1SLUB

Rat anionic n143h, e151h trypsin complexed to a86h ecotin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
216
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKVATVALPSSCAPAGTQCLISGWGHTLVNHPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECOTIN
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (serine protease/inhibitor)
total genus 53
structure length 216
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sluB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sluB02
1EX3A 3SV6A 1RTFB 2QY0B 4X1PU 2ZFPH 3STJA 5A8XA 2ZFQH 2A2QH 3ATWA 3PMAB 2OBQA 1TFXA 3CP7A 5FBEA 1Y3WA 4X1SU 3P17H 8ESTE 3ZV8A 3RXJA 3ZVCA 5EW1H 4NZLA 2GP9B 2GZ7A 2RDLA 3Q3YA 1RJXB 3TLOA 1QA0A 1XM1A 2PTCE 3U69H 4AFUA 1D6RA 1P11E 3A7VA 4AYYB 4AN7A 1HLTH 1VJAU 3A7YA 4X2WA 1ZHRA 1C5SA 2GT8A 2PSYA 4X1NU 1WTGH 1GBIA 2G8TA 4K1TA 1F5LA 4ZAEA 3BTEE 4DURA 3M3TA 3LDXH 1THPB 3A8AA 1TOMH 4GHQA 1GVKB 2CHAB 3H5CB 1J14A 2PKAB 1QNJA 1T8MA 2F9BH 2GCTC 2JH0D 4E7RG 4ZXXH 8GCHG 5DP3A 5HXFA 3LKWA 1KLJH 1AMHA 2ZGHA 1Q3XA 4THNH 1LPZB 1JIMA 1RFNA 1DY8A 1MU8B 1P10A 2ZO3H 3T5FH 1NRPH 1GI6A 1NU7B 2PW8H 2ZGBH 5JBAS 2BOKA 1AIXH 2BD4A 1C5NH 1LPKB 4ZKNU 2H5DA 2FX6A 1NM6A 1H8DH 1O3DA 4UEHH 1YPMH 3UWJH 1P2NA 2CF9H 4MPWA 1S81A 3P8NA 2DUCA 2B9LA 1QFKH 5GCHF 3BEFB 1QRXA 9ESTA 3ZVGA 2V0BA 1EB1H 2M5TA 5ETXA 3RLWH 2F91A 2ZHDA 3MU1A 3S7KB 1CT0E 1ELEE 2ZU5A 3GCOA 1Z71A 1FNIA 5J4SA 2PKSC 1GI7B 4AORA 2GDEH 5E2OA 2OQ5A 1SGYE 2A7CA 4WMDA 2ZFFH 4YT7H 4TWYA 1FY3A 2ZECA 1AUTC 1GJ8B 3KQDA 5LPRA 1C2LA 2O9QA 3SU1A 4XBBA 1QQ4A 1TAWA 2A45B 3P6ZB 2ZDVH 2FOEA 1D9IA 1J9CH 2ZQ1A 2EA3A 3GY2A 2O8LA 3GY5A 2FI4E 1TNHA 4MNVA 3ZVAA 1KXEA 3VXEH 4BXSA 3DFLA 1MQ6A 2W26A 1DXWA 1HXFH 1BA8B 3A88A 3A86A 1O2TA 4NIYA 3A89A 3LGIA 1S83A 2BX3A 2NU1E 1DPOA 2ZQ2A 1GBCA 1FONA 5DP4A 1UTKA 2JKHA 1NTPA 1Z7KA 2GD4B 3SJ8A 3BTWE 1T4VH 4BAQB 1EXFA 3TH4H 1CBWC 5DP6A 4NA8A 1IQJA 3CENA 3QUMP 5DG6A 4UFGH 1O2PA 3PROA 2ZGXH 1YPKH 2SGFE 1IHTH 1SBWA 1TNIA 2BD8A 4XFQA 1VITH 1BRAA 1V2OT 5HM2A 1GBFA 2J4IA 1NRNH 1EJAA 1QR3E 1P01A 3GCNA 4JK6A 5L6NH 3TGIE 4FUJA 2BD3A 1ZTLA 2PGBB 4D8NA 1VITF 3ELAH 1DLKB 3QGNB 1TX7A 2BQ7B 2C8ZB 5EQSA 5FBIA 3SV9A 1O2YA 2H9EH 3AAVA 1GI3A 1AVGH 4IBLH 1CT2E 1ABJH 1IAUA 4IGDA 1C5LH 1GMHG 3SNAA 4NZQA 3A7XA 1INCA 2FI5E 3UOUA 3UQVA 1Z6EA 1S85A 4TPYA 2GMTC 4FUCA 1O38A 4K1EA 1LVMA 3LJJA 1SOTA 1CHOG 1IQFA 2FOAA 1HJAB 3QTVH 4INKA 3RC5A 3A85A 4Y0YE 1GJ7B 1AKSB 3TJUA 1SLWB 1EAIA 2IOTA 1V2PT 1J16A 1NT1A 2C3SA 2J9NA 1W7GH 3F9HA 3Q3KA 3RXMA 5LGOA 4J2YB 2WPMS 2P8OC 2ZEBA 1TRYA 1Y5UT 3S9CA 4MTBA 5GWZA 4K8BA 3OSYA 1TGTA 2XBVA 4WWYA 1YCPK 2HNTF 4LXBH 1LHFH 1BHXB 3QGJA 4OS5A 1DM4B 5A8ZA 3HGNA 1TX8A 3MU5A 3GOVB 2CHAC 2EC9H 5CMXH 2PUXB 2AH4X 1F5KU 4ABGA 1O5BB 4AFZA 1C1MA 3D62A 1W11U 1OYQA 1UVPA 5LH8A 6CHAC 3ENSB 1K1JA 1GHBG 3PLPA 1F5RA 1HAYB 4MPXA 2QXJA 2XBXA 2JH5D 2VIDA 2TIOA 5F8TA 5IDKA 2D26C 3G01A 1G3DA 5EG4A 3LGYA 2XW9A 4AGJA 5F8XA 2BOHB 3W94A 3U1JB 2BY9X 3SI3H 1P57B 2AMDA 3DHKH 2B0FA 3E1XB 4DW2U 1C5UA 3VB7A 8KME2 2O8UA 3FAOA 3QLPH 4H42U 1FAKH 1GHZA 1XUFA 1YBWA 1GHAF 1JOUB 3E6PH 5DGJA 2Y80A 1A0LA 2ZU1A 2AFQB 4TY7A 2BY5X 1MMJN 3EA8A 4Y7AA 3SU6A 3SORA 2FPZA 3AW1A 1GHVH 1ZHPA 2G52A 1ESAA 2BY8X 1GDNA 2BDBA 4YT6H 4O3TA 1LKAA 1NRRH 3GCTG 4I32A 1ELCA 2OP9A 4I31A 3C1KA 4VGCC 2BD9A 2A5IA 1GJBB 4X8UH 1V2NT 2FODA 2SGDE 2ZDAH 1G37A 1G3EA 1ZR0A 2HRVA 1AU8A 1GCTB 1IQLA 4JCNA 7GCHG 2HPPH 2Z94A 1CA0C 4ABEA 1HAIH 3R3GB 5FPYA 4ISIH 4KKDA 2ZPSA 2V3OH 2FTMA 4A92A 1AD8H 1GVZA 4B2AA 3RC6A 2BXUH 2GX4A 4BXWA 1A61H 5C1UA 4YM9A 5HM9A 3BTHE 4IN1A 1QQUA 1TMBH 4CRFA 5AFZH 2IJOB 2K1QA 3HPTB 4X8VH 1TB6H 3MNBA 3C27B 1TQ0B 1TWXB 3SUDA 3BTDE 1P8VC 4E05H 3SUFA 1T8LA 5AF9H 1PQ5A 3O8BA 3F68H 2ZHQH 3ZZ3A 1K28D 2C8WB 4ZKSU 5L2YH 1P9SA 2J38A 1O31A 3VB4A 2C4FH 1TMUH 1C5VA 2IPHA 5FX6A 1O3AA 1PQAA 1E35B 2WV5A 1N1LA 1QURH 1Z8RA 2EI6A 2VWMA 3M3VA 1WQSA 2VIOA 4X0WU 1DE7H 1UCYE 3R0FA 1M9UA 2ALVA 3MYWA 1ZMNA 4ZUHA 2ZC9H 4ZMAH 1QB1A 1DUAA 4I33A 1XX9A 3DFJA 1RGQA 4MNYA 5EXNA 1TBRH 1XXDA 2PTNA 4Y10E 2YOLA 1EB2A 2ZF0H 3MFJA 2GT7A 3UUZA 1W8BH 2AERH 4AZ2B 2FWWA 1G32B 2VIPA 3SOSA 4UONA 3PB1E 1DOJA 1GMHF 3K2UA 2XC0A 1C1TA 4WF8A 1GBDA 3T26A 1P3EA 1ESBA 1C2DA 1GBHA 1NESE 1SGNE 4ZHAA 4D76A 2XBWA 1CGIE 1SPJA 2A5KA 3GCHC 1NN6A 3QTOH 2AS9A 1VCQA 3TITA 5E0GA 1LHGH 1DT2A 3I77A 1THRH 1K2I1 5EQRA 1SHHB 2W3KA 1TX6A 1KXCA 3MH7A 2BDHA 1G36A 1NO9H 2P95A 4RKJB 4DGJA 1L2EA 1SHYA 3LC5A 2GCTB 1L1NA 2Y6TA 1HAOH 3CS0A 3RXLA 2XNIA 1L4DA 3LC3A 1E34B 4DVAU 1OWEA 5EPYA 2D2DA 5TCAA 4AB8A 3V3MA 1GJDB 1HDTH 1MTNB 4KTSA 1GL0E 4BNRA 4Y8XA 2OINA 2BB4A 2FESH 2BZAA 5DP7A 1VCPA 4D9RA 4UD9H 1QHRB 1CGHA 1T8OA 1MTUA 1GGDC 4X8SH 1IQGA 1MBMA 1TYNA 2F9PA 4X2XA 2B7DH 3ZYEA 1CVWH 2BLOA 3U98H 1Q2WA 2I6QA 4JZFH 2XTTB 3K9XB 5K0HA 4Y0ZE 2QCYA 3UY9A 1E36B 1RRKA 1YP9A 4D7GA 2CXVA 4X1QU 1OPHB 2SGPE 2ODPA 3ODFA 2ZDKA 1GG6C 2BLQA 1KYNA 3RXQA 3UQOA 3SU5A 1BITA 1JRSA 5F6MA 1BZXE 1UTMA 2PKSB 3I78A 1MAYA 2Z3DA 9LPRA 2R3YA 1EAXA 1UCYK 4X6OA 3RXCA 1MKXH 1KXDA 1WAYB 4ABFA 3MU4A 5FAHA 3MWIU 2ULLA 4JZEH 3RXTA 2G81E 4ABAA 1HAHH 1F7ZA 5L30H 