A 1K9OE 1NPMA 4WY3A 5DP6A 1MKWK 3BF6H 3KQDA 1O32A 4CH8B 1EJAA 1BB0B 2F3CE 5B6OA 1G2MA 2GCTC 1BITA 4NCYA 2ASUB 5FCKA 4NA9H 3E91A 3B9FH 2A4RA 3RMOH 1Q3XA 1V2RT 2R3YA 4XE4A 1H8IH 3SJ9A 3ZZ6A 1OXGA 4YT7H 5LGOA 1ZYOA 1TBRH 3EDXB 1MKWH 2H5DA 1DXPA 5FHTA 5GPIB 1AVXA 3VEQB 1O31A 4NWLA 1UVSH 9ESTA 4KTSA 2QN5T 4Y6DA 1DM4B 4ZMAH 1HJAB 1GL1A 1C5RA 1TALA 5DJ7A 3U8RH 4XOJA 3AASA 1Y3XA 1BJVA 1ANBA 4E06H 1CE5A 4WH8A 2PUQH 3S9CA 2Q1JA 3RC5A 3VXFH 4X1SU 1A2CH 1WQVH 2OXSA 2FLBH 2NU3E 3RU4D 3UIRA 2C93B 1GI5A 1J17T 2ZHFH 4MVNA 3RLWH 3S69A 3P92A 5JYIA 1BHXF 2BB4A 1HCGA 2R9PA 4H6SB 1XVOA 2AMDA 1C1WH 1AZ8A 2Z6BD 5PTPA 2Y5HA 1BUIA 1P9SA 2GKVE 2LNCA 2CGAA 4XSKU 1BZXE 1O0DH 3UWJH 4ZXYH 2BD7A 1MQ6A 2HNTE 4DCDA 3WY8A 3C27B 1O5GH 3TU7H 8ESTE 1SG8B 2ZG0H 3RXAA 7GCHG 4CRAA 1Y3UA 3KN2A 1MCVA 4Q80A 1GBAA 3LONA 1DLEA 1CBWC 2OC7A 3ZYDA 3UNSA 2H6MA 2LPRA 2A2XH 4NFFA 4XFQA 2FIRH 1BTWA 1C5YB 2UUJB 1OWIA 1PPGE 3SV8A 3MU0A 1JRTA 3P17H 2BY5X 1LDTT 3FZZA 1TIOA 1O5FH 2A0QB 2WPJS 2GV6A 4X2YA 2J34A 5EW1H 4RKOB 3K6YA 1K21H 2THFB 2VVVA 3TH3H 3SGAE 1J15A 1D9IA 1SPJA 3FP8E 4GUXA 2OQ5A 1GJ9B 2GMTB 3T26A 2O9QA 3N7OA 1O3JA 2VGCB 3PM3A 2BDGA 2TGDA 2ZU4A 1F5LA 3TPIZ 3UWIA 2XC5A 1BTXA 4AFQA 3TK9A 2NU1E 1KDQB 3A85A 1P2MA 1AD8H 4ZROA 5AHGH 1IQGA 5BPEA 2J4IA 5T3HA 2G81E 2GV7A 1CT4E 1GJCB 3LPRA 4B75A 2XTTB 3GOVB 3DFJA 3LGVA 1P10A 4BTIB 2H1UA 1DPOA 1SGQE 1L1GA 2BD5A 3T29A 4UDWH 5L30H 3S9BA 4NIVA 2TBSA 3ZVEA 2G4TA 2ZEBA 1W11U 1SSXA 4AG1A 3QK1A 5JB9S 3TGJE 2ESTE 5I46H 1XMNB 1AHTH 3HKJB 1C5TA 1AFEH 2Z3CA 1ANCA 3PYHA 3B8JA 4U30A 1CA0C 2A4OA 2O8TA 1EPTA 4I7YH 2VB0A 3U8OH 1WOFA 3BIUH 1HNEE 3GY5A 1SGYE 4JMYA 2FTLE 4D9RA 1YPGH 2SNVA 4AX9H 1ZRBA 3BTHE 1OS8A 3SU5A 1GI0A 1Y5AT 1EB1H 4UFEH 2BD9A 2JH6D 1W13U 1HV7A 1TNGA 4GAWA 1AE8H 3QDZB 8KME2 5EW2H 1DSUA 2HLCA 1K1PA 2AYWA 4TYDA 3M5NA 4IC5A 2GCTB 4J1YA 3W95A 1YM0A 3M7TA 1QL8A 3MU4A 1XUJA 2Q6FA 2QV1A 2Z9LA 1HAXB 1P12E 1IQHA 2EI8A 2SGPE 3TH2H 3TK5A 1K22H 2EC9H 2ZGXH 2C8YB 1XKAC 1P2IA 3ZVGA 4Q7XA 4GCHF 4NFEA 2NU0E 5E8EH 6CHAC 4AGJA 4I31A 2Q6DA 2UUFB 5ESBA 1ELTA 2Z9JA 3RP2A 3U1IB 1TGTA 1UK2A 2VIWA 1C2JA 2ZPSA 2F91A 1RJXB 1MU8B 1KLIH 5HYOA 1BRCE 5AF9H 2ZFPH 5T6GA 1P04A 2FI5E 2Y5FA 4IMZA 4ABJA 3D62A 3ZZBA 5FAHA 1FAXA 1E0FD 3BN9A 1SFIA 4MPUA 1O3FA 2VNTA 1S82A 4TWWA 1SGFG 1D3DB 3RMNH 3T5FH 3A7YA 5H4IB 1A0LA 4HZHA 3V7TA 1QY6A 1BTUA 1TOMH 1BT7A 4ZAEA 1GHAG 1GMCG 4BAMB 1NU7B 4Q2KA 1GBTA 4NG9H 1AUJA 5EOKA 3DT0H 5EGMA 2Q6GA 3SU0A 2ZQ1A 2B0FA 2WYJA 1T31A
chains in the Genus database with same CATH superfamily
1W12U 1PPFE 3NPSA 2XCFA 1Z8RA 1NFXA 2Z9GA 3BSQA 3FKSD 1L0ZA 3ZZ5A 1D3QB 4TY6A 3T27A 3RU4E 1A46H 1V3XA 5JPMH 5L2YH 3MO9A 3DD2H 5JBCS 2H5CA 4FUBA 2F83A 3RXPA 1HFDA 1U6QA 3RXRA 1ZSJA 2YNAA 3ODFA 3SJKA 1TMUH 1C1SA 1HDTH 2IPHA 1GBHA 1UK4A 5DP5A 2GCHG 2PWXA 1EAIA 5C3NA 3O8DA 4HI3A 3QTVH 1ZMJA 4UONA 1V2JT 1AY6H 1O33A 1A5HA 2GX4A 2ALVA 3D65E 1J9CH 1ZHPA 1GMHF 1O2IA 1O38A 3N7EA 4O9VA 3FZDA 1GGDB 3A7VA 1BJUA 4ZHLU 1A61H 2PHBA 3PMHB 4LXBH 1LPZB 1P03A 3PMJA 1C5OH 3P8GA 2JETC 1OWJA 3UTUH 4I86A 5E2OA 4A92A 1OKXA 3VB7A 2KCPA 2QXHA 2WV5A 3A8BA 3ZZ8A 1YYY1 3H7OA 2BXTH 2FOCA 2P16A 3KHVA 1O2ZA 2FX6A 5IK2D 1ZGIA 2Y6TA 1F7ZA 3SU4A 3URDA 5EPYA 5C94A 3S9AA 3S0NA 3M7QA 2UWOA 3HPTB 1LHDH 4IC6A 5A8ZA 2SGEE 1JWTA 2A7CA 1SGTA 2HPPH 5C1XA 2VIPA 1J16A 2FZZA 1EKBB 1GMDG 2YNBA 1MTNC 1RRKA 1HAZB 3BTEE 2F9BH 5I25A 1TE0A 1DVAH 