1SLUB

Rat anionic n143h, e151h trypsin complexed to a86h ecotin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
216
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKVATVALPSSCAPAGTQCLISGWGHTLVNHPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (serine protease/inhibitor)
molecule keywords ECOTIN
total genus 53
structure length 216
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sluB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sluB02
3SJIA 3FP7E 2VWNA 2PHBA 2XBVA 5FBEA 1C2LA 1W7XH 1Z8GA 4NSYA 1TGCA 4NIVA 2BXUH 1O37A 3L33A 3UQOA 5EW2H 3SV8A 2ZP0H 4YZUA 3P8FA 3ZZ5A 2HGTH 1IQFA 1SLUB 4AFZA 4O3TA 4OS2A 1ZR0A 3BTFE 2FI4E 2AH4X 1MZDA 7KMEH 1YKTA 2P16A 1PPFE 2BHGA 1E37B 3MH5A 4K2YA 1VITG 4Q80A 1YBWA 1SSXA 1TPPA 3MH6A 4H42U 4CRAA 1FPHH 1KXDA 2SGAA 3F9GA 1T4UH 1NU7B 4ZXYH 3MNCA 1ESBA 3GY7A 3T29A 1G3DA 4ZMAH 1GI8B 1MTUA 2FWWA 1NO9H 1BMMH 2O8TA 1JOUB 3DFLA 1KLTA 3U69H 4CBOA 2FM2A 3ATIA 2D8WA 4BAQB 2AGGX 2PKSC 2C3SA 3AAUA 1FIWA 2ZWLH 1HYLA 1UVTH 2J92A 4X8TH 1SQAA 3EA9A 1PYTD 3V0XA 3RXSA 1MBMA 4IMQA 2TGTA 1P12E 1PPBH 2OTVA 3SNBA 1O5DH 1PQAA 5GIBA 3SBKA 1EP5A 3QX5H 3KGPA 2ZDLA 2B5TB 2ZGJA 2K1QA 3MU4A 1GHYH 2H1UA 3MI4A 1F92A 2UUFB 2G4TA 3UNRA 3DFJA 2QXGA 2JETC 1Z6EA 1K22H 2GDEH 3ZV9A 2FP7B 2A4OA 1BCUH 2F9OA 2AMDA 2JH5D 2PLXA 1V2QT 2BVRH 2BXTH 1C5NH 2HNTC 2FODA 2VVCA 5TJXA 4KTSA 2G81E 1IQIA 5FPSA 1ZZZA 1ELFA 4F4OC 5A8YA 1ZSKA 2A2XH 1Z8IB 1H8DH 1HLTH 1AFEH 2TGDA 1KXFA 2QC2A 4JYUH 1XUJA 4DIHH 3FZDA 1T31A 1AFQB 1RIWB 4SGAE 1C1PA 1QA0A 1YPEH 4XDEA 1SOTA 1KDQB 1T32A 2ZTZA 1SOZA 1DY8A 3AAVA 1GVKB 5E0JA 1QB1A 1CA0B 4YT7H 1ELAA 2BLOA 3SJKA 1C5ZB 1FLEE 3SI4H 1OWJA 3U1IB 2ZU4A 1EQ9A 1BIOA 1NESE 1GHAF 2GVFA 1P9UA 2BDCA 1GI7B 2XC4A 1QR3E 1UTNA 1SHYA 1GJBB 1GCTC 1KY9A 5A0BA 1CA8B 3RU4E 1D6RA 4K3JA 1P2IA 1O38A 2BD2A 1P09A 3VXFH 2NU1E 2UWOA 4B71A 1P9SA 3RMMH 1BHXB 1F7ZA 2EI6A 1BMAA 2A5AA 3RU4T 2BD3A 2A1DB 1GCDA 1C2KA 4Z0KA 4ZH8A 2LPRA 1GI4A 1ANDA 1C1TA 3ZYEA 4BANB 3PO1B 1DS2E 3F1SB 1J9CH 5C1XA 3S0NA 1UHBA 1XVOA 5DP4A 1GHVH 4Y79A 1CGHA 1P04A 1TALA 2XWAA 1SGQE 5GXPA 2BLWA 2B0FA 3LONA 4NA8A 1HPGA 4CRFA 1Q2WA 1RXPA 2GCHF 1EUFA 1HAIH 3RXHA 1O2JA 2A4RA 4U30A 4BXSA 3D62A 1OOKB 3S9AA 1MH0A 5CE1A 4WMEA 1TMBH 2XTTB 1HV7A 3MH4A 4BAKB 4K8BA 4U32A 2OC0A 1AVXA 4NWKA 4TPIZ 1E38B 3BTWE 3SW2B 1QQUA 3DD2H 2W5EA 2PW8H 1AWHB 5EODA 3PYHA 1UTQA 1C1VH 2H9HA 1YF4A 2J9NA 4FUIA 1TABE 3OSYA 4SGBE 1XMNB 1O33A 3NK8A 3S69A 1O5EH 2AIQA 2ZZUH 1TNIA 3A8DA 2XC5A 4JZEH 1O2IA 1OWEA 3UREA 1ELEE 1ACBE 3T26A 3VFEA 4VGCB 1A61H 1Z7KA 1ZTLA 1HBTH 2ZU1A 5GJ4B 3STJA 2ZHDA 2BD9A 1GJAB 1N8OC 1LO6A 1CHOG 2ALPA 5C1YA 3BF6H 2BX4A 1C5YB 3F9HA 2C8XB 1A1RA 1W2KH 1DPOA 3PTNA 5JBAS 5SGAE 2PGQB 2ZIQH 1AFQC 1V2UT 1MTSA 1GBLA 8GCHG 1T7CA 2ZHFH 1HRTH 1QQ4A 1O2ZA 2PGBB 2FI5E 1O2OA 1YPMH 3UNQA 1GMDF 3HK3B 1ELDE 1CQQA 2B9LA 1DWEH 2ILNA 1ABJH 1QY6A 3SGAE 2BDYA 3KQDA 1NM6A 4ZKOU 1S82A 3M5LA 1D6WA 2WV4A 1A3EH 5JBBS 3A82A 4FUHA 1A5IA 4AG2A 3JZ2B 5AF9H 1Y3WA 4FUFA 4K1SA 1O2PA 4XBBA 1C2IA 3RXDA 1BZXE 1VJAU 3RXIA 2ZO3H 2WYGA 2GMTC 2DE8A 3GOVB 3KF2A 3QO6A 4LXBH 1DUEA 1UK3A 4GAWA 1WQVH 1HAZB 1GJDB 2BDGA 3M7TA 1K1MA 2V3OH 1BMNH 3AW1A 2W7SA 4O3UA 2ZA5A 1W8BH 1UCYK 1W12U 1YGCH 2EC9H 3IG6B 3NPSA 1QRXA 4IN1A 4AX9H 2R2WU 1ARBA 2VIOA 3S9BA 3BEIB 1GBEA 1Z1JA 4ZHLU 1TGSZ 3MWIU 3TU7H 1NY22 2G4UA 1IAUA 3SI3H 2FYRA 1AQ7A 1OWIA 4I8HA 1ORFA 2H2ZA 4IN2A 4X0WU 1ZGVA 1UTKA 1G2MA 1O2UA 3TGIE 1E34B 1O32A 3PMJA 4INHA 4UFGH 2ASUB 1GBDA 1GGDB 2BLQA 2O8UA 3ZZ6A 3GCOA 2V6NA 9LPRA 1EZQA 3SJ8A 1L4DA 3U8RH 4Y0YE 2GT8A 1GHAG 3ZZ9A 1GPZA 3A7XA 5JB9S 2G52A 3QTVH 2FS8A 2H5CA 2V35A 1AUTC 2BY5X 3E90B 3PROA 4ABBA 3STIA 3PWBA 2W7UA 2Z9KA 4YOIA 1KXCA 4AB8A 4Y11E 4Y6DA 1YPHE 3SU0A 2BDIA 4I8KA 1Y5BT 5EPNA 5C5OA 1BTXA 1F0UA 1SBWA 2F9NA 4THNH 4AYVB 1PPCE 2FI3E 3SU1A 1PPZA 1XUIA 4BOHA 2GT7A 4BAHB 4GCHG 1GJ4H 2C90B 3DA9B 1W11U 1O3NA 2ZDKA 3ELAH 4YT6H 3LIWA 3M5NA 1O3KA 1GMCG 1ID5H 1AN1E 1S5SA 3I77A 5JDUB 1XXFA 3OU0A 7GCHG 3MO9A 3ZVBA 2QA9E 2UUYA 4BAMB 4UFFH 1SHHB 5HMAA 2BYAX 1XUGA 2OCVB 1Y3YA 1PFXC 1GDUA 3W95A 1QJ7B 1CU1A 1SLVB 3A88A 2P95A 2GCTC 4NCYA 1WQSA 4CHAB 3KN2A 1UVPA 3CS7A 1H4WA 1YPLH 1HXFH 2G5VA 3LDXH 1C2DA 3P8OA 4IGDA 1AE8H 1VGCC 1C9TA 1GBMA 1O2QA 1P02A 2GGVB 2NU2E 2STBE 2QGRA 3M3TA 4MPVA 5EXLA 1OWDA 3ZVAA 5J4SA 1LHFH 4FUBA 1HAPH 1NU9A 5HM9A 4YLUA 3UY9A 1VCQA 4NZLA 3OX7U 1K21H 4WF8A 2GP9B 1O2GH 1O3JA 4LOYH 2ZCHP 1GHZA 1SGCA 1F5RA 1C2FA 1TQ0B 1SLWB 3EDXB 2BD5A 1CBWC 1KDQA 1EAXA 1BT7A 1MU8B 1O3DA 1V2VT 1GBFA 4GHQA 4MVNA 3FZZA 1K9OE 1RRKA 1DSUA 4X8SH 1T8LA 1C5WB 1UMAH 1GBKA 5A0AE 1VITF 1AKSB 1H9IE 1AZZA 1INCA 4NA7A 2BY9X 4D9RA 2Y7XA 1AIXH 1MQ6A 4DT7B 4I7YH 1BTPA 3ODFA 4MTBA 4UE7H 7LPRA 1SVPA 4HTCH 5E2OA 3IITA 4ZHAA 4XBCA 3M37A 5IYTA 5A0CA 4YO9A 2BOKA 5A2MH 4DVAU 1QGFA 3QDZB 1LQEA 2J95A 1C5TA 2M5TA 3A89A 3MHWU 2H6MA 1ANCA 1O3PB 4ABIA 1CT0E 1QL8A 3SNCA 1GL0E 1QA7A 2GMTB 3E16B 4TWYA 1GI0A 2ZFRH 3SN8A 4AB9A 4OS5A 5L30H 1HAOH 2RG3A 2Q6FA 1TOCB 4AG1A 2TIOA 1U6QA 4RKOB 3LH3A 1DWDH 3Q3KA 1CO7E 1C2JA 3TK5A 2DUCA 4NIWA 1BBRH 2O8LA 3RMNH 2G55A 