2BD7A 3ZZ7A 5DO4H 1T8NA 1YPJH 4FUDA 1C5YB 1XKAC 3U9AH 5HGGA 5C20A 1ZMJA 4UDWH 3OY5U 4U01A 1GHXH 1GMDG 1SI5H 3FZDA 1SLXB 1ZSKA 1H1BA 2DE9A 1S0RA 1TRMA 2OQUA 3A8CA 2H9HA 1CO7E 2KAIA 1NZQH 3FP8E 1EZSC 2G55A 3Q76A 2A4RA 4BANB 1CBWB 4ABHA 2GV7A 4H6TA 4Y11E 1QBNA 3DT0H 5BRRE 7GCHF 1MUEB 1DY9A 1N8OC 2AMPA 1L1GA 1NRQH 3M5OA 4AOQA 6ESTA 2RA0A 3MU0A 3F9GA 5FCKA 3S7HB 1LDTT 2CJIA 1CSOE 1A1RA 3RMLH 3QDZB 4B76A 1GBAA 3RXVA 4FVBA 2VIWA 1GBJA 1T32A 3A82A 2VVVA 4XBDA 4JZDH 1C2KA 1UVTH 2A5AA 2CGAA 2HOBA 1P2OA 3UWIA 1PPBH 2XXLA 1QRWA 1JWTA 2AEIH 3L3TA 1IQEA 3M5MA 1FV9A 4MPVA 1FN8A 1SGEE 2UUYA 4OGXA 1Q31A 3K6YA 1DUEA 1O33A 4INLA 4CRCA 1LKBA 5DP5A 3HKJB 4UFEH 3OY6U 4AYVB 5C5NA 1UJ1A 4LZ4B 4BAHB 3BSQA 2GMTB 4FU8A 1MH0A 1HV7A 5AVDA 1O3FA 1SR5C 1XVOA 2ANMH 4RKOB 4GCHG 2UWPA 3LH3A 2RA3A 4UE7H 4LK4A 1EQ9A 1AFQC 1DS2E 4GUXA 2ZKSA 1QTFA 3E8LA 2H2ZA 4B71A 3ZV9A 1AI8H 1LQEA 2V3HH 1SGPE 2P8OB 1S6HA 1ANCA 4YOGA 1HRTH 3A83A 3RDZA 1A5HA 2ZWLH 1QCPA 2ZU4A 1BDAA 1ZJDA 1GHYH 2Y7XA 3P8GA 1FZZA 1ZSLA 3KL6A 3LIWA 2AIPA 1O2KA 4NWLA 1WUNH 1TNKA 2J94A 3UFAA 3U8TH 4GSOA 4BTIB 1KTTB 3E16B 4CR9A 2FI3E 4F4OC 3VXFH 3U8OH 6CHAB 2NWNA 4IC5A 1SVPA 2OXSA 1MTNC 1O3BA 3MTYA 4K5ZA 2H6MA 4MDSA 5SGAE 3A7WA 3SHCH 4CH8B 2O8WA 2Z3EA 2A1DB 2CMYA 2BZ6H 1OP0A 4E7NA 3WY8A 1RS0A 2WUBA 5DPAA 1GI5A 2GCHG 2A4OA 3BG4C 4K3JA 2CV3A 2WPLS 2AGEX 3SU4A 2PR3A 1WTHD 2Z9GA 3GICB 3QZQA 2ZPRA 1K1OA 1BBRE 4FUHA 1PFXC 2AMQA 3RXDA 1D3PB 4X6NA 3DUXH 4K60A 4WVPE 3S69A 3BTQE 2GZ8A 2HLCA 4CRAA 4Y8YA 1GJCB 1OYTH 1OWDA 2BYAX 2FDAA 4IMZA 1C5RA 2FYQA 4H6SB 3E0PB 6GCHG 2XWAA 1OOKB 2HNTC 4JMYA 1RTLA 1SFIA 1SOZA 1SGTA 2C8YB 1A2CH 4X1RU 4HZHA 4VGCB 1W13U 3ITIA 3T25A 3MH5A 2V35A 1PYTD 4B73A 1GDQA 4Y7BA 5JPMH 1GJ5H 2FXRA 2XCFA 3LGUA 3RXPA 1KSNA 2OLGA 3SNBA 4R0IA 1AWFH 1V2ST 1LVOA 3UOPA 1CA0B 5EXLA 3RUOA 3SV7A 3F1SB 4K1SA 2YNBA 1H9LB 2BQWB 1D3TB 1IQHA 2B5TB 1Z8IB 1W3CA 1QRZA 1HAVA 3URCA 3M5LA 2QXGA 4ASHA 1MD8A 1O3LA 5FX5A 1XXFA 1UTOA 2VJ1A 1GI1A 3GY3A 1IOEA 3LT3A 1P06A 1TLDA 2AGGX 1YGCH 2XC4A 4X8TH 3S9BA 3LOXA 2ESTE 1LHEH 1NFYA 1GBBA 1XMNB 1DWBH 4FVDA 2AYWA 3PTNA 3AVZA 2EI8A 2QF0A 3N7OA 4ABBA 1TPOA 1FUJA 2P3TB 1C2JA 1BUIA 1S84A 3GY8A 3V13A 5A8YA 4CHAC 5C3NA 1BMLA 1FPHH 3LJOA 3TU7H 2A7HA 3KIDU 3FP6E 2F9NA 3RU4D 1V2MT 1ELDE 3PM3A 1AFEH 1DDJA 1F0TA 3F9EA 3O8DA 3RMNH 4CH2B 4ISOA 2WINI 3EQ0H 1ESTA 1FDPA 1TBZH 2TRMA 3RM0H 5C5OA 1EAWA 3LH1A 1IHSH 4CBOA 4NGAH 1G2LA 1GI8B 1W14U 2LPRA 3OYPA 1PPCE 5TCCA 1LVBA 2VGCC 4ESTE 1BBRK 2WPIS 1NU9A 3TGKE 3TJNA 1C5XB 4NIXA 1GL1A 1C4V2 4DG4A 2GVFA 3SU3A 4OS6A 3P8OA 4CRGA 3AASA 1O5CB 1CA8B 1QIXB 3GY6A 3E3TA 3PLKA 5CHAC 3UREA 3QX5H 3SZNA 1PQ7A 1EP6A 1YCPM 3GCHB 1GJ6A 1P03A 3BIUH 1UK3A 3GISB 1HFDA 1O3OA 1FJSA 1HIAA 1O3EA 1O2HA 2FOGA 3RXBA 4OS2A 1ZGIA 1OKXA 4Y79A 3RC4A 4HFPB 1O2NA 1P02A 1K1NA 5F03A 1K1PA 2QAAA 3QZRA 3VPKA 5GIBA 2VB0A 2BVXH 1P2QA 1UMAH 4XOJA 1KY9A 1NS3A 1GJ4H 1V2TT 1MKWH 3T62A 1BRBE 5F8ZA 4HTCH 4AFSA 2ZTZA 1HPGA 3U8RH 5E8EH 1SGCA 5L2ZH 1A7SA 3L33A 2G5NA 1F0RA 2G00A 2ASUB 1SGIB 1AE8H 1NPMA 3RXEA 4NSVA 1GGDB 1O5FH 3A84A 2ILNA 3LONA 3KF2A 8GCHF 1BTHH 1NRSH 1V6DA 1BCUH 1PQ8A 1AB9C 4GHTA 4DOQA 1HAPH 3HGPA 4UFDH 2ALPA 5FHTA 4WMFA 2WPJS 1SFQB 1K1MA 4MPUA 1A5GH 2Y5GA 1V2WT 1VJ9U 1G3CA 3SGAE 3EYDA 2BDIA 1LTOA 1GMCG 2GCHF 1P2JA 1Y3YA 1DITH 1GG6B 4M7GA 2THFB 3TJOA 3UNQA 1XUKA 5DP9A 3A87A 2G5VA 4J1YA 3SJ9A 1W2KH 2F9UA 1YPGH 3NCLA 1TQ7B 1YPEH 1KIGH 1SGQE 2R2WU 4JZ1A 4AX9H 5JB8S 2QXIA 1EJNA 1K1IA 1C1VH 4BAOB 1JIRA 1BIOA 1SGFA 3T29A 2SNWA 3UTUH 1AUJA 3PWCA 3KQEA 1QBVH 3ZZ5A 4Y76A 2O8MA 1DXPA 1SLVB 1GI4A 5EXMA 1BRCE 1DANH 2V6NA 3GYMA 1WQVH 3KNXA 4X2YA 4X6MA 4B2CA 1Y3VA 1MCVA 2QA9E 3RXAA 3JZ1B 8LPRA 1XUIA 4OS7A 4NFEA 1BB0B 5LPEA 1X7AC 1V3XA 1GBKA 3M5NA 1ZPZA 1O32A 1DSTA 2HALA 1N8OB 2A4GA 2C90B 1TNJA 2BY6X 1ZJKA 1O3HA 5C67A 2BTCE 5DJ7A 3B23B 2FOMB 2NU3E 2ZCKP 1EUFA 5EPNA 5BPEA 3TVJB 1IQMA 1BTUA 1LHDH 2DE8A 2ZPQA 1C5MD 1E0FD 2HWLB 1E37B 3QO6A 4NIWA 1UO6A 5J4QA 5JBTA 2A4QA 2VVCA 1PPEE 1ZTJA 3OU0A 2BLVA 1O2ZA 1FXYA 2YNAA 1NY22 1A0JA 1HGTH 1QJ1B 1KTSB 1TA2A 1P05A 5DK1A 1UVUH 2XRCA 2F3CE 4IMQA 4FXGH 1Z8GA 2BHGA 2ZHFH 3KCGH 3RMOH 1SL3A 1W0YH 1DICA 4WY3A 2WUCA 1C2IA 1FY1A 2BDCA 3NKKA 4D7FA 1GWAA 2FOCA 1W12U 1O2VA 4Q7YA 1AFQB 2GZ9A 4WH6A 2W3IA 4NA9H 4OS4A 2Z3CA 4O97A 4WH8A 2ZP0H 1UTLM 3Q00A 3VEQB 4I8HA 4Z0KA 3RXGA 1V2LT 2OC7A 5E0HA 2I6SA 2ZHEH 1VR1H 1CHOF 3PO1C 1F2SE 3HK3B 3ATMA 5GJ4B 2Q6GA 3TJVA 1P2IA 1ELTA 1Y8TA 2Z9LA 2TGDA 1ZPBA 2FS9A 1QY6A 3EDXB 3E90B 2PSXA 4HGCA 1OWHA 2WV4A 4BTTB 1C2GA 1UHBB 1A0HB 1MCTA 2OBOA 3EA9A 3V0XA 1YPHC 3PMBB 2BDAA 3CS7A 1OP2A 2SGEE 2ZDMA 1OSSA 3BG8A 1V2QT 3SUEA 3VB3A 1TOCB 1ZRBA 3Q3XA 3SHAH 1V2JT 1GBMA 5C1YA 4SGBE 2BD2A 1OXGA 3NZIA 1O3NA 4FUBA 3RMMH 3TNSA 3UNSA 1T31A 3BG4B 1AHTH 2P59A 3MNSA 1XVMA 3GDVA 2A7JA 1S0QA 1XUJA 3UPEA 1EZUC 1GHBF 1IQIA 3SJOA 1S5SA 2Z9KA 3GY7A 4Q80A 4JK5A 1SLUB 1EAUA 1DLEA 3VFEA 2KAIB 1K22H 3SN8A 5AFYH 4A6LA 3MHWU 1EPTA 1QBOA 1G30B 2XCNA 3BN9A 3QWCH 1ORFA 1B0FA 1P3CA 4JYTA 1FIWA 5T3HA 1C1NA 4PROA 1C4U2 2TGTA 3MI4A 1AZZA 1TGBA 3EE0B 3QK1A 1V2UT 4Z6AH 