2LNCA

Solution nmr structure of norwalk virus protease
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
188
structure length
188
Chain Sequence
MHHHHHHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and dynamics characterization of norovirus protease.
pubmed doi rcsb
source organism Norovirus
molecule tags Hydrolase
molecule keywords 3C-like protease
total genus 16
structure length 188
sequence length 188
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2lncA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2lncA01
1MMJN 1P06A 1O3FA 3A7WA 1V2ST 1P2NA 3UOUA 2ODQA 1FZZA 1NY22 2C93B 1DUEA 1K21H 2F9BH 4TY6A 4AOQA 2CMYA 3LC3A 4Y11E 4F49A 1WV7H 3T25A 3UQVA 1HJ9A 5DGJA 3PTBA 5GIBA 2WPMS 3P95A 2H2ZA 1UK3A 1L4ZA 3HGNA 4X1QU 1DUAA 1ZSKA 3SJ8A 3D65E 2ZCKP 1HNEE 1O2XA 2OC8A 1QL8A 4CREA 1B5GH 2NWNA 2ANYA 2FOBA 1GJBB 1O34A 5DP9A 3TGKE 2F9VA 3LPRA 2Z9JA 1BIOA 1AWFH 4WMDA 2XCFA 2TBSA 1C4V2 3GDSA 1NRNH 1EP5A 1FPHH 4CR9A 5GDSH 1U6QA 4K8BA 4ABEA 3SHAH 1T4UH 2ZU2A 1WTHD 1O2NA 5A09A 1MUEB 4K1TA 1D9IA 1TA2A 4Z6AH 1ESAA 1UCYE 1RRKA 1FUJA 2KAIA 2JH6D 1MTUA 2HPPH 1NO9H 4ASHA 2ZGHA 1EP6A 4ABGA 4Y8ZA 1C5NH 3UR9A 1C5QA 2PW8H 1TIOA 1OSSA 4JYTA 2HPQH 2VWOA 5LH8A 1HRTH 1JRTA 2B8OH 1AVGH 1SOZA 1GVLA 4A92A 1GHVH 1N8OB 1UTNA 1XUIA 2XCNA 4KGAA 1ZMNA 2TPIZ 3SU1A 2STAE 2BOHB 4KTUA 4B71A 1T32A 3QLPH 1GHBF 1IQNA 4AG2A 5G4BA 1A5IA 1OPHB 3E3TA 3SGAE 1NTPA 1V2LT 1WUNH 3ATKA 3V13A 1YGCH 3M3SA 1OWJA 1V2WT 1TNJA 1LHEH 3TU7H 2FEQH 2Z9IA 1TLDA 1QTFA 3FAOA 1NRQH 2VVCA 3E1XB 3QGNB 3R3GB 1VGCC 1H9IE 2PKAA 1GMCG 1TGBA 1PJPA 1KXFA 1W0ZU 1FMGA 1VJAU 1XVOA 3LH1A 1RTFB 2BTCE 2FI4E 1PQAA 2YOLA 2OXSA 1YPMH 3SJIA 1Y3WA 4FUFA 4FVBA 1V2UT 2HNTE 1BDAA 1Y5AT 4YM9A 4H6SB 1SGTA 2BXTH 3P8NA 4MPWA 1CO7E 5A0CA 3LT3A 1VZQH 3G01A 4INHA 2SNWA 3RXOA 3ODFA 1P3CA 3B23B 1EKBB 2WV5A 3BTFE 2BVRH 3EA7A 3GY5A 4DGJA 1NS3A 1RXPA 2GVFA 4TWYA 2ZDNA 1C5MD 3A83A 4B1TA 1BBRK 4JMYA 1UTMA 3SJ9A 2ZDKA 1C5ZB 2AIPA 1A0JA 3AW0A 1D6RA 1TX8A 3KCGH 4NIWA 5C1XA 1FN6A 1O2GH 2O9QA 2ANKH 1P02A 1C2LA 4FUJA 4D8NA 1FAKH 5F6MA 2VWLA 2BD2A 1TPSA 1TBRH 4I33A 1MU6B 1UCYH 4O03A 3KQEA 3MFJA 1GG6C 4NIVA 1P05A 2AMDA 1LVBA 1MKXH 2UWPA 4BTUB 4MNYA 3F9HA 1CGHA 1EJNA 1ZR0A 1ZGVA 3U8OH 5E2PA 1O2KA 2BDAA 4AZ2B 3CP7A 1OKXA 5ESBA 1ZPCA 3M37A 1YKTA 1JOUB 4X2XA 4X2VA 2V6NA 3O8DA 2A5IA 5E8EH 4A5TS 1O5GH 3RXKA 5DP7A 1FIWA 1P03A 4OS4A 1VITH 3VFEA 1C1RA 2GT8A 1S6FA 2QXGA 3RXRA 1S5SA 1YPHE 2Y5FA 4I8LA 4CHAB 1XXDA 1V2JT 4AFZA 1LDTT 1IQKA 3OTJE 1ZTLA 4FUIA 3TVJB 3L3TA 3UTUH 5EU8A 3KQBA 1ANEA 3OX7U 1HDTH 1G37A 1KTSB 1C5LH 1TNIA 1HYLA 1AY6H 3RC4A 2BLOA 4Y7BA 1ETSH 1BCUH 4BXWA 1GHZA 2WPJS 5JB9S 4YLUA 5PTPA 1AB9B 2FOAA 2F83A 2OINA 1FONA 1O2ZA 1OWHA 3VB5A 1G2LA 1GMHF 1AFQB 1Q3XA 2FDAA 2O8WA 1GHAF 1CQQA 3QWCH 1HJAB 5DPAA 4AYVB 1NROH 4ISNA 1AKSA 1UTOA 3EA8A 3TJUA 3D49H 1PPGE 4OS2A 1EQ9A 1Z8IB 3AAVA 1BB0B 1W10U 5A0AE 1AD8H 1UMAH 3TK5A 4JZIA 3PWCA 2Z3DA 1C9PA 1OS8A 1P2IA 2VIVA 1KXEA 1LHFH 2BLWA 2R9PA 1ABIH 1O5BB 4Q2KA 4WH6A 5IYTA 1X7AC 1CA0C 3TGIE 1Z1JA 5FPSA 2JH0D 4WMFA 1O3JA 3BG4B 2ZQ1A 3Q3XA 3Q76A 2CV3A 1MAXA 2ZFFH 1IQHA 1NRRH 3HKIB 3MI4A 2GMTC 1K28D 1EOLA 3K65B 1W8BH 1JIMA 1SGNE 1SGCA 1J15A 1QBVH 5DP3A 1NN6A 4CR5A 2H6MA 1SMFE 2BDBA 5TCCA 3KQCA 3ELAH 2F3CE 5H4IB 2ZFTA 2CGAA 3KIDU 3NZIA 2A1DB 5GPIB 2ZU1A 1BT7A 3BV9B 1E35B 2WUCA 5T3HA 2G00A 1C5VA 2UWLA 3K6ZA 2A45B 5C1UA 3F1SB 1KXCA 2KAIB 4OS1A 2FX4A 1GJ7B 3PMHB 3NKKA 4B75A 1AUTC 2ZDAH 2VIQA 3Q3KA 2PGBB 2H5DA 2J2UA 1NFWA 1XVMA 2CF8H 1O39A 2BXUH 1ELCA 3A7TA 2CHAC 2OCVB 3NPSA 4H6TA 6ESTA 1EXFA 3A8CA 5EW1H 4D7FA 4U30A 3LGVA 2FS8A 1O3IA 1HIAA 3MHWU 4BAMB 4DG4A 1O3HA 1G3DA 1P8VC 2VIDA 1SFQB 3GCOA 1C4Y2 4UDWH 1GJ8B 1HV7A 3DT0H 3LGUA 1GMCF 2VWMA 1WAYB 2VH6A 1ZJKA 2PKAB 1PQ5A 3RXJA 1IHTH 3RU4E 4CRCA 1W3CA 1D3TB 2ZC9H 1MQ6A 1RJXB 4BAQB 2O8MA 1WOFA 2ZCLP 2BLQA 3SI4H 2PKSC 3SORA 2HRVA 1HAXB 1MTSA 3TJVA 3SNCA 4BOHA 1ESBA 3E8LA 3P70B 1V2KT 1OYTH 2W5EA 1OOKB 1M9UA 4HFPB 2GZ8A 3ZV8A 3QO6A 4IGDA 1OWEA 4WVPE 1NRPH 2A4RA 1BMAA 1G9IE 1O2IA 3LJOA 3TITA 3GYLB 4FUBA 4AG1A 1DOJA 1O2OA 1O0DH 1V2MT 2P93A 3LONA 3MOCA 3RLWH 4IBLH 1DSTA 3S7KB 1NM6A 5K0HA 1YPLH 1S6HA 5HMAA 1P04A 1W12U 2SGEE 4ZMAH 3ATWA 4F4OC 1HCGA 2AGEX 1NPMA 3SU6A 1LHCH 3RXVA 1AZ8A 2BD3A 5FBEA 3KNXA 4RKOB 5GCHF 3MH4A 3SNEA 2ZQ2A 1JIRA 4X1SU 1ZJDA 3L33A 1ESTA 1TRMA 4MNVA 3BTKE 1P2KA 1C1UH 4FUEA 1J8AA 3KEEA 1EASA 1VCPA 1G30B 1LHGH 1SOTA 2G5VA 2GCHF 3MTYA 2AH4X 3QN7A 2W7SA 1BTHH 4K60A 4X2WA 1SC8U 3SHCH 4GHQA 5EOKA 5K7RA 1TPAE 2DE8A 4O3UA 1IQFA 4ABFA 1O3BA 2GD4B 3RDZA 3TIUA 5JB8S 1OP2A 1SSXA 2P16A 3ZZ7A 4X1NU 9ESTA 4B74A 1TMUH 1K1IA 3P17H 3U98H 2B5TB 3I78A 4MNWA 4TPYA 3TK6A 3MU8A 1V2OT 1ELGA 1YPHC 1O3GA 1C2HA 1EPTB 4B2CA 3HK6B 1GI8B 4IN1A 4MVNA 2JH5D 3PM3A 1CHGA 1SLWB 1EPTC 1Z1IA 2P95A 1KIGH 4PROA 2BX4A 2TGPZ 2OQ5A 5CMXH 1B7XB 2NU0E 3PLKA 2ZU5A 5DKMA 2HOBA 3I77A 2IPHA 3RXGA 3BTGE 2SGFE 3HK3B 3A88A 4K8YA 3M7UA 3SUDA 1QGFA 3H7TA 2ANWA 3RMMH 2DUCA 3U8TH 1A4WH 9LPRA 1GI0A 1TA6A 2FOHA 2VJ1A 2ANMH 4AORA 2ZFRH 4U32A 1C1MA 4BXSA 1YPEH 3C1KA 4BAOB 4KELA 2BQ6B 1SGIB 2A32A 