1ZJKA 2AH4X 2OBOA 3FVFB 1V2ST 1S6HA 4MPXA 5EQQA 3PO1C 2ODYB 1W10U 1QZ8A 2TGPZ 3ZVAA 1H9LB 4ABDA 1IHSH 2WV9A 2BXUH 5AFZH 1GHZA 4D8NA 4MNWA 1AIXH 1YCPH 3CENA 2Y5GA 2PKSB 3UB0A 2BDHA 1CT2E 4F55A 2WUBA 2PV9B 3EE0B 1O5AB 2BD3A 1BCUH 3MNXA 4FUJA 1LVOA 1PPCE 1Q31A 4WVPE 1GBFA 5BRRE 2A1DB 1UTJA 2WZQA 1O2WA 5FBIA 2TIOA 4ISNA 3A83A 4I8HA 1WCZA 2QF4A 3Q3XA 3LGUA 2W5EA 1QBVH 2FYQA 1B0FA 4GVUA 1EXFA 1AB9B 4I33A 1TPOA 4CBOA 1OWHA 3SV2H 1DLKB 1YPJH 1DWCH 5EXMA 1MTUA 1UVOA 1T8NA 3M3TA 5GIBA 1C2MA 3SZNA 3E16B 1P2QA 3SNCA 1G30B 3A8CA 4OGXA 1YF4A 4NZQA 2WYGA 4IMQA 2RA3A 2KAIB 2QA9E 3BTGE 1EP5A 1IOEA 2SGDE 3LGYA 1FMGA 3K9XB 2ZU3A 1OP0A 3KYGA 4YOGA 2WPIS 2ZC9H 3E90B 1QURH 4X6OA 2XNIA 4OS6A 5FBEA 1MZDA 3LJJA 3URCA 5EQSA 4CHAB 1DSTA 2G55A 1RFNA 1ELVA 3TNSA 8GCHG 1CGHA 1YKTA 4R0IA 3R3GB 1KYNA 2BQWB 2BDIA 1O3CA 2V3OH 2VH6A 3SNBA 1T32A 3SYJA 2PTNA 1XUKA 3PROA 3UAIC 1MBMA 2P8OC 1GG6B 5L6NH 2XNDD 2ZDKA 1N6XA 2OP9A 4Y76A 1TABE 2F9VA 5EJLA 1ZPCA 3TVJB 2AGGX 3B23B 4O03A 3ESTA 3UY9A 4AYVB 1HJ8A 2BZAA 1UTOA 2A45B 2G5NA 4JYTA 7KMEH 1HYLA 1TYNA 3OAAD 1T7CA 1THPB 4GHTA 4JK6A 5EXNA 5DP8A 4OM9A 2ZF0H 2UUKB 1ZTLA 1WU1A 1HAHH 5DO4H 4Y8XA 4DG4A 1ESBA 3TJUA 1ARCA 2WSSD 3QX5H 4GPGA 2AHME 1UK3A 4X8TH 3SGBE 2EI7A 3SHCH 3UQVA 2BDCA 4BAOB 2PTCE 1QHRB 4X1QU 1SQAA 1L1JA 3GY8A 2JKHA 1C5UA 3EA9A 1C1PA 5TCAA 4DIIH 4ACBA 1SLVB 1EAXA 1C5NH 5AVDA 1IQEA 1NRQH 2P93A 2BX4A 2DE9A 4WF8A 2G5VA 1AVGH 5C1YA 5EIYA 1H9HE 1UTMA 2R2WU 1C5XB 1G32B 3TJVA 3LOXA 1GHBF 4UEHH 3SQHE 3JZ1B 4WXIA 1H8ED 4ZKRU 3OE7D 3SORA 3UPEA 3HKIB 5HGGA 4ACAA 1F0TA 4NSVA 1QB9A 3DFLA 3ATLA 1A1RA 1C4U2 1AZZA 5DPAA 5HM9A 3SV6A 5G4BA 1P3EA 3ATKA 4JZIA 1A4WH 1BBRE 1NFWA 1ZPBA 1FPHH 2BDBA 4F4OC 2CF9H 4JYVH 1DITH 3MNBA 5T6FA 4Z1MD 6ESTA 4K60A 2VIQA 3AW0A 5GDSH 1BMAA 3SI3H 1KDQA 3IITA 2JH0D 5F03A 1YPMH 3VGCC 3ZZ9A 1F5KU 1GHVH 1O3OA 1EB2A 2J38A 3F3BA 3MI4A 4Y0YE 3MOCA 2KM0A 1P2KA 2ZPRA 1ELGA 1SGNE 2IPQX 3M5LA 2YMSB 3RXOA 2R0LA 3MFJA 2XWAA 2FI3E 3JZ2B 4R8TB 3DSPA 1L1NA 2JIZD 5KGOA 1BA8B 5C20A 3GY7A 1O2KA 1TBQH 3N7DA 1C9TA 1A3EH 1UCYE 3BTWE 6GCHG 5CDFE 1C4V2 1QIXB 1S81A 3MU5A 1C5SA 2BDAA 1FIZA 3L3TA 1BMLA 4ASUD 1QQ4A 1QR3E 3LT3A 1O2NA 1GJAB 2GT8A 2GD4B 2SGFE 4OGYA 2BHGA 2J94A 4A7IB 4ZUHA 2A4QA 4FUDA 4P02A 5J4SA 4Y7AA 3T28A 2FPZA 1GDQA 3LH1A 1SB1H 1ZHMA 2QF0A 1O5CB 4BXSA 5CE1A 1CA8B 4MNXA 1ZRKA 1O30A 2FS9A 3MO6A 1SFQB 4SGBE 3CS7A 1VITF 3W1EA 2WPKS 1NBMD 1YPKH 2EEKA 1AWFH 2XC4A 1RIWC 1W0KD 1UHBB 1WAYB 4Q7YA 2UWPA 3ZIAD 1C2IA 4AG2A 2BY9X 4WJG2 4K5ZA 3TH4H 4IN2A 1AFQB 3HATH 4JK5A 1QB1A 1QJ7B 1NZQH 2WPLS 1NC6A 1OX1A 1W14U 2R3UA 1QRWA 2FM2A 8LPRA 4YZUA 5F53A 3RXEA 4B2CA 1MD8A 1MQ5A 3KQ5A 1F0UA 5FPYA 5HM2A 1GBBA 5JBTA 2FOAA 2AMQA 2W26A 2ZFTA 4AFUA 1O3AA 3ATMA 3RXQA 2F9OA 3SHAH 3SNEA 2ZDNA 1V2OT 1PYTC 2VVCA 4B71A 5CHAC 3MH5A 1NESE 3OTPA 1AWHB 1GI8B 3ZV8A 2HALA 3EYDA 1C5PA 4YT6H 3VB5A 1TGNA 1NM6A 1VZQH 1TWXB 4X1RU 2G4UA 1LVYA 3RMLH 3AK5A 4HG6A 1RGQA 3EA7A 3PMBB 1K2I1 1DICA 1FLEE 1BTZA 5GCHG 1AO5A 4P00A 1EZSC 1CHOG 1O2YA 2QYIA 3MH6A 4YLUA 3SW2B 4AGKA 2OCVB 2V6NA 3KF2A 3TJOA 3LIWA 3FFGA 1AQ7A 4J2YB 1GBKA 4AC9A 1C2FA 1GJ6A 3M7UA 3AAVA 2CJIA 3SNDA 2ZHQH 4KELA 1TX8A 4CREA 1C1TA 4Q7ZA 4UFDH 1TNIA 3A87A 3BG4B 1XKBC 1N8OC 3GDUA 4ISLA 2XYAA 1PJPA 1GI7B 1G3EA 2IN2A 1GI9B 1Y3WA 4VGCC 1LPKB 3KCGH 2KZ4A 5IDKA 2PGQB 7GCHF 3RMMH 5DGJA 4FU9A 3SU6A 2PKAB 4X6NA 1W7GH 3BEUA 1DUEA 2ZFFH 5T1VA 