4AFQA 7ESTE 5GXPA 2R0LA 2QXHA 1P09A 4Q7ZA 1AVWA 1O2UA 1B7XB 1O2LA 1FN6A 1BJUA 2FLBH 3BTTE 2OUAA 1EZQA 1ZOMA 4KELA 3MO3A 1GCDA 2J34A 3MH6A 1GI9B 1L0ZA 3KGPA 5E2PA 1LVYA 1O39A 1C2EA 1D3QB 1V2KT 1FIZA 1GMCF 2XC5A 3MOCA 1Z1JA 1PYTC 4MVNA 2AGIX 3FZZA 2HVXA 4I8GA 3GCTF 1YPHE 1FY8E 1QJ6B 4I8LA 2ZIQH 1O2IA 5A0AE 4FUEA 5GPIB 1EASA 1AWHB 2GTBA 2ODYB 3TH3H 3MO9A 2JH6D 4NIVA 1RD3B 2VVUA 1GBLA 4CR5A 2BVRH 2H1UA 3F6UH 4K69A 2ZA5A 5EODA 5A2MH 1OWKA 1C2FA 3SV8A 1MAXA 1CU1A 2QC2A 5CE1A 4QT8C 3SI4H 1AO5A 7KMEH 2PUQH 2FYRA 2H9TH 3ZVDA 4K8YA 1J15A 1VITG 1O2SA 3SGBE 2JETC 1EJMA 1BOQA 1ZGVA 2SNVA 3F9FA 1YYY1 3MMGA 4Q7XA 1KDQA 4CHAB 1HUTH 4NSYA 1MBQA 1BJVA 4BAMB 1YPLH 1BHXF 1ARCA 2FX4A 3K6ZA 4BOHA 3GDSA 1TABE 2Y82A 1GI0A 1UK4A 1N6YA 1YM0A 3ATIA 4TYDA 1O2MA 1W0ZU 2GV6A 1LO6A 1FY5A 2HPQH 3PV4A 2BDYA 2P93A 1H9IE 1KLTA 3ZYDA 3RXSA 1YF4A 1TBQH 3KQBA 3RXKA 1UTJA 3P70B 3SU2A 1O3IA 4XDEA 4FU7A 1OWIA 1CQQA 2SGAA 2NU4E 1UTPA 4KP0A 2Z7FE 1KXAA 1UTQA 2Q1JA 2VGCB 1QB9A 3BTFE 1MKXK 2B8OH 4HI3A 1VZQH 2ZFRH 5JYIA 3ZVBA 3HKIB 2QIQA 4MNWA 2ZGJA 4U32A 1EPTC 5CHAB 2FO9A 1K21H 1NFXA 4TWWA 3OX7U 2G4UA 1B5GH 1P2MA 1WCZA 3UR6A 1H9HE 1MTVA 1A4WH 1SB1H 1Y3XA 4ISNA 6LPRA 2QV1A 1AGJA 4ZHLU 4YOIA 1T4UH 2Y5HA 4ZROA 3RU4T 3SQHE 1XKBC 2XWBI 3LU9B 4ISHH 1FAXA 2FOBA 1NFUA 3VB6A 2D8WA 3PWBA 4Y8ZA 1ACBE 5FCRA 5PTPA 1HJ9A 1QA7A 1V2RT 3IITA 3O8CA 1D3DB 1TPPA 2Z9IA 3ESTA 3TPIZ 3MNXA 1GDUA 1CGJE 1C2MA 3DA9B 4SGAE 2FMJA 1D4PB 1GI2A 1AZ8A 1TONA 2FTLE 2A32A 4IS5A 3RU4E 1SC8U 4LOYH 4MQAA 2AIQA 1O30A 1HAVB 2UUKB 3EAJA 2BQ6B 1S6FA 2UWOA 1ANEA 1GHAG 2OD3B 2A0QB 1FQ3A 1THSH 3M7TA 4O3UA 1PPZA 1AB9B 4A1XA 2SGQE 1HB0B 3MO6A 3ZZ4A 1NROH 1QL9A 1TE0A 1J8AA 1O2RA 3SBKA 2W7SA 1BRUP 1O37A 3RXHA 1MQ5A 1O2OA 1EATA 1Z8JB 3B8JA 4IN2A 5IYTA 3PMHB 4D9QA 3NWUA 3DD2H 1O2QA 3ZVFA 7LPRA 2G51A 2ANKH 3VGCC 2Z6BD 3FFGA 5EU8A 2P16A 5C2ZA 2STAE 2TPIZ 2PKAA 1FMGA 1LPGB 1O3GA 1LHCH 3V12A 2G4TA 3M37A 4OGYA 3T27A 1DFPA 1P0SH 5JB9S 4WXVA 5T6FA 1BBRH 3RXUA 1DSUA 1ELBA 1C1PA 2ZCLP 1EOLA 3E91A 4IW4E 3M3SA 4X2VA 2Y7ZA 1ELAA 4XBCA 4JYUH 1SQTA 2VIVA 4NCYA 4GAWA 1ETTH 3GYLB 1WOFA 3A80A 1V2VT 2WPHS 2P3UB 1O5DH 2TGAA 1VGCC 1YCPH 3P8FA 1TPAE 1EKBB 2QGRA 1HYLA 1HCGA 4ABIA 1C5PA 2C8XB 3BEIB 1MU6B 1YLCA 1TGNA 3ATKA 1Y5BT 1GMDF 1C9TA 1FY4A 1QL7A 1WV7H 4JYVH 1SGDE 3U1IB 3SUGA 1ZYOA 1L1JA 1DWCH 1YC0A 2VINA 1HIAB 2LNCA 2UUFB 5FPTA 2Q6FA 1GPZA 1H4WA 1B0EA 2OC8A 1S82A 1A5IA 3NXPA 1OWJA 3RP2A 1C5TA 2QN5T 1DWDH 5K7RA 3EGKH 2PV9B 5E0JA 2HNTE 3IG6B 2WPKS 1AY6H 1JRTA 1O2GH 3URDA 3E0NB 4DIIH 4KTUA 1MTSA 2VH0A 1HAGE 1CE5A 3SNCA 1NFWA 1C5WB 1IQKA 1RIWC 1C9PA 1O2WA 1WBGB 5GDSH 1Z1IA 2QF3A 1FPCH 1EP5A 5B6OA 2O8TA 1TGCA 2TGPZ 1KXBA 2BXTH 3MNCA 1UK2A 4A7IB 1AN1E 3P95A 5T6GA 3SNEA 4U30A 4XSKU 2FOFA 1QB6A 1XUHA 1MTWA 4CBNA 2ODQA 3TIUA 2F9OA 1SMFE 3KEEA 3B9FH 4FUIA 4ZXYH 3A7TA 4F49A 1C5OH 3AAUA 1KXFA 4Q2KA 2OTVA 3PO1B 1C1SA 4GCHF 4YO9A 3RXFA 4ZH8A 3M7QA 1BT7A 2W7UA 5FPSA 1E38B 3SGQE 1VCWA 1G3BA 1ID5H 2ZNKH 4CRBA 1O2JA 4NWKA 2PFEA 1SGRE 4DJZB 2ANWA 4KTCA 4A1VA 2XYAA 4IC6A 5ESBA 1O3MA 2UWLA 4U2WA 1C1QA 2ZU2A 1A3EH 3ZZBA 4AGKA 2C93B 1OX1A 1N6XA 1A3BH 2PWXA 1BTZA 1MZDA 3BTME 2ZTXA 1P12E 2FEQH 4NG9H 2BD5A 1W7XH 3SQEE 2ZCHP 4DIHH 1ANBA 5JDUB 1ELFA 2ZDLA 4ISLA 5JBCS 1ELVA 2VIQA 3RM2H 2P3FH 2FZZA 1BTXA 1AKSA 3A8DA 2EI7A 3BIVH 4FUGA 2FOHA 3SU0A 1KLIH 5FXLA 2ANYA 5C1XA 3TK9A 3PYHA 4RN6A 1TMTH 1HXEH 4OS1A 1OS8A 4FUFA 3SW2B 2FLRH 5HMAA 1Z6JH 1WSSH 1TIOA 1UTNA 2Y81A 3M36A 1SQOA 4CRDA 2XBYA 3D23A 3UIRA 3BF6H 5JBBS 4I7YH 1G9IE 3GDUA 2WYJA 3HK6B 5T6DA 1EOJA 1HAXB 3ZZ8A 1AVXA 1O35A 1JXPA 5A0BA 4B2BA 2BM2A 3MU8A 3TGJE 3FANA 5LPFA 2BMGB 1MD7A 3BEUA 6GCHF 1WU1A 3L6PA 4INHA 1P04A 2FM2A 5I46H 1UVOA 3SJIA 3M7UA 3BTKE 1WYKA 1HNEE 4AG2A 3O8RA 3Q77A 4DT7B 1PJPA 1TGSZ 1MKWK 2J2UA 1JBUH 4Y6DA 4AB9A 5ABWA 3H7OA 2NU0E 2GKVE 1XUGA 3KN2A 3HATH 1ZHMA 1ABIH 4B74A 4LZ1H 2GGVB 5G4BA 2F83A 2BY7X 2JETB 1ETSH 1PPFE 2WYGA 3I29A 1ELGA 1SG8B 1C1RA 1GVLA 3OTJE 1AQ7A 4NA7A 1SGFG 3S9AA 2IN2A 1W10U 1GJ9B 1NC6A 2VU8E 2ZG0H 1LMWB 2J92A 4YOJA 3FP7E 2Z9JA 2ZZUH 2J95A 3QN7A 2OCVB 3A81A 5A09A 3RXRA 3PMJA 3ZZCA 2SFAA 1TA6A 1O0DH 1QJ7B 1PPGE 3NK8A 2VWNA 2Y5FA 1C1OA 1O34A 3TK5A 1SSXA 1BTWA 4ABJA 2CF8H 4MG3A 5EQQA 1HJAC 1TPSA 4A1TA 3M61U 1A46H 1F92A 3LGTA 1LCYA 2A31A 3TK6A 5DKMA 2Q6DA 4B75A 1FLEE 1EPTB 1C5ZB 2BVSH 1UCYH 2HGTH 4DCDA 1MZAA 3JZ2B 3TH2H 1F0UA 1ZRKA 4YLQH 4K2YA 4BTUB 2W5EA 3M35A 3LGWA 1LQDB 2D1JA 3A8BA 2BDGA 4YZUA 2ZDNA 3ZZ6A 3LGVA 4NFFA 3GY4A 3ZZ9A 2STBE 2NU2E 2VH6A 5DP8A 1HJ8A 1HBTH 1O3PB 1Y5AT 4MLFB 1ETRH 3KQCA 2BX4A 5TJXA 2VNTA 1DVAH 1K9OE 1ZPCA 2UUJB 4GPGA 1C5QA 1TNLA 3NUMA 4GLYA 1DWEH 3W95A 2ZTYA 5GCHG 1BTPA 1O5AB 3ATLA 3ZZAA 3ODDA 1ZTKA 3KHVA 3SJKA 1GHWH 1RTKA 2OC1A 1ANDA 2QYIA 3LPRA 4WJG2 1TRNA 1F0SA 3PTBA 3SNDA 3VB5A 1UVSH 1ZZZA 4DY7B 2ZHWH 2PLXA 5EGMA 1O5EH 5HYOA 1OP8A 1QL8A 3D49H 1D6WA 1Y59T 1C1UH 1BMAA 4O03A 4YTAA 2H5CA 1BMNH 1H8IH 5EW2H 1Y3UA 2F9VA 3H7TA 4CREA 3TNTA 1TNGA 2R9PA 4RSPA 4XE4A 3MH4A 1BMMH 2R0KA 1DX5M 3V7TA 1BTYA 1KDQB 4FU9A 1T7CA 1AE5A 4ABDA 1G2MA 2ZI2H 2ZFTA 3PLBA 3VGCB 1O36A 2ZU3A 3SV2H 2VWOA 2PGQB 1UHBA 1K1LA 4ZKOU 2RCEA 2FS8A 1EZXC 2BLWA 3FVFB 1FI8A 4YESB 1P2KA 2FP7B 5EOKA 3T2NA 3T28A 1YKTA 1C2HA 2GDDA 3UNRA 2R3UA 1GCTC 4O9VA 1O3KA 1GBEA 4YLUA 1ZSJA 1SQAA 3RXIA 5AHGH 1GJAB 3ZVEA 4R8TB 4E06H 3D65E 4H4FA 3RXOA 1CHGA 4ZHMU 3UR9A 3BTGE 1L4ZA 3EA7A 4B1TA 2PHBA 4Y71A 3P92A 1ARBA 1VGCB 1O3JA 2EEKA 1QGFA 1P9UA 1YLDA 4WXIA 1J17T 2A2XH 1O5GH 3S0NA 4I8JA 5ESTE 1JMOH 1ZLRA 4JZIA 2VWLA 3BV9B 3K65B 4UFFH 5A0CA 4AG1A 4WMEA 1IQNA 1GBTA 4A5TS 3NPSA 2ZGCA 2RG3A 1CT4E 4GVUA 2ZFSA 3RLYH 3STIA 2R2MB 4BAKB 1O2XA 4I8KA 3A7ZA 2TBSA 3IWMA 4KGAA 1O3CA 4TPIZ 5H4IB 2FIRH 4MNXA 4ZKRU 1C4Y2 2P94A 3SO3A 4X6PA 3ZZDA 1HAZB 4TY6A 3AW0A 2OC0A 1RIWB 1ZMLA 2CN0H 1PPHE 1RXPA 1TALA 1C1WH 1U6QA 5I25A 1BQYA