1QFKH 1P11E 2TGDA 1GGDB 2QAAA 4CBNA 1GBMA 2BMGB 4ABJA 1ELEE 3CS7A 3GYMA 3TNTA 1HJAC 4RSPA 5FAHA 1HAHH 3A87A 2VIWA 3O8CA 1GHXH 4UEHH 2ZTYA 1GBKA 2FOGA 2R2MB 5IDKA 3SU4A 1Z6JH 4ZAEA 3TH4H 1MZAA 1K9OE 3DFLA 1OX1A 3KF2A 1MCTA 2HNTC 3A82A 3PTNA 1EJMA 1SGYE 1GHYH 2J34A 3SZNA 4I8HA 3ITIA 1RD3B 1H8IH 1WQSA 1EZXC 1GMHG 1P9UA 2GGVB 4IMZA 3SJKA 6GCHF 1O5FH 1SHHB 3ZYDA 2ZGJA 1CU1A 2JETC 2OQUA 3A7VA 4DY7B 8ESTE 1O2WA 4TPIZ 1C1PA 2OTVA 4ISHH 2PSYA 4UFEH 1Y5BT 3ZVAA 1TGCA 4JCNA 4RKJB 3RU4D 1QQUA 3TLOA 1BUIA 1YPJH 2C3SA 2HWLB 3BTTE 4Y79A 5CE1A 3U69H 1LPKB 2VGCB 4I32A 3MNSA 5GCHG 3LH3A 1T8LA 3U1IB 1Y59T 1GJ9B 3K9XB 3IITA 1XXFA 3SUEA 3ATMA 3PWBA 1GBEA 1O2HA 4ISIH 1P2QA 1GBBA 1SGRE 4M7GA 1PPEE 5EXLA 5J4SA 3QGJA 3SQHE 4ZHMU 2ZA5A 4VGCC 1TALA 1NU9A 3FZZA 2QN5T 5SGAE 1TQ7B 1C5XB 1TBQH 1T4VH 2EA3A 1SQTA 3OU0A 5EG4A 3H5CB 1F5LA 3S9AA 2Q6FA 4A7IB 5B6OA 1VCWA 1KTTB 3M36A 3OYPA 4BNRA 5T6DA 3PMBB 3U8RH 1HXEH 2R0LA 3DUXH 2CJIA 2EI7A 2ZHWH 1D4PB 2JETB 2O8TA 1ARBA 3T28A 3S9BA 3MU0A 1FY8E 5I46H 1KDQA 1QHRB 1ZLRA 2C8YB 1UVTH 1O3EA 3R0FA 3DHKH 1HAGE 2XWBI 1P12E 3SU0A 1QJ7B 3ZZ6A 1TBZH 2SGDE 3A7XA 1O36A 1QL7A 2PKSB 2XYAA 1Y3XA 1EAWA 2TGTA 3BIUH 3MU1A 3V0XA 3BEFB 1G36A 3N7OA 3ZZ3A 2HLCA 4NA9H 1GHAG 1TOMH 5F8XA 1TGTA 3M61U 1QIXB 1CE5A 2BHGA 4XBCA 2ILNA 1V3XA 1TGNA 4AB8A 1W0YH 1ZOMA 2NU1E 1F2SE 2Z9GA 3DD2H 4ZHLU 3W95A 4NWKA 3SGQE 1ZRKA 3ZZ4A 2A4OA 4CBOA 1QRWA 1A1RA 1GI3A 1VJ9U 3RXFA 1O37A 4GVUA 4TY7A 1AFQC 1LHDH 1LQDB 3VXEH 3S69A 4DIHH 1A3EH 1ZYOA 3GY2A 2GCTB 2O8UA 2BYAX 5DP8A 1LVYA 3STJA 2BY8X 4SGAE 2G8TA 4LZ1H 4XFQA 1HAVB 2VU8E 1PYTC 4IC6A 3PROA 1N8OC 4X0WU 3ZZBA 2NU2E 3PLBA 2NU3E 3E6PH 2VIPA 5A8ZA 1GI2A 2A7CA 1GI6A 3LOXA 4Y76A 1ELAA 2A2XH 1GJDB 3UNSA 1TWXB 1MZDA 3ZV9A 1ANBA 1DICA 4TYDA 1O3PB 2FWWA 4XSKU 2SFAA 1ANDA 4X1PU 3SU3A 3URDA 5L6NH 4UD9H 1ZGIA 1QB1A 4ZHAA 2TIOA 2A2QH 2AEIH 1LVMA 1AVWA 3ZVDA 2W7UA 4XBBA 3LC5A 1QJ1B 2PHBA 3RC6A 1HFDA 1K2I1 1A0LA 1C5SA 1G2MA 4RN6A 1C2DA 1FV9A 1A7SA 2UUYA 3EA9A 2G5NA 1KDQB 1ELBA 5TCAA 2FIRH 3BTQE 4MQAA 1CVWH 2PGQB 3RXUA 2WPIS 5L2ZH 4CRFA 1MU8B 1SGEE 4D76A 4J1YA 2GT7A 1O3NA 2ZECA 1MTVA 1F92A 3S0NA 4O97A 2I6QA 4GHTA 4K69A 4DT7B 4X6MA 3FZDA 2QA9E 4AX9H 1GJ5H 1DANH 4CRBA 1O5CB 5C20A 2J4IA 2EI8A 4Y0ZE 2TGAA 1AFEH 2WPHS 3QTVH 2FYQA 3A85A 5I25A 4LK4A 1N6YA 1AIXH 1AVXA 3GDUA 1W14U 2ESTE 3P8OA 4DURA 1DVAH 3TH2H 1SI5H 3AW1A 1QY6A 4JYVH 5CHAC 2OC0A 5AF9H 2FOEA 3LGYA 5DP6A 1RFNA 1AE8H 1ZRBA 4U01A 1MD8A 4MPUA 3RXIA 4AB9A 2Y81A 4KTSA 1XUJA 3MH6A 2PV9B 3A81A 4TWWA 1ELDE 4Q80A 1C1WH 1YF4A 5AHGH 3LGTA 1IQIA 2C8ZB 3Q3YA 1K1NA 1IQJA 4UFDH 3UPEA 2ZU4A 1VCQA 2P8OC 2GTBA 2ZNKH 5FPTA 1BMLA 2FI5E 4GPGA 3RUOA 1TMBH 2GDEH 1G32B 5AFYH 1LPZB 3PMJA 2FTLE 3WY8A 5DG6A 1UCYK 1ELVA 4YT7H 5F8ZA 4IW4E 1TYNA 2QY0B 4YESB 1CA0B 3C27B 3GY8A 4MNXA 5C5NA 2HNTF 1AN1E 1K22H 1P57B 2R0KA 4K3JA 4XDEA 2PTCE 2ALPA 3ZVFA 3VPKA 4AFUA 1O3KA 1HAOH 5AFZH 4GAWA 1QJ6B 3EE0B 5DP5A 2ZDVH 1TPPA 3KHVA 2GMTB 1F5RA 4FXGH 2O8LA 1GJ6A 2G4TA 3GCTF 1RTLA 1P9SA 3BEIB 4BANB 4DIIH 3NXPA 1GI9B 1S84A 2W3IA 2ZFQH 2UWOA 1EAXA 1O5DH 4FVDA 4DW2U 3UFAA 3P8FA 1LPGB 2RA3A 1H1BA 1SLVB 1P01A 1OWDA 2HALA 1E37B 2EI6A 3F9EA 1UK2A 3M35A 1QBNA 8LPRA 2A31A 3BG4C 2H9EH 2OLGA 3TH3H 3S7HB 5DP4A 3QDZB 2A4GA 2I6SA 1AKSB 1TOCB 4E7RG 3ODDA 3AAUA 2D1JA 1JRSA 1H4WA 3A8DA 4JZDH 4JK6A 1AMHA 1O35A 1GBCA 1V6DA 3TGJE 3UNRA 4FUGA 1ELTA 1AB9C 1EJAA 1HXFH 1C4U2 2ZU3A 1Z8GA 1TFXA 4A1TA 2IJOB 1CT0E 5E2OA 4ABAA 2TRMA 1NRSH 8GCHF 2BD7A 1D6WA 5EXNA 1BTXA 1XUGA 2GP9B 4INKA 2QXIA 5EPYA 1F0TA 1F5KU 3GY6A 2BQWB 1HAZB 3ZZAA 1UTLM 1IAUA 1BRCE 1YC0A 2FLBH 1QRXA 1J14A 3MWIU 4JZ1A 1SBWA 3UWIA 2ZWLH 1CA8B 1C1SA 2HGTH 4NZQA 5LPFA 1DFPA 1ZMJA 1RIWC 1YLDA 1Z7KA 2V35A 3RXCA 4ISOA 3GISB 1GMDF 4O3TA 1XKBC 1KLJH 1HLTH 2VNTA 1V2NT 1XM1A 3RXSA 1IQGA 1LMWB 3M7QA 3A86A 4YOGA 5JBTA 1QRZA 1GI5A 1IQEA 2FOFA 2FYRA 1SLUB 1ZHPA 1TX6A 3ZZ8A 1O2PA 3NCLA 1TNGA 3SW2B 2YNBA 1HUTH 1GJAB 1CT4E 4FUDA 1A5HA 3M5NA 1BA8B 1D3DB 2XWAA 4K1SA 1BHXF 4U2WA 1PPFE 1N1LA 5ESTE 4HGCA 1MH0A 1C1TA 3STIA 2BDCA 4WF8A 2DE9A 4R8TB 2J92A 5C3NA 2Z9KA 1D3PB 1QA0A 1IHSH 3BTHE 2P8OB 3HGPA 1BMMH 8KME2 3ZZ5A 1ZHMA 3SBKA 2ZHQH 1AI8H 3MO6A 1BTPA 3MH5A 4B76A 2B9LA 3RXQA 2BD8A 1GBHA 3BIVH 2H9HA 2G4UA 3SUFA 1H9HE 2AMQA 2FXRA 2WPLS 1Y3UA 1HAPH 1TABE 1Q31A 3SGBE 1EZQA 1UO6A 1FY3A 2BX3A 7ESTE 2ZGBH 1OXGA 1NFXA 3K2UA 1BQYA 1PYTD 2BY5X 1K1LA 2BLVA 2Y7ZA 4D7GA 3M5OA 1P2MA 4D9RA 1LTOA 2P3UB 3JZ2B 2UUFB 3RXDA 1UK4A 5LPEA 2G52A 1V2RT 3UIRA 1J9CH 2UUKB 2WPKS 1H9LB 2ASUB 2A4QA 3FP6E 2D2DA 5JYIA 2ZI2H 4BAHB 1GI1A 3M3VA 4Y7AA 3RLYH 2BM2A 2AYWA 4JZEH 3QZRA 3L6PA 1C2GA 1YP9A 1T8MA 1XMNB 1AQ7A 1MAYA 1GMDG 2VB0A 3A89A 1C5YB 2ZGXH 4IC5A 4WWYA 5A2MH 3VXFH 3ATLA 1LKAA 2IN2A 4KKDA 4AGJA 3UR6A 2ZP0H 1TNKA 1PPHE 5C67A 1WYKA 1JXPA 1PQ8A 1TB6H 2Z3CA 1BRBE 1PFXC 1PPCE 5FHTA 1YCPK 1O5EH 2PSXA 1DWBH 3EAJA 1NFUA 3ZYEA 4ZKRU 4NG9H 3RM2H 1HBTH 4D9QA 3SUGA 1QB6A 2Z6BD 4X6OA 1D3QB 2OBQA 2K1QA 1DY9A 3QUMP 4CRDA 3SQEE 1DSUA 3UQOA 2PWXA 4WJG2 1GWAA 2HVXA 1XUHA 2XRCA 1FNIA 1C2MA 3GY7A 3SV8A 1FY4A 2R3YA 3E16B 5J4QA 1KXDA 4WH8A 4I7YH 4ISLA 3ESTA 