1G37A 1B7XB 1FONA 3SBKA 1L4DA 1SMFE 1COWD 1D3TB 3A86A 3LH3A 1C9PA 1WBGB 2B5TB 1UTPA 3OTJE 4RN6A 1TNJA 1T8OA 1HAOH 1GBCA 1EFRD 1LMWB 4CRBA 9LPRA 5HMAA 1A7SA 2GVFA 4B1TA 3QWCH 1IQJA 3SGQE 2ZGJA 3ZZ7A 3U9AH 1QJ1B 4FXGH 2Z94A 1A0JA 1P3CA 1SQRA 3QUMP 4ZXXH 1P01A 3S7KB 6LPRA 3F2FA 3QN7A 1ELAA 1GI3A 3GCHB 2C3SA 1O2XA 5ETXA 1TAWA 1QL9A 1P11E 2RCEA 1Y3VA 1VR1H 7ESTE 1L4ZA 1TRMA 5C5NA 2F9PA 1LVMA 2KX4A 3MNSA 1XVMA 1X7AC 1C1QA 3EQ0H 3NCLA 1TRNA 1Z1IA 2ALPA 3FP7E 4ABFA 1GCTB 4INHA 1GHXH 3E0NB 4X6MA 2KFWA 1EPTC 5FPSA 1MU6B 1AKSB 1FY4A 1KTSB 1BDAA 3F6UH 4FU7A 2VWNA 4NGAH 5JB8S 3D49H 3P95A 3V3MA 3GYLB 1GBIA 2R2MB 2OINA 4YTAA 2CHAC 3ZVDA 2Y82A 3I29A 2GJGA 4ISHH 3PTNA 3CP7A 1GCDA 3UQOA 4CRGA 2ODPA 2CMYA 2Z3DA 1XUGA 2KR7A 1FJSA 2Z9KA 2ZI2H 2PLXA 3V0XA 3VFEA 4ABEA 4U32A 5AFYH 1GI2A 1ID5H 1KTTB 1AI8H 1C2LA 1YPEH 5LH8A 2FLRH 4O3UA 4Y10E 1NROH 1OYQA 1HAVB 2HOBA 1UTKA 4MNVA 4WMEA 2GT7A 3P70B 1C1RA 1ETSH 2BQ6B 3UR9A 1B5GH 2QIQA 2A4GA 1VGCC 2K0QA 1PQ5A 1O2VA 3V12A 1GVZA 4A1XA 2RDLA 4WH6A 2A32A 2BVSH 2BDYA 3GDSA 2Y7XA 2FOBA 2I6QA 4YESB 5CHAB 3RXGA 1LO6A 1BTHH 3PLPA 1O3IA 3A82A 4BTTB 4HGCA 1J14A 5HKKD 3TGKE 3VXEH 1B0EA 1KIGH 2J2UA 2AEIH 4FVDA 1KY9A 3PWCA 3F9GA 1ZTKA 3F68H 2NU2E 3MH4A 1EZXC 3I78A 2FOFA 1NBME 1O3PB 1O2JA 2BVRH 2ILNA 2KAIA 2WPMS 1MAYA 3S7HB 1ELDE 1DWBH 4DW2U 1D3PB 3MMGA 4M7GA 3M3VA 1ESTA 3MWIU 3ZZDA 1NS3A 1O3GA 4B76A 2BTCE 2VWLA 1K0HA 1SGRE 1HJ9A 3NWUA 4TY7A 4NA7A 1OSSA 1PYTD 1PFXC 1MTSA 3OY6U 2L6OA 1QJ6B 2BOHB 1G36A 3SU1A 4H6TA 1ESAA 1N8OB 3K6ZA 2C4FH 4ESTE 1K1OA 2OC0A 3T62A 1BRAA 1SLWB 1UVTH 3U28C 1Z7KA 1FUJA 1ZTJA 3Q77A 1QA0A 3RLYH 4Z0KA 2FESH 3A81A 1FQ3A 1GHAF 1GMCF 1GI1A 2OBQA 2XBVA 3RXSA 3RUOA 3ZZAA 3KQEA 1PQ8A 1CGIE 2F9UA 1IQNA 4MG3A 1THSH 2FTMA 1BMMH 1FZZA 3TITA 2HVYB 3HK3B 2KCOA 2ZHWH 1C5MD 1MMJN 1HRTH 4K3JA 1BTPA 1QA7A 4WWYA 2F4LA 2P94A 3LDXH 3ELAH 4OS7A 2YOLA 4YM9A 3BTFE 5IYTA 1O3NA 2UWLA 3E0PB 3VB6A 1C2KA 2G8TA 2H2ZA 4X8VH 4BAQB 2EQNA 2ZFRH 4D76A 3FOAA 1HAYB 1P02A 1P9UA 2Z3EA 3GDVA 1MD7A 1DE7H 1S5SA 3ZVCA 1D6WA 2AGEX 2OC1A 1SGPE 2BLQA 2HRVA 1C1NA 4OS4A 1EZUC 2VIOA 1A5IA 3RXVA 4QT8C 2ZDAH 1YLCA 4O3TA 1V2VT 1CHGA 1H1BA 1K1MA 1PPBH 1XUIA 3RXMA 1CA0B 3RXFA 5EXLA 1FN8A 5L2ZH 2C8WB 1WQSA 4MLFB 1YCPK 1THRH 1F0SA 1QRXA 1BOQA 2K1QA 1ZOMA 1SGEE 1C5LH 2V35A 2VU8E 2QE7D 4MPWA 3BTDE 2A7HA 1V2TT 2ODQA 3E6PH 2QGRA 3F1SB 1GJ5H 3M35A 1O2PA 2ZCHP 1EOJA 2Y7ZA 3A84A 3P8FA 1OPHB 1VCPA 2P3UB 1ZSLA 1YC0A 4KTCA 3BEFB 1EATA 1OP2A 4OS2A 2GGVB 4X2VA 3M61U 1GMDF 1OWDA 3LGWA 2GDEH 1AN1E 4HTCH 1RS0A 2ZGBH 3NK8A 4ISOA 1P57B 6CHAB 1C2HA 1H8DH 4YOIA 4TSFD 2V0BA 2ZGCA 1K1JA 2ZDVH 1LHCH 2BYAX 2FS8A 4E7RG 2F43B 3M3SA 5C1UA 1LVBA 3QZQA 5ESTE 2ZTXA 1IHTH 1DUAA 3Q3YA 1GL0E 1EJMA 4CR5A 1RTLA 1XX9A 1TONA 3SZEA 1CO7E 1YPLH 2OC8A 2VIDA 1SQTA 3F2GA 1HXEH 1QB6A 4Q4LA 2ANWA 3UNQA 1QTFA 4AZ2B 1AGJA 1UHBA 5C5OA 1TNHA 4X2XA 1H4WA 1KXBA 1PPHE 2HLDD 4MTBA 2ZHDA 2CXVA 3PWBA 4ABAA 5F8XA 2CN0H 4UFFH 2BVXH 1K1LA 1LPGB 2I6SA 2O8WA 3GCNA 1FI8A 1SL3A 4Y8ZA 3UOPA 5SGAE 1QCPA 5A2MH 2C8XB 2D26C 1TGSZ 5F8ZA 5GNDA 4RI0A 3RXLA 4DOQA 1HJAC 4IGDA 3MHWU 2Y81A 2ZCKP 3Q76A 5DP9A 1ZPZA 5LPFA 2OTVA 1ZMLA 1C1VH 1ZHRA 1ACBE 1UJ1A 1SGDE 2L74A 1V2QT 1SHYA 3RM2H 1NRRH 4FUFA 2FI4E 2BD2A 3GICB 3QO6A 1TOCB 2W7UA 2ZQ2A 1PPZA 1MAXA 4Y11E 1W2KH 1C1MA 5GJ4B 4LOYH 1C2EA 2VBCA 1Z8GA 1O2OA 2FO9A 2A5KA 1UTLM 2ZU2A 2ZA5A 2GZ9A 3CS0A 4FUCA 4HFPB 1XXDA 