1MTVA 2CXVA 3WY8A 1K1LA 2GV7A 2ANYA 4FU7A 4TWWA 3P70B 3E3TA 1EX3A 4FUJA 1Z6JH 3R3GB 4BXWA 1D9IA 1SGFA 2XC0A 3BTTE 3KQCA 1EJAA 4GHTA 5JBTA 3A85A 1O3LA 5T6GA 4ZHMU 1SLXB 8LPRA 5FBIA 2PTCE 3NWUA 3U9AH 5F03A 2OXSA 1O3MA 4MNYA 1GJ6A 4X2WA 3H7TA 5TCCA 2F9VA 1Q31A 3W94A 4Q7XA 4XSKU 2ALVA 2CHAC 3HPTB 2QYIA 4Q7ZA 4A5TS 4K8YA 4ZKRU 4XFQA 2WPHS 1FQ3A 3OYPA 1O2MA 5FPYA 5GPIB 3OY6U 1MKWK 3KL6A 4MPXA 4IC6A 3P95A 4CH8B 3PV4A 3UOPA 4XBDA 1YM0A 3FFGA 1THRH 4NG9H 3SV7A 2VNTA 1UO6A 2CF8H 4B2CA 4B73A 3PMHB 5PTPA 2ZGBH 3MNXA 1SB1H 3KQEA 2JKHA 1O5BB 2FIRH 1E35B 3D23A 2ZFQH 3E0NB 1OP0A 3SQEE 1ZTJA 1OWKA 1LKBA 5T6FA 3E8LA 1NRPH 1UCYE 1LKAA 3SUDA 3FVFB 5K7RA 3A7WA 2Z3EA 1UCYH 2R2MB 1PPEE 1L4ZA 3TK6A 3UFAA 1A5HA 4KTCA 3VXEH 3KHVA 2FS9A 1P2KA 1QB9A 2XW9A 2ZDAH 4DCDA 2XYAA 3ZVDA 1PYTC 1T8OA 1V2NT 2SGFE 1ZHMA 1ELGA 5C2ZA 1FY8E 1S85A 3BTEE 4AFSA 4LK4A 1JRSA 1P0SH 3F6UH 1S6FA 2XCFA 1NRSH 1O2RA 3MH7A 4ZUHA 1EB1H 2P8OB 2TRMA 1BHXF 5J4QA 2D2DA 1GWAA 4K1TA 3RXAA 1RGQA 2HRVA 2BDAA 2FOBA 3HKIB 3I29A 1V2LT 4X6MA 1NZQH 4YOJA 2HPPH 1Y59T 5EQSA 2ZHQH 4O97A 2WPKS 2ZC9H 4OS6A 1E36B 1GCTB 3TNTA 3V13A 2NU4E 4X1RU 1TB6H 2PR3A 2RA0A 3HGPA 2Y7ZA 1SGRE 3I78A 4ISLA 3M36A 1P8VC 4HGCA 3RM2H 4K60A 1NFXA 2ZGHA 2PV9B 6GCHF 1WTHD 1FUJA 4MPUA 1K1PA 2SGQE 4DOQA 2A0QB 4GLYA 3U1JB 1O2KA 5HM2A 1O2SA 2Z7FE 1TNHA 4X1QU 4X1NU 3T27A 1OWHA 4I8LA 3TK9A 2A32A 2F83A 3UWIA 3O8CA 1TRYA 2OQ5A 1S83A 1C5MD 1BB0B 1H8IH 1O3IA 5FAHA 5B6OA 1FMGA 2ZEBA 4OGXA 2OUAA 3ODDA 3VB6A 1F5LA 1UVOA 3ATMA 3BTKE 3ZZDA 1QNJA 1MU6B 1FI8A 3BTGE 2SGPE 4XOJA 2V3HH 2BD8A 2P3TB 4Q7YA 3VEQB 1EOJA 1KXEA 2VWMA 2A5IA 2Y81A 3KQBA 1MKXH 3QTOH 1TNLA 2B8OH 3E6PH 2QXHA 4Y7AA 3GYMA 1GI9B 1VZQH 3D65E 2ZNKH 1Y8TA 3CENA 2ULLA 1O3EA 1Y3XA 1TX8A 1TPOA 1TGTA 3E1XB 2W26A 5EPYA 1P11E 2Z3CA 5DP3A 1EZXC 2UWPA 4I33A 3EAJA 3NZIA 3BTHE 1OXGA 1ZLRA 1LHCH 1BOQA 3A80A 1TBZH 5DP7A 2QCYA 2P8OC 1EPTC 2QF3A 4X8UH 4VGCC 3C1KA 1W0ZU 1ZPZA 1YPHC 1O2TA 1DICA 1GMCF 1MTNB 1O35A 1G30B 2RCEA 1VITH 3T28A 4E05H 3GY2A 1LHEH 1HFDA 1P2MA 1QCPA 3LC3A 2CN0H 1WV7H 1C4V2 2IJOB 4D9QA 5A8XA 3RLWH 1AD8H 3A7ZA 4ABFA 2LNCA 4B74A 1FIZA 4DW2U 4R8TB 1CE5A 3SO3A 2QF0A 2PKSB 1PPGE 5DGJA 1YYY1 2QV1A 1MBQA 3TGJE 1AKSA 1V2JT 1D3QB 1WSSH 4X6OA 1MTNC 3NKKA 1A0JA 3TJNA 3ZZ3A 1G3EA 2IOTA 4DURA 4WWYA 1Z71A 4BTIB 2J34A 1QBVH 4NA9H 3SNDA 1CA0C 1HCGA 3A8CA 1W14U 1IHTH 2BM2A 2PSXA 2HWLB 3PMAB 1GI2A 3RU4D 2AGIX 3RXOA 1ETTH 1DVAH 3ENSB 1W3CA 3RMOH 3UTUH 1A4WH 1FY5A 2BOHB 2ZDVH 2FZZA 1A3BH 3GICB 1Z8RA 4Y8XA 5G4BA 2QXIA 3O8BA 2J94A 1GMHF 1SL3A 2ODPA 2G5NA 2THFB 2Z9LA 2BY6X 4JZDH 1BMLA 2WPJS 2A4QA 2C8ZB 3OY5U 3RXFA 4ASHA 1V2ST 3ZZ8A 1O3GA 1VCPA 3KEEA 1FN6A 3PLBA 1KSNA 4I31A 4JZ1A 4D7FA 2AYWA 4B2BA 3T2NA 1O3FA 4JCNA 1SPJA 1ZSJA 1KLJH 2VIDA 1BQYA 1C4Y2 2FPZA 1C5OH 2PSYA 1GDNA 2O8WA 1EAUA 4WMFA 4AFQA 1HUTH 1KYNA 1P05A 1F0RA 1RIWC 1BBRK 2FOGA 4JZIA 1A5GH 2BDBA 3ATWA 4X6NA 2ZCKP 1TLDA 2FDAA 3K65B 1XX9A 8ESTE 2OBOA 1ZGIA 2XBXA 4IBLH 3DHKH 1P2QA 1O3OA 4MPWA 5EQRA 3PM3A 4TY7A 2QY0B 5C1UA 1NFWA 5I46H 1MMJN 1MKWH 3B8JA 2FOMB 4O03A 4WH6A 1L1NA 1NFUA 3GCHB 4NSVA 1G9IE 1GVZA 3GDUA 1XKAC 1GHBG 2TGAA 2BVSH 3SQHE 1OX1A 1HGTH 2OBQA 1OPHB 3LKWA 3TJVA 1GJ7B 1BRCE 1GG6B 4OS4A 3BTME 1EP6A 1GMDG 3A8BA 2AMQA 2GD4B 5I25A 1A46H 2ZG0H 1K28D 3V7TA 2VU8E 1KTSB 3MNSA 1DUAA 3PB1E 1HNEE 5IDKA 1DX5M 4R0IA 1WCZA 1ZTKA 4BAOB 1UK2A 4H4FA 3QWCH 1NROH 4AORA 1DDJA 5LPFA 1WBGB 3GDSA 2BD7A 1BRAA 1GJ8B 1XUHA 1TNJA 3MU0A 1D3DB 3ATKA 4AOQA 4FXGH 4ABEA 4UEHH 4Y0ZE 1TRMA 1MCVA 1HAXB 4K1EA 3AASA 1UTMA 5DP8A 3BIUH 1DANH 3A7TA 2SNWA 1BITA 1GHWH 1V2WT 2PFEA 1SGYE 1ELCA 1S81A 1KLIH 1P2NA 1RFNA 2VWLA 4FUCA 3GY3A 3SOSA 4NIYA 1MD7A 3M3SA 3TITA 5JBCS 1TGBA 3P8NA 1D4PB 2P59A 1HJAB 1ZOMA 3QLPH 1O5GH 2FEQH 1FNIA 3M35A 2HOBA 1TX7A 5DKMA 4O9VA 6LPRA 1DLEA 4UD9H 3EYDA 1QJ6B 1HAVA 1THPB 4GUXA 4MNWA 1C5SA 4MNVA 1HAHH 1C5PA 1Y5AT 1AGJA 2R9PA 1C1QA 4H6SB 1EXFA 5FCRA 4FU9A 1P3EA 4WY3A 1BTHH 2F9BH 2F9PA 4CR9A 1FV9A 3T5FH 3URCA 9ESTA 2C4FH 2Q1JA 2BZ6H 3Q3YA 4ABDA 1ANEA 1O5FH 1SI5H 4KGAA 3BEUA 1ZYOA 2G51A 3BTDE 2TGPZ 1NPMA 3IWMA 1L1JA 1A0HB 1EAWA 2FTLE 2PUQH 3O8DA 1TWXB 3SNAA 1L0ZA 4I8GA 1ETRH 1ANBA 2C8YB 4AN7A 4HZHA 1C5QA 1FZZA 3VPKA 2BD4A 2OC8A 1DOJA 1LPKB 4CRBA 1V2MT 2CF9H 2VH0A 1O39A 2Z6BD 3SV2H 2VB0A 1BTWA 1V2PT 1LDTT 2UUKB 3F9FA 3P8GA 1CSOE 2ZPQA 4B1TA 1UTLM 2ZTYA 4Q2KA 5FPTA 5LGOA 2EI7A 1IQGA 2FMJA 3SJOA 4ABGA 3MOCA 3PTBA 4X1PU 4BTUB 2XNIA 4RSPA 2FO9A 3MO6A 2A7JA 4B2AA 2QAAA 1T4VH 3RXJA 3QGNB 3BSQA 5GCHG 1NRQH 1PPHE 1SGEE 1O2NA 1EAIA 1N1LA 1C5LH 3PLPA 3VGCB 3LGTA 4X6PA 5EG4A 4ISIH 1NRRH 1S0QA 3MO3A 4TY6A 4UFEH 1GHBF 3QGJA 3RXUA 4CH2B 4CRCA 4WJG2 2Z9JA 1GBCA 6CHAB 3SU5A 4OS1A 2BLVA 3FP6E 4CRDA 1V2OT 1O2VA 2BY8X 5GDSH 1CHGA 1G3BA 1GJ9B 5A09A 4ISOA 4Y8YA 2A7HA 2SGEE 2Z94A 2JH6D 1VCWA 2WPIS 2AIPA 1G32B 2WPMS 2XBWA 4FU8A 3TH3H 2ZPSA 4KELA 3GCTG 2ZPRA 3TVJB 1CGIE 5EXMA 2NU3E 1EPTA 1TNGA 5E8EH 2ZFPH 3EA7A 4Y7BA 2VIWA 2OP9A 1FDPA 1A2CH 4F49A 1B7XB 1TOMH 3VB4A 2J4IA 3S7KB 4JZFH 2CGAA 2WPLS 2ZCLP 4Y8ZA 4ISNA 1QHRB 1EKBB 4NIXA 3RUOA 1THSH 3HGNA 4MNXA 2AS9A 2CMYA 