chains in the Genus database with same CATH superfamily
1EX3A 3SV6A 1RTFB 2QY0B 4X1PU 2ZFPH 3STJA 5A8XA 2ZFQH 2A2QH 3ATWA 3PMAB 2OBQA 1TFXA 3CP7A 5FBEA 1Y3WA 4X1SU 3P17H 8ESTE 3ZV8A 3RXJA 3ZVCA 5EW1H 4NZLA 2GP9B 2GZ7A 2RDLA 3Q3YA 1RJXB 3TLOA 1QA0A 1XM1A 2PTCE 3U69H 4AFUA 1D6RA 2KM0A 1P11E 3A7VA 4AYYB 4AN7A 1HLTH 1VJAU 3A7YA 4X2WA 1ZHRA 1C5SA 2GT8A 2PSYA 4X1NU 1WTGH 1GBIA 2G8TA 4K1TA 1F5LA 4ZAEA 3BTEE 4DURA 3M3TA 3LDXH 1THPB 3A8AA 2F4LA 1TOMH 4GHQA 4AC9A 1GVKB 2CHAB 1K0HA 3H5CB 1J14A 2PKAB 1QNJA 1T8MA 2F9BH 2GCTC 2JH0D 4E7RG 4ZXXH 8GCHG 5DP3A 5HXFA 3LKWA 1KLJH 1AMHA 2ZGHA 1Q3XA 4THNH 1LPZB 1JIMA 1RFNA 5T1VA 1DY8A 1MU8B 1P10A 2ZO3H 3T5FH 1NRPH 1GI6A 1NU7B 2PW8H 2ZGBH 5JBAS 2BOKA 1AIXH 3N7DA 2BD4A 1C5NH 1LPKB 4ZKNU 2H5DA 2FX6A 1NM6A 1H8DH 2L74A 1O3DA 4DT4A 4UEHH 1YPMH 3UWJH 1P2NA 2CF9H 4MPWA 1S81A 3P8NA 2DUCA 2B9LA 1QFKH 5GCHF 3BEFB 5KEDA 1QRXA 9ESTA 3ZVGA 2V0BA 1EB1H 2M5TA 5ETXA 3RLWH 2F91A 2ZHDA 3MU1A 3S7KB 1CT0E 1ELEE 2ZU5A 3GCOA 4HG6A 1Z71A 1FNIA 5J4SA 2PKSC 1GI7B 3FOAA 4AORA 2GDEH 5E2OA 2OQ5A 1SGYE 2A7CA 4WMDA 2ZFFH 4YT7H 4TWYA 1FY3A 2ZECA 1AUTC 1GJ8B 3KQDA 5LPRA 1C2LA 2O9QA 3SU1A 4XBBA 1QQ4A 1TAWA 2A45B 3P6ZB 2ZDVH 2FOEA 1D9IA 1J9CH 2ZQ1A 2EA3A 4P02A 3GY2A 2O8LA 3GY5A 2FI4E 1TNHA 4MNVA 5HIZA 3ZVAA 1KXEA 3VXEH 4BXSA 3DFLA 1MQ6A 2W26A 1DXWA 1HXFH 1BA8B 3A88A 3A86A 1O2TA 4NIYA 3SYJA 3A89A 3LGIA 1S83A 2BX3A 2NU1E 1DPOA 2ZQ2A 1GBCA 1FONA 5DP4A 1UTKA 2JKHA 1NTPA 1Z7KA 2GD4B 3SJ8A 3BTWE 1T4VH 4BAQB 1EXFA 3TH4H 1CBWC 5DP6A 4NA8A 1IQJA 3CENA 3QUMP 5DG6A 4UFGH 1O2PA 3PROA 2ZGXH 1YPKH 2SGFE 1IHTH 1SBWA 1TNIA 2BD8A 4XFQA 1VITH 1BRAA 1V2OT 5HM2A 1GBFA 2J4IA 1NRNH 1EJAA 1QR3E 1P01A 3GCNA 4JK6A 3OE7D 5L6NH 3TGIE 4FUJA 2BD3A 1ZTLA 2PGBB 4D8NA 5GNDA 1VITF 3ELAH 1DLKB 3QGNB 1TX7A 2BQ7B 2C8ZB 5EQSA 5FBIA 3SV9A 2YMSB 1O2YA 2H9EH 3AAVA 1GI3A 1AVGH 4IBLH 1CT2E 1ABJH 1IAUA 4IGDA 1C5LH 1GMHG 3SNAA 4NZQA 3A7XA 1INCA 2FI5E 3UOUA 3UQVA 1Z6EA 1S85A 4Z1MD 4TPYA 2GMTC 4FUCA 1O38A 4K1EA 1LVMA 3LJJA 1SOTA 1CHOG 4TT3D 1IQFA 2FOAA 1HJAB 2HLDD 3QTVH 4INKA 3RC5A 3A85A 4Y0YE 1GJ7B 1AKSB 3TJUA 1SLWB 1EAIA 2IOTA 1V2PT 1J16A 1NT1A 2C3SA 2J9NA 1W7GH 3F9HA 3Q3KA 3RXMA 4F55A 5LGOA 4J2YB 2WPMS 2P8OC 2ZEBA 1TRYA 1Y5UT 3S9CA 4MTBA 3WW7A 5GWZA 4K8BA 3OSYA 1TGTA 2XBVA 4WWYA 1YCPK 2HNTF 4LXBH 1LHFH 1H8ED 1BHXB 3QGJA 4OS5A 1DM4B 5A8ZA 3HGNA 1TX8A 3MU5A 3GOVB 2CHAC 2EC9H 5CMXH 2PUXB 2AH4X 1F5KU 4ABGA 1O5BB 4AFZA 1C1MA 3D62A 1W11U 1OYQA 1UVPA 5LH8A 6CHAC 3ENSB 1K1JA 1GHBG 3PLPA 1F5RA 1HAYB 4MPXA 2QXJA 2XBXA 2JH5D 2VIDA 2TIOA 3CNRA 5F8TA 5IDKA 2D26C 3G01A 1G3DA 5EG4A 3LGYA 2XW9A 4AGJA 5F8XA 2BOHB 3W94A 3U1JB 2BY9X 3SI3H 1P57B 2AMDA 1WXRA 3DHKH 2B0FA 3E1XB 4DW2U 1C5UA 3VB7A 8KME2 2O8UA 3FAOA 3QLPH 4H42U 1FAKH 1GHZA 1XUFA 1YBWA 1GHAF 1JOUB 3E6PH 5DGJA 2Y80A 4RT0A 1A0LA 2ZU1A 2AFQB 4TY7A 2BY5X 1MMJN 3EA8A 4Y7AA 3SU6A 3KYGA 3SORA 1NBME 2FPZA 3AW1A 1GHVH 5EJLA 1ZHPA 2G52A 1ESAA 2BY8X 1GDNA 2BDBA 4YT6H 4O3TA 1LKAA 1NRRH 3GCTG 4I32A 1ELCA 2OP9A 4I31A 3C1KA 4VGCC 2BD9A 2A5IA 1GJBB 4X8UH 1V2NT 2FODA 2SGDE 2ZDAH 1G37A 1G3EA 1ZR0A 2HRVA 1AU8A 1GCTB 1WDIA 1IQLA 4JCNA 7GCHG 2HPPH 2Z94A 1CA0C 4ABEA 1HAIH 3R3GB 5FPYA 4ISIH 4KKDA 2ZPSA 2V3OH 2FTMA 4A92A 3DSPA 1AD8H 1GVZA 4B2AA 3RC6A 2BXUH 2GX4A 4BXWA 1A61H 5C1UA 4YM9A 5HM9A 3BTHE 4IN1A 1QQUA 1TMBH 4CRFA 5AFZH 2IJOB 2K1QA 3HPTB 4X8VH 1TB6H 3MNBA 3C27B 1TQ0B 1TWXB 3SUDA 3BTDE 1P8VC 4E05H 3SUFA 1T8LA 5AF9H 1PQ5A 3O8BA 3F68H 2ZHQH 4I86A 3ZZ3A 1K28D 2C8WB 4ZKSU 5L2YH 1P9SA 2J38A 1O31A 3VB4A 2C4FH 1TMUH 1C5VA 2IPHA 5FX6A 1O3AA 1PQAA 1E35B 2WV5A 2KX4A 1N1LA 1QURH 1Z8RA 2EI6A 2WHXA 2VWMA 3M3VA 1WQSA 2VIOA 4X0WU 1DE7H 2EY4C 1UCYE 5EJZA 3R0FA 1M9UA 2ALVA 5B6LA 3MYWA 1ZMNA 4ZUHA 2ZC9H 4ZMAH 1QB1A 3N7EA 1DUAA 4I33A 1XX9A 3DFJA 1RGQA 4MNYA 5EXNA 1TBRH 1XXDA 2PTNA 4Y10E 2YOLA 1EB2A 2ZF0H 3MFJA 2GT7A 3UUZA 1W8BH 2AERH 4AZ2B 2FWWA 1G32B 2VIPA 3SOSA 4UONA 3PB1E 1DOJA 1GMHF 3K2UA 2XC0A 1C1TA 4WF8A 1GBDA 3T26A 1P3EA 1ESBA 1C2DA 1GBHA 1E79D 1NESE 1SGNE 2QE7D 4ZHAA 4D76A 2XBWA 1CGIE 1SPJA 2A5KA 3GCHC 1NN6A 3QTOH 2AS9A 4P00A 1VCQA 3TITA 5E0GA 1LHGH 1DT2A 3I77A 1THRH 1K2I1 5EQRA 1SHHB 2W3KA 1TX6A 1KXCA 3VG8A 3MH7A 2BDHA 1G36A 1NO9H 2P95A 4RKJB 4DGJA 1L2EA 1SHYA 3LC5A 2GCTB 1L1NA 2Y6TA 1HAOH 3CS0A 3RXLA 2XNIA 1L4DA 3LC3A 1E34B 4XD7D 4DVAU 1OWEA 5EPYA 2D2DA 5TCAA 4AB8A 3V3MA 