2ZGCA 3A7ZA 2XNIA 1O5AB 1FI8A 1VITG 1QCPA 2QC2A 1YM0A 2SGPE 3ZVCA 2WYGA 4X8SH 2Y80A 2QGRA 4O9VA 2ZG0H 3RM0H 3A80A 1TQ0B 1THSH 1QR3E 1TNHA 1GBLA 2AIQA 1J16A 2BB4A 1ZMLA 1O2JA 1GJ4H 1O30A 2JKHA 1VGCB 4YOJA 3SU5A 1O2YA 1NESE 3ZZ9A 1HIAB 1TGSZ 1DY8A 1LO6A 4XBDA 2GV6A 1ZSLA 3FANA 1FXYA 3ZZCA 2BY7X 1UTJA 2FLRH 1NT1A 1BBRE 2B0FA 1O2RA 3RXTA 3LGWA 4GCHG 1MBQA 4LXBH 1C5WB 2Y6TA 2A0QB 1T31A 2RDLA 1K1MA 4J2YB 2OC7A 2ODPA 1UVOA 3F9FA 3BEUA 3U9AH 2Y7XA 1ORFA 2P3FH 2WUBA 1EATA 1HAIH 2FM2A 4DVAU 1KSNA 2XC5A 3PYHA 4Y6DA 4YLQH 1B0FA 1MKWK 1ZTJA 1A0HB 3UUZA 3TNSA 1TX7A 3GCHB 5LPRA 2SGQE 2CN0H 2QIQA 3URCA 3ZVEA 3QK1A 3Q00A 4ZROA 1S81A 3M7TA 4NFEA 7GCHG 1EB1H 2CF9H 1SFIA 1ETRH 1HB0B 1HGTH 1SGFG 2Z94A 5LGOA 2WV4A 1L1GA 4B73A 5E0HA 1FIZA 1QQ4A 2AERH 1EUFA 2XW9A 3O8RA 1S85A 4UONA 3GCNA 4YTAA 1Y8TA 4SGBE 1O2VA 2G51A 3GY3A 1A61H 3EDXB 2R3UA 1W11U 2XC0A 4MPVA 2RG3A 1KLIH 1XUKA 3GDVA 1EB2A 1AO5A 1FLEE 4YZUA 6CHAC 3BG8A 1O33A 1SHYA 4GCHF 1SQAA 1WSSH 4I8JA 3FP8E 1FQ3A 4MDSA 1PPBH 3SV7A 1C1OA 1K1PA 3MO3A 4WXIA 4UE7H 3BN9A 3IWMA 2FZZA 2ALVA 3BTEE 3UY9A 1W7XH 5HM2A 2FODA 4A1XA 1TPOA 3LDXH 1UTKA 3HPTB 4HZHA 1SGFA 3EQ0H 1BOQA 2FOCA 4CH8B 2ZZUH 1S0QA 4FUHA 1W13U 3RXHA 4E7NA 2BDYA 1YPKH 1GDUA 5EW2H 1EZUC 1ELFA 5FX6A 3RXPA 4AN7A 5HGGA 2VGCC 1O2TA 2FMJA 1FY1A 1J17T 1NZQH 4KP0A 1CGIE 4IN2A 5JBCS 1GHBG 1THPB 1P10A 1C5TA 3GCTG 2EC9H 5EODA 4Q7ZA 2QF0A 4X1RU 4YOIA 2FPZA 4ZKSU 1UHBA 2ZTZA 2VH0A 4DOQA 4OGYA 5ABWA 1OWKA 3KL6A 1CHOG 2GV7A 2J9NA 6CHAB 1O31A 2GX4A 1T7CA 3M5LA 2AFQB 1YPGH 1UJ1A 5FBIA 1BJVA 3KN2A 5EQSA 5JBBS 1PQ7A 1MKXK 1ZZZA 2D8WA 1LCYA 1W7GH 2ZPSA 4GSOA 4OS6A 1WU1A 2GCTC 1O3AA 1ZHRA 4OS7A 4XOJA 1UVPA 1INCA 2C8WB 2SGAA 1QB9A 3MNXA 1ZSJA 2FO9A 4ABDA 2BD9A 2VINA 2XBXA 1CHOF 2ZFPH 4AYYB 5A8XA 1DWEH 1AGJA 1FPCH 4MPXA 1ZTKA 2F91A 1MBMA 3EGKH 1CGJE 3MNBA 3TPIZ 4OS5A 1GCDA 1RTKA 2BZ6H 2BD5A 4CRAA 4Q7XA 3VB4A 1P2JA 3SNDA 1GBIA 2BDIA 1GG6B 1JMOH 5EGMA 1ACBE 1EPTA 1E34B 1SQOA 1MTNC 2C90B 3UWJH 4X6PA 1G3EA 1ABJH 3LU9B 4R0IA 3NK8A 4MTBA 1L1NA 2BDGA 1BMNH 3W94A 3TJOA 5T6FA 1C1VH 2STBE 4GUXA 5CHAB 1BITA 2QCYA 1O3CA 2ZFSA 4I8GA 1O2LA 2GKVE 1CSOE 3RXAA 1P0SH 2J38A 2BOKA 4ZXYH 4NIXA 2Z3EA 4ZKOU 3RU4T 1XKAC 2GZ9A 4JZFH 1VR1H 3ENSB 3RXLA 3SV6A 1DXPA 2Q1JA 2XTTB 2Q6GA 3F68H 2BZAA 3O8BA 4B2BA 3E0PB 4IS5A 2Y5HA 4ZKNU 4AGKA 4CH2B 1IOEA 2QYIA 1S0RA 1Z71A 2OP9A 3I29A 5TJXA 1WBGB 1DM4B 1S82A 1GBFA 1DE7H 3VB3A 3H7OA 3AVZA 5HYOA 3M5MA 3BTME 1EAIA 1YCPM 1HPGA 3GOVB 1TMTH 3T26A 4K5ZA 1ETTH 4UFGH 3RXMA 4X2YA 3Q77A 1F0RA 1SVPA 5EQQA 3FVFB 3P6ZB 2G81E 4Y8YA 1EAUA 3OY6U 2H1UA 1TRYA 4QT8C 3T29A 1HJ8A 1GVZA 1O3MA 4ZH8A 2BQ7B 1ZPBA 1BTYA 1BTWA 4NGAH 3GCHC 3P92A 3RMOH 5C5OA 1C2IA 3CS0A 3RMNH 3RXEA 7GCHF 5HXFA 2CHAB 2Z9LA 2ZKSA 3E91A 3BSQA 3SV9A 3FFGA 2V3OH 5DJ7A 4FU7A 5DO4H 2V3HH 1LVOA 3SU2A 1AU8A 2BVXH 3SNAA 2GCHG 1Z8RA 1AZZA 1O3DA 3UNQA 1C5RA 3LGIA 1V2TT 1JBUH 1GBDA 2BY6X 1LQEA 1QURH 4LZ4B 1O2MA 1GGDC 2ZDLA 1WTGH 5A8YA 3LIWA 2PR3A 4H4FA 1A2CH 3RC5A 3GY4A 1W2KH 1TNLA 1C5PA 5L30H 5BPEA 1SR5C 2XC4A 3SN8A 7KMEH 1GDQA 2IOTA 3PB1E 1A3BH 3SNBA 1GDNA 2YNAA 2SNVA 4GLYA 2AGIX 4INLA 3V12A 2FESH 3JZ1B 3PO1C 4LOYH 4CHAC 2ZPQA 3PO1B 2Z7FE 5E0GA 2Y5GA 3E90B 2NU4E 3F9GA 5FX5A 2ZEBA 1KYNA 3SO3A 3TK9A 1C5UA 4I8KA 5A0BA 4ABHA 4FUCA 1Z6EA 2BVSH 3RXBA 1DDJA 4H42U 4Y8XA 3ZVBA 1C1NA 5JBAS 1OYQA 5C1YA 1QL9A 5GWZA 7LPRA 2XBVA 3D23A 5ETXA 1KY9A 4E06H 1T8OA 1Z8JB 5EQRA 1SPJA 1YYY1 1NU7B 2D26C 4WXVA 4HTCH 2XBWA 1C2JA 1BZXE 1BTUA 4NZLA 2ODYB 4YT6H 1NC6A 1GCTC 3DFJA 1BHXB 2OBOA 2P3TB 1OP8A 3LJJA 2J94A 1C1QA 2W3KA 2ZTXA 3A7YA 1F0SA 2VIOA 1TONA 4AFQA 3IG6B 8GCHG 1P09A 1F0UA 4DJZB 1GBJA 1FDPA 1O38A 1UVSH 3QZQA 1FAXA 3SI3H 1C2FA 4Y10E 2WYJA 2VVUA 3VEQB 5DK1A 3QX5H 1UHBB 2Y82A 2F9UA 1OWIA 2ZCHP 3VGCB 1B0EA 3QTOH 1SGQE 4X6NA 2QXJA 1E38B 1TRNA 2ZHEH 1THRH 3PLPA 1QA7A 2FP7B 1DWDH 1O3OA 1SGDE 2QF3A 3MNCA 4CRGA 4MG3A 1E0FD 3UOPA 1TE0A 2P59A 2W26A 2PFEA 2FTMA 1K1OA 2P94A 4WY3A 3SJOA 1DLKB 1UTPA 4XE4A 1DLEA 1DITH 2LNCA 4Z0KA 6LPRA 1YBWA 4FU8A 2FOMB 5HM9A 3RMLH 3NUMA 1MCVA 1HAYB 1K1JA 1MQ5A 3P8GA 3ZZDA 4K1EA 1V2PT 3VB6A 1GPZA 1PPZA 3K6YA 2ZHDA 3E0NB 2Q6DA 4JYUH 2OC1A 1C9TA 1NFYA 1AWHB 2WINI 5AVDA 5JPMH 1P2OA 3SV2H 1BTZA 4Y71A 1OP0A 3EYDA 2J95A 4X8VH 2FS9A 1T8NA 3DA9B 1DWCH 2H9TH 2AMPA 1H8DH 5JDUB 1SLXB 1GI4A 1IQMA 3T5FH 1GL0E 4FU9A 1C5OH 2F9NA 1TAWA 3T2NA 2OUAA 1G3CA 2PLXA 4B2AA 2ZDMA 4X8UH 4YO9A 2RCEA 3PV4A 4THNH 3BTWE 5F8TA 1QNJA 1LKBA 2G55A 3NWUA 1KLTA 1DT2A 2VVVA 3MMGA 1UTQA 4E05H 1C2KA 2C4FH 1Y3YA 2A5AA 2UUJB 3MU5A 1FJSA 1EOJA 1GL1A 3F6UH 1JWTA 4VGCB 3HATH 3KGPA 4ESTE 1AE5A 4HI3A 1YLCA 1V2QT 1C2EA 1RS0A 1HAVA 1MKWH 1BJUA 1WQVH 1AHTH 2ZO3H 1O2UA 2BY9X 4OGXA 1Y3VA 5GJ4B 4WMEA 1MTWA 3A84A 1SG8B 2RA0A 5E0JA 1BRAA 2AGGX 5T6GA 2H5CA 2AS9A 4Q7YA 2QV1A 4BTTB 1S83A 2XBYA 3V7TA 5FXLA 2PUQH 4K2YA 3LKWA 1FY5A 1SGPE 1GBTA 1BRUP 2BDHA 1F7ZA 1O32A 2PTNA 1XX9A 4A6LA 4AFSA 3AASA 1ZPZA 4KTCA 1V2VT 1ARCA 1CT2E 2F9PA 1AUJA 1Y5UT 5F03A 4ZUHA 3MYWA 3B8JA 1QBOA 1KXBA 1GCTB 3T62A 4X8TH 3BTDE 1MTNB 3U1JB 2THFB 2LPRA 1ID5H 3A8AA 2ZF0H 1A46H 1GI7B 3PMAB 1G3BA 1DX5M 3RP2A 4BAKB 4JK5A 2OD3B 2A5KA 4ABBA 1EZSC 1L4DA 5EXMA 2GDDA 1GBAA 3BF6H 2BD4A 4NA8A 3V3MA 6GCHG 1A5GH 1O2SA 1L0ZA 3HKJB 4Y0YE 3FP7E 1DXWA 1BBRH 2VWNA 3SOSA 3VGCC 3KQDA 2V0BA 1RIWB 1SB1H 4IMQA 2A7HA 4NA7A 3MU4A 1O2QA 5C2ZA 3VB7A 4DCDA 1GVKB 1WCZA 2C8XB 1GJCB 1E36B 3CENA 4NCYA 4A1VA 1CBWB 2XXLA 5FPYA 2ULLA 1GHWH 1CBWC 2FX6A 3OY5U 1ANCA 2ZIQH 5L2YH 3UREA 2M5TA 3TJNA 2EEKA 1FN8A 3MH7A 3B9FH 1DS2E 2B7DH 4NSYA 1P3EA 1YCPH 1MD7A 4MLFB 2A7JA 3GICB 5FCRA 1Q2WA 1SL3A 1DPOA 2F9OA 2QXHA 3OSYA 2CXVA 5BRRE 5FCKA 1EX3A 1RGQA 3ZVGA 1L1JA 3T27A 5EPNA 4UFFH 3D62A 2PUXB 1N6XA 1IQLA 1KXAA 2FI3E 4NWLA 1UVUH 1L2EA 4BTIB 1VITF 3ATIA 1O3LA 4NIYA 4ABIA 2ZPRA 4NFFA 4ZXXH 3S9CA 3M3TA 5GXPA 4NSVA 2GZ7A 1XUFA 3MO9A 2ZHFH 3A8BA 4I31A 2R2WU