3A86A 4MLFB 4NGAH 1ESTA 3LT3A 3K9XB 4A92A 1NTPA 1GDQA 3UR9A 1CVWH 1YPJH 1AVWA 1C2GA 1LVOA 3Q00A 4MQAA 5ESTE 1JIRA 1HAYB 1WTGH 1P03A 1YP9A 5JB8S 1PQ5A 1AVGH 1GI6A 2STAE 3DT0H 2H5DA 1WYKA 1AB9B 1O0DH 1OSSA 3SU4A 2YNAA 1BTZA 3LJJA 2SFAA 1S0RA 3SU3A 1K1JA 1NC6A 1Y3VA 3M5MA 3RXBA 1LPZB 1EASA 2Y82A 1D3PB 3EE0B 4YOGA 1ELTA 3RXLA 1ZRBA 5HYOA 2PWXA 3KIDU 1GJCB 1NFYA 5ABWA 2Z9GA 3GCTF 3U8TH 4A1TA 2ZHWH 4UDWH 1SMFE 1P01A 2ZQ1A 5EQQA 1LVYA 1V6DA 2I6QA 2VWOA 1AO5A 5C3NA 2G00A 4BTTB 4MDSA 4ESTE 3LJOA 4FUDA 4UONA 1E0FD 4D8NA 1O2WA 3PLKA 3SUGA 2XRCA 3TNSA 3GISB 1AB9C 3UPEA 4DGJA 3QK1A 2ZGXH 1ESAA 1EZUC 4FVDA 1O31A 1O5AB 5E0HA 2R3YA 3SHCH 2G8TA 1AE5A 2FLBH 4Y76A 1CT2E 3GY6A 4ABJA 1ELBA 1MUEB 1UTPA 2Y5FA 5DJ7A 3UR6A 1HIAA 5FX5A 4WXVA 4BNRA 4Z6AH 1SC8U 2WUBA 4FUEA 4INKA 2Y6TA 4AZ2B 2D26C 2F91A 2BZAA 1V2RT 3HKJB 5DPAA 2IPHA 1MD8A 1YC0A 4NWLA 4KP0A 5E2PA 2OINA 3UUZA 3HATH 3QUMP 3RXRA 3MMGA 5BRRE 1QBNA 2IN2A 1XM1A 2CJIA 4AFUA 2ODQA 5JYIA 1WAYB 4NFEA 2VIQA 5LPRA 3MU8A 1AUJA 5K0HA 1KXBA 1SR5C 1SFQB 2Y80A 1SGPE 2YNBA 1O30A 2BX3A 2ANMH 1BUIA 1O34A 1NT1A 2FTMA 1GI3A 3HK6B 1EZSC 1O3AA 1Y5UT 2FLRH 3RP2A 2WYJA 2EEKA 4IC5A 1V2TT 1IHSH 5DO4H 2ZHEH 3A7YA 2XBYA 1SGTA 4UFDH 3RM0H 3M61U 1FXYA 1JBUH 2OC7A 2BTCE 4B75A 1YPKH 8KME2 2C8WB 5EW1H 1OS8A 1BDAA 2PTNA 4U2WA 1LQDB 3UNSA 1IQNA 1DXWA 1C2MA 3TPIZ 3KNXA 4CRGA 2ZI2H 3LGYA 1Y3UA 1Z1IA 2Y5GA 2FOFA 3RC5A 3SZNA 3RXPA 3T62A 4JYTA 4AGKA 4OGYA 1IQKA 1YPGH 4IW4E 3RXTA 3SUEA 1EJNA 1TMTH 2HLCA 5LH8A 1QTFA 1PQ8A 5FX6A 2O8MA 4I8JA 3EGKH 3TIUA 3ZVEA 1QFKH 3G01A 4JK5A 1PJPA 1FPCH 1LHDH 4FVBA 2FOAA 1SGIB 2KAIB 1O2XA 3SNEA 2OD3B 3ZZ7A 4XE4A 2ZDNA 1DT2A 3U98H 3K6ZA 1VR1H 7ESTE 3Q76A 3SU2A 3DUXH 1GBJA 2FOEA 4X1SU 1GG6C 1F0SA 5F8ZA 1P10A 1IQLA 1LHGH 4INLA 4QT8C 4M7GA 2ZFSA 1UVSH 4NZQA 2VIVA 3RXCA 1MZAA 1O3HA 3A7VA 1ZJKA 2Y5HA 1M9UA 3RXQA 1GBBA 1J8AA 2FOHA 5C67A 1FY4A 1QJ1B 3RMLH 2HPQH 4ZXXH 1G36A 3JZ1B 4Y10E 5DK1A 1RS0A 3B9FH 3LGVA 2P94A 3RDZA 1UJ1A 3OTJE 1AU8A 4CR5A 2VVUA 4MG3A 1FONA 2FXRA 3H7OA 3A84A 1MCTA 1O5CB 1FY3A 5GWZA 3BN9A 2XWBI 2VJ1A 1EJMA 4GSOA 3SV9A 3O8RA 3LGWA 1DITH 2AERH 1ZMNA 3BIVH 2J2UA 5AFYH 2R3UA 1XXDA 1GVLA 1GHXH 2V0BA 2FYQA 2GTBA 3F68H 1C1MA 2GV6A 5EGMA 1B5GH 5BPEA 4RKJB 2A2QH 2VINA 4KTUA 2PKAA 3ZZ4A 2VIPA 3LGUA 5F8TA 1QIXB 5EU8A 5HGGA 2ZU3A 1F5KU 1SQTA 2TBSA 6ESTA 3LGIA 3VB5A 1BJUA 3P17H 1K1NA 4WMDA 1EATA 1RTKA 2SGDE 1QURH 1C1OA 3GY8A 3Q3XA 1TNKA 2GDDA 2DE9A 1FY1A 5GCHF 2HVXA 1IQHA 1PQ7A 2UWLA 4E06H 1H9HE 1N6XA 4A1XA 1NRNH 4K5ZA 3GY5A 3A81A 4X8VH 1P2JA 1AI8H 3RXMA 4D76A 1KTTB 4OS7A 4WVPE 2BQ6B 5FCKA 1W10U 1TGNA 1ABIH 1MAXA 1GJ5H 4HI3A 3K2UA 5DG6A 5H4IB 3R0FA 1HXEH 1XUFA 3MFJA 3MU1A 1FN8A 1TMUH 4AGJA 2ZF0H 3FP8E 3LPRA 3CP7A 8GCHF 1HAGE 1BA8B 2KAIA 4NFFA 1ZHRA 4YM9A 4IS5A 4D7GA 1TFXA 2AMPA 1BJVA 3ITIA 3P92A 1GI5A 1OYTH 4ABHA 1CGJE 3RC4A 1VJ9U 3NCLA 1JRTA 5EOKA 1GBIA 1WU1A 1HJAC 1HIAB 1GBAA 1MAYA 1C1UH 1EPTB 4YESB 3TH4H 7GCHF 2GZ7A 1C5UA 1UK4A 3E91A 4KKDA 3TGKE 5TCAA 2NU0E 4H6TA 1GMHG 3CS0A 4ZROA 2VGCB 3FANA 1RD3B 1V2KT 3ZVFA 2H9TH 3FAOA 1AHTH 2VVVA 4DJZB 1YCPH 5F8XA 1D3TB 1TAWA 2GZ8A 2RA3A 1MQ5A 3GDVA 1B0EA 1C1WH 2ZTXA 3TH2H 4TPYA 1ELVA 2Q6GA 2UUJB 3ZV8A 1WUNH 1J14A 1G2LA 2GKVE 1ZRKA 1CBWB 5C20A 1LCYA 4LZ1H 4TYDA 1J15A 2P3UB 1XVMA 1C5VA 1K1OA 1GGDC 1BTUA 3RXVA 1SGDE 1W7GH 3ZYDA 3ZVCA 2ZFTA 1X7AC 2NWNA 5HXFA 5E0GA 4ZKSU 3TJOA 1QL9A 2WINI 4J1YA 3VB7A 1C5RA 1JXPA 1QB6A 1L2EA 5F6MA 1JMOH 1VGCB 2HALA 4JYVH 3EA8A 3TJUA 1RTFB 3GCHC 4X2VA 3BG4B 4B76A 1DLKB 1C9PA 2Z3DA 2BMGB 4CHAC 2ESTE 1TX6A 1YLCA 3RXEA 2GCTB 1NN6A 2GX4A 2YOLA 1NS3A 3KCGH 3LU9B 1SGNE 1FAXA 4ZAEA 3MTYA 2BB4A 2Q6DA 2ZQ2A 1YCPM 3QZQA 5AFZH 3MNBA 4WXIA 4AYYB 4LZ4B 3N7OA 2QXJA 2W3KA 3QN7A 2OC1A 4JMYA 2ZU5A 3NXPA 1S84A 4GPGA 3V3MA 3TLOA 5CMXH 3U8OH 5LPEA 1JIMA 1TBQH 2P93A 5AHGH 2EI8A 3RXGA 1AMHA 1HDTH 2J38A 1N6YA 4CREA 1O2LA 1LVMA 3SU6A 2FOCA 3V12A 3SHAH 1AWFH 1ZPBA 4X2XA 1RTLA 1TYNA 1UTJA 1RJXB 3A87A 1GI1A 3BEFB 1DWBH 1ZJDA 3L6PA 2AGEX 4I32A 5T3HA 4JK6A 2ZGCA 3PO1C 5CHAC 1EOLA 1T8MA 2FX6A 1C1SA 1C2EA 1LMWB 1V3XA 1HJ8A 1W13U 5T6DA 3M5OA 3F9EA 1G37A 1OP8A 2OQUA 1XUKA 1BBRE 4A7IB 5DP6A 1B0FA 1GBTA 1K2I1 1TQ7B 1DM4B 1N8OB 4E7RG 2BDHA 3T25A 1ZSLA 4Y71A 4DIIH 3S9CA 2A5KA 1TA6A 3ZZAA 1SQOA 1LVBA 2A7CA 3H5CB 4K69A 1SG8B 1T8NA 3GY4A 1F2SE 3LC5A 3UQVA 1LTOA 1C1RA 1CT4E 1TONA 3PWCA 1UVUH 3SGBE 2ZDMA 1DE7H 1TA2A 1H9LB 1C1NA 3M7QA 2BQ7B 3GYLB 3BV9B 1O36A 2H9EH 4FUGA 1FJSA 2R0KA 3NUMA 1S6HA 2CHAB 3RLYH 1TPSA 1SGFG 2R0LA 1ETSH 5FXLA 1A0LA 1TBRH 2FX4A 1J16A 1TPAE 1FAKH 3SJ9A 1WOFA 3A83A 2D1JA 5C5NA 1AY6H 2B7DH 2ZU2A 4J2YB 5L6NH 4X2YA 5DP9A 1O3CA 3E0PB 1GBHA 2WV5A 3UIRA 3BTQE 3M3VA 2ZECA 3D49H 1J17T 1DWCH 4U01A 2QIQA 1C4U2 3EQ0H 3BG8A 1P06A 2WUCA 1QRZA 4DY7B 2ANWA 3URDA 3VB3A 2ZKSA 4ABAA 1HAVB 2P3FH 3BG4C 4IMZA 5DP5A 1O2HA 1GL1A 1IQMA 3SV6A 1DFPA 1Z8JB 2GZ9A 3C27B 1O2YA 3P6ZB 3B23B 1K1IA 1DSTA 1P57B 4GCHF 1HB0B 2FESH 1C5XB 5FHTA 2AFQB 1P3CA 2XXLA 4GVUA 3VGCC 2W3IA 2BVXH 1CHOF 4HFPB 2C93B 1IOEA 1OYQA 2I6SA 3LOXA 2ODYB 2CV3A 2EA3A 5EXNA 1W0YH 1BRUP 3UWJH 2ANKH 4WH8A 3SORA 4ZKNU 1A7SA 1UHBB 2PUXB 1HJ9A 1MKXK 3ATLA 1ZPCA 3LH1A 3ZZCA 6CHAC 1ZHPA 1QBOA 2ZFFH 1QRWA 1XKBC 1UTOA 1QL7A 1EB2A 1TIOA 3L3TA 1L1GA 4A1VA 1DY9A 1KIGH 1H1BA 2HNTE 2OLGA 5ETXA 2A31A 2F3CE 2TPIZ 1SFIA 4CBNA 6GCHG 2Z9IA 2PKAB 2SNVA 1G3CA 1O3BA 2VGCC 5L2ZH 2VH6A 1BRBE 1F0TA 3M7UA 2A45B 2AEIH 3RXKA 2F9UA 1Q3XA 5JPMH 1BTYA 4YTAA 3K6YA 3SGQE 4A6LA 1MTWA 1YCPK 4RN6A 3UOUA 1LPGB 1C2HA 1TE0A 2BQWB 1IQEA 3AVZA 2BY7X 1DXPA 3PMBB 2GCHG 5CHAB 3A8AA 3S7HB 1YLDA 1KXAA 3ESTA 1IQJA 5ESBA 1AZ8A 4E7NA 2RDLA 2O9QA 4ISHH 3SUFA 3MU5A 5AVDA 1ZMLA 1OKXA 3AW0A 3Q77A 3ZVGA 3ZZBA 5L2YH 3MYWA 1P2OA 4PROA 2JETB 1JWTA 2HNTF 5A8ZA 4DG4A 2A4GA 3RC6A 3GCNA 1ARCA 2QN5T 3QZRA 2JH0D 1TRNA 2XCNA 4YLQH 1ZMJA 1OP2A
