1SLUB

Rat anionic n143h, e151h trypsin complexed to a86h ecotin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
216
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKVATVALPSSCAPAGTQCLISGWGHTLVNHPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine protease/inhibitor)
molecule keywords ECOTIN
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 216
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sluB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sluB02
4WVPE 2BD4A 3BTME 1MTSA 2BY8X 2Y82A 2ZP0H 3BEUA 2VIQA 3H7TA 3BIVH 1ZMJA 4YZUA 2D1JA 3G01A 2XBWA 1GL1A 2G55A 2HOBA 2EA3A 3TLOA 1O2RA 1AGJA 3GCHB 1QQ4A 3B9FH 4GPGA 1EP5A 1IQIA 3QN7A 3QGNB 4UFGH 2O8WA 4MVNA 1GJAB 4GCHF 3GY2A 3OY5U 3RMNH 1TRYA 4IBLH 4WY3A 3RXRA 3GY4A 2FOEA 2P3FH 4ZXXH 4X2VA 1MBQA 3TIUA 2Q1JA 3UOUA 1O3AA 1E37B 4GSOA 2ZEBA 3RXSA 4RKJB 3T28A 2A4RA 3TH4H 4JZFH 1TB6H 2GMTC 1A1RA 1H4WA 1YPHE 2Z9GA 3A82A 4M7GA 2A0QB 1BRAA 1FPCH 2FM2A 2R2WU 1UTPA 3HKIB 4JYUH 5HMAA 3S69A 2Z94A 2JH6D 1YPEH 3SUFA 5AF9H 1TX8A 1RGQA 3NK8A 1LCYA 3RMMH 2Z6BD 1GBAA 2WPMS 4AYVB 1XXDA 3SJKA 3SN8A 4DG4A 1OS8A 1QHRB 1UHBB 2PKSC 3SGBE 5C67A 4TY6A 1LMWB 1P9UA 1KXEA 3RXIA 7GCHG 4X0WU 4ABEA 3GYMA 1HYLA 4WWYA 1THRH 5T6FA 4ZAEA 1P2NA 3P95A 2IOTA 1HCGA 1O3GA 1SGQE 4ABBA 1VITG 1MD8A 1GCTC 1C5MD 1IQHA 3VB6A 1ORFA 1F0SA 3RLYH 4NIVA 2GDDA 3GICB 4A5TS 1QQUA 1C5SA 2GV7A 4NIYA 1TLDA 2QF3A 3M5OA 1FAKH 2UUFB 3RC4A 4ABJA 1BT7A 1A0LA 4ABAA 4Y8XA 2AS9A 4DURA 4XBCA 1XX9A 3SU0A 3QZQA 3R3GB 2WPJS 1F92A 1C5RA 1HPGA 2J2UA 5DP3A 1BBRK 1FIZA 3SU1A 4UFEH 1ELFA 1QRWA 2VWOA 2ZQ2A 4BAMB 3MNBA 1EAWA 4KTSA 4FUCA 3SQHE 1C2JA 2PSXA 2ZTYA 1KLJH 5A0BA 3EE0B 1SGIB 2W3IA 1A3BH 5L2YH 2QCYA 3NCLA 1YF4A 4Z0KA 