chains in the Genus database with same CATH superfamily
1MMJN 1P06A 1O3FA 3A7WA 3MQKC 1V2ST 2HLDD 1P2NA 3UOUA 2ODQA 1FZZA 1E1QD 1NY22 2C93B 1DUEA 1K21H 2F9BH 4TY6A 4AOQA 2CMYA 3LC3A 4Y11E 4F49A 1WV7H 3T25A 4TSFD 3UQVA 1HJ9A 5DGJA 3PTBA 5GIBA 2WPMS 3P95A 2H2ZA 1UK3A 1L4ZA 3HGNA 4X1QU 1DUAA 1ZSKA 3SJ8A 3D65E 2ZCKP 1HNEE 1O2XA 2OC8A 1QL8A 4CREA 1B5GH 2NWNA 2ANYA 2FOBA 1GJBB 1O34A 5DP9A 3TGKE 2HVYB 2F9VA 3LPRA 2Z9JA 1BIOA 1AWFH 4WMDA 2XCFA 3WW7A 2TBSA 1C4V2 3GDSA 1NRNH 1EP5A 1FPHH 4CR9A 5GDSH 1U6QA 4K8BA 4ABEA 3SHAH 1T4UH 1WDIA 2ZU2A 2F43B 1WTHD 1O2NA 5A09A 1MUEB 4K1TA 1D9IA 1TA2A 4DT4A 4Z6AH 1ESAA 1UCYE 1RRKA 4ASUD 1FUJA 2KAIA 2JH6D 1MTUA 5HKKD 2HPPH 1NO9H 4ASHA 2ZGHA 1EP6A 4ABGA 4Y8ZA 1C5NH 3KYGA 3UR9A 3F2HA 1C5QA 2PW8H 1TIOA 1OSSA 4JYTA 2HPQH 2VWOA 5LH8A 1HRTH 1JRTA 2B8OH 1AVGH 1SOZA 5KGOA 1GVLA 4A92A 1GHVH 1N8OB 1UTNA 1XUIA 2XCNA 4KGAA 1ZMNA 2TPIZ 3SU1A 2STAE 2BOHB 4KTUA 4B71A 1T32A 3QLPH 1GHBF 1IQNA 4AG2A 5G4BA 1A5IA 1OPHB 3E3TA 3SGAE 3U28C 1NTPA 1V2LT 1WUNH 3ATKA 3V13A 1YGCH 3M3SA 1OWJA 1V2WT 1TNJA 3F2FA 1LHEH 3TU7H 2FEQH 3FKSD 2Z9IA 3KQ5A 1TLDA 1QTFA 3FAOA 1NRQH 2VVCA 3E1XB 5EJ1A 3QGNB 3R3GB 1VGCC 1H9IE 2PKAA 1GMCG 1TGBA 1PJPA 1KXFA 1W0ZU 1FMGA 1VJAU 1XVOA 3F0OA 1RTFB 3LH1A 2BTCE 2FI4E 1PQAA 2YOLA 2OXSA 1E79D 1YPMH 3SJIA 1Y3WA 3N99A 4FUFA 4FVBA 1V2UT 2HNTE 1BDAA 1Y5AT 4YM9A 4H6SB 1SGTA 2BXTH 3P8NA 4MPWA 1CO7E 5C0UA 5A0CA 3LT3A 1VZQH 3G01A 4INHA 2SNWA 3RXOA 3ODFA 1P3CA 3B23B 1EKBB 2WV5A 3BTFE 2BVRH 3EA7A 3GY5A 4DGJA 1NS3A 1RXPA 1YWUA 2GVFA 4TWYA 2ZDNA 1C5MD 3A83A 2OK5A 4B1TA 1BBRK 4JMYA 1UTMA 3SJ9A 2ZDKA 1W0JD 1C5ZB 3OE7D 2AIPA 1A0JA 3AW0A 1D6RA 1TX8A 3KCGH 2KCPA 4NIWA 5C1XA 1FN6A 1O2GH 2O9QA 2ANKH 1P02A 1C2LA 4FUJA 4AC9A 4D8NA 1FAKH 5F6MA 2VWLA 2BD2A 1TPSA 1TBRH 4I33A 1MU6B 1UCYH 4O03A 3KQEA 3MFJA 1GG6C 4NIVA 1P05A 2AMDA 1LVBA 1MKXH 2UWPA 4BTUB 2WV9A 4MNYA 3F9HA 2IPQX 1CGHA 1EJNA 1ZR0A 1ZGVA 3U8OH 5E2PA 1O2KA 1BMFD 2BDAA 4AZ2B 3CP7A 1OKXA 5ESBA 1ZPCA 3M37A 1YKTA 1JOUB 4X2XA 4X2VA 2V6NA 3O8DA 2A5IA 5E8EH 4A5TS 1O5GH 3RXKA 5DP7A 1FIWA 1P03A 4OS4A 1VITH 3VFEA 1C1RA 2GT8A 1S6FA 5DSFA 2QXGA 3RXRA 1S5SA 1YPHE 2Y5FA 4I8LA 4CHAB 1XXDA 1V2JT 4AFZA 1LDTT 1IQKA 3OTJE 1ZTLA 4FUIA 3TVJB 3L3TA 3UTUH 5EU8A 3KQBA 1ANEA 3OX7U 1HDTH 1G37A 1KTSB 1C5LH 3DSPA 1TNIA 1NBME 2YMSB 1HYLA 1AY6H 3RC4A 2BLOA 4Y7BA 1ETSH 1BCUH 4BXWA 1GHZA 2KCAA 2WPJS 5JB9S 4YLUA 5PTPA 1AB9B 2FOAA 2F83A 2OINA 1FONA 1O2ZA 1OWHA 3VB5A 1G2LA 1GMHF 1AFQB 1Q3XA 2FDAA 2O8WA 1GHAF 1CQQA 3QWCH 1HJAB 5DPAA 4AYVB 1NROH 4ISNA 1AKSA 1UTOA 3EA8A 3TJUA 3D49H 1PPGE 4OS2A 1EQ9A 1Z8IB 3AAVA 1BB0B 1W10U 5A0AE 1AD8H 1UMAH 3TK5A 4JZIA 3PWCA 2Z3DA 1C9PA 1OS8A 1P2IA 2VIVA 1KXEA 1LHFH 2BLWA 2R9PA 1ABIH 1O5BB 4Q2KA 4WH6A 5IYTA 1X7AC 1CA0C 3TGIE 1Z1JA 5FPSA 2JH0D 4WMFA 1O3JA 3BG4B 2ZQ1A 3Q3XA 3Q76A 2CV3A 1MAXA 2ZFFH 1IQHA 1NRRH 3HKIB 3MI4A 2GMTC 1K28D 1EOLA 3K65B 1W8BH 1JIMA 1SGNE 1SGCA 1J15A 1QBVH 5DP3A 1NN6A 4CR5A 2H6MA 1SMFE 2BDBA 5TCCA 3KQCA 3ELAH 2F3CE 3F2GA 5H4IB 2ZFTA 2CGAA 3KIDU 3NZIA 2A1DB 5GPIB 2ZU1A 1BT7A 3BV9B 3PV2A 1E35B 2WUCA 5FL7D 5T3HA 2G00A 1C5VA 2UWLA 3K6ZA 2A45B 5C1UA 3F1SB 1KXCA 2KAIB 4OS1A 2FX4A 1GJ7B 3PMHB 3NKKA 3DSOA 4B75A 1AUTC 2ZDAH 2J98A 2VIQA 3Q3KA 2PGBB 2H5DA 2J2UA 1NFWA 1XVMA 2CF8H 1O39A 2BXUH 1ELCA 3A7TA 1VKYA 2CHAC 2OCVB 3KYFA 3NPSA 4H6TA 3DCLA 6ESTA 1EXFA 3A8CA 5EW1H 4D7FA 4U30A 3LGVA 2FS8A 1O3IA 1HIAA 3MHWU 4BAMB 4DG4A 1O3HA 2KCOA 1G3DA 1P8VC 2VIDA 1SFQB 3GCOA 1C4Y2 4UDWH 1GJ8B 2VBCA 1HV7A 3DT0H 3LGUA 1GMCF 2VWMA 1WAYB 2VH6A 1ZJKA 2PKAB 1PQ5A 3RXJA 1IHTH 3RU4E 4CRCA 1W3CA 1D3TB 2ZC9H 1MQ6A 1RJXB 4BAQB 2EQNA 2O8MA 1WOFA 2ZCLP 2BLQA 3SI4H 2PKSC 3SORA 2HRVA 1HAXB 1MTSA 3TJVA 3SNCA 4BOHA 1ESBA 3E8LA 3P70B 1V2KT 1OYTH 2W5EA 1OOKB 1M9UA 4HFPB 2GZ8A 3ZV8A 3QO6A 4IGDA 1OWEA 4WVPE 1NRPH 2A4RA 1BMAA 1G9IE 1O2IA 3LJOA 3TITA 3GYLB 4FUBA 4AG1A 1DOJA 1O2OA 1O0DH 1V2MT 2P93A 3LONA 3MOCA 3RLWH 4IBLH 1DSTA 3S7KB 1NM6A 5K0HA 1YPLH 2V7QD 1S6HA 5HMAA 1P04A 1W12U 2SGEE 4ZMAH 3ATWA 4F4OC 1HCGA 2AGEX 1NPMA 3SU6A 1LHCH 3RXVA 1AZ8A 2BD3A 5FBEA 3KNXA 4RKOB 5GCHF 3MH4A 3SNEA 2ZQ2A 2EY4C 1JIRA 4X1SU 1ZJDA 3L33A 1ESTA 1TRMA 4MNVA 3BTKE 1P2KA 1C1UH 4FUEA 1J8AA 3KEEA 1EASA 1VCPA 1G30B 1LHGH 1SOTA 2G5VA 2GCHF 3MTYA 2AH4X 3QN7A 2W7SA 1BTHH 4K60A 4X2WA 1SC8U 3SHCH 4GHQA 5EOKA 5K7RA 1TPAE 2DE8A 1WXRA 