chains in the Genus database with same CATH superfamily
3SJIA 3FP7E 2VWNA 2PHBA 2XBVA 5FBEA 1C2LA 1W7XH 1Z8GA 4NSYA 1TGCA 4NIVA 2BXUH 2EQNA 1O37A 3L33A 3UQOA 5EW2H 3SV8A 2ZP0H 4YZUA 3P8FA 3ZZ5A 2HGTH 1IQFA 1SLUB 4AFZA 4O3TA 4OS2A 1ZR0A 3BTFE 2FI4E 5KGOA 2AH4X 1MZDA 7KMEH 1YKTA 2M2AA 2P16A 2RDEA 1PPFE 2BHGA 1E37B 3MH5A 4K2YA 1VITG 3DSGA 4Q80A 1YBWA 1SSXA 1TPPA 3MH6A 4H42U 4CRAA 1FPHH 1KXDA 2SGAA 3F9GA 1T4UH 1NU7B 4ZXYH 3MNCA 1ESBA 3GY7A 3T29A 1G3DA 2WV9A 1GI8B 4ZMAH 1MTUA 2FWWA 1NO9H 1BMMH 2O8TA 1JOUB 3DFLA 1KLTA 3U69H 4CBOA 2FM2A 3ATIA 2D8WA 4BAQB 2AGGX 2PKSC 2C3SA 3AAUA 1FIWA 2ZWLH 4XD7D 3MQKC 1HYLA 1UVTH 2J92A 4X8TH 1SQAA 3EA9A 1PYTD 3V0XA 3RXSA 1MBMA 4IMQA 2TGTA 5KEDA 1P12E 1PPBH 2OTVA 3SNBA 1O5DH 1PQAA 5GIBA 3SBKA 1EP5A 3QX5H 3KGPA 2ZDLA 2B5TB 5B6LA 4HG6A 2ZGJA 2K1QA 3MU4A 1GHYH 2H1UA 3MI4A 1F92A 2UUFB 2G4TA 3UNRA 3DFJA 2QXGA 2JETC 1Z6EA 1K22H 2GDEH 3ZV9A 2FP7B 2A4OA 1BCUH 2F9OA 2AMDA 2JH5D 2PLXA 1V2QT 2BVRH 2KCYA 2BXTH 1C5NH 2HNTC 2FODA 2VVCA 3FN8A 2J97A 4KTSA 5TJXA 2G81E 1IQIA 5FPSA 1ZZZA 1ELFA 4F4OC 5A8YA 1ZSKA 2A2XH 1Z8IB 2J98A 1H8DH 1HLTH 1AFEH 2TGDA 1KXFA 2QC2A 4JYUH 1XUJA 4DIHH 3FZDA 1T31A 1AFQB 1RIWB 4SGAE 1C1PA 1QA0A 1YPEH 4XDEA 1SOTA 1KDQB 1T32A 2ZTZA 1SOZA 1DY8A 1E1QD 1GVKB 3AAVA 5E0JA 1QB1A 1CA0B 4YT7H 1ELAA 2BLOA 3SJKA 1C5ZB 1FLEE 3SI4H 1OWJA 3U1IB 2ZU4A 1EQ9A 1BIOA 1NESE 1GHAF 3KQ5A 2GVFA 1P9UA 2BDCA 1GI7B 2XC4A 1QR3E 1UTNA 1SHYA 1GJBB 1GCTC 1KY9A 5A0BA 1CA8B 3CNRA 3RU4E 1H8ED 1D6RA 4K3JA 1P2IA 1O38A 2BD2A 1P09A 3VXFH 2NU1E 2UWOA 4B71A 1P9SA 3RMMH 1BHXB 1F7ZA 2EI6A 2YMSB 1BMAA 2A5AA 3RU4T 2BD3A 2A1DB 1GCDA 1C2KA 4Z0KA 4ZH8A 2LPRA 1GI4A 1ANDA 1C1TA 3ZYEA 4BANB 3PO1B 1DS2E 3F1SB 1J9CH 5C1XA 3S0NA 1UHBA 1XVOA 5DP4A 1GHVH 4Y79A 1CGHA 1P04A 1TALA 2XWAA 1SGQE 5GXPA 2BLWA 2B0FA 3LONA 4NA8A 5T1VA 1HPGA 4CRFA 1Q2WA 2JJ1D 1RXPA 2GCHF 1EUFA 1HAIH 3RXHA 1O2JA 2A4RA 4U30A 4BXSA 3D62A 1OOKB 3S9AA 1MH0A 5CE1A 4WMEA 1TMBH 2XTTB 1HV7A 3MH4A 4BAKB 4K8BA 4U32A 2OC0A 1AVXA 4NWKA 4TPIZ 1E38B 3BTWE 3SW2B 1QQUA 3DD2H 2W5EA 2PW8H 1AWHB 5EODA 4F48B 3PYHA 1UTQA 1C1VH 2H9HA 4B6FA 1YF4A 2J9NA 4FUIA 1TABE 3OSYA 4SGBE 1XMNB 1O33A 3NK8A 3S69A 1O5EH 4Q4LA 2AIQA 2ZZUH 1TNIA 3A8DA 2XC5A 4JZEH 1O2IA 1OWEA 3UREA 1ELEE 1ACBE 3T26A 3VFEA 4VGCB 1A61H 1Z7KA 1ZTLA 1HBTH 2ZU1A 5GJ4B 3STJA 2ZHDA 2BD9A 1GJAB 1N8OC 1LO6A 1CHOG 2ALPA 4TT3D 5C1YA 3BF6H 2BX4A 1C5YB 2XOKD 3F9HA 2C8XB 1A1RA 1W2KH 1DPOA 3PTNA 5JBAS 5SGAE 2PGQB 2F43B 2ZIQH 1AFQC 1V2UT 1BMFD 1MTSA 1GBLA 8GCHG 1T7CA 4M9FA 2ZHFH 1HRTH 1QQ4A 1O2ZA 2PGBB 2FI5E 1O2OA 1YPMH 3UNQA 1GMDF 3HK3B 1ELDE 1CQQA 2B9LA 1DWEH 3KYFA 2ILNA 1ABJH 1QY6A 3SGAE 2KFWA 2BDYA 3KQDA 1NM6A 4ZKOU 1S82A 3M5LA 1D6WA 2WV4A 1A3EH 2JIZD 5JBBS 3A82A 4FUHA 1A5IA 4AG2A 3JZ2B 5AF9H 4AC9A 1Y3WA 4FUFA 4K1SA 1O2PA 4XBBA 1C2IA 3RXDA 1BZXE 1VJAU 2WHXA 3RXIA 2ZO3H 2WYGA 2GMTC 2DE8A 3GOVB 3KF2A 3QO6A 4LXBH 1DUEA 1UK3A 2F4LA 4GAWA 1WQVH 1HAZB 1GJDB 2BDGA 3M7TA 1K1MA 2V3OH 1BMNH 3AW1A 2W7SA 4O3UA 2ZA5A 1W8BH 1UCYK 1W12U 1YGCH 2IJD1 2EC9H 3IG6B 3NPSA 1QRXA 4IN1A 4AX9H 2R2WU 1ARBA 2WZQA 2VIOA 3S9BA 3BEIB 3OEHD 1GBEA 1Z1JA 4ZHLU 1TGSZ 3MWIU 3TU7H 1NY22 2G4UA 1MABB 1IAUA 3SI3H 2FYRA 1AQ7A 1OWIA 4I8HA 1ORFA 2H2ZA 4IN2A 4X0WU 1ZGVA 1UTKA 1G2MA 1O2UA 3TGIE 1E34B 1O32A 3PMJA 4INHA 4UFGH 2ASUB 1GBDA 1GGDB 2BLQA 2O8UA 3ZZ6A 3GCOA 2V6NA 9LPRA 1YY3A 1EZQA 3SJ8A 1L4DA 3U8RH 4Y0YE 2GT8A 1GHAG 3ZZ9A 1GPZA 3A7XA 5JB9S 2G52A 2LELA 3QTVH 2FS8A 2H5CA 2V35A 1AUTC 2BY5X 4DT4A 3E90B 3PROA 4ABBA 3STIA 3PWBA 2W7UA 2Z9KA 4YOIA 1KXCA 4AB8A 4Y11E 4Y6DA 1YPHE 3SU0A 2BDIA 1UW7A 4I8KA 1Y5BT 5EPNA 5C5OA 1BTXA 1F0UA 3DSOA 1SBWA 2F9NA 4THNH 4AYVB 1PPCE 2FI3E 3SU1A 1PPZA 1XUIA 4BOHA 2GT7A 4BAHB 4GCHG 1GJ4H 2C90B 3DA9B 1W11U 1O3NA 2ZDKA 1NBMD 3ELAH 4YT6H 3LIWA 3M5NA 1O3KA 1GMCG 1ID5H 1AN1E 1S5SA 3I77A 5JDUB 1XXFA 3OU0A 7GCHG 3MO9A 3ZVBA 2QA9E 2UUYA 4BAMB 2QF5A 4UFFH 1SHHB 5HMAA 2BYAX 1XUGA 3OEED 2OCVB 1Y3YA 1PFXC 1GDUA 3W95A 1QJ7B 1CU1A 1SLVB 3A88A 2P95A 2GCTC 3EE7A 4NCYA 1WQSA 4CHAB 3KN2A 5C0TA 1UVPA 3CS7A 1H4WA 1YPLH 1HXFH 2G5VA 3LDXH 1C2DA 3P8OA 4IGDA 1AE8H 1VGCC 1C9TA 1GBMA 1O2QA 1P02A 2GGVB 2NU2E 2STBE 2QGRA 3M3TA 4MPVA 5EXLA 1OWDA 3ZVAA 5J4SA 1LHFH 2WPDD 4FUBA 1HAPH 1NU9A 5HM9A 4YLUA 3UY9A 1VCQA 4NZLA 3OX7U 1K21H 3F2FA 4WF8A 2VBCA 4P00A 2GP9B 1O2GH 1O3JA 4LOYH 2ZCHP 1GHZA 1SGCA 1F5RA 1C2FA 