2ULLA 1TGBA 2ZNKH 1GVKB 1V2UT 3I77A 4ZKSU 1FX0B 1WYKA 4ABGA 5B6LA 8GCHF 3TIUA 3P6ZB 2KCAA 4GSOA 3L33A 5C2ZA 2GDDA 1LHGH 3HK6B 3VG8A 3PLBA 1G3CA 4JYUH 2WPHS 4BXWA 1GBDA 4AYYB 1FAKH 1HGTH 2CF8H 5A8YA 1QBNA 1GJ8B 4X6PA 4H42U 1MH0A 4ISIH 4B6FA 4D9QA 1C5ZB 3T25A 1JXPA 3AAUA 3NKKA 1ZMNA 2JETB 1BRUP 4K8YA 5DP4A 3KEEA 3GCTG 1IAUA 1T8LA 3A88A 1FXYA 1GJBB 3GY3A 4WMDA 1HAIH 5KEDA 3RM0H 1VKYA 3KL6A 1TBZH 4I8JA 4GLYA 4K8BA 4XDEA 3GYMA 1FY3A 4PROA 5C67A 3GCOA 2ZO3H 1YY3A 4CRFA 1E37B 1W3CA 3F9FA 2G52A 2ZZUH 3F9EA 3PV4A 3PRDA 2OD3B 1QL7A 2FOGA 5J4QA 2PKAA 1SBWA 4Y71A 1F2SE 1S6FA 3E3TA 1O39A 3KGPA 3V13A 1EOLA 1T4VH 3NRLA 2GMTC 1MTNB 1TX6A 1NRSH 3RC6A 5E2PA 5A0AE 2PR3A 3ATWA 1INCA 4ZCNA 3PO1B 1E38B 1NO9H 1ZSKA 1CSOE 1F92A 1HAGE 1VJAU 1NFYA 2AERH 2RG3A 4RT1A 1QQUA 1RD3B 2DUCA 4AORA 1O2QA 4XBCA 3TNTA 4Q63A 1TNLA 4ZKOU 2O8LA 2EI6A 1V2MT 3QGNB 1E36B 1A3BH 3SU3A 2QC2A 3EE7A 2GTBA 2BY8X 2ZKSA 1C1UH 1O37A 2OQUA 2XBWA 3A80A 2XXLA 1ORFA 2PSYA 4B73A 1NY22 1OWKA 1UMAH 3SJIA 2RA0A 2SNWA 3DSOA 4U2WA 1AMHA 1MCTA 4FUGA 1OP8A 2BX3A 3U98H 3RXCA 1VITH 5A09A 1AKSA 2B7DH 1AU8A 2FODA 2JDID 1PQ7A 5LPRA 4CRDA 1ARBA 1Z71A 5DP3A 4K69A 1E35B 5T6DA 4ZKNU 1UO6A 3M5OA 2P59A 1TA6A 4KKDA 6GCHF 1CVWH 4X1PU 2FX4A 3RXBA 3QTOH 1JBUH 2Z9IA 1Y59T 1DXWA 1BMFD 3DUXH 3UREA 3K65B 3TK6A 1GWAA 2XCNA 2ZCLP 1GBEA 4XBDA 3VB3A 4JZ1A 1C2GA 1E1QD 1WTHD 3A7TA 1BIOA 3LC3A 4IN1A 1DANH 3NUMA 3PV5A 1F5RA 1EQ9A 4B2AA 4LZ1H 1YCPM 1HAVA 2VVUA 1TPPA 1EP6A 2XBYA 3TLOA 2AFQB 4IW4E 1O2RA 1Z6JH 3ZZCA 4Z6AH 1O2UA 2ZDLA 2G51A 3NXPA 1KSNA 1G9IE 1MZAA 1W0JD 2ZWLH 2P8OB 2FDAA 1TQ0B 4TT3D 2OUAA 2C90B 1O3BA 1GBMA 3SUFA 1O2SA 4THNH 1HIAB 5JBBS 4ZH8A 5A0CA 5JBAS 2AMPA 2XRCA 2HPQH 1EX3A 1MUEB 1MBQA 2J98B 2C8ZB 2WUCA 3CNRA 4SGAE 4ASHA 2A5AA 4K2YA 3BIVH 2ZU1A 3BTQE 1EUFA 2UUYA 1E34B 1OHHD 2TPIZ 1YWUA 1NFUA 2SGQE 2W6JD 4IBLH 1K28D 1DWEH 1FNIA 1LHEH 1LHFH 1WDIA 3F2HA 1FY1A 1OOKB 2W7SA 3KNXA 1BRBE 5F6MA 5CMXH 1AE5A 1AVWA 1IQMA 2A2QH 1O3DA 5GXPA 1Z8JB 1TPSA 1YPHC 2BD8A 2FOEA 1C2DA 3A89A 4BANB 5GCHF 2D1JA 2LP6A 3IG6B 1AUTC 2DE8A 1SOZA 1TB6H 4U01A 1CHOF 1YGCH 2GZ7A 4Y0ZE 3BG8A 1S0RA 3E1XB 4AFZA 5DN6D 3OX7U 1ZR0A 2H9EH 3U8TH 4JZFH 4DURA 4INKA 1DT2A 1Y8TA 1W7XH 1Z1JA 1P09A 2Z7FE 1KLJH 2ANMH 3QLPH 5ABWA 1O2HA 2CK3D 2CV3A 3KIDU 2P3FH 4M9FA 3PTBA 3GISB 4FETA 2SGAA 3VGCB 5DKMA 1CBWB 1JMOH 1SLUB 1P06A 4E7NA 3RDZA 3SJOA 1GGDC 4FUIA 1S0QA 2BD4A 2AIQA 3RU4T 2ZDMA 1JIMA 1CGJE 4BAKB 1P2NA 2O8UA 2BOKA 3HGPA 5FX5A 2HWLB 4A1TA 5C0UA 4MDSA 3KQCA 3DHKH 3LU9B 5FX6A 4CR9A 3MO3A 1G2LA 1VCWA 1ETTH 1KXFA 2VH0A 4K1TA 4RKJB 2WV4A 4TPYA 2J95A 2PGBB 1XM1A 3OFND 3LGTA 1ABIH 1BTYA 5EQRA 1FY5A 1HB0B 4YLQH 3O8RA 2ZHEH 3F0PA 3A7ZA 4DY7B 1S83A 1TMBH 1S85A 3MNCA 4XBBA 4Y8YA 3D23A 1KXAA 4MNYA 2AIPA 1F0RA 1FPCH 2XC0A 4JZEH 1O2LA 3UR6A 4NA8A 4ABIA 1JOUB 1V2WT 4K1SA 3VB4A 4GCHG 1NRPH 5EU8A 1KXDA 1KXCA 1O3LA 4X0WU 5E0JA 1ELCA 1W0YH 1E1RD 3MU8A 1RIWB 2SFAA 1XUFA 1H8HD 2PW8H 5TJXA 2HNTC 3T2NA 3SUGA 5F8TA 1ELEE 1T8MA 1O34A 3G01A 1P2JA 2PKSC 1GBLA 3OYPA 1LKBA 4A6LA 4D7FA 4ZHMU 4FUEA 1GHWH 4KTUA 1O3MA 2AGIX 4OS1A 1P2OA 1C5WB 2QAAA 2AS9A 4BNRA 1SR5C 2J5UA 1OWEA 5LPEA 1A0HB 2PSXA 4BOHA 1O36A 4B6EA 1AB9C 3BTTE 4X8UH 1EAUA 3FP6E 4I32A 3PV2A 3EGKH 4A1VA 5A8XA 1FDPA 3OY5U 3WWBA 4MQAA 2WINI 3ZZ4A 3O8CA 4YOJA 1C1OA 2F9NA 3A8AA 2VIVA 4IS5A 3ZVFA 1K1NA 1O3KA 1SGCA 2FP7B 3H7TA 1OYTH 4DVAU 4RSPA 1QFKH 1H9IE 