1GJDB 1HDTH 1MTNB 4KTSA 5CHBA 1GL0E 4BNRA 4Y8XA 2OINA 2BB4A 2FESH 2BZAA 5DP7A 1VCPA 4D9RA 4UD9H 1QHRB 1CGHA 1T8OA 1MTUA 1GGDC 4X8SH 1IQGA 1MBMA 1TYNA 2F9PA 2XNDD 4ACAA 4X2XA 2B7DH 3ZYEA 1CVWH 2BLOA 3U98H 1Q2WA 4ASUD 2I6QA 4JZFH 2XTTB 3K9XB 5K0HA 4Y0ZE 2QCYA 3UY9A 1E36B 1RRKA 1YP9A 4D7GA 2CXVA 4Q4LA 4X1QU 1OPHB 2SGPE 2ODPA 3ODFA 2ZDKA 1GG6C 2BLQA 4RI0A 1KYNA 3RXQA 3UQOA 3SU5A 1BITA 1JRSA 5F6MA 1BZXE 1UTMA 2PKSB 3I78A 1MAYA 4F48B 2Z3DA 9LPRA 2R3YA 1EAXA 1UCYK 4X6OA 3RXCA 1MKXH 1KXDA 1WAYB 4ABFA 3MU4A 5FAHA 3MWIU 2ULLA 4JZEH 3RXTA 2G81E 4ABAA 1HAHH 1F7ZA 5L30H 2BD7A 3ZZ7A 5DO4H 1T8NA 1YPJH 2J98B 4FUDA 1C5YB 1XKAC 3U9AH 5HGGA 5C20A 1ZMJA 4UDWH 3OY5U 4U01A 1GHXH 1GMDG 1SI5H 3FZDA 1SLXB 1ZSKA 1H1BA 2DE9A 1S0RA 1TRMA 2OQUA 3A8CA 2H9HA 1CO7E 3F2GA 2KAIA 1NZQH 1COWD 1EZSC 3FP8E 2G55A 3Q76A 2A4RA 4BANB 1CBWB 4ABHA 2GV7A 4H6TA 4Y11E 1QBNA 3DT0H 2RDEA 5BRRE 7GCHF 3OEHD 1MUEB 1DY9A 1N8OC 2AMPA 1L1GA 1NRQH 3M5OA 4AOQA 6ESTA 2RA0A 3MU0A 3F9GA 5FCKA 3S7HB 1LDTT 2CJIA 1CSOE 1A1RA 3RMLH 3QDZB 4B76A 1GBAA 2IJD1 5EIYA 3RXVA 4FVBA 3FO8D 2VIWA 1GBJA 1T32A 3A82A 2VVVA 4XBDA 4JZDH 1C2KA 1UVTH 2A5AA 2CGAA 1QZ8A 2HOBA 1P2OA 3UWIA 3FN8A 1PPBH 2XXLA 1QRWA 1JWTA 2AEIH 4B6FA 3L3TA 1IQEA 3M5MA 1FV9A 4MPVA 1FN8A 1SGEE 2UUYA 4OGXA 1Q31A 3K6YA 1DUEA 1O33A 4INLA 4CRCA 1LKBA 5DP5A 1BMFD 3HKJB 4UFEH 3OY6U 4AYVB 5C5NA 1UJ1A 4LZ4B 4BAHB 3BSQA 2GMTB 4FU8A 1MH0A 1HV7A 5AVDA 1O3FA 1SR5C 1XVOA 2ANMH 4RKOB 4GCHG 2UWPA 3LH3A 2RA3A 4UE7H 4LK4A 1EQ9A 1AFQC 1DS2E 4GUXA 3DSOA 2ZKSA 1QTFA 3E8LA 2H2ZA 4B71A 3ZV9A 1AI8H 1LQEA 2V3HH 1SGPE 2P8OB 1S6HA 1ANCA 4YOGA 1HRTH 3A83A 3RDZA 1A5HA 2ZWLH 3DCLA 1QCPA 2ZU4A 1BDAA 1ZJDA 1GHYH 2Y7XA 3P8GA 1FZZA 1ZSLA 3KL6A 3LIWA 2AIPA 1O2KA 4NWLA 1WUNH 1TNKA 2J94A 3UFAA 3U8TH 4GSOA 3OEED 4BTIB 1KTTB 3E16B 4CR9A 2FI3E 4F4OC 3VXFH 3U8OH 6CHAB 2NWNA 4IC5A 1SVPA 4Q63A 2OXSA 1MTNC 1O3BA 3MTYA 4K5ZA 2H6MA 4MDSA 5SGAE 3A7WA 3SHCH 4CH8B 2O8WA 2Z3EA 2A1DB 2CMYA 2BZ6H 1OP0A 4E7NA 3WY8A 1RS0A 2WUBA 5DPAA 1GI5A 2GCHG 2A4OA 3BG4C 4K3JA 2CV3A 2WPLS 2AGEX 3SU4A 2PR3A 2KZ4A 1WTHD 2Z9GA 3GICB 3QZQA 2ZPRA 1K1OA 1BBRE 2QF4A 1PFXC 4FUHA 2AMQA 3RXDA 1D3PB 4X6NA 3DUXH 4K60A 4WVPE 3S69A 3BTQE 2GZ8A 2HLCA 4CRAA 4Y8YA 1GJCB 1OYTH 1OWDA 2BYAX 2FDAA 4IMZA 1C5RA 2FYQA 4H6SB 3E0PB 6GCHG 2XWAA 1OOKB 2HNTC 4JMYA 1RTLA 1SFIA 1SOZA 1SGTA 2C8YB 1A2CH 4X1RU 4HZHA 4VGCB 1W13U 3ITIA 3T25A 3W1EA 3MH5A 2V35A 1PYTD 4B73A 1GDQA 4Y7BA 5JPMH 1GJ5H 2FXRA 2XCFA 3LGUA 3RXPA 1KSNA 2OLGA 3SNBA 4R0IA 1AWFH 1V2ST 1LVOA 3UOPA 1CA0B 5EXLA 3RUOA 3SV7A 3F1SB 4K1SA 2YNBA 1H9LB 2BQWB 1D3TB 1IQHA 2B5TB 1Z8IB 1W3CA 1QRZA 1HAVA 3URCA 3M5LA 2QXGA 4ASHA 1MD8A 1O3LA 5DSFA 5FX5A 1XXFA 1UTOA 2VJ1A 1GI1A 3GY3A 1IOEA 3LT3A 1P06A 1TLDA 2AGGX 2K0QA 1YGCH 2XC4A 4X8TH 3S9BA 3LOXA 2ESTE 1LHEH 1NFYA 1GBBA 1XMNB 1DWBH 4FVDA 2AYWA 3PTNA 3AVZA 2EI8A 2QF0A 3N7OA 4ABBA 1TPOA 1FUJA 5KECA 2P3TB 3F0OA 1C2JA 1BUIA 1S84A 3GY8A 3V13A 5A8YA 4CHAC 5C3NA 1BMLA 1FPHH 3LJOA 3TU7H 2A7HA 3KIDU 3FP6E 2F9NA 3RU4D 1V2MT 1ELDE 3PM3A 1AFEH 1DDJA 1F0TA 3F9EA 3O8DA 2WV9A 3RMNH 4CH2B 4ISOA 2WINI 3EQ0H 1ESTA 1FDPA 1TBZH 2TRMA 2L6OA 3RM0H 5C5OA 1EAWA 3LH1A 1IHSH 4CBOA 4NGAH 1G2LA 1GI8B 1W14U 2LPRA 3OYPA 3F0PA 1PPCE 5TCCA 1LVBA 2VGCC 4ESTE 1BBRK 4FETA 2WPIS 1NU9A 3TGKE 5HIYA 3TJNA 1C5XB 4NIXA 1GL1A 1C4V2 4DG4A 2GVFA 3SU3A 4OS6A 3P8OA 4CRGA 3WWFA 3AASA 1O5CB 1CA8B 1QIXB 3GY6A 3E3TA 3PLKA 5CHAC 3UREA 3QX5H 3SZNA 1PQ7A 1EP6A 1YCPM 3GCHB 1GJ6A 1P03A 3BIUH 1UK3A 3GISB 1HFDA 1O3OA 1FJSA 1VKYA 1HIAA 1O3EA 1O2HA 2FOGA 3RXBA 4OS2A 1ZGIA 1OKXA 4Y79A 3RC4A 4HFPB 1O2NA 1P02A 1K1NA 5F03A 1K1PA 2EQNA 2QAAA 3QZRA 3VPKA 5GIBA 2VB0A 2BVXH 1P2QA 3OFND 1UMAH 4XOJA 1KY9A 1NS3A 1GJ4H 1V2TT 1MKWH 3T62A 1BRBE 5F8ZA 4HTCH 4AFSA 2ZTZA 1HPGA 3U8RH 5E8EH 1SGCA 5L2ZH 1A7SA 3L33A 2G5NA 1F0RA 2G00A 2ASUB 1SGIB 1AE8H 1NPMA 3RXEA 4NSVA 1GGDB 1O5FH 2IPQX 3A84A 2ILNA 2JDID 3KF2A 3LONA 8GCHF 1BTHH 1NRSH 1V6DA 1BCUH 1PQ8A 1AB9C 4GHTA 4DOQA 1HAPH 3HGPA 4UFDH 2ALPA 5FHTA 4WMFA 2WPJS 1SFQB 1K1MA 4MPUA 1A5GH 2Y5GA 1E1RD 1V2WT 1VJ9U 1G3CA 3SGAE 3EYDA 2GJGA 2BDIA 1LTOA 1GMCG 2GCHF 1P2JA 1Y3YA 1DITH 1GG6B 4M7GA 2THFB 2W6JD 3TJOA 3UNQA 3PV5A 1XUKA 5DP9A 2WSSD 3A87A 2G5VA 4J1YA 3SJ9A 1W2KH 2F9UA 1YPGH 3NCLA 1UW7A 3PV2A 1TQ7B 1YPEH 1KIGH 1SGQE 2R2WU 4JZ1A 4AX9H 5JB8S 2QXIA 1EJNA 1K1IA 1C1VH 4BAOB 1JIRA 1BIOA 1SGFA 3T29A 2SNWA 3UTUH 1AUJA 3PWCA 3KQEA 1QBVH 3ZZ5A 4Y76A 2O8MA 1DXPA 1SLVB 1GI4A 5EXMA 1BRCE 1DANH 2V6NA 3GYMA 1WQVH 3KNXA 4X2YA 4X6MA 4B2CA 3OTPA 1Y3VA 1MCVA 2QA9E 3RXAA 3JZ1B 8LPRA 1XUIA 4OS7A 4NFEA 1BB0B 5LPEA 1X7AC 1V3XA 2VBCA 1GBKA 3M5NA 1ZPZA 1O32A 1DSTA 2HALA 1N8OB 2A4GA 2C90B 1TNJA 2BY6X 1ZJKA 1O3HA 5C67A 2BTCE 5DJ7A 3B23B 2FOMB 2NU3E 2ZCKP 1EUFA 3DSGA 5EPNA 5BPEA 3TVJB 1IQMA 1BTUA 1LHDH 2DE8A 2ZPQA 1C5MD 1E0FD 2HWLB 1E37B 3QO6A 4NIWA 5HKKD 1UO6A 5J4QA 5JBTA 2A4QA 2VVCA 1PPEE 1ZTJA 3OU0A 2BLVA 1O2ZA 1FXYA 2YNAA 5CDFE 1NY22 1A0JA 1HGTH 1QJ1B 1KTSB 1TA2A 3KQ5A 1P05A 5DK1A 1UVUH 2XRCA 2F3CE 4IMQA 4FXGH 1Z8GA 2BHGA 2ZHFH 3KCGH 3RMOH 5F53A 1SL3A 1W0YH 1DICA 4WY3A 2WUCA 1C2IA 1FY1A 