1TQ0B 1SLWB 3EDXB 2BD5A 3KYGA 1CBWC 1KDQA 1EAXA 1BT7A 1MU8B 1O3DA 1V2VT 1GBFA 4GHQA 1E1RD 4MVNA 3FZZA 1K9OE 1RRKA 1DSUA 4X8SH 1T8LA 1C5WB 1UMAH 1GBKA 5A0AE 1VITF 1AKSB 1H9IE 1AZZA 1INCA 4NA7A 2BY9X 4D9RA 2Y7XA 1AIXH 1MQ6A 4DT7B 4I7YH 1BTPA 3ODFA 4MTBA 4UE7H 7LPRA 1SVPA 4HTCH 5E2OA 3IITA 4ZHAA 4XBCA 3M37A 5IYTA 2QE7D 5A0CA 4YO9A 2BOKA 5A2MH 4DVAU 1QGFA 3QDZB 1LQEA 2J95A 5DSFA 1C5TA 2M5TA 3A89A 3MHWU 2H6MA 1ANCA 1O3PB 4ABIA 1CT0E 1QL8A 3SNCA 1GL0E 1QA7A 2GMTB 3E16B 4TWYA 1GI0A 2KCOA 2ZFRH 3SN8A 4AB9A 4OS5A 5L30H 1HAOH 2RG3A 2Q6FA 1TOCB 4AG1A 2TIOA 1U6QA 4RKOB 3LH3A 1DWDH 3Q3KA 1CO7E 1C2JA 3TK5A 2DUCA 4NIWA 1BBRH 2O8LA 3RMNH 2G55A 1MTVA 2CXVA 3WY8A 1K1LA 2GV7A 2ANYA 3PRBA 4FU7A 4TWWA 3P70B 3E3TA 1EX3A 4FUJA 1Z6JH 3R3GB 4BXWA 1D9IA 1SGFA 2XC0A 3BTTE 3KQCA 1EJAA 4GHTA 5JBTA 3A85A 1O3LA 5T6GA 4ZHMU 1SLXB 8LPRA 5FBIA 2PTCE 3NWUA 3U9AH 5F03A 2OXSA 1O3MA 4MNYA 1GJ6A 4X2WA 3H7TA 5TCCA 2F9VA 1YWUA 1Q31A 3W94A 4Q7XA 4XSKU 2ALVA 2CHAC 3HPTB 2QYIA 3OFND 4Q7ZA 4A5TS 4K8YA 4ZKRU 4XFQA 2WPHS 1FQ3A 3OYPA 1O2MA 5FPYA 5GPIB 3OY6U 1MKWK 3KL6A 4MPXA 4IC6A 3P95A 4CH8B 3PV4A 3UOPA 4XBDA 1YM0A 3FFGA 1THRH 4NG9H 3SV7A 2VNTA 1UO6A 2CF8H 4B2CA 4RT1A 4B73A 3PMHB 5PTPA 2ZGBH 3MNXA 1SB1H 2PP6A 3KQEA 2JKHA 1O5BB 2FIRH 1E35B 3D23A 2ZFQH 3E0NB 1OP0A 3SQEE 5GNDA 1ZTJA 4OM9A 1OWKA 1LKBA 4FETA 5T6FA 1WDIA 3E8LA 1NRPH 1UCYE 1LKAA 3SUDA 3FVFB 5K7RA 3A7WA 2Z3EA 1UCYH 2R2MB 1PPEE 1L4ZA 3TK6A 3UFAA 1A5HA 4KTCA 3VXEH 3KHVA 2FS9A 1P2KA 1QB9A 2KR7A 2XW9A 2ZDAH 4DCDA 4YXWD 2XYAA 3ZVDA 1PYTC 1T8OA 1V2NT 1W0KD 2SGFE 1ZHMA 1ELGA 5C2ZA 1FY8E 1S85A 3BTEE 4AFSA 4LK4A 1JRSA 1P0SH 3F6UH 1S6FA 2XCFA 1NRSH 1O2RA 3MH7A 4ZUHA 1EB1H 2P8OB 2TRMA 1BHXF 5J4QA 2D2DA 1GWAA 4K1TA 3RXAA 1RGQA 2HRVA 2BDAA 2FOBA 3HKIB 3I29A 1V2LT 4X6MA 1NZQH 4YOJA 2HPPH 1Y59T 5EQSA 2ZHQH 4O97A 2WPKS 2ZC9H 4OS6A 1E36B 3FO8D 1GCTB 3TNTA 3V13A 2W6JD 2NU4E 4X1RU 1TB6H 2PR3A 2RA0A 3HGPA 2Y7ZA 1SGRE 3I78A 4ISLA 3M36A 1P8VC 4HGCA 3RM2H 4K60A 1NFXA 2ZGHA 2PV9B 6GCHF 1WTHD 1FUJA 4MPUA 1K1PA 2SGQE 4DOQA 2A0QB 1E79D 4GLYA 1O2KA 3U1JB 3F3BA 1O2SA 2Z7FE 5HM2A 1TNHA 4X1QU 4X1NU 3T27A 1OWHA 4I8LA 3TK9A 2A32A 2F83A 3UWIA 3O8CA 1TRYA 2OQ5A 1S83A 1C5MD 1BB0B 1H8IH 1O3IA 3H09A 5FAHA 5B6OA 1FMGA 2ZEBA 4OGXA 2OUAA 3ODDA 3VB6A 1F5LA 1UVOA 3ATMA 3BTKE 3ZZDA 1QNJA 1MU6B 1FI8A 3BTGE 2SGPE 2HVYB 4XOJA 2V3HH 2BD8A 2P3TB 4Q7YA 3VEQB 1EOJA 1KXEA 2VWMA 2A5IA 2Y81A 3KQBA 1MKXH 3QTOH 1TNLA 2B8OH 3E6PH 2QXHA 4Y7AA 3GYMA 1GI9B 1VZQH 3D65E 2ZNKH 1Y8TA 3WWFA 3CENA 2ULLA 1O3EA 1Y3XA 1TX8A 1TPOA 1TGTA 3E1XB 2W26A 5EPYA 1P11E 2Z3CA 5DP3A 1EZXC 2UWPA 4I33A 3EAJA 3NZIA 3WW7A 3BTHE 1OXGA 1ZLRA 2JJ2D 1LHCH 1BOQA 3A80A 1TBZH 5DP7A 2QCYA 2P8OC 1EPTC 2QF3A 4X8UH 4VGCC 3C1KA 1W0ZU 1ZPZA 1YPHC 1O2TA 1DICA 2K8IA 1GMCF 1MTNB 1O35A 1G30B 2RCEA 1VITH 3T28A 4E05H 3GY2A 3AK5A 1LHEH 1HFDA 1P2MA 1QCPA 3LC3A 2CN0H 4TSFD 1WV7H 1C4V2 2IJOB 4D9QA 4B6EA 5A8XA 3RLWH 1AD8H 3A7ZA 4ABFA 2LNCA 4B74A 1FIZA 4DW2U 4R8TB 1CE5A 3SO3A 3VG8A 2QF0A 2PKSB 1PPGE 3F2HA 5DGJA 1YYY1 2QV1A 1MBQA 3TGJE 1AKSA 1V2JT 1D3QB 1WSSH 4X6OA 1MTNC 3NKKA 1A0JA 3TJNA 3ZZ3A 1G3EA 2IOTA 4DURA 4WWYA 1Z71A 4BTIB 2J34A 1QBVH 4NA9H 3SNDA 1CA0C 1HCGA 3A8CA 1W14U 5HIYA 5EJLA 2LP6A 1IHTH 2BM2A 2PSXA 2HWLB 3PMAB 1GI2A 3RU4D 2AGIX 3RXOA 1ETTH 1DVAH 3ENSB 1W3CA 3RMOH 3UTUH 1A4WH 1FY5A 2BOHB 2ZDVH 2FZZA 1A3BH 3GICB 4ACBA 1Z8RA 4Y8XA 5G4BA 2QXIA 3O8BA 2J94A 1GMHF 1SL3A 2ODPA 2G5NA 2THFB 2Z9LA 2BY6X 4JZDH 1BMLA 2WPJS 2A4QA 2C8ZB 3OY5U 3RXFA 4ASHA 1V2ST 3ZZ8A 1O3GA 1VCPA 3KEEA 1FN6A 3PLBA 1KSNA 4I31A 4JZ1A 4D7FA 2AYWA 4B2BA 3T2NA 1O3FA 4JCNA 1SPJA 1ZSJA 1KLJH 2VIDA 1BQYA 1C4Y2 2FPZA 1C5OH 2PSYA 1GDNA 2O8WA 4Q63A 1EAUA 4WMFA 4AFQA 1HUTH 1KYNA 1P05A 1F0RA 1RIWC 1BBRK 2FOGA 4JZIA 1A5GH 2BDBA 3ATWA 4X6NA 2HLDD 2ZCKP 1TLDA 2FDAA 3K65B 1XX9A 8ESTE 2OBOA 1ZGIA 2XBXA 4IBLH 3DHKH 1P2QA 1O3OA 4MPWA 5EQRA 3PM3A 4TY7A 2QY0B 5C1UA 1NFWA 5I46H 1MMJN 1MKWH 3B8JA 3DCLA 2KCPA 2FOMB 4O03A 4WH6A 1L1NA 1NFUA 3GCHB 4NSVA 3UB0A 1G9IE 1GVZA 4ZCNA 3GDUA 1XKAC 1GHBG 2TGAA 2BVSH 3SQHE 1OX1A 1HGTH 2OBQA 1OPHB 3LKWA 3TJVA 1GJ7B 1BRCE 1GG6B 4OS4A 3BTME 1EP6A 1GMDG 3A8BA 2AMQA 2GD4B 5I25A 1A46H 2ZG0H 1K28D 3V7TA 2VU8E 3PV2A 1KTSB 3MNSA 1DUAA 3PB1E 1HNEE 5IDKA 1DX5M 4R0IA 1WCZA 1ZTKA 4BAOB 1UK2A 4H4FA 3QWCH 1NROH 4AORA 1DDJA 5LPFA 1WBGB 3GDSA 2BD7A 1BRAA 1GJ8B 1XUHA 1TNJA 3MU0A 1D3DB 3ATKA 4AOQA 4FXGH 4ABEA 4UEHH 4Y0ZE 1TRMA 1MCVA 1HAXB 4K1EA 3AASA 1UTMA 5DP8A 3BIUH 1DANH 3A7TA 2SNWA 1BITA 1GHWH 1V2WT 3U28C 2PFEA 1SGYE 1ELCA 1S81A 1KLIH 1P2NA 1RFNA 2VWLA 4FUCA 3GY3A 3SOSA 4NIYA 1MD7A 3M3SA 3TITA 5JBCS 1TGBA 3P8NA 1D4PB 2P59A 1HJAB 1ZOMA 3QLPH 1O5GH 2FEQH 1FNIA 3M35A 3OE7D 2HOBA 1TX7A 5DKMA 4O9VA 6LPRA 1DLEA 4UD9H 3EYDA 1QJ6B 1HAVA 1THPB 4GUXA 4MNWA 1C5SA 2QF4A 5HKKD 4MNVA 1HAHH 1C5PA 1Y5AT 1AGJA 2R9PA 1C1QA 4H6SB 1EXFA 5FCRA 4FU9A 5KECA 1P3EA 3FOAA 4WY3A 1BTHH 2F9BH 2F9PA 4CR9A 1FV9A 3T5FH 3URCA 9ESTA 2C4FH 2Q1JA 3PRDA 2BZ6H 3Q3YA 4ABDA 1ANEA 1O5FH 1SI5H 4KGAA 3BEUA 1ZYOA 2G51A 3BTDE 2TGPZ 1NPMA 3IWMA 1L1JA 1A0HB 1EAWA 2FTLE 2PUQH 3O8DA 1TWXB 