3C1KA 4Y79A 1O2TA 2QY0B 2BQ7B 2J9NA 4NIYA 4CHAC 1A5GH 3ODDA 3VPKA 1DX5M 1EJNA 2LELA 2WPDD 1O2MA 1Q2WA 2FMJA 1CT0E 2XWBI 1CU1A 1O5EH 1SVPA 1XXFA 4VGCB 3M5MA 1GMHG 3RXJA 1GG6C 1YP9A 3ZV9A 5EJ1A 5K7RA 5EODA 5DK1A 5FCRA 1KXEA 2TRMA 3N99A 5K0HA 4UD9H 1G3DA 3KQBA 3TGIE 3AW1A 4ABHA 2B9LA 4JZDH 2HVXA 1HPGA 4FUHA 1GHYH 3BV9B 2ZFQH 3DA9B 3IWMA 3UOUA 1Z8IB 4CBNA 2BY7X 2ZTYA 3RXTA 1WUNH 1GI4A 2G00A 1GJ7B 1Y5UT 2ZFSA 3E8LA 3MH7A 1ELBA 4K1EA 1ANDA 3FAOA 2ZGHA 1MKXK 5HIYA 1HLTH 3QZRA 1ZGVA 3LKWA 1ETRH 1PQAA 1HUTH 1KLTA 3EA8A 1SOTA 2GCHF 3SV9A 2VINA 3LC5A 1E79D 1P0SH 1HAPH 3SO3A 4I8GA 2M5TA 3WW7A 1SC8U 1MKXH 3F9HA 5TCCA 3OEHD 1O3HA 4O97A 5EG4A 3SV7A 3RXUA 1FY8E 1EPTB 4I8KA 1BBRK 4FOUC 3STIA 2STBE 4BAHB 2H9HA 1SI5H 2GZ8A 1EZQA 1JIRA 1SQOA 1BQYA 3OSYA 4TWYA 4TPIZ 3STJA 4ABBA 1Z6EA 2QCYA 3UFAA 2CHAB 1DS2E 2JH5D 4DJZB 1V2PT 1BBRH 3UUZA 1ANEA 1TLDA 3U69H 4CRCA 1GI6A 4GHQA 1WV7H 4F48B 2V3HH 1GVLA 2XW9A 3O8BA 1SLXB 2YMSC 4AB9A 4H4FA 3RC4A 1UCYK 2W3KA 2BM2A 4KP0A 4UE7H 1TPAE 1DY9A 3OU0A 1XUHA 3UNRA 1TMTH 1J8AA 1TRYA 2VJ1A 3LJOA 2R0KA 2W3IA 3M36A 1VGCB 1UVUH 3RXIA 2ZTZA 2FOHA 2BLWA 1UCYH 2P3TB 1WXRA 4D7GA 1V6DA 2FWWA 5E0GA 2FOMB 3ZYEA 4AFSA 3SQEE 1LQDB 5FL7D 2XOKD 3GY6A 1VJ9U 2BLOA 3BTME 3P8NA 3W94A 2K8IA 3NZIA 1UTQA 1HBTH 1P05A 3PRBA 2EY4C 3Q00A 1TX7A 1NRNH 3A7XA 1T4UH 3SN8A 3RXKA 2OLGA 2EA3A 4DIHH 4Y7BA 2GP9B 4I8LA 1IQIA 2QF3A 1TA2A 3EAJA 2JJ1D 1DWDH 1FIWA 3AVZA 3TJNA 2QXIA 2IOTA 3BEIB 3SNAA 2TGAA 2D8WA 2O8MA 1AFQC 1O5DH 4KGAA 1IQLA 2ANKH 3MTYA 1UVPA 1PPEE 4WXVA 5E0HA 4DT7B 1ELFA 2QF5A 5DG6A 4JCNA 1P8VC 1GPZA 1NU9A 1C5VA 3QGJA 1QGFA 1RTFB 3ZVBA 3SJ8A 1WTGH 2FYRA 2IJD1 1N6YA 4DGJA 1GBJA 2BZ6H 1NN6A 3GY4A 4AOQA 5EPNA 3MYWA 1QBOA 1TNKA 1VCQA 3GS9A 4DT4A 1C5QA 3ITIA 1O3EA 2ANYA 1BMNH 4AN7A 4X2WA 2ZU5A 2J92A 3MQKC 5JDUB 2ZPQA 1HIAA 1EAWA 4FVBA 4X1NU 3GY2A 2IJOB 3RXDA 1FN6A 3RXHA 2PUXB 3PLKA 1ZJDA 3SUDA 1TGCA 1K1IA 2J98A 1GHBG 1NTPA 1ZZZA 3R0FA 4FU8A 4A5TS 2A31A 2PFEA 4NSYA 3H09A 3K2UA 1V2KT 3DCLA 1GDUA 1O35A 1M9UA 5FXLA 1QRZA 3FO8D 2HGTH 1L2EA 2H9TH 3ZZ3A 1O2GH 2PP6A 3BTKE 4CH2B 1TQ7B 1BHXB 1TFXA 1DDJA 2ZP0H 3MU1A 5A0BA 1S84A 3BG4C 1MABB 2D2DA 5DP7A 4UFGH 2A5IA 2BLVA 1UW7A 1UTNA 4E05H 1GJ4H 2VWMA 1DFPA 1V2LT 3L6PA 2BMGB 1N1LA 4NIWA 4X8SH 3U1JB 1O5BB 1W8BH 2NWNA 2HNTF 4B2BA 4BTUB 1DOJA 1SGIB 1W0ZU 1SHHB 2P95A 2ZECA 5HXFA 3PB1E 4NZLA 4ZHAA 2VGCC 1G3BA 3A8DA 1C4Y2 2VWOA 1ZLRA 4LK4A 1YLDA 2FEQH 3SUEA 4AB8A 2QXGA 3HGNA 3LGIA 1LCYA 1RTKA 2FXRA 4F49A 2XBXA 3GCTF 1JRSA 1LTOA 1RXPA 1YLNA 4OS5A 5DSFA 2TGTA 2BY6X 1V2NT 2A7JA 2STAE 5GWZA 3ATIA 1MTWA 2QXJA 2B8OH 1SGFA 4NWKA 1LKAA 3P8OA 1FV9A 2ZIQH 1YBWA 1ABJH 1NT1A 3GCHC 3A7WA 1IQFA 4INLA 1GJDB 1YPHE 1D6RA 1VITG 1Y5BT 2NU4E 1WSSH 3SOSA 3SU2A 3ENSB 3H5CB 1MTVA 4YO9A 1HXFH 1LQEA 3Q3KA 1EASA 4NIXA 1GCTC 3FN8A 5FPTA 3SI4H 3FANA 3PMAB 7LPRA 2Y80A 4WMFA 1CQQA 1GDNA 3M37A 1QNJA 4LZ4B 4B74A 1S6LA 4MPVA 1IQKA 1Y3YA 1D4PB 1DY8A 1K9OE 1NPMA 4WY3A 5DP6A 1MKWK 3BF6H 3KQDA 1O32A 4CH8B 1EJAA 1BB0B 2F3CE 5B6OA 1G2MA 2GCTC 1BITA 4NCYA 2ASUB 2YMSD 5FCKA 4NA9H 3E91A 3B9FH 2A4RA 3RMOH 1Q3XA 1V2RT 2R3YA 4XE4A 1H8IH 3SJ9A 3ZZ6A 1OXGA 4YT7H 5LGOA 1ZYOA 1TBRH 3EDXB 1MKWH 2H5DA 1DXPA 5FHTA 5GPIB 1AVXA 3VEQB 1O31A 4NWLA 1UVSH 9ESTA 4KTSA 2QN5T 4Y6DA 1DM4B 4ZMAH 1HJAB 1GL1A 1C5RA 1TALA 5DJ7A 3U8RH 4XOJA 3AASA 1Y3XA 1BJVA 1ANBA 4E06H 1CE5A 4XRNA 4WH8A 2PUQH 3S9CA 2Q1JA 3RC5A 3VXFH 