2BDCA 3NKKA 4D7FA 4YXWD 1GWAA 2FOCA 1W12U 1O2VA 4Q7YA 1AFQB 2GZ9A 4WH6A 2W3IA 4NA9H 4OS4A 2Z3CA 4O97A 4WH8A 2ZP0H 1UTLM 3Q00A 3VEQB 4I8HA 4Z0KA 3F3BA 3RXGA 1V2LT 2OC7A 5E0HA 2I6SA 2ZHEH 3EE7A 1VR1H 1CHOF 3PO1C 1F2SE 3HK3B 3ATMA 5GJ4B 2Q6GA 3TJVA 2HVYB 1P2IA 1ELTA 1Y8TA 2Z9LA 2TGDA 1ZPBA 2FS9A 1QY6A 3EDXB 3E90B 2PSXA 4HGCA 1OWHA 2JIZD 2WV4A 4BTTB 1C2GA 1UHBB 1A0HB 1MCTA 2OBOA 3EA9A 3V0XA 1YPHC 3PMBB 2BDAA 3CS7A 1OP2A 2SGEE 2ZDMA 1OSSA 3BG8A 1V2QT 3SUEA 3VB3A 1TOCB 1ZRBA 3Q3XA 3SHAH 1V2JT 1GBMA 3U28C 5C1YA 4SGBE 2BD2A 1OXGA 3NZIA 1O3NA 4FUBA 3RMMH 3TNSA 3UNSA 1T31A 3BG4B 1AHTH 2P59A 3MNSA 1XVMA 3GDVA 2A7JA 1S0QA 1XUJA 3UPEA 1EZUC 1GHBF 3F2HA 1IQIA 1S6LA 3SJOA 1S5SA 2Z9KA 3GY7A 4Q80A 4JK5A 1SLUB 1EAUA 1DLEA 3VFEA 2KAIB 3PRDA 1K22H 3SN8A 5AFYH 4A6LA 3MHWU 1EPTA 1QBOA 1G30B 2XCNA 3BN9A 3QWCH 1ORFA 1B0FA 1P3CA 4JYTA 1FIWA 5T3HA 1C1NA 4PROA 1C4U2 2TGTA 3MI4A 1AZZA 2QF5A 1TGBA 3EE0B 3QK1A 2OK5A 1V2UT 4Z6AH 4AFQA 7ESTE 5GXPA 2R0LA 2QXHA 3UB0A 1P09A 4Q7ZA 1E1QD 1AVWA 1O2UA 1B7XB 1O2LA 1FN6A 1BJUA 2FLBH 3BTTE 2OUAA 1EZQA 1ZOMA 4KELA 3MO3A 1GCDA 2J34A 3MH6A 1GI9B 1SQRA 1SKYE 2V3MA 1L0ZA 3KGPA 5E2PA 1LVYA 1O39A 1C2EA 1D3QB 1V2KT 1FIZA 1GMCF 2XC5A 3MOCA 1Z1JA 1PYTC 4MVNA 2AGIX 3FZZA 2HVXA 4I8GA 3GCTF 1YPHE 1FY8E 1QJ6B 4I8LA 2ZIQH 1O2IA 5A0AE 4FUEA 5GPIB 1EASA 1AWHB 2GTBA 2ODYB 3TH3H 3MO9A 2JH6D 4NIVA 1RD3B 2VVUA 1GBLA 4RT1A 4CR5A 2BVRH 2H1UA 3F6UH 4K69A 2ZA5A 5EODA 5DN6D 5A2MH 1OWKA 1C2FA 2AHME 3SV8A 1MAXA 1CU1A 3KYFA 2QC2A 5CE1A 2KCYA 4QT8C 3SI4H 1AO5A 7KMEH 2PUQH 2FYRA 2H9TH 3ZVDA 4K8YA 1J15A 1KMHB 3MQKC 1VITG 1O2SA 3SGBE 2JETC 1EJMA 1FX0B 1BOQA 1ZGVA 2SNVA 3F9FA 1YYY1 3MMGA 4Q7XA 1KDQA 4CHAB 1HUTH 2J97A 4NSYA 1MBQA 1BJVA 4BAMB 1YPLH 1BHXF 1ARCA 2FX4A 3K6ZA 4BOHA 3GDSA 1TABE 2Y82A 1GI0A 1UK4A 1N6YA 1YM0A 3ATIA 4TYDA 1O2MA 1W0ZU 2GV6A 1LO6A 1FY5A 2HPQH 3PV4A 2BDYA 2P93A 1H9IE 1KLTA 3ZYDA 3RXSA 1YF4A 1TBQH 3KQBA 3RXKA 1UTJA 3P70B 3SU2A 3SZEA 1O3IA 4XDEA 4FU7A 1OWIA 1CQQA 2SGAA 2NU4E 1UTPA 4KP0A 2Z7FE 1KXAA 1UTQA 2Q1JA 2VGCB 1QB9A 3BTFE 1MKXK 2B8OH 4HI3A 1VZQH 2ZFRH 5JYIA 3ZVBA 3HKIB 2QIQA 4MNWA 2ZGJA 4U32A 1EPTC 5CHAB 2FO9A 2JJ1D 1K21H 1NFXA 2JJ2D 4TWWA 3OX7U 2G4UA 1B5GH 1P2MA 1WCZA 1YY3A 3UR6A 1H9HE 1MTVA 1A4WH 1SB1H 1Y3XA 4ISNA 6LPRA 2QV1A 1AGJA 4ZHLU 4YOIA 4OM9A 1T4UH 2Y5HA 4ZROA 3RU4T 1EFRD 1XKBC 3SQHE 2XWBI 3LU9B 4ISHH 1FAXA 2FOBA 1NFUA 3VB6A 2D8WA 3PWBA 4Y8ZA 1ACBE 5FCRA 5PTPA 1HJ9A 1QA7A 1V2RT 3IITA 3O8CA 1D3DB 2WPDD 5IK2D 1TPPA 2Z9IA 5C0UA 3ESTA 3TPIZ 3MNXA 1GDUA 1CGJE 1C2MA 3DA9B 4SGAE 2FMJA 1D4PB 1GI2A 1AZ8A 1TONA 2FTLE 2A32A 4IS5A 3RU4E 1SC8U 4FOUC 4LOYH 4MQAA 2AIQA 1O30A 1HAVB 2UUKB 3EAJA 2BQ6B 1S6FA 2UWOA 1ANEA 1GHAG 2OD3B 2A0QB 3H09A 1FQ3A 1THSH 3M7TA 4O3UA 1PPZA 1AB9B 4A1XA 2SGQE 1HB0B 3MO6A 3ZZ4A 1NROH 1QL9A 1TE0A 1J8AA 2W6ID 2KCOA 1O2RA 3SBKA 2W7SA 1BRUP 1O37A 3RXHA 1MQ5A 1O2OA 3OAAD 1EATA 1Z8JB 3B8JA 4IN2A 5IYTA 3PMHB 4D9QA 5C17A 3NWUA 3DD2H 1O2QA 3ZVFA 7LPRA 2G51A 2ANKH 3VGCC 2Z6BD 3FFGA 5EU8A 2P16A 5C2ZA 2STAE 2TPIZ 2PKAA 1FMGA 1LPGB 1O3GA 1LHCH 3V12A 2G4TA 3M37A 4OGYA 3T27A 1DFPA 1P0SH 4ZCNA 4WXVA 5JB9S 5T6FA 1BBRH 3RXUA 1DSUA 1ELBA 1C1PA 2ZCLP 1EOLA 3E91A 4IW4E 3M3SA 4X2VA 2Y7ZA 1ELAA 4XBCA 4JYUH 1SQTA 2VIVA 4NCYA 4GAWA 1ETTH 3GYLB 1WOFA 3A80A 1V2VT 2WPHS 2P3UB 1O5DH 2TGAA 1VGCC 1YCPH 3P8FA 1TPAE 1EKBB 2QGRA 1HYLA 1HCGA 4ABIA 1C5PA 2C8XB 3BEIB 1MU6B 1YLCA 1TGNA 3ATKA 1Y5BT 1GMDF 1C9TA 1FY4A 1QL7A 1WV7H 4JYVH 1SGDE 3U1IB 3SUGA 1ZYOA 1L1JA 1DWCH 1YC0A 2VINA 1HIAB 2LNCA 2UUFB 5FPTA 2Q6FA 1GPZA 1H4WA 1B0EA 2OC8A 1S82A 1A5IA 3NXPA 1OWJA 3RP2A 1C5TA 2QN5T 1DWDH 5K7RA 3EGKH 2PV9B 5E0JA 2HNTE 3IG6B 2WPKS 1AY6H 1JRTA 1O2GH 3URDA 3E0NB 4DIIH 4KTUA 1MTSA 2VH0A 1HAGE 3ZIAD 5C94A 1CE5A 3SNCA 1NFWA 1C5WB 1IQKA 1RIWC 1C9PA 1O2WA 1WBGB 5GDSH 1Z1IA 2QF3A 1FPCH 1EP5A 5B6OA 2O8TA 1TGCA 2TGPZ 1KXBA 2BXTH 3MNCA 1UK2A 4A7IB 1AN1E 3P95A 5T6GA 3SNEA 2XOKD 4U30A 4XSKU 2FOFA 2LP6A 1QB6A 1XUHA 1MTWA 4CBNA 2ODQA 3TIUA 2F9OA 3UAIC 1SMFE 3KEEA 3B9FH 4FUIA 4ZXYH 3A7TA 4F49A 1C5OH 3AAUA 1KXFA 4Q2KA 2OTVA 3PO1B 1C1SA 4GCHF 4YO9A 3RXFA 4ZH8A 3M7QA 1BT7A 2W7UA 5FPSA 1E38B 3SGQE 1VCWA 1G3BA 1ID5H 2ZNKH 4CRBA 1O2JA 4NWKA 2PFEA 1SGRE 4DJZB 2ANWA 1YWUA 4KTCA 4A1VA 2XYAA 4IC6A 5ESBA 1O3MA 2UWLA 4U2WA 1C1QA 2ZU2A 1A3EH 3ZZBA 4AGKA 2C93B 1OX1A 1N6XA 1A3BH 2PWXA 1BTZA 1MZDA 3BTME 2ZTXA 1P12E 2FEQH 4NG9H 2BD5A 1W7XH 3SQEE 2ZCHP 4DIHH 1ANBA 4ACBA 5JDUB 1ELFA 2ZDLA 4ISLA 5JBCS 1ELVA 2VIQA 3RM2H 2P3FH 2FZZA 1BTXA 1AKSA 3A8DA 2EI7A 3BIVH 4FUGA 2FOHA 3F2FA 3SU0A 1KLIH 5FXLA 2ANYA 5C1XA 3TK9A 3PYHA 4RN6A 1TMTH 1HXEH 4OS1A 1OS8A 3N99A 4FUFA 3SW2B 2FLRH 5HMAA 2KCAA 1Z6JH 1WSSH 1TIOA 1UTNA 2KFWA 2Y81A 3M36A 1SQOA 4CRDA 2XBYA 3D23A 3UIRA 3BF6H 5JBBS 4I7YH 1G9IE 3GDUA 2WYJA 3HK6B 5T6DA 3AK5A 1EOJA 1HAXB 3ZZ8A 1AVXA 1O35A 1JXPA 5A0BA 4B2BA 2BM2A 3MU8A 3TGJE 3FANA 5LPFA 2BMGB 1MD7A 3BEUA 6GCHF 1WU1A 2PP6A 3L6PA 4INHA 1P04A 2FM2A 5I46H 1UVOA 3SJIA 3M7UA 3BTKE 1WYKA 1HNEE 4AG2A 3O8RA 3Q77A 4DT7B 1PJPA 1TGSZ 1MKWK 2J2UA 1JBUH 3FKSD 4Y6DA 4AB9A 5ABWA 3H7OA 2NU0E 2GKVE 1XUGA 