4O3UA 1IQFA 4ABFA 1O3BA 2GD4B 3RDZA 3TIUA 5JB8S 1OP2A 1SSXA 2P16A 3ZZ7A 4X1NU 9ESTA 4B74A 1TMUH 1K1IA 3P17H 3U98H 2B5TB 3I78A 4MNWA 4TPYA 3TK6A 3MU8A 1V2OT 1ELGA 1YPHC 1O3GA 1C2HA 1EPTB 4RT1A 4B2CA 3HK6B 1GI8B 4IN1A 4MVNA 2JH5D 3PM3A 1CHGA 1SLWB 5EJLA 1EPTC 1Z1IA 2P95A 1KIGH 1YLNA 4PROA 2BX4A 2TGPZ 2OQ5A 5CMXH 1B7XB 2NU0E 3PLKA 2ZU5A 5DKMA 2HOBA 3I77A 2IPHA 3RXGA 3BTGE 2SGFE 3HK3B 3A88A 4K8YA 3M7UA 3SUDA 1QGFA 3H7TA 2ANWA 3RMMH 2DUCA 3U8TH 1A4WH 9LPRA 1GI0A 1TA6A 2FOHA 2VJ1A 2ANMH 4AORA 2QF5A 2ZFRH 4U32A 5KECA 1C1MA 4BXSA 1YPEH 3C1KA 4BAOB 4KELA 2BQ6B 1SGIB 2A32A 1QFKH 1P11E 2TGDA 1GGDB 2QAAA 4CBNA 1GBMA 2KCYA 2BMGB 4ABJA 1ELEE 3CS7A 3GYMA 3TNTA 1HJAC 4RSPA 3CNRA 5C17A 5FAHA 1HAHH 3A87A 2VIWA 3O8CA 1GHXH 4UEHH 2ZTYA 1GBKA 2FOGA 2R2MB 5IDKA 3SU4A 1Z6JH 4ZAEA 3TH4H 1MZAA 1K9OE 3DFLA 1OX1A 3KF2A 1MCTA 5C0TA 2HNTC 3A82A 3PTNA 1EJMA 1SGYE 1GHYH 2J34A 3SZNA 4I8HA 3ITIA 1RD3B 1H8IH 1WQSA 1EZXC 1GMHG 1P9UA 2GGVB 4IMZA 3SJKA 6GCHF 1KMHB 1O5FH 1SHHB 3ZYDA 2ZGJA 1CU1A 2JETC 2OQUA 3A7VA 4DY7B 8ESTE 1O2WA 4TPIZ 1C1PA 2OTVA 4ISHH 2PSYA 4UFEH 1Y5BT 3ZVAA 1TGCA 4JCNA 4RKJB 3RU4D 1QQUA 3TLOA 1BUIA 1YPJH 2C3SA 2HWLB 3BTTE 2XNDD 4Y79A 5CE1A 3U69H 1LPKB 2VGCB 4I32A 3MNSA 5GCHG 3LH3A 1T8LA 3U1IB 1Y59T 1GJ9B 3K9XB 3IITA 1XXFA 3SUEA 3ATMA 3PWBA 1GBEA 1O2HA 4ISIH 1P2QA 1GBBA 1SGRE 4M7GA 1PPEE 5EXLA 5J4SA 3QGJA 3SQHE 4ZHMU 2ZA5A 4VGCC 1TALA 1NU9A 3FZZA 2QN5T 5SGAE 1TQ7B 1C5XB 1TBQH 1T4VH 2EA3A 1SQTA 3OU0A 5EG4A 3H5CB 1F5LA 3S9AA 2Q6FA 1MABB 4A7IB 5B6OA 1VCWA 5IK2D 1KTTB 3M36A 3OYPA 4BNRA 5T6DA 1OHHD 3PMBB 3U8RH 1HXEH 2R0LA 2KFWA 3DUXH 2CJIA 2EI7A 2ZHWH 1D4PB 2K8IA 2JETB 3PRBA 2JIZD 2O8TA 1ARBA 3T28A 3S9BA 3MU0A 1FY8E 5I46H 1KDQA 1QHRB 1ZLRA 2C8YB 1UVTH 1O3EA 3R0FA 3DHKH 3F0PA 2M2AA 1HAGE 2XWBI 1P12E 3SU0A 1QJ7B 3ZZ6A 1TBZH 2SGDE 1COWD 3A7XA 1O36A 1NBMD 1QL7A 2PKSB 2XYAA 1Y3XA 1EAWA 2TGTA 3BIUH 3MU1A 3V0XA 4Z1MD 3BEFB 1G36A 3N7OA 3ZZ3A 2HLCA 4NA9H 1GHAG 1TOMH 5F8XA 1TGTA 3M61U 1QIXB 1CE5A 2BHGA 4XBCA 2ILNA 1V3XA 1TGNA 4AB8A 1W0YH 1ZOMA 2NU1E 1F2SE 2Z9GA 3DD2H 4ZHLU 3W95A 2AHME 4NWKA 3SGQE 1ZRKA 3ZZ4A 2A4OA 4CBOA 1QRWA 5T1VA 1A1RA 1GI3A 1VJ9U 3RXFA 1O37A 1UW7A 4GVUA 4TY7A 1AFQC 1LHDH 1LQDB 3VXEH 3S69A 4DIHH 1A3EH 1ZYOA 3GY2A 2GCTB 2O8UA 2BYAX 5DP8A 1LVYA 3STJA 2BY8X 4SGAE 2G8TA 4LZ1H 4XFQA 1HAVB 3WWBA 2VU8E 1PYTC 2IJD1 4IC6A 3PROA 1N8OC 4X0WU 3ZZBA 2NU2E 3PLBA 2NU3E 3E6PH 2VIPA 5A8ZA 1GI2A 2A7CA 1GI6A 3LOXA 4Y76A 1ELAA 2A2XH 1GJDB 3UNSA 1TWXB 1MZDA 3ZV9A 1ANBA 1DICA 4TYDA 1O3PB 2FWWA 4XSKU 2SFAA 1ANDA 4X1PU 3SU3A 3URDA 5L6NH 4UD9H 1ZGIA 1QB1A 4ZHAA 2TIOA 2A2QH 2AEIH 1LVMA 1QZ8A 1AVWA 3ZVDA 2W7UA 4XBBA 3LC5A 1QJ1B 2PHBA 3RC6A 1HFDA 1K2I1 1A0LA 1C5SA 1G2MA 2L74A 4RN6A 1C2DA 1FV9A 1A7SA 2UUYA 3EA9A 4RI0A 2G5NA 1KDQB 1ELBA 5TCAA 2FIRH 3BTQE 4MQAA 1CVWH 2PGQB 3RXUA 2WPIS 5L2ZH 4CRFA 1MU8B 1SGEE 4D76A 4J1YA 2GT7A 1O3NA 2ZECA 1MTVA 1F92A 3S0NA 4O97A 2I6QA 4GHTA 4K69A 4DT7B 4X6MA 3FZDA 2QA9E 4AX9H 1GJ5H 1DANH 4CRBA 1O5CB 5C20A 2J4IA 2EI8A 2GJGA 4Y0ZE 2TGAA 1AFEH 2WPHS 3QTVH 2FYQA 3A85A 5I25A 4LK4A 1N6YA 1AIXH 1AVXA 2XOKD 3GDUA 1W14U 2ESTE 3P8OA 2KZ4A 4DURA 1DVAH 3TH2H 1SI5H 3AW1A 1QY6A 4JYVH 5CHAC 2OC0A 5AF9H 2FOEA 3LGYA 5EIYA 5DP6A 1RFNA 1AE8H 1ZRBA 4U01A 5CDFE 1MD8A 4MPUA 3RXIA 4AB9A 2Y81A 2RDEA 4KTSA 1E1RD 1XUJA 3MH6A 2PV9B 3A81A 4TWWA 1ELDE 4Q80A 1C1WH 1YF4A 5AHGH 2JDID 3LGTA 1IQIA 2C8ZB 3Q3YA 1K1NA 1IQJA 4UFDH 3UPEA 2ZU4A 1VCQA 2P8OC 2GTBA 2ZNKH 5FPTA 1BMLA 2FI5E 4GPGA 3RUOA 1TMBH 2GDEH 1G32B 5AFYH 1LPZB 3PMJA 2FTLE 4ACBA 3WY8A 5DG6A 1UCYK 1ELVA 4YT7H 5F8ZA 4IW4E 1TYNA 2QY0B 4YESB 3OTPA 1CA0B 3C27B 3GY8A 4MNXA 3OEHD 5C5NA 2HNTF 1AN1E 1K22H 1P57B 2R0KA 4K3JA 4XDEA 2PTCE 2ALPA 3ZVFA 3FO8D 3VPKA 4AFUA 1O3KA 1HAOH 5AFZH 4GAWA 1QJ6B 3EE0B 5DP5A 2ZDVH 1TPPA 3KHVA 2GMTB 1F5RA 4FXGH 2O8LA 1GJ6A 2G4TA 3GCTF 1RTLA 1P9SA 3BEIB 4BANB 4DIIH 3NXPA 1GI9B 1S84A 2W3IA 2ZFQH 2UWOA 1EAXA 1O5DH 4FVDA 4DW2U 3UFAA 2YMSD 2J97A 1LPGB 2RA3A 3P8FA 1H1BA 1SLVB 1P01A 1OWDA 2HALA 1E37B 2EI6A 3F9EA 1UK2A 3OFND 3M35A 1QBNA 8LPRA 2A31A 3BG4C 2H9EH 2OLGA 3TH3H 3S7HB 5DP4A 3QDZB 2A4GA 2I6SA 1AKSB 1TOCB 4E7RG 2LELA 3ODDA 2WSSD 3AAUA 2D1JA 1JRSA 1H4WA 3A8DA 4JZDH 4JK6A 1AMHA 1O35A 1GBCA 1V6DA 3TGJE 3UNRA 4FUGA 1ELTA 1AB9C 1EJAA 1HXFH 1C4U2 2ZU3A 1Z8GA 1TFXA 4A1TA 2IJOB 1CT0E 5E2OA 4ABAA 2TRMA 1NRSH 8GCHF 2BD7A 3GS9A 1D6WA 5EXNA 1BTXA 1XUGA 2GP9B 4INKA 2QXIA 5EPYA 1F0TA 1F5KU 3GY6A 2BQWB 1HAZB 3ZZAA 1UTLM 1IAUA 1BRCE 1YC0A 2FLBH 1QRXA 1J14A 3MWIU 4JZ1A 1SBWA 3UWIA 2ZWLH 1CA8B 1C1SA 2HGTH 4NZQA 5LPFA 1DFPA 1ZMJA 1RIWC 1YLDA 1Z7KA 2V35A 3RXCA 4ISOA 3GISB 1GMDF 4O3TA 1XKBC 1KLJH 1HLTH 2VNTA 1V2NT 1XM1A 3RXSA 1IQGA 1LMWB 3M7QA 3A86A 4YOGA 5JBTA 1QRZA 3F3BA 1GI5A 1IQEA 2FOFA 2FYRA 1SLUB 1ZHPA 1TX6A 3ZZ8A 1O2PA 3NCLA 1TNGA 3SW2B 2RFKC 2YNBA 1HUTH 1GJAB 1CT4E 4FUDA 1A5HA 3M5NA 1BA8B 1D3DB 2XWAA 4K1SA 1BHXF 4U2WA 1PPFE 1N1LA 5ESTE 4HGCA 1MH0A 1C1TA 5EJZA 5GNDA 3STIA 2BDCA 4WF8A 2DE9A 4R8TB 2J92A 3DSGA 2Z9KA 1D3PB 5C3NA 5KEDA 1QA0A 1IHSH 3BTHE 4Q63A 2P8OB 3HGPA 1BMMH 8KME2 3ZZ5A 1ZHMA 3SBKA 2ZHQH 1AI8H 3MO6A 