4X1SU 1A2CH 1WQVH 2OXSA 2FLBH 2NU3E 3RU4D 3UIRA 2C93B 1GI5A 1J17T 2ZHFH 4MVNA 3RLWH 3S69A 3P92A 5JYIA 1BHXF 2BB4A 1HCGA 2R9PA 4H6SB 1XVOA 2AMDA 1C1WH 1AZ8A 2Z6BD 5PTPA 2Y5HA 1BUIA 1P9SA 2GKVE 2LNCA 2CGAA 4XSKU 1BZXE 1O0DH 5EJZA 3UWJH 4ZXYH 2BD7A 1MQ6A 2HNTE 4DCDA 3WY8A 3C27B 1O5GH 3TU7H 8ESTE 1SG8B 2ZG0H 3RXAA 7GCHG 4CRAA 1Y3UA 3KN2A 1MCVA 4Q80A 1GBAA 3LONA 1DLEA 1CBWC 2OC7A 3ZYDA 3UNSA 2H6MA 2LPRA 2A2XH 4NFFA 3OEED 4XFQA 2FIRH 1BTWA 1C5YB 2UUJB 1OWIA 1PPGE 3SV8A 3MU0A 1JRTA 1SKYE 3P17H 4RT0A 2BY5X 1LDTT 3FZZA 1KMHB 1O5FH 1TIOA 2A0QB 2WPJS 2GV6A 4X2YA 2J34A 5EW1H 4RKOB 3K6YA 1K21H 2THFB 2VVVA 3TH3H 3SGAE 1J15A 1D9IA 1SPJA 3FP8E 4GUXA 2OQ5A 3DSGA 1GJ9B 2GMTB 3T26A 2O9QA 3N7OA 1O3JA 2VGCB 3PM3A 2BDGA 2TGDA 4YXWD 5HIZA 2ZU4A 1F5LA 3TPIZ 3UWIA 2XC5A 1BTXA 4AFQA 3TK9A 2NU1E 1KDQB 3A85A 1P2MA 1AD8H 4ZROA 5AHGH 1IQGA 5BPEA 2J4IA 5T3HA 2G81E 2GV7A 2V3MA 2J97A 1CT4E 1GJCB 3LPRA 4B75A 2XTTB 3GOVB 2RDEA 3DFJA 3LGVA 1P10A 4BTIB 2M2AA 2H1UA 1DPOA 1SGQE 2V7QD 1L1GA 2BD5A 3T29A 2JJ2D 4UDWH 5L30H 3KYFA 3S9BA 4NIVA 2TBSA 3ZVEA 2G4TA 2ZEBA 1W11U 1SSXA 4AG1A 3QK1A 5JB9S 3TGJE 2ESTE 5I46H 1XMNB 1AHTH 3HKJB 1C5TA 2W6ID 1AFEH 2Z3CA 1ANCA 3PYHA 3B8JA 4U30A 1CA0C 2A4OA 1EPTA 2O8TA 4I7YH 2VB0A 3U8OH 1WOFA 3BIUH 1HNEE 3GY5A 1SGYE 4JMYA 2RFKC 2FTLE 4D9RA 1YPGH 2SNVA 4AX9H 2WHXA 1ZRBA 3BTHE 1OS8A 3F0OA 3SU5A 1GI0A 1Y5AT 1EB1H 4UFEH 2BD9A 2JH6D 1W13U 1HV7A 1TNGA 4GAWA 1AE8H 3QDZB 8KME2 5EW2H 1DSUA 2HLCA 1K1PA 2AYWA 4TYDA 3M5NA 4IC5A 2GCTB 2KCYA 4J1YA 3W95A 1YM0A 3M7TA 1QL8A 3MU4A 1XUJA 2Q6FA 2QV1A 2Z9LA 1HAXB 1P12E 1IQHA 2EI8A 2SGPE 3TH2H 3TK5A 1K22H 2EC9H 2ZGXH 2C8YB 1XKAC 1P2IA 3ZVGA 4Q7XA 4GCHF 4NFEA 2NU0E 4XD7D 5E8EH 6CHAC 4AGJA 4I31A 2Q6DA 2UUFB 5ESBA 1ELTA 2Z9JA 3RP2A 3U1IB 1TGTA 1UK2A 2VIWA 1C2JA 2ZPSA 2F91A 1RJXB 1MU8B 1KLIH 5HYOA 1BRCE 5AF9H 2ZFPH 5T6GA 1P04A 2FI5E 2Y5FA 4IMZA 4ABJA 3D62A 3ZZBA 5FAHA 1FAXA 1E0FD 3BN9A 1SFIA 4MPUA 1O3FA 2VNTA 1S82A 4TWWA 5C17A 1SGFG 1D3DB 3RMNH 3T5FH 3A7YA 5H4IB 1A0LA 4HZHA 3V7TA 3WWFA 1QY6A 1BTUA 1TOMH 1BT7A 5CHBA 4ZAEA 1GHAG 1GMCG 4BAMB 1NU7B 4Q2KA 1GBTA 4NG9H 1AUJA 5EOKA 3DT0H 5EGMA 5KECA 5C0TA 2Q6GA 3SU0A 2ZQ1A 2B0FA 2WYJA 2OK5A 1T31A
chains in the Genus database with same CATH topology
1W12U 1PPFE 3NPSA 2XCFA 1Z8RA 1NFXA 2Z9GA 3BSQA 1L0ZA 3ZZ5A 1D3QB 4TY6A 3T27A 3RU4E 1A46H 1V3XA 5JPMH 5L2YH 3MO9A 3DD2H 5JBCS 2H5CA 4FUBA 2F83A 3RXPA 1HFDA 1U6QA 3RXRA 1ZSJA 2YNAA 3ODFA 3SJKA 1TMUH 1C1SA 1HDTH 2IPHA 1GBHA 1UK4A 5DP5A 2GCHG 2PWXA 1EAIA 5C3NA 3O8DA 4HI3A 3QTVH 1ZMJA 4UONA 1V2JT 1AY6H 1O33A 1A5HA 2GX4A 2ALVA 3D65E 1J9CH 1ZHPA 1GMHF 1O2IA 1O38A 4O9VA 3FZDA 1GGDB 3A7VA 1BJUA 4ZHLU 1A61H 2PHBA 3PMHB 4LXBH 1LPZB 1P03A 3PMJA 1C5OH 3P8GA 2JETC 1OWJA 3UTUH 5E2OA 4A92A 1OKXA 3VB7A 2QXHA 2WV5A 3A8BA 3ZZ8A 1YYY1 3H7OA 2BXTH 2FOCA 2P16A 3KHVA 1O2ZA 2FX6A 1ZGIA 2Y6TA 1F7ZA 3SU4A 3URDA 5EPYA 3S9AA 3S0NA 3M7QA 2UWOA 3HPTB 1LHDH 4IC6A 5A8ZA 2SGEE 1JWTA 2A7CA 1SGTA 2HPPH 5C1XA 2VIPA 1J16A 2FZZA 1EKBB 1GMDG 2YNBA 1MTNC 1RRKA 1HAZB 3BTEE 2F9BH 5I25A 1TE0A 1DVAH 1ZJKA 2AH4X 2OBOA 3FVFB 1V2ST 1S6HA 4MPXA 5EQQA 3PO1C 2ODYB 1W10U 2TGPZ 3ZVAA 1H9LB 4ABDA 1IHSH 5AFZH 2BXUH 4D8NA 1GHZA 4MNWA 1AIXH 1YCPH 3CENA 2Y5GA 2PKSB 2BDHA 1CT2E 2WUBA 2PV9B 3EE0B 1O5AB 2BD3A 1BCUH 3MNXA 4FUJA 1LVOA 1PPCE 1Q31A 4WVPE 1GBFA 5BRRE 2A1DB 1UTJA 5FBIA 1O2WA 2TIOA 4ISNA 3A83A 4I8HA 1WCZA 3Q3XA 