3PLPA 3FP6E 2VINA 1KXCA 1YP9A 2H9HA 2ZU3A 1C5VA 1QB9A 5DPAA 5EOKA 1QURH 4TPIZ 3SNBA 2XCNA 1TGSZ 2HRVA 2WPIS 2SGFE 4K8YA 1UK3A 1T4UH 1A0JA 1GJ8B 1AD8H 1HNEE 3W94A 2BY5X 1H1BA 1P04A 1S83A 2P8OC 3A8AA 1ZSKA 5C2ZA 1V2ST 5L30H 1MQ5A 2GCTB 1O3FA 1SB1H 4ZHAA 2OQ5A 1LO6A 1IQMA 1EUFA 3ZYEA 2ZGJA 3MO9A 3M3VA 2XTTB 3VPKA 1EPTB 1Y3YA 1OSSA 1TPAE 1SGRE 5K0HA 1ELCA 3EA7A 3P8GA 1HB0B 1HJ8A 1O3MA 1KYNA 1V2NT 5C20A 1LVOA 1F0TA 1ZZZA 1GHVH 4CRFA 2OC8A 3IITA 4AORA 1Y5BT 5E0JA 1GJ4H 1WCZA 3NWUA 3A84A 1BTHH 3ZZ6A 4J1YA 1QL8A 5DKMA 2NU1E 1E0FD 6ESTA 2PW8H 4NSYA 3KEEA 5CMXH 3QLPH 1W2KH 4B2AA 3EQ0H 1XUHA 2BDGA 4X1RU 1DICA 2Y7XA 3TJOA 1BMNH 4FU9A 1CA0B 1UJ1A 1LPGB 3BTEE 1OKXA 2G52A 1ZPBA 4MPWA 1GBBA 1FZZA 1NFUA 1IAUA 2VJ1A 1YCPH 1LQDB 3SUGA 3A7WA 4ABHA 2FO9A 3LDXH 1NU7B 3MNSA 5FBIA 2SGQE 3UR6A 1DWCH 4DIIH 2ZI2H 3ZVEA 4JYVH 1QFKH 1UVSH 4J2YB 1CBWC 1LTOA 4NWLA 3LH3A 5K7RA 1C1NA 3MU0A 2F9VA 4FUGA 3VGCC 3ITIA 1FNIA 1ZPCA 3E91A 4O03A 3SV9A 1O2NA 4CHAB 1QJ6B 4BXWA 4X8SH 2QC2A 2FLRH 1IOEA 1T8MA 5DP5A 1KY9A 1NESE 1J17T 4B1TA 1AO5A 3MU1A 1GHAG 2RDLA 1RTFB 1DWEH 2GP9B 3MO6A 1FY5A 2FXRA 3UY9A 3RXQA 9LPRA 1A0HB 1K1OA 1ZGVA 4BAKB 1ANEA 4AGKA 1YGCH 1D3DB 1FPHH 4B2BA 1T8OA 2QXIA 3ODFA 1GHBG 2B8OH 1A46H 4B2CA 1JOUB 2PR3A 3ZZ7A 2BHGA 4LK4A 5CE1A 1CO7E 3M3TA 1Q3XA 3PWBA 4CREA 3UWJH 2Z3DA 3TJUA 1X7AC 1AHTH 3ZYDA 1WV7H 1MKXH 1A5IA 4Y11E 1AWFH 3RU4E 1KLTA 2BDAA 2RA3A 1RRKA 1TGNA 4UFFH 1SG8B 3PMAB 5BPEA 2R0KA 1NZQH 2ZPQA 4H6TA 1ZLRA 3O8BA 2P16A 3STJA 1GI2A 3TVJB 5JB8S 2OUAA 1DPOA 4U2WA 2BYAX 2G81E 1GCDA 1S85A 2BXTH 4ISNA 3ZZ9A 3LH1A 1P09A 3TK9A 3ZZ3A 5EGMA 1SI5H 4XBDA 1HGTH 3KIDU 1GBCA 2EEKA 1Y3XA 1DE7H 2ZHEH 4YT6H 1TNHA 3K9XB 1MCTA 3M7QA 1P12E 4ISHH 1BRUP 1D9IA 