3SNAA 1L0ZA 4I8GA 1ETRH 1ANBA 1W0JD 2C8YB 4AN7A 4HZHA 1C5QA 1FZZA 3N99A 3VPKA 2BD4A 2OC8A 1DOJA 1LPKB 4CRBA 1V2MT 2CF9H 2VH0A 1O39A 2Z6BD 3SV2H 2VB0A 1BTWA 1V2PT 1LDTT 2UUKB 3F9FA 3P8GA 1CSOE 2ZPQA 4B1TA 1UTLM 2ZTYA 3SYJA 4Q2KA 5FPTA 5LGOA 2EI7A 1IQGA 2FMJA 3SJOA 4RI0A 4ABGA 3MOCA 5EIYA 3PTBA 4X1PU 4BTUB 1VKYA 2XNIA 4RSPA 2FO9A 3MO6A 2A7JA 4B2AA 2QAAA 1T4VH 3RXJA 3QGNB 3BSQA 5GCHG 1NRQH 1PPHE 1SGEE 1O2NA 1EAIA 3F2GA 1N1LA 1C5LH 3PLPA 1SKYE 3VGCB 3DSPA 3LGTA 4X6PA 5EG4A 4ISIH 1NRRH 1S0QA 3MO3A 4TY6A 4UFEH 1GHBF 1NBME 3QGJA 3RXUA 5CHBA 4CH2B 4CRCA 4WJG2 2Z9JA 1GBCA 6CHAB 3SU5A 4OS1A 2BLVA 3FP6E 4CRDA 1V2OT 4RT0A 1O2VA 2KCAA 2AHME 2BY8X 5GDSH 1CHGA 1G3BA 1GJ9B 5A09A 4ISOA 4Y8YA 2A7HA 2SGEE 2Z94A 2JH6D 3NRLA 1VCWA 2WPIS 2AIPA 1G32B 2WPMS 2XBWA 4FU8A 3TH3H 2ZPSA 4KELA 3GCTG 2ZPRA 3TVJB 1CGIE 5EXMA 2NU3E 1EPTA 1TNGA 5E8EH 2ZFPH 3EA7A 4Y7BA 2VIWA 2OP9A 1FDPA 1A2CH 4F49A 1B7XB 1TOMH 3VB4A 2J4IA 3S7KB 4JZFH 2CGAA 2WPLS 2ZCLP 4Y8ZA 4ISNA 1QHRB 1EKBB 4NIXA 3RUOA 1THSH 3HGNA 4MNXA 2AS9A 2CMYA 3A86A 4MLFB 3N7DA 4NGAH 1ESTA 3LT3A 1OHHD 3K9XB 4A92A 4Z1MD 1NTPA 1GDQA 3UR9A 1CVWH 1YPJH 1AVWA 1C2GA 1LVOA 3Q00A 4MQAA 5ESTE 1JIRA 1HAYB 1WTGH 1P03A 1YP9A 5JB8S 1PQ5A 1AVGH 1GI6A 2STAE 3DT0H 5C0UA 2H5DA 1WYKA 1AB9B 2J98B 1O0DH 1OSSA 3SU4A 2YNAA 1BTZA 3LJJA 2SFAA 1S0RA 3SU3A 1K1JA 1NC6A 1Y3VA 3M5MA 3RXBA 1LPZB 1EASA 2Y82A 5EJZA 1D3PB 3EE0B 4YOGA 1ELTA 3RXLA 1ZRBA 5HYOA 2PWXA 3KIDU 1GJCB 1NFYA 5ABWA 2Z9GA 3GCTF 3U8TH 4A1TA 2ZHWH 4UDWH 1SMFE 1P01A 2IPQX 2ZQ1A 5EQQA 1LVYA 1V6DA 2I6QA 2VWOA 1AO5A 5C3NA 2G00A 4BTTB 4MDSA 1KMHB 5IK2D 4ESTE 3LJOA 4FUDA 4UONA 1E0FD 4D8NA 1O2WA 3PLKA 1COWD 3SUGA 1K0HA 2XRCA 3TNSA 3GISB 1AB9C 3UPEA 4DGJA 3QK1A 2ZGXH 1ESAA 1EZUC 5F53A 4FVDA 1O31A 1O5AB 5E0HA 2R3YA 3SHCH 2G8TA 1AE5A 2FLBH 4Y76A 1CT2E 3GY6A 4ABJA 1ELBA 1MUEB 1UTPA 1YLNA 2Y5FA 5DJ7A 3UR6A 1HIAA 5FX5A 4WXVA 4BNRA 4Z6AH 4FOUC 1SC8U 2WUBA 4FUEA 4INKA 2Y6TA 4AZ2B 2D26C 2F91A 2BZAA 1V2RT 3HKJB 5DPAA 2IPHA 1MD8A 1YC0A 4NWLA 4KP0A 5E2PA 2OINA 3UUZA 3HATH 3QUMP 3RXRA 3MMGA 5BRRE 1QBNA 2IN2A 1XM1A 2CJIA 4AFUA 2ODQA 5JYIA 1WAYB 4NFEA 3F0PA 2VIQA 5LPRA 3MU8A 1AUJA 5K0HA 1KXBA 1SR5C 1SFQB 2Y80A 1SGPE 2YNBA 1O30A 2BX3A 2ANMH 1BUIA 1O34A 1NT1A 2FTMA 1GI3A 3HK6B 2V3MA 1EZSC 1O3AA 1Y5UT 2FLRH 3RP2A 3FKSD 2WYJA 2EEKA 4IC5A 1V2TT 1IHSH 3ZIAD 5DO4H 2ZHEH 3A7YA 2XBYA 1SGTA 4UFDH 3RM0H 3M61U 1FXYA 1JBUH 2OC7A 2WSSD 2BTCE 4B75A 1YPKH 8KME2 2C8WB 5EW1H 1OS8A 1BDAA 2PTNA 4U2WA 1LQDB 3UNSA 1IQNA 1DXWA 1C2MA 3TPIZ 3KNXA 4CRGA 2ZI2H 3LGYA 1Y3UA 1Z1IA 2Y5GA 2FOFA 3RC5A 3SZNA 3RXPA 3T62A 4JYTA 4AGKA 4OGYA 1IQKA 1YPGH 2KX4A 4IW4E 3RXTA 3SUEA 1EJNA 1TMTH 2HLCA 5LH8A 1QTFA 1PQ8A 5FX6A 2O8MA 4I8JA 3EGKH 3TIUA 3ZVEA 1QFKH 3G01A 4JK5A 1PJPA 1FPCH 1LHDH 4FVBA 2FOAA 1SGIB 2KAIB 1O2XA 3SNEA 2OD3B 3ZZ7A 4XE4A 2ZDNA 1DT2A 3U98H 3F0OA 3K6ZA 1VR1H 7ESTE 3Q76A 3SU2A 3DUXH 1GBJA 2FOEA 4X1SU 1GG6C 1F0SA 5F8ZA 3OTPA 1P10A 1IQLA 1LHGH 5CDFE 4INLA 4QT8C 4M7GA 2ZFSA 3WWBA 1UVSH 4NZQA 2VIVA 3RXCA 1MZAA 1O3HA 3W1EA 3A7VA 1ZJKA 2Y5HA 1M9UA 3RXQA 1GBBA 1J8AA 2FOHA 5C67A 1FY4A 1QJ1B 3RMLH 2HPQH 4ZXXH 1G36A 3JZ1B 4Y10E 5DK1A 1RS0A 3B9FH 3LGVA 2P94A 3RDZA 1UJ1A 3OTJE 1AU8A 4CR5A 2VVUA 4MG3A 1FONA 2FXRA 3H7OA 3A84A 1MCTA 1O5CB 1FY3A 5GWZA 3BN9A 2XWBI 2VJ1A 1EJMA 4GSOA 3SV9A 3O8RA 3LGWA 1DITH 2AERH 1ZMNA 3BIVH 2J2UA 5AFYH 2R3UA 1XXDA 1GVLA 1GHXH 2V0BA 2FYQA 2GTBA 3F68H 1C1MA 2GV6A 5EGMA 1B5GH 5BPEA 4RKJB 2A2QH 2VINA 4KTUA 2PKAA 3ZZ4A 2VIPA 3LGUA 5F8TA 1QIXB 5EU8A 4I86A 5HGGA 2ZU3A 1F5KU 1SQTA 2TBSA 6ESTA 3LGIA 3VB5A 1BJUA 3P17H 1K1NA 4WMDA 1EATA 1RTKA 2L6OA 2SGDE 1QURH 1C1OA 3GY8A 3Q3XA 1TNKA 2GDDA 2DE9A 1FY1A 5GCHF 2HVXA 1IQHA 1PQ7A 2UWLA 4E06H 1H9HE 1N6XA 4A1XA 5EJ1A 1NRNH 4K5ZA 3GY5A 3A81A 4X8VH 1P2JA 1AI8H 3RXMA 4D76A 1KTTB 2YMSD 4OS7A 4WVPE 2BQ6B 5FCKA 1W10U 1TGNA 1ABIH 1MAXA 1GJ5H 4HI3A 3K2UA 5DG6A 5H4IB 3R0FA 1HXEH 1XUFA 3MFJA 3MU1A 1FN8A 4ASUD 1TMUH 4AGJA 2ZF0H 3FP8E 3LPRA 3CP7A 8GCHF 1HAGE 1BA8B 2KAIA 4NFFA 1ZHRA 2OK5A 4YM9A 4IS5A 4D7GA 1TFXA 2AMPA 1BJVA 3ITIA 3P92A 1GI5A 1OYTH 4ABHA 1CGJE 3RC4A 1VJ9U 3NCLA 1JRTA 5EOKA 1GBIA 1WU1A 1HJAC 1HIAB 1GBAA 1MAYA 1C1UH 1EPTB 1WXRA 4YESB 3TH4H 7GCHF 2GZ7A 1C5UA 3SZEA 1UK4A 3E91A 4KKDA 3TGKE 5TCAA 2NU0E 4H6TA 1GMHG 3CS0A 4ZROA 2VGCB 1S6LA 3FANA 4F55A 2GJGA 1RD3B 1V2KT 3ZVFA 2H9TH 3FAOA 1AHTH 2VVVA 4DJZB 1YCPH 5F8XA 3UAIC 1D3TB 1TAWA 2GZ8A 2RA3A 1MQ5A 3GDVA 1B0EA 1C1WH 2ZTXA 3TH2H 4TPYA 4XRNA 1FX0B 1ELVA 2EY4C 2Q6GA 2UUJB 3ZV8A 1WUNH 1J14A 1G2LA 2GKVE 1ZRKA 1CBWB 1H8HD 5C20A 1LCYA 4LZ1H 4TYDA 1J15A 2P3UB 5DN6D 1XVMA 1C5VA 1K1OA 1GGDC 1BTUA 3RXVA 1SGDE 1W7GH 3ZYDA 3ZVCA 2ZFTA 1X7AC 2NWNA 5HXFA 5E0GA 4ZKSU 3TJOA 1QL9A 2WINI 4J1YA 3VB7A 1C5RA 1JXPA 2W6ID 1QB6A 1L2EA 5F6MA 1JMOH 1VGCB 2HALA 4JYVH 3EA8A 3TJUA 1RTFB 3GCHC 4X2VA 3BG4B 4B76A 1DLKB 1C9PA 2Z3DA 2BMGB 4CHAC 3PV5A 2ESTE 1TX6A 1YLCA 3RXEA 2GCTB 1NN6A 2GX4A 2YOLA 1NS3A 3KCGH 3LU9B 1SGNE 1FAXA 4ZAEA 3MTYA 2BB4A 2Q6DA 2ZQ2A 1YCPM 3QZQA 5AFZH 3MNBA 4WXIA 4AYYB 4LZ4B 3N7OA 2QXJA 2W3KA 3QN7A 2OC1A 4JMYA 2ZU5A 3NXPA 1S84A 4GPGA 