1BTPA 3MH5A 1H8HD 4B76A 2B9LA 3RXQA 2BD8A 1GBHA 3BIVH 2H9HA 2G4UA 3SUFA 1H9HE 2AMQA 2FXRA 2WPLS 1Y3UA 4TT3D 1HAPH 1TABE 1Q31A 3SGBE 1EZQA 1UO6A 1FY3A 4OM9A 2BX3A 7ESTE 2ZGBH 1OXGA 1NFXA 3K2UA 1BQYA 1PYTD 2BY5X 1K1LA 2BLVA 2Y7ZA 2F4LA 4D7GA 3M5OA 2JJ2D 1P2MA 1SKYE 1S6LA 5HIYA 4D9RA 1LTOA 2P3UB 3JZ2B 2UUFB 2QE7D 3RXDA 1UK4A 5LPEA 2G52A 1V2RT 3UIRA 1J9CH 2UUKB 2WPKS 1H9LB 2ASUB 2A4QA 3FP6E 2D2DA 5JYIA 3NRLA 2ZI2H 4BAHB 1GI1A 3M3VA 4Y7AA 3RLYH 2BM2A 2AYWA 4JZEH 3QZRA 3L6PA 1C2GA 1YP9A 1T8MA 1XMNB 1AQ7A 1MAYA 1GMDG 2VB0A 3A89A 1C5YB 2ZGXH 4IC5A 4WWYA 5A2MH 3VXFH 3ATLA 1LKAA 2IN2A 4KKDA 4AGJA 3UR6A 2ZP0H 3SYJA 1TNKA 1PPHE 5C67A 1WYKA 1JXPA 1PQ8A 1TB6H 2Z3CA 1BRBE 1PFXC 1PPCE 5FHTA 1YCPK 1O5EH 2PSXA 1DWBH 3EAJA 1NFUA 3ZYEA 4ZKRU 4NG9H 3RM2H 1HBTH 4D9QA 3SUGA 1QB6A 2Z6BD 4X6OA 5HIZA 1D3QB 2OBQA 2K1QA 1EFRD 1DY9A 3QUMP 4CRDA 3SQEE 1DSUA 3UQOA 2PWXA 4WJG2 1GWAA 2HVXA 4P00A 1XUHA 2XRCA 1FNIA 1C2MA 3GY7A 3SV8A 1FY4A 2R3YA 3H09A 3E16B 5J4QA 1KXDA 4WH8A 4I7YH 4ISLA 3ESTA 2ZGCA 3A7ZA 2XNIA 1O5AB 1FI8A 1VITG 1QCPA 2QC2A 1YM0A 2SGPE 3ZVCA 2WYGA 4X8SH 2Y80A 2QGRA 4O9VA 2ZG0H 3RM0H 3A80A 1TQ0B 1THSH 1QR3E 1TNHA 1GBLA 2AIQA 1J16A 2BB4A 1ZMLA 1O2JA 1GJ4H 1O30A 2JKHA 1VGCB 4YOJA 3SU5A 1O2YA 1NESE 3ZZ9A 1HIAB 1TGSZ 1DY8A 1LO6A 4XBDA 2GV6A 1ZSLA 3FANA 1FXYA 3ZZCA 2BY7X 1UTJA 2FLRH 1NT1A 1BBRE 2B0FA 1O2RA 3RXTA 3LGWA 4GCHG 1MBQA 4LXBH 1C5WB 2Y6TA 2A0QB 1T31A 2RDLA 1K1MA 4J2YB 2OC7A 2ODPA 5B6LA 1UVOA 3F9FA 5F53A 3BEUA 3U9AH 2Y7XA 1ORFA 2P3FH 2WUBA 1EATA 4XRNA 1HAIH 2FM2A 4DVAU 1KSNA 2XC5A 3PYHA 4Y6DA 4YLQH 1B0FA 1H8ED 1MKWK 1ZTJA 1A0HB 3UUZA 3TNSA 1TX7A 3GCHB 5LPRA 2SGQE 2CN0H 2QIQA 3URCA 3ZVEA 3QK1A 3Q00A 4ZROA 1S81A 3M7TA 4NFEA 2L6OA 7GCHG 1EB1H 2CF9H 1SFIA 1ETRH 1HB0B 1HGTH 1SGFG 2Z94A 5LGOA 2WV4A 1L1GA 4B73A 5E0HA 1FIZA 1QQ4A 2AERH 1EUFA 2XW9A 3O8RA 1S85A 4UONA 3GCNA 4YTAA 1Y8TA 4SGBE 1O2VA 2G51A 4FETA 3GY3A 1A61H 3EDXB 2R3UA 1W11U 2XC0A 4MPVA 2RG3A 1KLIH 1XUKA 3GDVA 1EB2A 1AO5A 1FLEE 4YZUA 6CHAC 3BG8A 1O33A 1SHYA 4GCHF 1SQAA 1WSSH 4I8JA 3FP8E 2J98B 1FQ3A 4MDSA 1PPBH 3SV7A 1C1OA 1K1PA 3MO3A 4I86A 4WXIA 4UE7H 3BN9A 2V3MA 3IWMA 2FZZA 2ALVA 3BTEE 3UY9A 1W7XH 5HM2A 2FODA 4A1XA 1TPOA 5C94A 3LDXH 1UTKA 3HPTB 4HZHA 1SGFA 3FN8A 3EQ0H 1BOQA 2FOCA 4CH8B 2ZZUH 1S0QA 4FUHA 1W13U 3RXHA 4E7NA 2BDYA 1YPKH 1GDUA 5EW2H 4M9FA 1EZUC 1ELFA 5FX6A 3RXPA 4AN7A 5HGGA 2VGCC 1O2TA 2FMJA 1FY1A 1J17T 1NZQH 4KP0A 1CGIE 4IN2A 5JBCS 1GHBG 1THPB 1P10A 1C5TA 3GCTG 2EC9H 2W6JD 5EODA 3ZIAD 4Q7ZA 2QF0A 4X1RU 4YOIA 2FPZA 4ZKSU 1UHBA 2ZTZA 2J5UA 2VH0A 4DOQA 4OGYA 5ABWA 1OWKA 3KL6A 1CHOG 2GV7A 2J9NA 6CHAB 1O31A 2GX4A 1T7CA 3M5LA 2AFQB 1YPGH 1UJ1A 5FBIA 1BJVA 3N7DA 3KN2A 5EQSA 5JBBS 1PQ7A 1MKXK 1ZZZA 2D8WA 1LCYA 1W7GH 2ZPSA 4GSOA 4OS6A 1WU1A 2GCTC 1O3AA 1ZHRA 4Q4LA 4OS7A 4XOJA 1UVPA 1INCA 2C8WB 2SGAA 1QB9A 3MNXA 1ZSJA 2FO9A 4ABDA 2BD9A 2VINA 2XBXA 1CHOF 2ZFPH 4AYYB 4YXWD 5A8XA 4B6EA 1DWEH 1AGJA 1FPCH 4MPXA 1ZTKA 2F91A 1MBMA 3EGKH 1CGJE 3MNBA 3TPIZ 4OS5A 1GCDA 1RTKA 2BZ6H 2BD5A 3EE7A 4CRAA 4Q7XA 3VB4A 1P2JA 3SNDA 1GBIA 3W1EA 2BDIA 1GG6B 1JMOH 5EGMA 1ACBE 2KX4A 1EPTA 1E34B 1SQOA 1MTNC 2C90B 3UAIC 3UWJH 4ZCNA 4X6PA 1G3EA 1ABJH 3LU9B 4R0IA 2LP6A 3NK8A 4MTBA 1L1NA 2BDGA 1BMNH 3W94A 3TJOA 5T6FA 1C1VH 2WZQA 2STBE 4GUXA 5CHAB 1BITA 2QCYA 1O3CA 2ZFSA 4I8GA 1O2LA 2GKVE 1CSOE 3RXAA 1P0SH 2J38A 2BOKA 4ZXYH 4NIXA 2Z3EA 4ZKOU 3RU4T 1XKAC 2GZ9A 4JZFH 1VR1H 3ENSB 3RXLA 3SV6A 1DXPA 2Q1JA 2XTTB 2Q6GA 3F68H 2BZAA 3O8BA 4B2BA 3E0PB 4IS5A 2Y5HA 4ZKNU 4AGKA 4CH2B 1IOEA 2QYIA 1S0RA 1Z71A 2OP9A 3I29A 5CHBA 5TJXA 1WBGB 1DM4B 1S82A 1GBFA 1DE7H 3VB3A 3H7OA 3AVZA 5HYOA 3M5MA 3BTME 1EAIA 1YCPM 1HPGA 3GOVB 1TMTH 3T26A 4K5ZA 4ACAA 1ETTH 4UFGH 3RXMA 4X2YA 3Q77A 1F0RA 1SVPA 5EQQA 3FVFB 3P6ZB 2G81E 4Y8YA 1EAUA 3OY6U 2H1UA 1TRYA 4QT8C 3T29A 1HJ8A 1GVZA 1O3MA 4ZH8A 2BQ7B 1ZPBA 1BTYA 1BTWA 4NGAH 3GCHC 3P92A 3RMOH 5C5OA 1C2IA 3CS0A 3RMNH 3RXEA 7GCHF 5HXFA 2CHAB 2Z9LA 2ZKSA 3E91A 3BSQA 3SV9A 3FFGA 2V3OH 5DJ7A 4FU7A 5DO4H 2V3HH 1LVOA 3SU2A 1AU8A 2BVXH 3SNAA 2GCHG 1Z8RA 1AZZA 1O3DA 3UNQA 1C5RA 3LGIA 3PV5A 1V2TT 1JBUH 1GBDA 2BY6X 1LQEA 1QURH 4LZ4B 1O2MA 1GGDC 2ZDLA 1WTGH 5A8YA 3LIWA 2PR3A 4H4FA 1A2CH 3RC5A 3GY4A 1W2KH 2JJ1D 1TNLA 1C5PA 5L30H 5BPEA 1SR5C 2XC4A 3SN8A 7KMEH 1GDQA 2IOTA 3PB1E 1A3BH 3SNBA 1GDNA 2YNAA 2SNVA 4GLYA 2AGIX 4INLA 3V12A 2FESH 3JZ1B 3PO1C 4LOYH 4CHAC 2ZPQA 3PO1B 4P02A 2Z7FE 5E0GA 2Y5GA 3E90B 2NU4E 3F9GA 5FX5A 2ZEBA 1KYNA 3SO3A 3TK9A 1C5UA 4I8KA 5A0BA 4XD7D 4ABHA 4FUCA 1Z6EA 2BVSH 3RXBA 1DDJA 4H42U 4Y8XA 3ZVBA 1C1NA 5JBAS 1OYQA 5C1YA 1QL9A 5GWZA 7LPRA 2XBVA 3D23A 5ETXA 1KY9A 4E06H 1T8OA 1Z8JB 5EQRA 1SPJA 1YYY1 1NU7B 2D26C 4WXVA 4HTCH 2XBWA 1C2JA 1BZXE 1BTUA 3PRDA 1SQRA 4NZLA 2ODYB 3N7EA 4YT6H 1NC6A 1GCTC 3DFJA 1BHXB 2OBOA 2P3TB 1OP8A 3LJJA 2J94A 1C1QA 2W3KA 2ZTXA 4F48B 3A7YA 1F0SA 2VIOA 1TONA 4AFQA 3IG6B 8GCHG 1P09A 1F0UA 4DJZB 1GBJA 1FDPA 1O38A 1UVSH 3QZQA 1FAXA 3SI3H 1C2FA 4Y10E 2WYJA 2VVUA 3VEQB 5DK1A 3QX5H 1UHBB 2Y82A 2F9UA 1OWIA 2ZCHP 3VGCB 1B0EA 3QTOH 1SGQE 3VG8A 4X6NA 2QXJA 1E38B 1TRNA 2ZHEH 1THRH 3PLPA 1QA7A 