1GVZA 1A61H 2ZCHP 3RU4D 2TGTA 2AEIH 1O2ZA 3JZ1B 7KMEH 1ZSLA 1GMHG 1K1LA 1GJ6A 3SNEA 2J4IA 1GBEA 2G4TA 3P17H 4JYTA 1RFNA 3S9CA 3PLBA 3T2NA 4WF8A 1L0ZA 3IG6B 5FHTA 1GJCB 2OCVB 3AW1A 1S0QA 1HBTH 3TGJE 1O3BA 2ALPA 1BOQA 2XRCA 2QXGA 1AMHA 1P2OA 3SV2H 5TCCA 1AVGH 1MCVA 1QR3E 2VIPA 1W0ZU 3Q76A 1ZJKA 1YPMH 2VH0A 5GPIB 1C4V2 2ESTE 2WUBA 1O2IA 1NRNH 1BITA 4AB8A 5GCHG 4NZLA 3ZVFA 1J14A 1YCPK 3T25A 3FFGA 1Y3UA 2F9NA 4HGCA 4OGYA 3VFEA 1ELVA 2BZ6H 1C5XB 2C8ZB 4YESB 1GI5A 2G5VA 1FN6A 2J94A 1Y59T 1SGFG 1B7XB 1MKWH 1Z7KA 2WUCA 1C1VH 3LGIA 3SQEE 2Z9KA 3M35A 1XKAC 1XVOA 3MH7A 3Q3XA 1BDAA 1C5PA 3LGTA 1Z6JH 1T4VH 1W13U 1UVPA 1FI8A 1VGCB 1GHAF 1HXFH 1QB6A 1P06A 1BA8B 3TH3H 1CE5A 3MU5A 1GJ7B 3PO1C 3URCA 3E1XB 3NXPA 1P2KA 2ULLA 1HLTH 2UWPA 1RXPA 4AX9H 4IN1A 1IQNA 3UNQA 2XBVA 2ZNKH 3E8LA 2I6SA 5C5NA 2Q6DA 3GDVA 1GBLA 2Z9JA 1C5UA 4I32A 2V3HH 3K2UA 4WXVA 3Q77A 3RMLH 1F5KU 3LJOA 1AB9B 4BOHA 1C2LA 1YKTA 4Y7BA 3RXJA 1MTVA 1Z8JB 3BEFB 1C9PA 5FAHA 4VGCC 1O34A 2ZA5A 2JH0D 1TWXB 3F68H 3A7YA 2QGRA 4A7IB 1C1SA 1NU9A 2Y5GA 8GCHG 2FPZA 4MTBA 2SFAA 4K8BA 4Y76A 2Q6FA 1OP2A 2VIDA 4BNRA 1MBMA 2V0BA 1G3DA 4XFQA 4E7RG 5EODA 1AQ7A 1ZMNA 5C1YA 2D26C 1A3EH 2V3OH 3HATH 1O3HA 1KDQB 2H9TH 1IQGA 1MTWA 3T27A 5HXFA 4K5ZA 1GJBB 1TMBH 1GVLA 1CA8B 4DIHH 4H4FA 1QRZA 4MNYA 1GHWH 2AMPA 1G3EA 2WPHS 1BTYA 1Z8RA 3GCTF 1PPZA 3SOSA 1NFXA 1EKBB 1TMUH 4ISOA 1RJXB 1SSXA 5EXMA 1QCPA 2FOFA 2F9BH 3HK3B 4Y8YA 1LHGH 1HJ9A 4TWWA 3PMHB 2VIVA 1UHBA 1FN8A 5DJ7A 5SGAE 1A4WH 1G36A 3ZVDA 1JRTA 2VGCB 2V35A 1TIOA 1EP6A 3SU3A 1TGBA 2HVXA 2GDEH 3UREA 1O2LA 2PV9B 2BQ6B 8KME2 3M5MA 3QGJA 1QJ1B 4AG2A 1OOKB 1NRSH 3U69H 1F5LA 4K1SA 4BTUB 4AFUA 1P0SH 1KSNA 4IC6A 3VB4A 1O2MA 2HWLB 1TALA 1G30B 3CENA 4LZ4B 1MTNB 