3LGUA 2W5EA 1QBVH 2FYQA 1B0FA 4GVUA 1EXFA 1AB9B 4I33A 1TPOA 4CBOA 1OWHA 3SV2H 1DLKB 1YPJH 1DWCH 5EXMA 1MTUA 1UVOA 1T8NA 3M3TA 5GIBA 1C2MA 3SZNA 3E16B 1P2QA 3SNCA 1G30B 3A8CA 4OGXA 1YF4A 4NZQA 2WYGA 4IMQA 2RA3A 2KAIB 2QA9E 3BTGE 1EP5A 1IOEA 2SGDE 3LGYA 1FMGA 3K9XB 2ZU3A 1OP0A 4YOGA 2WPIS 2ZC9H 3E90B 1QURH 4X6OA 2XNIA 4OS6A 5FBEA 1MZDA 3LJJA 3URCA 5EQSA 4CHAB 1DSTA 2G55A 1RFNA 1ELVA 3TNSA 8GCHG 1CGHA 1YKTA 4R0IA 3R3GB 1KYNA 2BQWB 2BDIA 1O3CA 2V3OH 2VH6A 3SNBA 1T32A 2PTNA 1XUKA 3PROA 1MBMA 2P8OC 1GG6B 5L6NH 2ZDKA 1N6XA 2OP9A 4Y76A 1TABE 2F9VA 1ZPCA 3TVJB 2AGGX 3B23B 4O03A 3ESTA 3UY9A 4AYVB 1HJ8A 2BZAA 1UTOA 2A45B 2G5NA 4JYTA 7KMEH 1HYLA 1TYNA 1T7CA 1THPB 4GHTA 4JK6A 5EXNA 5DP8A 2ZF0H 2UUKB 1ZTLA 1WU1A 1HAHH 5DO4H 4Y8XA 4DG4A 1ESBA 3TJUA 1ARCA 3QX5H 4GPGA 4X8TH 1UK3A 3SGBE 3UQVA 2EI7A 3SHCH 2BDCA 4BAOB 2PTCE 1QHRB 4X1QU 1SQAA 1L1JA 3GY8A 2JKHA 1C5UA 3EA9A 1C1PA 5TCAA 4DIIH 1SLVB 1EAXA 1C5NH 5AVDA 1IQEA 1NRQH 2P93A 2BX4A 2DE9A 4WF8A 2G5VA 1AVGH 5C1YA 1H9HE 1UTMA 2R2WU 1C5XB 1G32B 3TJVA 3LOXA 1GHBF 4UEHH 3SQHE 3JZ1B 4WXIA 4ZKRU 3SORA 3UPEA 3HKIB 5HGGA 1F0TA 4NSVA 1QB9A 3DFLA 3ATLA 1A1RA 1C4U2 1AZZA 5DPAA 5HM9A 3SV6A 5G4BA 1P3EA 3ATKA 4JZIA 1A4WH 1BBRE 1NFWA 1ZPBA 1FPHH 2BDBA 4F4OC 2CF9H 4JYVH 1DITH 3MNBA 5T6FA 6ESTA 4K60A 2VIQA 3AW0A 5GDSH 1BMAA 3SI3H 1KDQA 3IITA 2JH0D 5F03A 1YPMH 3VGCC 3ZZ9A 1F5KU 1GHVH 1O3OA 1EB2A 2J38A 3MI4A 4Y0YE 3MOCA 1P2KA 2ZPRA 1ELGA 1SGNE 3M5LA 3RXOA 2R0LA 3MFJA 2XWAA 2FI3E 3JZ2B 4R8TB 1L1NA 5C20A 1BA8B 3GY7A 1O2KA 1TBQH 6GCHG 1C9TA 1A3EH 1UCYE 3BTWE 1C4V2 1QIXB 1S81A 3MU5A 1C5SA 2BDAA 1FIZA 3L3TA 1BMLA 1QQ4A 1QR3E 3LT3A 1O2NA 1GJAB 2GT8A 2GD4B 2SGFE 4OGYA 2BHGA 2J94A 4A7IB 4ZUHA 2A4QA 4FUDA 5J4SA 4Y7AA 3T28A 2FPZA 1GDQA 3LH1A 1SB1H 1ZHMA 2QF0A 1O5CB 4BXSA 5CE1A 1CA8B 4MNXA 1ZRKA 1O30A 2FS9A 3MO6A 1SFQB 4SGBE 3CS7A 1VITF 2WPKS 1YPKH 2EEKA 1AWFH 2XC4A 1RIWC 1UHBB 1WAYB 4Q7YA 2UWPA 1C2IA 4AG2A 2BY9X 4WJG2 4K5ZA 3TH4H 4IN2A 1AFQB 3HATH 4JK5A 1QB1A 1QJ7B 1NZQH 2WPLS 1NC6A 1OX1A 1W14U 2R3UA 1QRWA 2FM2A 8LPRA 4YZUA 3RXEA 4B2CA 1MD8A 1MQ5A 1F0UA 5FPYA 5HM2A 1GBBA 5JBTA 2FOAA 2AMQA 2W26A 2ZFTA 4AFUA 1O3AA 3ATMA 3RXQA 2F9OA 3SHAH 3SNEA 2ZDNA 1V2OT 1PYTC 2VVCA 4B71A 5CHAC 3MH5A 1NESE 1AWHB 1GI8B 3ZV8A 2HALA 3EYDA 1C5PA 4YT6H 3VB5A 1TGNA 1NM6A 1VZQH 1TWXB 4X1RU 2G4UA 1LVYA 3RMLH 1RGQA 3EA7A 3PMBB 1K2I1 1DICA 1FLEE 1BTZA 5GCHG 1AO5A 1EZSC 1CHOG 1O2YA 2QYIA 3MH6A 4YLUA 3SW2B 4AGKA 2OCVB 2V6NA 3KF2A 3TJOA 3LIWA 3FFGA 1AQ7A 4J2YB 1GBKA 1C2FA 1GJ6A 3M7UA 3AAVA 2CJIA 3SNDA 2ZHQH 4KELA 1TX8A 4CREA 1C1TA 4Q7ZA 4UFDH 1TNIA 3A87A 3BG4B 1XKBC 1N8OC 3GDUA 4ISLA 2XYAA 1PJPA 1GI7B 1G3EA 2IN2A 1GI9B 1Y3WA 4VGCC 1LPKB 3KCGH 5IDKA 2PGQB 7GCHF 3RMMH 5DGJA 4FU9A 3SU6A 2PKAB 4X6NA 1W7GH 3BEUA 1DUEA 2ZFFH 1G37A 1B7XB 1FONA 3SBKA 1L4DA 1SMFE 1D3TB 3A86A 3LH3A 1C9PA 1WBGB 2B5TB 1UTPA 3OTJE 4RN6A 1TNJA 1T8OA 1HAOH 1GBCA 1LMWB 4CRBA 9LPRA 5HMAA 1A7SA 2GVFA 4B1TA 3QWCH 1IQJA 3SGQE 2ZGJA 3ZZ7A 3U9AH 1QJ1B 4FXGH 2Z94A 1A0JA 1P3CA 3QUMP 4ZXXH 1P01A 3S7KB 6LPRA 3QN7A 1ELAA 1GI3A 3GCHB 2C3SA 1O2XA 5ETXA 1TAWA 1QL9A 1P11E 2RCEA 1Y3VA 1VR1H 7ESTE 1L4ZA 1TRMA 5C5NA 2F9PA 1LVMA 3MNSA 1XVMA 1X7AC 1C1QA 3EQ0H 3NCLA 1TRNA 1Z1IA 2ALPA 3FP7E 4ABFA 1GCTB 4INHA 1GHXH 3E0NB 4X6MA 1EPTC 5FPSA 1MU6B 1AKSB 1FY4A 1KTSB 1BDAA 3F6UH 4FU7A 2VWNA 4NGAH 5JB8S 3D49H 3P95A 3V3MA 3GYLB 1GBIA 2R2MB 2OINA 4YTAA 