2FP7B 1DWDH 1O3OA 1SGDE 2QF3A 3MNCA 4CRGA 4MG3A 1E0FD 3UOPA 1TE0A 2P59A 2W26A 2PFEA 2FTMA 1K1OA 2P94A 4WY3A 3SJOA 2W6ID 1DLKB 1UTPA 4XE4A 1DLEA 1DITH 2LNCA 4Z0KA 6LPRA 1YBWA 4FU8A 2FOMB 5HM9A 3RMLH 3NUMA 1MCVA 1HAYB 1K1JA 1MQ5A 3P8GA 1W0KD 3ZZDA 4K1EA 1V2PT 3VB6A 1GPZA 1PPZA 3K6YA 2ZHDA 3E0NB 2Q6DA 4JYUH 4RT0A 2OC1A 2KM0A 1C9TA 1NFYA 3FOAA 1AWHB 2WINI 5AVDA 5JPMH 2K0QA 1P2OA 3SV2H 1BTZA 4Y71A 1OP0A 3EYDA 2J95A 4X8VH 2FS9A 1T8NA 3DA9B 1DWCH 2H9TH 2AMPA 1H8DH 5JDUB 1SLXB 1GI4A 1IQMA 3T5FH 1GL0E 4FU9A 1C5OH 2F9NA 1TAWA 3T2NA 2OUAA 1G3CA 2PLXA 4B2AA 2ZDMA 4X8UH 4YO9A 3SZEA 2RCEA 3PV4A 4THNH 3BTWE 5F8TA 1QNJA 1LKBA 2G55A 3NWUA 3UB0A 1KLTA 1DT2A 2VVVA 3MMGA 1UTQA 4E05H 1C2KA 2C4FH 1Y3YA 1YY3A 2A5AA 2UUJB 3MU5A 1FJSA 1EOJA 1GL1A 3F6UH 1JWTA 4VGCB 3HATH 3KGPA 4B6FA 4ESTE 1AE5A 4HI3A 1YLCA 1V2QT 1C2EA 1RS0A 2CK3D 1HAVA 1MKWH 1BJUA 1WQVH 1AHTH 2ZO3H 1O2UA 2BY9X 5DN6D 4OGXA 1Y3VA 5GJ4B 4WMEA 1MTWA 3A84A 3WWFA 1SG8B 2RA0A 5E0JA 1BRAA 2AGGX 5T6GA 2H5CA 4HG6A 2QF4A 2AS9A 4Q7YA 2QV1A 4BTTB 1S83A 2XBYA 3V7TA 5FXLA 2PUQH 4K2YA 3LKWA 1FY5A 1SGPE 1GBTA 1BRUP 2BDHA 1F7ZA 1O32A 2PTNA 3OAAD 1XX9A 4A6LA 4AFSA 3AASA 1ZPZA 4KTCA 1V2VT 1ARCA 1CT2E 2F9PA 1AUJA 1Y5UT 5F03A 4ZUHA 3MYWA 3B8JA 2WPDD 4F55A 1QBOA 2YMSC 1KXBA 3OEED 1GCTB 3T62A 4X8TH 3BTDE 1MTNB 3U1JB 2THFB 2LPRA 1ID5H 3A8AA 2ZF0H 1A46H 1GI7B 3PMAB 1G3BA 1DX5M 3RP2A 4BAKB 4JK5A 2OD3B 2A5KA 4ABBA 1EZSC 1L4DA 5EXMA 2GDDA 1GBAA 3BF6H 2BD4A 4NA8A 3V3MA 6GCHG 1A5GH 4FOUC 1O2SA 1L0ZA 3HKJB 4Y0YE 3FP7E 1DXWA 1BBRH 2VWNA 3SOSA 3VGCC 3KQDA 2V0BA 1RIWB 1SB1H 4IMQA 2A7HA 4NA7A 3MU4A 1O2QA 5C2ZA 3VB7A 4DCDA 1GVKB 1WCZA 2C8XB 1GJCB 1E36B 3CENA 4NCYA 4A1VA 1CBWB 2XXLA 5FPYA 2ULLA 1GHWH 1CBWC 2FX6A 3OY5U 1ANCA 2ZIQH 5L2YH 3UREA 2M5TA 3TJNA 2EEKA 1FN8A 3MH7A 2WHXA 3B9FH 1DS2E 2B7DH 4NSYA 1P3EA 1YCPH 1MD7A 4MLFB 2A7JA 3GICB 5FCRA 1Q2WA 1SL3A 1FX0B 1DPOA 2F9OA 2QXHA 3OSYA 2CXVA 5BRRE 5FCKA 1EX3A 1RGQA 3ZVGA 1L1JA 3T27A 2KR7A 5EPNA 4UFFH 3D62A 2PP6A 2PUXB 1N6XA 1K0HA 1IQLA 1KXAA 2FI3E 3AK5A 4NWLA 1UVUH 1L2EA 4BTIB 1VITF 3ATIA 1O3LA 4NIYA 4ABIA 2ZPRA 4NFFA 4ZXXH 3S9CA 3M3TA 5GXPA 4NSVA 2GZ7A 1XUFA 3MO9A 2ZHFH 3A8BA 4I31A 2R2WU
chains in the Genus database with same CATH topology
1MMJN 1P06A 1O3FA 3A7WA 1V2ST 1P2NA 3UOUA 2ODQA 1FZZA 1NY22 2C93B 1DUEA 1K21H 2F9BH 4TY6A 4AOQA 2CMYA 3LC3A 4Y11E 4F49A 1WV7H 3T25A 3UQVA 1HJ9A 5DGJA 3PTBA 5GIBA 2WPMS 3P95A 2H2ZA 1UK3A 1L4ZA 3HGNA 4X1QU 1DUAA 1ZSKA 3SJ8A 3D65E 2ZCKP 1HNEE 1O2XA 2OC8A 1QL8A 4CREA 1B5GH 2NWNA 2ANYA 2FOBA 1GJBB 1O34A 5DP9A 3TGKE 2F9VA 3LPRA 2Z9JA 1BIOA 1AWFH 4WMDA 2XCFA 2TBSA 1C4V2 3GDSA 1NRNH 1EP5A 1FPHH 4CR9A 5GDSH 1U6QA 4K8BA 4ABEA 3SHAH 1T4UH 2ZU2A 1WTHD 1O2NA 5A09A 1MUEB 4K1TA 1D9IA 1TA2A 4Z6AH 1ESAA 1UCYE 1RRKA 1FUJA 2KAIA 2JH6D 1MTUA 2HPPH 1NO9H 4ASHA 2ZGHA 1EP6A 4ABGA 4Y8ZA 1C5NH 3UR9A 1C5QA 2PW8H 1TIOA 1OSSA 4JYTA 2HPQH 2VWOA 5LH8A 1HRTH 1JRTA 2B8OH 1AVGH 1SOZA 1GVLA 4A92A 1GHVH 1N8OB 1UTNA 1XUIA 2XCNA 4KGAA 1ZMNA 2TPIZ 3SU1A 2STAE 2BOHB 4KTUA 4B71A 1T32A 3QLPH 1GHBF 1IQNA 4AG2A 5G4BA 1A5IA 1OPHB 3E3TA 3SGAE 1NTPA 1V2LT 1WUNH 3ATKA 3V13A 1YGCH 3M3SA 1OWJA 1V2WT 1TNJA 1LHEH 3TU7H 2FEQH 2Z9IA 1TLDA 1QTFA 3FAOA 1NRQH 2VVCA 3E1XB 3QGNB 3R3GB 1VGCC 1H9IE 2PKAA 1GMCG 1TGBA 1PJPA 1KXFA 1W0ZU 1FMGA 1VJAU 1XVOA 3LH1A 1RTFB 2BTCE 2FI4E 1PQAA 2YOLA 2OXSA 1YPMH 3SJIA 1Y3WA 4FUFA 4FVBA 1V2UT 2HNTE 1BDAA 1Y5AT 4YM9A 4H6SB 1SGTA 2BXTH 3P8NA 4MPWA 1CO7E 5A0CA 3LT3A 1VZQH 3G01A 4INHA 2SNWA 3RXOA 3ODFA 1P3CA 3B23B 1EKBB 2WV5A 3BTFE 2BVRH 3EA7A 3GY5A 4DGJA 1NS3A 1RXPA 2GVFA 4TWYA 2ZDNA 1C5MD 3A83A 4B1TA 1BBRK 4JMYA 1UTMA 3SJ9A 2ZDKA 1C5ZB 2AIPA 1A0JA 3AW0A 1D6RA 1TX8A 3KCGH 4NIWA 5C1XA 1FN6A 1O2GH 2O9QA 2ANKH 1P02A 1C2LA 4FUJA 4D8NA 1FAKH 5F6MA 2VWLA 2BD2A 1TPSA 1TBRH 4I33A 1MU6B 1UCYH 4O03A 3KQEA 3MFJA 1GG6C 4NIVA 1P05A 2AMDA 1LVBA 1MKXH 2UWPA 4BTUB 4MNYA 3F9HA 1CGHA 1EJNA 1ZR0A 1ZGVA 3U8OH 5E2PA 1O2KA 2BDAA 4AZ2B 3CP7A 1OKXA 5ESBA 1ZPCA 3M37A 1YKTA 1JOUB 4X2XA 4X2VA 2V6NA 3O8DA 2A5IA 5E8EH 4A5TS 1O5GH 3RXKA 5DP7A 1FIWA 1P03A 4OS4A 1VITH 3VFEA 1C1RA 2GT8A 1S6FA 2QXGA 3RXRA 1S5SA 1YPHE 2Y5FA 4I8LA 4CHAB 1XXDA 1V2JT 4AFZA 1LDTT 1IQKA 3OTJE 1ZTLA 4FUIA 3TVJB 3L3TA 3UTUH 5EU8A 3KQBA 1ANEA 3OX7U 1HDTH 1G37A 1KTSB 1C5LH 1TNIA 1HYLA 1AY6H 3RC4A 2BLOA 4Y7BA 1ETSH 1BCUH 4BXWA 1GHZA 2WPJS 5JB9S 4YLUA 5PTPA 1AB9B 2FOAA 2F83A 2OINA 1FONA 1O2ZA 1OWHA 3VB5A 1G2LA 1GMHF 1AFQB 1Q3XA 2FDAA 2O8WA 1GHAF 1CQQA 3QWCH 1HJAB 5DPAA 4AYVB 1NROH 4ISNA 1AKSA 1UTOA 3EA8A 3TJUA 3D49H 1PPGE 4OS2A 1EQ9A 1Z8IB 3AAVA 1BB0B 1W10U 5A0AE 1AD8H 1UMAH 3TK5A 4JZIA 3PWCA 2Z3DA 1C9PA 1OS8A 1P2IA 2VIVA 1KXEA 1LHFH 2BLWA 2R9PA 1ABIH 1O5BB 4Q2KA 4WH6A 5IYTA 1X7AC 1CA0C 3TGIE 1Z1JA 5FPSA 2JH0D 4WMFA 1O3JA 3BG4B 2ZQ1A 3Q3XA 3Q76A 2CV3A 1MAXA 2ZFFH 1IQHA 1NRRH 3HKIB 3MI4A 2GMTC 1K28D 1EOLA 3K65B 1W8BH 1JIMA 1SGNE 1SGCA 1J15A 1QBVH 5DP3A 1NN6A 4CR5A 2H6MA 1SMFE 2BDBA 5TCCA 3KQCA 3ELAH 2F3CE 5H4IB 2ZFTA 2CGAA 3KIDU 3NZIA 2A1DB 5GPIB 2ZU1A 1BT7A 3BV9B 1E35B 2WUCA 5T3HA 2G00A 1C5VA 2UWLA 3K6ZA 2A45B 5C1UA 3F1SB 1KXCA 2KAIB 4OS1A 