3V3MA 3TLOA 5CMXH 3U8OH 5LPEA 1JIMA 1TBQH 2P93A 5AHGH 2EI8A 3RXGA 1AMHA 1HDTH 2J38A 1N6YA 4CREA 1O2LA 1LVMA 3SU6A 2FOCA 3V12A 3SHAH 1AWFH 1ZPBA 4X2XA 1RTLA 1TYNA 1UTJA 1RJXB 3A87A 1GI1A 3BEFB 1QZ8A 1DWBH 1ZJDA 2K0QA 3L6PA 2AGEX 4I32A 5T3HA 4JK6A 2ZGCA 3PO1C 5CHAC 1EOLA 1T8MA 2FX6A 1C1SA 1C2EA 1LMWB 1V3XA 1HJ8A 1W13U 5T6DA 3M5OA 3F9EA 1G37A 1OP8A 2OQUA 1XUKA 1BBRE 4A7IB 5DP6A 1B0FA 1GBTA 1K2I1 1TQ7B 1DM4B 1N8OB 4E7RG 2BDHA 3T25A 1ZSLA 4Y71A 4DIIH 3S9CA 2A5KA 1TA6A 3ZZAA 1SQOA 4ACAA 1LVBA 2A7CA 3H5CB 4K69A 1SG8B 1T8NA 3GY4A 1F2SE 3LC5A 3UQVA 1LTOA 1C1RA 1CT4E 1TONA 5C17A 3PWCA 1UVUH 3SGBE 2ZDMA 3OAAD 1DE7H 1TA2A 1H9LB 1C1NA 3M7QA 2BQ7B 3GYLB 3BV9B 1O36A 2H9EH 4FUGA 1FJSA 2R0KA 3NUMA 1S6HA 2CHAB 3RLYH 1TPSA 1SGFG 2R0LA 4P02A 1ETSH 5FXLA 1A0LA 1TBRH 2FX4A 1J16A 1TPAE 1FAKH 2KZ4A 3SJ9A 1WOFA 5C94A 3A83A 2D1JA 5C5NA 1AY6H 2B7DH 2ZU2A 4J2YB 5L6NH 4X2YA 5DP9A 1O3CA 3E0PB 2RFKC 1GBHA 2WV5A 3UIRA 3BTQE 1EFRD 3M3VA 2ZECA 3D49H 1J17T 1DWCH 4U01A 2QIQA 1C4U2 3EQ0H 3BG8A 1P06A 2WUCA 1QRZA 4DY7B 2ANWA 3URDA 3N7EA 3VB3A 2ZKSA 4ABAA 1HAVB 2P3FH 3BG4C 4IMZA 5DP5A 1O2HA 1GL1A 1IQMA 3SV6A 1DFPA 1Z8JB 2GZ9A 3C27B 1O2YA 3P6ZB 3B23B 1K1IA 1DSTA 1P57B 4GCHF 1HB0B 2FESH 1C5XB 2YMSC 5FHTA 2AFQB 1P3CA 2XNDD 2XXLA 4GVUA 3VGCC 2W3IA 2BVXH 1CHOF 4HFPB 2C93B 1IOEA 1OYQA 2I6SA 3LOXA 2ODYB 2CV3A 2EA3A 5EXNA 1W0YH 1BRUP 3UWJH 2ANKH 4WH8A 3SORA 4ZKNU 2PUXB 1A7SA 1UHBB 1HJ9A 1MKXK 1SQRA 1ZPCA 2KM0A 3ATLA 3LH1A 3ZZCA 6CHAC 1ZHPA 1QBOA 2ZFFH 1QRWA 1XKBC 1UTOA 1QL7A 1EB2A 1TIOA 3L3TA 1L1GA 4A1VA 2JDID 1DY9A 2L74A 1KIGH 1H1BA 2HNTE 2OLGA 5ETXA 2A31A 2F3CE 2TPIZ 1SFIA 4CBNA 6GCHG 2Z9IA 2PKAB 2SNVA 1G3CA 1O3BA 2VGCC 5L2ZH 2VH6A 1BRBE 1F0TA 3M7UA 2A45B 2AEIH 2V7QD 3RXKA 2F9UA 2J5UA 1Q3XA 5JPMH 1BTYA 4YTAA 3K6YA 3SGQE 4A6LA 1MTWA 1YCPK 4RN6A 3UOUA 1LPGB 1C2HA 1TE0A 2BQWB 3GS9A 1IQEA 3AVZA 2BY7X 1DXPA 3PMBB 2GCHG 5CHAB 3A8AA 3S7HB 1YLDA 1KXAA 3ESTA 1IQJA 5ESBA 1AZ8A 4E7NA 5HIZA 2RDLA 2O9QA 4ISHH 3SUFA 3MU5A 5AVDA 1ZMLA 1OKXA 2CK3D 3AW0A 3Q77A 3ZVGA 3ZZBA 5L2YH 3MYWA 1P2OA 4PROA 2JETB 1JWTA 2HNTF 5A8ZA 4DG4A 2A4GA 5FL7D 3RC6A 3GCNA 1ARCA 2QN5T 3QZRA 2JH0D 1TRNA 2XCNA 4YLQH 1ZMJA 1OP2A
chains in the Genus database with same CATH topology
3SJIA 3FP7E 2VWNA 2PHBA 2XBVA 5FBEA 1C2LA 1W7XH 1Z8GA 4NSYA 1TGCA 4NIVA 2BXUH 1O37A 3L33A 3UQOA 5EW2H 3SV8A 2ZP0H 4YZUA 3P8FA 3ZZ5A 2HGTH 1IQFA 1SLUB 4AFZA 4O3TA 4OS2A 1ZR0A 3BTFE 2FI4E 2AH4X 1MZDA 7KMEH 1YKTA 2P16A 1PPFE 2BHGA 1E37B 3MH5A 4K2YA 1VITG 4Q80A 1YBWA 1SSXA 1TPPA 3MH6A 4H42U 4CRAA 1FPHH 1KXDA 2SGAA 3F9GA 1T4UH 1NU7B 4ZXYH 3MNCA 1ESBA 3GY7A 3T29A 1G3DA 4ZMAH 1GI8B 1MTUA 2FWWA 1NO9H 1BMMH 2O8TA 1JOUB 3DFLA 1KLTA 3U69H 4CBOA 2FM2A 3ATIA 2D8WA 4BAQB 2AGGX 2PKSC 2C3SA 3AAUA 1FIWA 2ZWLH 1HYLA 1UVTH 2J92A 4X8TH 1SQAA 3EA9A 1PYTD 3V0XA 3RXSA 1MBMA 4IMQA 2TGTA 1P12E 1PPBH 2OTVA 3SNBA 1O5DH 1PQAA 5GIBA 3SBKA 1EP5A 3QX5H 3KGPA 2ZDLA 2B5TB 2ZGJA 2K1QA 3MU4A 1GHYH 2H1UA 3MI4A 1F92A 2UUFB 2G4TA 3UNRA 3DFJA 2QXGA 2JETC 1Z6EA 1K22H 2GDEH 3ZV9A 2FP7B 2A4OA 1BCUH 2F9OA 2AMDA 2JH5D 2PLXA 1V2QT 2BVRH 2BXTH 1C5NH 2HNTC 2FODA 2VVCA 5TJXA 4KTSA 2G81E 1IQIA 5FPSA 1ZZZA 1ELFA 4F4OC 5A8YA 1ZSKA 2A2XH 1Z8IB 1H8DH 1HLTH 1AFEH 2TGDA 1KXFA 2QC2A 4JYUH 1XUJA 4DIHH 3FZDA 1T31A 1AFQB 1RIWB 4SGAE 1C1PA 1QA0A 1YPEH 4XDEA 1SOTA 1KDQB 1T32A 2ZTZA 1SOZA 1DY8A 3AAVA 1GVKB 5E0JA 1QB1A 1CA0B 4YT7H 1ELAA 2BLOA 3SJKA 1C5ZB 1FLEE 3SI4H 1OWJA 3U1IB 2ZU4A 1EQ9A 1BIOA 1NESE 1GHAF 2GVFA 1P9UA 2BDCA 1GI7B 2XC4A 1QR3E 1UTNA 1SHYA 1GJBB 1GCTC 1KY9A 5A0BA 1CA8B 3RU4E 1D6RA 4K3JA 1P2IA 1O38A 2BD2A 1P09A 3VXFH 2NU1E 2UWOA 4B71A 1P9SA 3RMMH 1BHXB 1F7ZA 2EI6A 1BMAA 2A5AA 3RU4T 2BD3A 2A1DB 1GCDA 1C2KA 4Z0KA 4ZH8A 2LPRA 1GI4A 1ANDA 1C1TA 3ZYEA 4BANB 3PO1B 1DS2E 3F1SB 1J9CH 5C1XA 3S0NA 1UHBA 1XVOA 5DP4A 1GHVH 4Y79A 1CGHA 1P04A 1TALA 2XWAA 1SGQE 5GXPA 2BLWA 2B0FA 3LONA 4NA8A 1HPGA 4CRFA 1Q2WA 1RXPA 2GCHF 1EUFA 1HAIH 3RXHA 1O2JA 2A4RA 4U30A 4BXSA 3D62A 1OOKB 3S9AA 1MH0A 5CE1A 4WMEA 1TMBH 2XTTB 1HV7A 3MH4A 4BAKB 4K8BA 4U32A 2OC0A 1AVXA 4NWKA 4TPIZ 1E38B 3BTWE 3SW2B 1QQUA 3DD2H 2W5EA 2PW8H 1AWHB 5EODA 3PYHA 1UTQA 1C1VH 2H9HA 1YF4A 2J9NA 4FUIA 1TABE 3OSYA 4SGBE 1XMNB 1O33A 3NK8A 3S69A 1O5EH 2AIQA 2ZZUH 1TNIA 3A8DA 2XC5A 4JZEH 1O2IA 1OWEA 3UREA 1ELEE 1ACBE 3T26A 3VFEA 4VGCB 1A61H 1Z7KA 1ZTLA 1HBTH 2ZU1A 5GJ4B 3STJA 2ZHDA 2BD9A 1GJAB 1N8OC 1LO6A 1CHOG 2ALPA 5C1YA 3BF6H 2BX4A 1C5YB 3F9HA 2C8XB 1A1RA 1W2KH 1DPOA 3PTNA 5JBAS 5SGAE 2PGQB 2ZIQH 1AFQC 1V2UT 1MTSA 1GBLA 8GCHG 1T7CA 2ZHFH 1HRTH 1QQ4A 1O2ZA 2PGBB 2FI5E 1O2OA 1YPMH 3UNQA 1GMDF 3HK3B 1ELDE 1CQQA 2B9LA 1DWEH 2ILNA 1ABJH 1QY6A 3SGAE 2BDYA 3KQDA 1NM6A 4ZKOU 1S82A 3M5LA 1D6WA 2WV4A 1A3EH 5JBBS 3A82A 4FUHA 1A5IA 4AG2A 3JZ2B 5AF9H 1Y3WA 4FUFA 4K1SA 1O2PA 4XBBA 1C2IA 3RXDA 1BZXE 1VJAU 3RXIA 2ZO3H 2WYGA 2GMTC 2DE8A 3GOVB 3KF2A 3QO6A 4LXBH 1DUEA 1UK3A 4GAWA 1WQVH 1HAZB 1GJDB 2BDGA 3M7TA 1K1MA 2V3OH 1BMNH 3AW1A 2W7SA 4O3UA 2ZA5A 1W8BH 1UCYK 1W12U 1YGCH 2EC9H 3IG6B 3NPSA 1QRXA 4IN1A 4AX9H 2R2WU 1ARBA 2VIOA 3S9BA 3BEIB 1GBEA 1Z1JA 4ZHLU 1TGSZ 