2CHAC 3ZVDA 2Y82A 3I29A 4ISHH 3PTNA 3CP7A 1GCDA 3UQOA 4CRGA 2ODPA 2CMYA 2Z3DA 1XUGA 2ZI2H 1FJSA 2Z9KA 3V0XA 2PLXA 3VFEA 4ABEA 4U32A 5AFYH 1GI2A 1ID5H 1KTTB 1AI8H 1C2LA 1YPEH 5LH8A 2FLRH 4O3UA 4Y10E 1NROH 1OYQA 1HAVB 2HOBA 1UTKA 4MNVA 4WMEA 2GT7A 3P70B 1C1RA 1ETSH 2BQ6B 3UR9A 1B5GH 2QIQA 2A4GA 1VGCC 1PQ5A 1O2VA 3V12A 1GVZA 4A1XA 2RDLA 4WH6A 2A32A 2BVSH 2BDYA 3GDSA 2Y7XA 2FOBA 2I6QA 4YESB 5CHAB 3RXGA 1LO6A 1BTHH 3PLPA 1O3IA 3A82A 4BTTB 4HGCA 1J14A 3TGKE 3VXEH 1B0EA 1KIGH 2J2UA 2AEIH 4FVDA 1KY9A 3PWCA 3F9GA 1ZTKA 3F68H 2NU2E 3MH4A 1EZXC 3I78A 2FOFA 1O3PB 1O2JA 2BVRH 2ILNA 2KAIA 2WPMS 1MAYA 3S7HB 1ELDE 1DWBH 4DW2U 1D3PB 3MMGA 4M7GA 3M3VA 1ESTA 3MWIU 3ZZDA 1NS3A 1O3GA 4B76A 2BTCE 2VWLA 1SGRE 1HJ9A 3NWUA 4TY7A 4NA7A 1OSSA 1PYTD 1PFXC 1MTSA 3OY6U 1QJ6B 2BOHB 1G36A 3SU1A 4H6TA 1ESAA 1N8OB 3K6ZA 2C4FH 4ESTE 1K1OA 2OC0A 3T62A 1BRAA 1SLWB 1UVTH 1Z7KA 1FUJA 1ZTJA 3Q77A 1QA0A 3RLYH 4Z0KA 2FESH 3A81A 1FQ3A 1GHAF 1GMCF 1GI1A 2OBQA 2XBVA 3RXSA 3RUOA 3ZZAA 3KQEA 1PQ8A 1CGIE 2F9UA 1IQNA 4MG3A 1THSH 2FTMA 1BMMH 1FZZA 3TITA 3HK3B 2ZHWH 1C5MD 1MMJN 1HRTH 4K3JA 1BTPA 1QA7A 4WWYA 2P94A 3LDXH 3ELAH 4OS7A 2YOLA 4YM9A 3BTFE 5IYTA 1O3NA 2UWLA 3E0PB 3VB6A 1C2KA 2G8TA 2H2ZA 4X8VH 4BAQB 2ZFRH 4D76A 1HAYB 1P02A 1P9UA 2Z3EA 3GDVA 1MD7A 1DE7H 1S5SA 3ZVCA 1D6WA 2AGEX 2OC1A 1SGPE 2BLQA 2HRVA 1C1NA 4OS4A 1EZUC 2VIOA 1A5IA 3RXVA 4QT8C 2ZDAH 1YLCA 4O3TA 1V2VT 1CHGA 1H1BA 1K1MA 1PPBH 1XUIA 3RXMA 1CA0B 3RXFA 5EXLA 1FN8A 5L2ZH 2C8WB 1WQSA 4MLFB 1YCPK 1THRH 1F0SA 1QRXA 1BOQA 2K1QA 1ZOMA 1SGEE 1C5LH 2V35A 2VU8E 4MPWA 3BTDE 2A7HA 1V2TT 2ODQA 3E6PH 2QGRA 3F1SB 1GJ5H 3M35A 1O2PA 2ZCHP 1EOJA 2Y7ZA 3A84A 3P8FA 1OPHB 1VCPA 2P3UB 1ZSLA 1YC0A 4KTCA 3BEFB 1EATA 1OP2A 4OS2A 2GGVB 4X2VA 3M61U 1GMDF 1OWDA 3LGWA 2GDEH 1AN1E 4HTCH 1RS0A 2ZGBH 3NK8A 4ISOA 1P57B 6CHAB 1C2HA 1H8DH 4YOIA 2V0BA 2ZGCA 1K1JA 2ZDVH 1LHCH 2BYAX 2FS8A 4E7RG 3M3SA 5C1UA 1LVBA 3QZQA 5ESTE 2ZTXA 1IHTH 1DUAA 3Q3YA 1GL0E 1EJMA 4CR5A 1RTLA 1XX9A 1TONA 1CO7E 1YPLH 2OC8A 2VIDA 1SQTA 1HXEH 1QB6A 2ANWA 3UNQA 1QTFA 4AZ2B 1AGJA 1UHBA 5C5OA 1TNHA 4X2XA 1H4WA 1KXBA 1PPHE 4MTBA 2ZHDA 2CXVA 3PWBA 4ABAA 5F8XA 2CN0H 4UFFH 2BVXH 1K1LA 1LPGB 2I6SA 2O8WA 3GCNA 1FI8A 1SL3A 4Y8ZA 3UOPA 5SGAE 1QCPA 5A2MH 2C8XB 2D26C 1TGSZ 5F8ZA 3RXLA 4DOQA 1HJAC 4IGDA 3MHWU 2Y81A 2ZCKP 3Q76A 5DP9A 1ZPZA 5LPFA 2OTVA 1ZMLA 1C1VH 1ZHRA 1ACBE 1UJ1A 1SGDE 1V2QT 1SHYA 3RM2H 1NRRH 4FUFA 2FI4E 2BD2A 3GICB 3QO6A 1TOCB 2W7UA 2ZQ2A 1PPZA 1MAXA 4Y11E 1W2KH 1C1MA 5GJ4B 4LOYH 1C2EA 1Z8GA 1O2OA 2FO9A 2A5KA 1UTLM 2ZU2A 2ZA5A 2GZ9A 3CS0A 4FUCA 4HFPB 1XXDA 2ULLA 1TGBA 2ZNKH 1GVKB 1V2UT 3I77A 4ZKSU 1WYKA 4ABGA 8GCHF 3TIUA 3P6ZB 4GSOA 3L33A 5C2ZA 2GDDA 1LHGH 3HK6B 3PLBA 1G3CA 4JYUH 2WPHS 4BXWA 1GBDA 4AYYB 1FAKH 1HGTH 2CF8H 5A8YA 1QBNA 1GJ8B 4X6PA 4H42U 1MH0A 4ISIH 4D9QA 1C5ZB 3T25A 1JXPA 3AAUA 3NKKA 1ZMNA 2JETB 1BRUP 4K8YA 5DP4A 3KEEA 3GCTG 1IAUA 1T8LA 3A88A 1FXYA 1GJBB 3GY3A 4WMDA 1HAIH 3RM0H 3KL6A 1TBZH 4I8JA 4GLYA 4K8BA 4XDEA 3GYMA 1FY3A 4PROA 5C67A 3GCOA 2ZO3H 4CRFA 1E37B 1W3CA 3F9FA 2G52A 2ZZUH 3F9EA 3PV4A 2OD3B 1QL7A 2FOGA 5J4QA 2PKAA 1SBWA 4Y71A 1F2SE 1S6FA 3E3TA 1O39A 3KGPA 3V13A 1EOLA 1T4VH 2GMTC 1MTNB 1TX6A 1NRSH 3RC6A 5E2PA 5A0AE 2PR3A 3ATWA 1INCA 3PO1B 1E38B 1NO9H 1ZSKA 1CSOE 1F92A 1HAGE 1VJAU 1NFYA 2AERH 2RG3A 1QQUA 1RD3B 2DUCA 4AORA 1O2QA 4XBCA 3TNTA 4ZKOU 1TNLA 2O8LA 2EI6A 1V2MT 3QGNB 1E36B