2FX4A 1GJ7B 3PMHB 3NKKA 4B75A 1AUTC 2ZDAH 2VIQA 3Q3KA 2PGBB 2H5DA 2J2UA 1NFWA 1XVMA 2CF8H 1O39A 2BXUH 1ELCA 3A7TA 2CHAC 2OCVB 3NPSA 4H6TA 6ESTA 1EXFA 3A8CA 5EW1H 4D7FA 4U30A 3LGVA 2FS8A 1O3IA 1HIAA 3MHWU 4BAMB 4DG4A 1O3HA 1G3DA 1P8VC 2VIDA 1SFQB 3GCOA 1C4Y2 4UDWH 1GJ8B 1HV7A 3DT0H 3LGUA 1GMCF 2VWMA 1WAYB 2VH6A 1ZJKA 2PKAB 1PQ5A 3RXJA 1IHTH 3RU4E 4CRCA 1W3CA 1D3TB 2ZC9H 1MQ6A 1RJXB 4BAQB 2O8MA 1WOFA 2ZCLP 2BLQA 3SI4H 2PKSC 3SORA 2HRVA 1HAXB 1MTSA 3TJVA 3SNCA 4BOHA 1ESBA 3E8LA 3P70B 1V2KT 1OYTH 2W5EA 1OOKB 1M9UA 4HFPB 2GZ8A 3ZV8A 3QO6A 4IGDA 1OWEA 4WVPE 1NRPH 2A4RA 1BMAA 1G9IE 1O2IA 3LJOA 3TITA 3GYLB 4FUBA 4AG1A 1DOJA 1O2OA 1O0DH 1V2MT 2P93A 3LONA 3MOCA 3RLWH 4IBLH 1DSTA 3S7KB 1NM6A 5K0HA 1YPLH 1S6HA 5HMAA 1P04A 1W12U 2SGEE 4ZMAH 3ATWA 4F4OC 1HCGA 2AGEX 1NPMA 3SU6A 1LHCH 3RXVA 1AZ8A 2BD3A 5FBEA 3KNXA 4RKOB 5GCHF 3MH4A 3SNEA 2ZQ2A 1JIRA 4X1SU 1ZJDA 3L33A 1ESTA 1TRMA 4MNVA 3BTKE 1P2KA 1C1UH 4FUEA 1J8AA 3KEEA 1EASA 1VCPA 1G30B 1LHGH 1SOTA 2G5VA 2GCHF 3MTYA 2AH4X 3QN7A 2W7SA 1BTHH 4K60A 4X2WA 1SC8U 3SHCH 4GHQA 5EOKA 5K7RA 1TPAE 2DE8A 4O3UA 1IQFA 4ABFA 1O3BA 2GD4B 3RDZA 3TIUA 5JB8S 1OP2A 1SSXA 2P16A 3ZZ7A 4X1NU 9ESTA 4B74A 1TMUH 1K1IA 3P17H 3U98H 2B5TB 3I78A 4MNWA 4TPYA 3TK6A 3MU8A 1V2OT 1ELGA 1YPHC 1O3GA 1C2HA 1EPTB 4B2CA 3HK6B 1GI8B 4IN1A 4MVNA 2JH5D 3PM3A 1CHGA 1SLWB 1EPTC 1Z1IA 2P95A 1KIGH 4PROA 2BX4A 2TGPZ 2OQ5A 5CMXH 1B7XB 2NU0E 3PLKA 2ZU5A 5DKMA 2HOBA 3I77A 2IPHA 3RXGA 3BTGE 2SGFE 3HK3B 3A88A 4K8YA 3M7UA 3SUDA 1QGFA 3H7TA 2ANWA 3RMMH 2DUCA 3U8TH 1A4WH 9LPRA 1GI0A 1TA6A 2FOHA 2VJ1A 2ANMH 4AORA 2ZFRH 4U32A 1C1MA 4BXSA 1YPEH 3C1KA 4BAOB 4KELA 2BQ6B 1SGIB 2A32A 1QFKH 1P11E 2TGDA 1GGDB 2QAAA 4CBNA 1GBMA 2BMGB 4ABJA 1ELEE 3CS7A 3GYMA 3TNTA 1HJAC 4RSPA 5FAHA 1HAHH 3A87A 2VIWA 3O8CA 1GHXH 4UEHH 2ZTYA 1GBKA 2FOGA 2R2MB 5IDKA 3SU4A 1Z6JH 4ZAEA 3TH4H 1MZAA 1K9OE 3DFLA 1OX1A 3KF2A 1MCTA 2HNTC 3A82A 3PTNA 1EJMA 1SGYE 1GHYH 2J34A 3SZNA 4I8HA 3ITIA 1RD3B 1H8IH 1WQSA 1EZXC 1GMHG 1P9UA 2GGVB 4IMZA 3SJKA 6GCHF 1O5FH 1SHHB 3ZYDA 2ZGJA 1CU1A 2JETC 2OQUA 3A7VA 4DY7B 8ESTE 1O2WA 4TPIZ 1C1PA 2OTVA 4ISHH 2PSYA 4UFEH 1Y5BT 3ZVAA 1TGCA 4JCNA 4RKJB 3RU4D 1QQUA 3TLOA 1BUIA 1YPJH 2C3SA 2HWLB 3BTTE 4Y79A 5CE1A 3U69H 1LPKB 2VGCB 4I32A 3MNSA 5GCHG 3LH3A 1T8LA 3U1IB 1Y59T 1GJ9B 3K9XB 3IITA 1XXFA 3SUEA 3ATMA 3PWBA 1GBEA 1O2HA 4ISIH 1P2QA 1GBBA 1SGRE 4M7GA 1PPEE 5EXLA 5J4SA 3QGJA 3SQHE 4ZHMU 2ZA5A 4VGCC 1TALA 1NU9A 3FZZA 2QN5T 5SGAE 1TQ7B 1C5XB 1TBQH 1T4VH 2EA3A 1SQTA 3OU0A 5EG4A 3H5CB 1F5LA 3S9AA 2Q6FA 4A7IB 5B6OA 1VCWA 1KTTB 3M36A 3OYPA 4BNRA 5T6DA 3PMBB 3U8RH 1HXEH 2R0LA 3DUXH 2CJIA 2EI7A 2ZHWH 1D4PB 2JETB 2O8TA 1ARBA 3T28A 3S9BA 3MU0A 1FY8E 5I46H 1KDQA 1QHRB 1ZLRA 2C8YB 1UVTH 1O3EA 3R0FA 3DHKH 1HAGE 2XWBI 1P12E 3SU0A 1QJ7B 3ZZ6A 1TBZH 2SGDE 3A7XA 1O36A 1QL7A 2PKSB 2XYAA 1Y3XA 1EAWA 2TGTA 3BIUH 3MU1A 3V0XA 3BEFB 1G36A 3N7OA 3ZZ3A 2HLCA 4NA9H 1GHAG 1TOMH 5F8XA 1TGTA 3M61U 1QIXB 1CE5A 2BHGA 4XBCA 2ILNA 1V3XA 1TGNA 4AB8A 1W0YH 1ZOMA 2NU1E 1F2SE 2Z9GA 3DD2H 4ZHLU 3W95A 4NWKA 3SGQE 1ZRKA 3ZZ4A 2A4OA 4CBOA 1QRWA 1A1RA 1GI3A 1VJ9U 3RXFA 1O37A 4GVUA 4TY7A 1AFQC 1LHDH 1LQDB 3VXEH 3S69A 4DIHH 1A3EH 1ZYOA 3GY2A 2GCTB 2O8UA 2BYAX 5DP8A 1LVYA 3STJA 2BY8X 4SGAE 2G8TA 4LZ1H 4XFQA 1HAVB 2VU8E 1PYTC 4IC6A 3PROA 1N8OC 4X0WU 3ZZBA 2NU2E 3PLBA 2NU3E 3E6PH 2VIPA 5A8ZA 1GI2A 2A7CA 1GI6A 3LOXA 4Y76A 1ELAA 2A2XH 1GJDB 3UNSA 1TWXB 1MZDA 3ZV9A 1ANBA 1DICA 4TYDA 1O3PB 2FWWA 4XSKU 2SFAA 1ANDA 4X1PU 3SU3A 3URDA 5L6NH 4UD9H 1ZGIA 1QB1A 4ZHAA 2TIOA 2A2QH 2AEIH 1LVMA 1AVWA 3ZVDA 2W7UA 4XBBA 3LC5A 1QJ1B 2PHBA 3RC6A 1HFDA 1K2I1 1A0LA 1C5SA 1G2MA 4RN6A 1C2DA 1FV9A 1A7SA 2UUYA 3EA9A 2G5NA 1KDQB 1ELBA 5TCAA 2FIRH 3BTQE 4MQAA 1CVWH 2PGQB 3RXUA 2WPIS 5L2ZH 4CRFA 1MU8B 1SGEE 4D76A 4J1YA 2GT7A 1O3NA 2ZECA 1MTVA 1F92A 3S0NA 4O97A 2I6QA 4GHTA 4K69A 4DT7B 4X6MA 3FZDA 2QA9E 4AX9H 1GJ5H 1DANH 4CRBA 1O5CB 5C20A 2J4IA 2EI8A 4Y0ZE 2TGAA 1AFEH 2WPHS 3QTVH 2FYQA 3A85A 5I25A 4LK4A 1N6YA 1AIXH 1AVXA 3GDUA 1W14U 2ESTE 3P8OA 4DURA 1DVAH 3TH2H 1SI5H 3AW1A 1QY6A 4JYVH 5CHAC 2OC0A 5AF9H 2FOEA 3LGYA 5DP6A 1RFNA 1AE8H 1ZRBA 4U01A 1MD8A 4MPUA 3RXIA 4AB9A 2Y81A 4KTSA 1XUJA 3MH6A 2PV9B 3A81A 4TWWA 1ELDE 4Q80A 1C1WH 1YF4A 5AHGH 3LGTA 1IQIA 2C8ZB 3Q3YA 1K1NA 1IQJA 4UFDH 3UPEA 2ZU4A 1VCQA 2P8OC 2GTBA 2ZNKH 5FPTA 1BMLA 2FI5E 4GPGA 3RUOA 1TMBH 2GDEH 1G32B 5AFYH 1LPZB 3PMJA 2FTLE 3WY8A 5DG6A 1UCYK 1ELVA 4YT7H 5F8ZA 4IW4E 1TYNA 2QY0B 4YESB 1CA0B 3C27B 3GY8A 4MNXA 5C5NA 2HNTF 1AN1E 1K22H 1P57B 2R0KA 4K3JA 4XDEA 2PTCE 2ALPA 3ZVFA 3VPKA 4AFUA 1O3KA 1HAOH 5AFZH 4GAWA 1QJ6B 3EE0B 5DP5A 2ZDVH 1TPPA 3KHVA 2GMTB 1F5RA 4FXGH 2O8LA 1GJ6A 2G4TA 3GCTF 1RTLA 1P9SA 3BEIB 4BANB 4DIIH 3NXPA 1GI9B 1S84A 2W3IA 2ZFQH 2UWOA 1EAXA 1O5DH 4FVDA 4DW2U 3UFAA 3P8FA 1LPGB 2RA3A 1H1BA 1SLVB 1P01A 1OWDA 2HALA 1E37B 2EI6A 3F9EA 1UK2A 3M35A 1QBNA 8LPRA 2A31A 3BG4C 2H9EH 2OLGA 3TH3H 3S7HB 5DP4A 3QDZB 2A4GA 2I6SA 1AKSB 1TOCB 4E7RG 3ODDA 3AAUA 2D1JA 1JRSA 1H4WA 3A8DA 4JZDH 4JK6A 1AMHA 1O35A 1GBCA 1V6DA 3TGJE 3UNRA 4FUGA 1ELTA 1AB9C 1EJAA 1HXFH 1C4U2 2ZU3A 1Z8GA 1TFXA <