3MWIU 3TU7H 1NY22 2G4UA 1IAUA 3SI3H 2FYRA 1AQ7A 1OWIA 4I8HA 1ORFA 2H2ZA 4IN2A 4X0WU 1ZGVA 1UTKA 1G2MA 1O2UA 3TGIE 1E34B 1O32A 3PMJA 4INHA 4UFGH 2ASUB 1GBDA 1GGDB 2BLQA 2O8UA 3ZZ6A 3GCOA 2V6NA 9LPRA 1EZQA 3SJ8A 1L4DA 3U8RH 4Y0YE 2GT8A 1GHAG 3ZZ9A 1GPZA 3A7XA 5JB9S 2G52A 3QTVH 2FS8A 2H5CA 2V35A 1AUTC 2BY5X 3E90B 3PROA 4ABBA 3STIA 3PWBA 2W7UA 2Z9KA 4YOIA 1KXCA 4AB8A 4Y11E 4Y6DA 1YPHE 3SU0A 2BDIA 4I8KA 1Y5BT 5EPNA 5C5OA 1BTXA 1F0UA 1SBWA 2F9NA 4THNH 4AYVB 1PPCE 2FI3E 3SU1A 1PPZA 1XUIA 4BOHA 2GT7A 4BAHB 4GCHG 1GJ4H 2C90B 3DA9B 1W11U 1O3NA 2ZDKA 3ELAH 4YT6H 3LIWA 3M5NA 1O3KA 1GMCG 1ID5H 1AN1E 1S5SA 3I77A 5JDUB 1XXFA 3OU0A 7GCHG 3MO9A 3ZVBA 2QA9E 2UUYA 4BAMB 4UFFH 1SHHB 5HMAA 2BYAX 1XUGA 2OCVB 1Y3YA 1PFXC 1GDUA 3W95A 1QJ7B 1CU1A 1SLVB 3A88A 2P95A 2GCTC 4NCYA 1WQSA 4CHAB 3KN2A 1UVPA 3CS7A 1H4WA 1YPLH 1HXFH 2G5VA 3LDXH 1C2DA 3P8OA 4IGDA 1AE8H 1VGCC 1C9TA 1GBMA 1O2QA 1P02A 2GGVB 2NU2E 2STBE 2QGRA 3M3TA 4MPVA 5EXLA 1OWDA 3ZVAA 5J4SA 1LHFH 4FUBA 1HAPH 1NU9A 5HM9A 4YLUA 3UY9A 1VCQA 4NZLA 3OX7U 1K21H 4WF8A 2GP9B 1O2GH 1O3JA 4LOYH 2ZCHP 1GHZA 1SGCA 1F5RA 1C2FA 1TQ0B 1SLWB 3EDXB 2BD5A 1CBWC 1KDQA 1EAXA 1BT7A 1MU8B 1O3DA 1V2VT 1GBFA 4GHQA 4MVNA 3FZZA 1K9OE 1RRKA 1DSUA 4X8SH 1T8LA 1C5WB 1UMAH 1GBKA 5A0AE 1VITF 1AKSB 1H9IE 1AZZA 1INCA 4NA7A 2BY9X 4D9RA 2Y7XA 1AIXH 1MQ6A 4DT7B 4I7YH 1BTPA 3ODFA 4MTBA 4UE7H 7LPRA 1SVPA 4HTCH 5E2OA 3IITA 4ZHAA 4XBCA 3M37A 5IYTA 5A0CA 4YO9A 2BOKA 5A2MH 4DVAU 1QGFA 3QDZB 1LQEA 2J95A 1C5TA 2M5TA 3A89A 3MHWU 2H6MA 1ANCA 1O3PB 4ABIA 1CT0E 1QL8A 3SNCA 1GL0E 1QA7A 2GMTB 3E16B 4TWYA 1GI0A 2ZFRH 3SN8A 4AB9A 4OS5A 5L30H 1HAOH 2RG3A 2Q6FA 1TOCB 4AG1A 2TIOA 1U6QA 4RKOB 3LH3A 1DWDH 3Q3KA 1CO7E 1C2JA 3TK5A 2DUCA 4NIWA 1BBRH 2O8LA 3RMNH 2G55A 1MTVA 2CXVA 3WY8A 1K1LA 2GV7A 2ANYA 4FU7A 4TWWA 3P70B 3E3TA 1EX3A 4FUJA 1Z6JH 3R3GB 4BXWA 1D9IA 1SGFA 2XC0A 3BTTE 3KQCA 1EJAA 4GHTA 5JBTA 3A85A 1O3LA 5T6GA 4ZHMU 1SLXB 8LPRA 5FBIA 2PTCE 3NWUA 3U9AH 5F03A 2OXSA 1O3MA 4MNYA 1GJ6A 4X2WA 3H7TA 5TCCA 2F9VA 1Q31A 3W94A 4Q7XA 4XSKU 2ALVA 2CHAC 3HPTB 2QYIA 4Q7ZA 4A5TS 4K8YA 4ZKRU 4XFQA 2WPHS 1FQ3A 3OYPA 1O2MA 5FPYA 5GPIB 3OY6U 1MKWK 3KL6A 4MPXA 4IC6A 3P95A 4CH8B 3PV4A 3UOPA 4XBDA 1YM0A 3FFGA 1THRH 4NG9H 3SV7A 2VNTA 1UO6A 2CF8H 4B2CA 4B73A 3PMHB 5PTPA 2ZGBH 3MNXA 1SB1H 3KQEA 2JKHA 1O5BB 2FIRH 1E35B 3D23A 2ZFQH 3E0NB 1OP0A 3SQEE 1ZTJA 1OWKA 1LKBA 5T6FA 3E8LA 1NRPH 1UCYE 1LKAA 3SUDA 3FVFB 5K7RA 3A7WA 2Z3EA 1UCYH 2R2MB 1PPEE 1L4ZA 3TK6A 3UFAA 1A5HA 4KTCA 3VXEH 3KHVA 2FS9A 1P2KA 1QB9A 2XW9A 2ZDAH 4DCDA 2XYAA 3ZVDA 1PYTC 1T8OA 1V2NT 2SGFE 1ZHMA 1ELGA 5C2ZA 1FY8E 1S85A 3BTEE 4AFSA 4LK4A 1JRSA 1P0SH 3F6UH 1S6FA 2XCFA 1NRSH 1O2RA 3MH7A 4ZUHA 1EB1H 2P8OB 2TRMA 1BHXF 5J4QA 2D2DA 1GWAA 4K1TA 3RXAA 1RGQA 2HRVA 2BDAA 2FOBA 3HKIB 3I29A 1V2LT 4X6MA 1NZQH 4YOJA 2HPPH 1Y59T 5EQSA 2ZHQH 4O97A 2WPKS 2ZC9H 4OS6A 1E36B 1GCTB 3TNTA 3V13A 2NU4E 4X1RU 1TB6H 2PR3A 2RA0A 3HGPA 2Y7ZA 1SGRE 3I78A 4ISLA 3M36A 1P8VC 4HGCA 3RM2H 4K60A 1NFXA 2ZGHA 2PV9B 6GCHF 1WTHD 1FUJA 4MPUA 1K1PA 2SGQE 4DOQA 2A0QB 4GLYA 3U1JB 1O2KA 5HM2A 1O2SA 2Z7FE 1TNHA 4X1QU 4X1NU 3T27A 1OWHA 4I8LA 3TK9A 2A32A 2F83A 3UWIA 3O8CA 1TRYA 2OQ5A 1S83A 1C5MD 1BB0B 1H8IH 1O3IA 5FAHA 5B6OA 1FMGA 2ZEBA 4OGXA 2OUAA 3ODDA 3VB6A 1F5LA 1UVOA 3ATMA 3BTKE 3ZZDA 1QNJA 1MU6B 1FI8A 3BTGE 2SGPE 4XOJA 2V3HH 2BD8A 2P3TB 4Q7YA 3VEQB 1EOJA 1KXEA 2VWMA 2A5IA 2Y81A 3KQBA 1MKXH 3QTOH 1TNLA 2B8OH 3E6PH 2QXHA 4Y7AA 3GYMA 1GI9B 1VZQH 3D65E 2ZNKH 1Y8TA 3CENA 2ULLA 1O3EA 1Y3XA 1TX8A 1TPOA 1TGTA 3E1XB 2W26A 5EPYA 1P11E 2Z3CA 5DP3A 1EZXC 2UWPA 4I33A 3EAJA 3NZIA 3BTHE 1OXGA 1ZLRA 1LHCH 1BOQA 3A80A 1TBZH 5DP7A 2QCYA 2P8OC 1EPTC 2QF3A 4X8UH 4VGCC 3C1KA 1W0ZU 1ZPZA 1YPHC 1O2TA 1DICA 1GMCF 1MTNB 1O35A 1G30B 2RCEA 1VITH 3T28A 4E05H 3GY2A 1LHEH 1HFDA 1P2MA 1QCPA 3LC3A 2CN0H 1WV7H 1C4V2 2IJOB 4D9QA 5A8XA 3RLWH 1AD8H 3A7ZA 4ABFA 2LNCA 4B74A 1FIZA 4DW2U 4R8TB 1CE5A 3SO3A 2QF0A 2PKSB 1PPGE 5DGJA 1YYY1 2QV1A 1MBQA 3TGJE 1AKSA 1V2JT 1D3QB 1WSSH 4X6OA 1MTNC 3NKKA 1A0JA 3TJNA 3ZZ3A 1G3EA 2IOTA 4DURA 4WWYA 1Z71A 4BTIB 2J34A 1QBVH 4NA9H 3SNDA 1CA0C 1HCGA 3A8CA 1W14U 1IHTH 2BM2A 2PSXA 2HWLB 3PMAB 1GI2A 3RU4D 2AGIX 3RXOA 1ETTH 1DVAH 3ENSB 1W3CA 3RMOH 3UTUH 1A4WH 1FY5A 2BOHB 2ZDVH 2FZZA 1A3BH 3GICB 1Z8RA 4Y8XA 5G4BA 2QXIA 3O8BA 2J94A 1GMHF 1SL3A 2ODPA 2G5NA 2THFB 2Z9LA 2BY6X 4JZDH 1BMLA 2WPJS 2A4QA 2C8ZB 3OY5U 3RXFA 4ASHA 1V2ST 3ZZ8A 1O3GA 1VCPA 3KEEA 1FN6A 3PLBA 1KSNA 4I31A 4JZ1A 4D7FA 2AYWA 4B2BA 3T2NA 1O3FA 4JCNA 1SPJA 1ZSJA 1KLJH 2VIDA 1BQYA 1C4Y2 2FPZA 1C5OH 2PSYA 1GDNA 2O8WA 1EAUA 4WMFA 4AFQA 1HUTH 1KYNA 1P05A 1F0RA 1RIWC 1BBRK 2FOGA 4JZIA 1A5GH 2BDBA 3ATWA 4X6NA 2ZCKP 1TLDA 2FDAA 3K65B 1XX9A 8ESTE 2OBOA 1ZGIA 2XBXA 4IBLH 3DHKH 1P2QA 1O3OA 4MPWA 5EQRA 3PM3A 4TY7A 2QY0B 5C1UA 1NFWA 5I46H 1MMJN 1MKWH 3B8JA 2FOMB 4O03A 4WH6A 1L1NA 1NFUA 3GCHB 4NSVA 1G9IE 1GVZA 3GDUA 1XKAC 1GHBG 2TGAA 2BVSH 3SQHE 1OX1A 1HGTH 2OBQA 1OPHB 3LKWA 3TJVA 1GJ7B 1BRCE 1GG6B 4OS4A 3BTME 1EP6A 1GMDG 3A8BA 2AMQA 2GD4B 5I25A 1A46H 2ZG0H 1K28D 3V7TA 2VU8E 1KTSB 3MNSA 1DUAA 3PB1E 1HNEE