3KN2A 3HATH 1ZHMA 1ABIH 4B74A 4LZ1H 3PRBA 1W0JD 2GGVB 5G4BA 2F83A 2BY7X 2JETB 1ETSH 1PPFE 2WYGA 3I29A 1ELGA 1SG8B 1C1RA 1GVLA 3OTJE 1AQ7A 4NA7A 1SGFG 3S9AA 2IN2A 1W10U 1GJ9B 1NC6A 2VU8E 2ZG0H 1LMWB 2J92A 4B6EA 4YOJA 2J5UA 3FP7E 2Z9JA 2ZZUH 2J95A 3QN7A 2OCVB 3A81A 5A09A 3RXRA 2YMSC 3PMJA 3ZZCA 2SFAA 1TA6A 1O0DH 1QJ7B 1PPGE 3NK8A 2VWNA 2Y5FA 1C1OA 1O34A 3TK5A 1SSXA 1BTWA 4ABJA 2CF8H 4MG3A 5EQQA 2KCPA 1HJAC 1TPSA 4A1TA 3M61U 1A46H 1F92A 1NBMD 3LGTA 1LCYA 2A31A 3TK6A 5DKMA 2Q6DA 4B75A 1FLEE 1EPTB 1C5ZB 2BVSH 1W0KD 1UCYH 2HGTH 4DCDA 1MZAA 3JZ2B 3TH2H 1F0UA 1ZRKA 4YLQH 4K2YA 3WWBA 4BTUB 2W5EA 3M35A 3LGWA 1LQDB 2D1JA 3A8BA 2BDGA 4YZUA 2ZDNA 3ZZ6A 3LGVA 4NFFA 5FL7D 3GY4A 3ZZ9A 2STBE 2NU2E 2VH6A 5DP8A 1HJ8A 1HBTH 1O3PB 1Y5AT 4MLFB 1ETRH 3KQCA 2BX4A 5TJXA 2WZQA 2VNTA 1DVAH 1K9OE 1ZPCA 2UUJB 4GPGA 1C5QA 1TNLA 3NUMA 4GLYA 1DWEH 3W95A 2ZTYA 5GCHG 1BTPA 1MABB 1O5AB 3ATLA 3ZZAA 3ODDA 1ZTKA 3KHVA 3SJKA 1GHWH 1RTKA 2OC1A 2RFKC 1ANDA 2QYIA 3LPRA 4WJG2 1TRNA 1F0SA 3PTBA 3SNDA 3VB5A 5C0TA 1UVSH 1YLNA 1ZZZA 4DY7B 2ZHWH 2PLXA 5EGMA 1O5EH 5HYOA 1OP8A 1QL8A 3D49H 1D6WA 1Y59T 1C1UH 1BMAA 4O03A 4YTAA 2H5CA 1BMNH 1H8IH 5EW2H 1Y3UA 2F9VA 3H7TA 4CREA 3TNTA 1TNGA 2R9PA 4RSPA 2F43B 2M2AA 4XE4A 3MH4A 1BMMH 2R0KA 1DX5M 3V7TA 1BTYA 1KDQB 4FU9A 1T7CA 1AE5A 4ABDA 1G2MA 2CK3D 2ZI2H 2ZFTA 3PLBA 5KGOA 3VGCB 5EJ1A 1O36A 2ZU3A 3SV2H 2KR7A 2VWOA 2PGQB 1UHBA 1K1LA 4ZKOU 2K8IA 2RCEA 2FS8A 1EZXC 4XRNA 2BLWA 3FVFB 1FI8A 4YESB 1P2KA 2FP7B 5EOKA 3T2NA 3T28A 1YKTA 1C2HA 3NRLA 2GDDA 3UNRA 2R3UA 1GCTC 4O9VA 1O3KA 1GBEA 4YLUA 1ZSJA 1SQAA 3RXIA 5AHGH 1OHHD 1GJAB 2V7QD 3ZVEA 4R8TB 4E06H 3D65E 4H4FA 3RXOA 1CHGA 4ZHMU 3UR9A 3BTGE 1L4ZA 3EA7A 4B1TA 1H8HD 2PHBA 4Y71A 3P92A 1ARBA 1VGCB 1O3JA 2EEKA 1QGFA 2LELA 1P9UA 1YLDA 4WXIA 1J17T 2A2XH 1O5GH 3S0NA 4I8JA 5ESTE 1JMOH 1ZLRA 4JZIA 2VWLA 3BV9B 3K65B 4UFFH 5A0CA 4AG1A 4WMEA 1IQNA 1GBTA 4A5TS 3NPSA 2ZGCA 2RG3A 1CT4E 4GVUA 2ZFSA 2YMSD 3RLYH 2R2MB 3STIA 4BAKB 1O2XA 4I8KA 3A7ZA 2TBSA 3IWMA 4KGAA 1O3CA 4TPIZ 5H4IB 2FIRH 4MNXA 3GS9A 4ZKRU 1C4Y2 4TSFD 2P94A 3SO3A 4X6PA 3ZZDA 1HAZB 4TY6A 3AW0A 2OC0A 1RIWB 1ZMLA 2CN0H 1PPHE 2J98A 1RXPA 1TALA 1C1WH 1U6QA 5I25A 4M9FA 1BQYA
chains in the Genus database with same CATH topology
1EX3A 3SV6A 1RTFB 2QY0B 4X1PU 2ZFPH 3STJA 5A8XA 2ZFQH 2A2QH 3ATWA 3PMAB 2OBQA 1TFXA 3CP7A 5FBEA 1Y3WA 4X1SU 3P17H 8ESTE 3ZV8A 3RXJA 3ZVCA 5EW1H 4NZLA 2GP9B 2GZ7A 2RDLA 3Q3YA 1RJXB 3TLOA 1QA0A 1XM1A 2PTCE 3U69H 4AFUA 1D6RA 1P11E 3A7VA 4AYYB 4AN7A 1HLTH 1VJAU 3A7YA 4X2WA 1ZHRA 1C5SA 2GT8A 2PSYA 4X1NU 1WTGH 1GBIA 2G8TA 4K1TA 1F5LA 4ZAEA 3BTEE 4DURA 3M3TA 3LDXH 1THPB 3A8AA 1TOMH 4GHQA 1GVKB 2CHAB 3H5CB 1J14A 2PKAB 1QNJA 1T8MA 2F9BH 2GCTC 2JH0D 4E7RG 4ZXXH 8GCHG 5DP3A 5HXFA 3LKWA 1KLJH 1AMHA 2ZGHA 1Q3XA 4THNH 1LPZB 1JIMA 1RFNA 1DY8A 1MU8B 1P10A 2ZO3H 3T5FH 1NRPH 1GI6A 1NU7B 2PW8H 2ZGBH 5JBAS 2BOKA 1AIXH 2BD4A 1C5NH 1LPKB 4ZKNU 2H5DA 2FX6A 1NM6A 1H8DH 1O3DA 4UEHH 1YPMH 3UWJH 1P2NA 2CF9H 4MPWA 1S81A 3P8NA 2DUCA 2B9LA 1QFKH 5GCHF 3BEFB 1QRXA 9ESTA 3ZVGA 2V0BA 1EB1H 2M5TA 5ETXA 3RLWH 2F91A 2ZHDA 3MU1A 3S7KB 1CT0E 1ELEE 2ZU5A 3GCOA 1Z71A 1FNIA 5J4SA 2PKSC 1GI7B 4AORA 2GDEH 5E2OA 2OQ5A 1SGYE 2A7CA 4WMDA 2ZFFH 4YT7H 4TWYA 1FY3A 2ZECA 1AUTC 1GJ8B 3KQDA 5LPRA 1C2LA 2O9QA 3SU1A 4XBBA 1QQ4A 1TAWA 2A45B 3P6ZB 2ZDVH 2FOEA 1D9IA 1J9CH 2ZQ1A 2EA3A 3GY2A 2O8LA 3GY5A 2FI4E 1TNHA 4MNVA 3ZVAA 1KXEA 3VXEH 4BXSA 3DFLA 1MQ6A 2W26A 1DXWA 1HXFH 1BA8B 3A88A 3A86A 1O2TA 4NIYA 3A89A 3LGIA 1S83A 2BX3A 2NU1E 1DPOA 2ZQ2A 1GBCA 1FONA 5DP4A 1UTKA 2JKHA 1NTPA 1Z7KA 2GD4B 3SJ8A 3BTWE 1T4VH 4BAQB 1EXFA 3TH4H 1CBWC 5DP6A 4NA8A 1IQJA 3CENA 3QUMP 5DG6A 4UFGH 1O2PA 3PROA 2ZGXH 1YPKH 2SGFE 1IHTH 1SBWA 1TNIA 2BD8A 4XFQA 1VITH 1BRAA 1V2OT 5HM2A 1GBFA 2J4IA 1NRNH 1EJAA 1QR3E 1P01A 3GCNA 4JK6A 5L6NH 3TGIE 4FUJA 2BD3A 1ZTLA 2PGBB 4D8NA 1VITF 3ELAH 1DLKB 3QGNB 1TX7A 2BQ7B 2C8ZB 5EQSA 5FBIA 3SV9A 1O2YA 2H9EH 3AAVA 1GI3A 1AVGH 4IBLH 1CT2E 1ABJH 1IAUA 4IGDA 1C5LH 1GMHG 3SNAA 4NZQA 3A7XA 1INCA 2FI5E 3UOUA 3UQVA 1Z6EA 1S85A 4TPYA 2GMTC 4FUCA 1O38A 4K1EA 1LVMA 3LJJA 1SOTA 1CHOG 1IQFA 2FOAA 1HJAB 3QTVH 4INKA 3RC5A 3A85A 4Y0YE 1GJ7B 1AKSB 3TJUA 1SLWB 1EAIA 2IOTA 1V2PT 1J16A 1NT1A 2C3SA 2J9NA 1W7GH 3F9HA 3Q3KA 3RXMA 5LGOA 4J2YB 2WPMS 2P8OC 2ZEBA 1TRYA 1Y5UT 3S9CA 4MTBA 5GWZA 4K8BA 3OSYA 1TGTA 2XBVA 4WWYA 1YCPK 2HNTF 4LXBH 1LHFH 1BHXB 3QGJA 4OS5A 1DM4B 5A8ZA 3HGNA 1TX8A 3MU5A 3GOVB 2CHAC 2EC9H 5CMXH 2PUXB 2AH4X 1F5KU 4ABGA 1O5BB 4AFZA 1C1MA 3D62A 1W11U 1OYQA 1UVPA 5LH8A 6CHAC 3ENSB 1K1JA 1GHBG 3PLPA 1F5RA 1HAYB 4MPXA 2QXJA 2XBXA 2JH5D 2VIDA 2TIOA 5F8TA 5IDKA 2D26C 3G01A 1G3DA 5EG4A 3LGYA 2XW9A 4AGJA 5F8XA 2BOHB 3W94A 3U1JB 2BY9X 3SI3H 1P57B 2AMDA 3DHKH 2B0FA 3E1XB 4DW2U 1C5UA 3VB7A 8KME2 2O8UA 3FAOA 3QLPH 4H42U 1FAKH 1GHZA 1XUFA 1YBWA 1GHAF 1JOUB 3E6PH 5DGJA 2Y80A 1A0LA 2ZU1A 2AFQB 4TY7A 2BY5X 1MMJN 3EA8A 4Y7AA 3SU6A 3SORA 2FPZA 3AW1A 1GHVH 1ZHPA 2G52A 1ESAA 2BY8X 1GDNA 2BDBA 4YT6H 4O3TA 1LKAA 1NRRH 3GCTG 4I32A 1ELCA 2OP9A 4I31A 3C1KA 4VGCC 2BD9A 2A5IA 1GJBB 4X8UH 1V2NT 2FODA 2SGDE 2ZDAH 1G37A 1G3EA 1ZR0A 2HRVA 1AU8A 1GCTB 1IQLA 4JCNA 7GCHG 2HPPH 2Z94A 1CA0C 4ABEA 1HAIH 3R3GB 5FPYA 4ISIH 4KKDA 2ZPSA 2V3OH 2FTMA 4A92A 1AD8H 1GVZA 4B2AA 3RC6A 2BXUH 2GX4A 4BXWA 1A61H 5C1UA 4YM9A 5HM9A 3BTHE 4IN1A 1QQUA 1TMBH 4CRFA 5AFZH 2IJOB 2K1QA 3HPTB 4X8VH 1TB6H 3MNBA 3C27B 1TQ0B 1TWXB 3SUDA 3BTDE 1P8VC 4E05H 3SUFA 1T8LA 5AF9H 1PQ5A 3O8BA 3F68H 2ZHQH 3ZZ3A 1K28D 2C8WB 4ZKSU 5L2YH 1P9SA 2J38A 1O31A 3VB4A 2C4FH 1TMUH 1C5VA 2IPHA 5FX6A 1O3AA 1PQAA 1E35B 2WV5A 1N1LA 1QURH 1Z8RA 2EI6A 2VWMA 3M3VA 1WQSA 2VIOA 4X0WU 1DE7H 1UCYE 3R0FA 1M9UA 2ALVA 3MYWA 1ZMNA 4ZUHA 2ZC9H 4ZMAH 1QB1A 1DUAA 4I33A 1XX9A 3DFJA 1RGQA 4MNYA 5EXNA 1TBRH 1XXDA 2PTNA 4Y10E 2YOLA 1EB2A 2ZF0H 3MFJA 2GT7A 3UUZA 1W8BH 2AERH 4AZ2B 2FWWA 1G32B 2VIPA 3SOSA 4UONA 3PB1E 1DOJA 1GMHF 3K2UA 2XC0A 1C1TA 4WF8A 1GBDA 3T26A 1P3EA 1ESBA 1C2DA 1GBHA 1NESE 1SGNE 4ZHAA 4D76A 2XBWA 1CGIE 1SPJA 2A5KA 3GCHC 1NN6A 3QTOH 2AS9A 1VCQA 3TITA 5E0GA 1LHGH 1DT2A 3I77A 1THRH 1K2I1 5EQRA 1SHHB 2W3KA 1TX6A 1KXCA 3MH7A 2BDHA 1G36A 1NO9H 2P95A 4RKJB 4DGJA 1L2EA 1SHYA 3LC5A 2GCTB 1L1NA 2Y6TA 1HAOH 3CS0A 3RXLA 2XNIA 1L4DA 3LC3A 1E34B 4DVAU 1OWEA 5EPYA 2D2DA 5TCAA 4AB8A 3V3MA 1GJDB 1HDTH 1MTNB 4KTSA 1GL0E 4BNRA 4Y8XA 2OINA 2BB4A 2FESH 2BZAA 5DP7A 1VCPA 4D9RA 4UD9H 1QHRB 1CGHA 1T8OA 1MTUA 1GGDC 4X8SH 1IQGA 1MBMA 1TYNA 2F9PA 4X2XA 2B7DH 3ZYEA 1CVWH 2BLOA 3U98H 1Q2WA 2I6QA 4JZFH 2XTTB 3K9XB 5K0HA 4Y0ZE 2QCYA 3UY9A 1E36B 1RRKA 1YP9A 4D7GA 2CXVA 4X1QU 1OPHB 2SGPE 2ODPA 3ODFA 2ZDKA 1GG6C 2BLQA 1KYNA 3RXQA 3UQOA 3SU5A 1BITA 1JRSA 5F6MA 1BZXE 1UTMA 2PKSB 3I78A 1MAYA 2Z3DA 9LPRA 2R3YA 1EAXA 1UCYK 4X6OA 3RXCA 1MKXH 1KXDA 1WAYB 4ABFA 3MU4A 5FAHA 3MWIU 2ULLA 4JZEH 3RXTA 2G81E 4ABAA 1HAHH 1F7ZA 5L30H 2BD7A 3ZZ7A 5DO4H 1T8NA 1YPJH 4FUDA 1C5YB 1XKAC 3U9AH 5HGGA 5C20A 1ZMJA 4UDWH 3OY5U 4U01A 1GHXH 1GMDG 1SI5H 3FZDA 1SLXB 1ZSKA 1H1BA 2DE9A 1S0RA 1TRMA 2OQUA 3A8CA 2H9HA 1CO7E 2KAIA 1NZQH 3FP8E 1EZSC 2G55A 3Q76A 2A4RA 4BANB 1CBWB 4ABHA 2GV7A 4H6TA 4Y11E 1QBNA 3DT0H 5BRRE 7GCHF 1MUEB 1DY9A 1N8OC 2AMPA 1L1GA 1NRQH 3M5OA 4AOQA 6ESTA 2RA0A 3MU0A 3F9GA 5FCKA 3S7HB 1LDTT 2CJIA 1CSOE 1A1RA 3RMLH 3QDZB 4B76A 1GBAA 3RXVA 4FVBA 2VIWA 1GBJA 1T32A 3A82A 2VVVA 4XBDA 4JZDH 1C2KA 1UVTH 2A5AA 2CGAA 2HOBA 1P2OA 3UWIA 1PPBH 2XXLA 1QRWA 1JWTA 2AEIH 3L3TA 1IQEA 3M5MA 1FV9A 4MPVA 1FN8A 1SGEE 2UUYA 4OGXA 1Q31A 3K6YA 1DUEA 1O33A 4INLA 4CRCA 1LKBA 5DP5A 3HKJB 4UFEH 3OY6U 4AYVB 5C5NA 1UJ1A 4LZ4B 4BAHB 3BSQA 2GMTB 4FU8A 1MH0A 1HV7A 5AVDA 1O3FA 1SR5C 1XVOA 2ANMH 4RKOB 4GCHG 2UWPA 3LH3A 2RA3A 4UE7H 4LK4A 1EQ9A 1AFQC 1DS2E 4GUXA 2ZKSA 1QTFA 3E8LA 2H2ZA 4B71A 3ZV9A 1AI8H 1LQEA 2V3HH 1SGPE 2P8OB 1S6HA 1ANCA 4YOGA 1HRTH 3A83A 3RDZA 1A5HA 2ZWLH 1QCPA 2ZU4A 1BDAA 1ZJDA 1GHYH 2Y7XA 3P8GA 1FZZA 1ZSLA 3KL6A 3LIWA 2AIPA 1O2KA 4NWLA 1WUNH 1TNKA 2J94A 3UFAA 3U8TH 4GSOA 4BTIB 1KTTB 3E16B 4CR9A 2FI3E 4F4OC 3VXFH 3U8OH 6CHAB 2NWNA 4IC5A 1SVPA 2OXSA 1MTNC 1O3BA 3MTYA 4K5ZA 2H6MA 4MDSA 5SGAE 3A7WA 3SHCH 4CH8B 2O8WA 2Z3EA 2A1DB 2CMYA 2BZ6H 1OP0A 4E7NA 3WY8A 1RS0A 2WUBA 5DPAA 1GI5A 2GCHG 2A4OA 3BG4C 4K3JA 2CV3A 2WPLS 2AGEX 3SU4A 2PR3A 1WTHD 2Z9GA 3GICB 3QZQA 2ZPRA 1K1OA 1BBRE 4FUHA 1PFXC 2AMQA 3RXDA 1D3PB 4X6NA 3DUXH 4K60A 4WVPE 3S69A 3BTQE 2GZ8A 2HLCA 4CRAA 4Y8YA 1GJCB 1OYTH 1OWDA 2BYAX 2FDAA 4IMZA 1C5RA 2FYQA 4H6SB 3E0PB 6GCHG 2XWAA 1OOKB 2HNTC 4JMYA 1RTLA 1SFIA 1SOZA 1SGTA 2C8YB 1A2CH 4X1RU 4HZHA 4VGCB 1W13U 3ITIA 3T25A 3MH5A 2V35A 1PYTD 4B73A 1GDQA 4Y7BA 5JPMH 1GJ5H 2FXRA 2XCFA 3LGUA 3RXPA 1KSNA 2OLGA 3SNBA 4R0IA 1AWFH 1V2ST 1LVOA 3UOPA 1CA0B 5EXLA 3RUOA 3SV7A 3F1SB 4K1SA 2YNBA 1H9LB 2BQWB 1D3TB 1IQHA 2B5TB 1Z8IB 1W3CA 1QRZA 1HAVA 3URCA 3M5LA 2QXGA 4ASHA 1MD8A 1O3LA 5FX5A 1XXFA 1UTOA 2VJ1A 1GI1A 3GY3A 1IOEA 3LT3A 1P06A 1TLDA 2AGGX 1YGCH 2XC4A 4X8TH 3S9BA 3LOXA 2ESTE 1LHEH 1NFYA 1GBBA 1XMNB 1DWBH 4FVDA 2AYWA 3PTNA 3AVZA 2EI8A 2QF0A 3N7OA 4ABBA 1TPOA 1FUJA 2P3TB 1C2JA 1BUIA 1S84A 3GY8A 3V13A 5A8YA 4CHAC 5C3NA 1BMLA 1FPHH 3LJOA 3TU7H 2A7HA 3KIDU 3FP6E 2F9NA 3RU4D 1V2MT 1ELDE 3PM3A 1AFEH 1DDJA 1F0TA 3F9EA 3O8DA 3RMNH 4CH2B 4ISOA 2WINI 3EQ0H 1ESTA 1FDPA 1TBZH 2TRMA 3RM0H 5C5OA 1EAWA 3LH1A 1IHSH 4CBOA 4NGAH 1G2LA 1GI8B 1W14U 2LPRA 3OYPA 1PPCE 5TCCA 1LVBA 2VGCC 4ESTE 1BBRK 2WPIS 1NU9A 3TGKE 3TJNA 1C5XB 4NIXA 1GL1A 1C4V2 4DG4A 2GVFA 3SU3A 4OS6A 3P8OA 4CRGA 3AASA 1O5CB 1CA8B 1QIXB 3GY6A 3E3TA 3PLKA 5CHAC 3UREA 3QX5H 3SZNA 1PQ7A 1EP6A 1YCPM 3GCHB 1GJ6A 1P03A 3BIUH 1UK3A 3GISB 1HFDA 1O3OA 1FJSA 1HIAA 1O3EA 1O2HA 2FOGA 3RXBA 4OS2A 1ZGIA 1OKXA 4Y79A 3RC4A 4HFPB 1O2NA 1P02A 1K1NA 5F03A 1K1PA 2QAAA 3QZRA 3VPKA 5GIBA 2VB0A 2BVXH 1P2QA 1UMAH 4XOJA 1KY9A 1NS3A 1GJ4H 1V2TT 1MKWH 3T62A 1BRBE 5F8ZA 4HTCH 4AFSA 2ZTZA 1HPGA 3U8RH 5E8EH 1SGCA 5L2ZH 1A7SA 3L33A 2G5NA 1F0RA 2G00A 2ASUB 1SGIB 1AE8H 1NPMA 3RXEA 4NSVA 1GGDB 1O5FH 3A84A 2ILNA 3LONA 3KF2A 8GCHF 1BTHH 1NRSH 1V6DA 1BCUH 1PQ8A 1AB9C 4GHTA 4DOQA 1HAPH 3HGPA 4UFDH 2ALPA 5FHTA 4WMFA 2WPJS 1SFQB 1K1MA 4MPUA 1A5GH 2Y5GA 1V2WT 1VJ9U 1G3CA 3SGAE 3EYDA 2BDIA 1LTOA 1GMCG 2GCHF 1P2JA 1Y3YA 1DITH 1GG6B 4M7GA 2THFB 3TJOA 3UNQA 1XUKA 5DP9A </