2NU3E 4H42U 1ABIH 1Z8GA 2WPLS 2IJOB 1QRXA 2BDYA 4X2XA 1A5GH 1NN6A 1WQSA 1ZHRA 2BMGB 3HKJB 5FXLA 3SORA 3SUEA 4GUXA 2FWWA 2BDBA 3KQEA 2QA9E 3BTGE 1O2PA 1NY22 2J38A 1K22H 2ZPSA 3ATMA 1NT1A 3ZVAA 3GCHC 1YLDA 2QF0A 4Y8ZA 4Y7AA 1QGFA 1P2MA 1P01A 3BTDE 1ZR0A 2Z3EA 2A32A 1SGFA 1V2WT 4MDSA 3ZZ5A 1AVXA 2K1QA 1P8VC 4O3UA 3E6PH 2F9PA 1BQYA 1MAXA 2J34A 5FPSA 4BAQB 1C5ZB 5T3HA 5L6NH 1CHGA 2CV3A 5EW1H 3DUXH 1UTOA 1DLEA 1P2JA 1FLEE 2FLBH 1C5TA 3RXFA 1IHTH 4MNXA 3UWIA 3MMGA 1UO6A 3EGKH 2EI6A 3LU9B 1EPTA 1O31A 1O2KA 5AFYH 1SQAA 5T6DA 1N8OB 3RXDA 2C90B 1WSSH 1SGNE 3HGPA 2PHBA 1O36A 3RXMA 1TGCA 1WQVH 3SHCH 1EZQA 3RXKA 2GGVB 2QIQA 1D6WA 1PPGE 3BF6H 1SLUB 1OWEA 1FY3A 2RA0A 3RMOH 1MU6B 5A8ZA 2ALVA 1TA2A 5A0AE 3WY8A 1CU1A 4FVBA 5J4SA 3A81A 1BHXF 3GDUA 4KGAA 3JZ2B 1RIWB 2Y5HA 4HFPB 1SLXB 4YOIA 5E8EH 2I6QA 2F83A 4I7YH 2P95A 3F1SB 1ANBA 2ZFPH 1KIGH 1TMTH 2PGBB 3ODDA 1ESAA 3U1JB 1KXDA 3LOXA 2TIOA 3RU4T 2R3UA 4UFDH 2AYWA 3NKKA 4RN6A 4CH2B 6CHAB 1TNJA 2FX4A 1CHOG 1BTPA 1HDTH 2OC1A 1MH0A 1GHYH 4MPXA 1VITH 1V2OT 2JETB 2B0FA 3GY5A 1IQKA 1K1NA 3HGNA 3P92A 4ZH8A 2W7SA 1J8AA 2BLQA 1C5WB 2C8YB 4A92A 1P9SA 2ZHWH 1DSUA 1O2SA 3A87A 4AOQA 3GDSA 1G32B 2AFQB 3F9GA 3ZVBA 2VWLA 1UTLM 3T62A 4MPUA 2PKAB 3K65B 4XBBA 3FZZA 4Y0YE 3MTYA 3I78A 1QL7A 4CRBA 1W0YH 3PTNA 3RUOA 1W8BH 3F9FA 1C2KA 2CXVA 1AFQB 1DITH 2G8TA 4IC5A 1A2CH 4XE4A 2BB4A 1WAYB 1RTKA 1BZXE 3RXUA 1GJ9B 1SGEE 1VZQH 3SNAA 4NA7A 2ZFFH 1EQ9A 1UVTH 4ESTE 1O2HA 1D3TB 2ZGXH 1JIMA 5EQSA 3O8RA 1L1NA 1ZJDA 5LPEA 3D49H 2VH6A 1K21H 4X6NA 4JMYA 1C1WH 1L4DA 2OP9A 4INLA 1HJAB 1EPTC 2GKVE 1K1IA 2AIQA 1O3NA 2ILNA 4FUDA 5EQRA 3M61U 2BLOA 2ZZUH 1GBHA 1O3LA 1XXFA 2H1UA 2R0LA 2ZGBH 4KP0A 1V2LT 4Q7XA 2FI5E 4DY7B 2W3KA 2BDCA 1LVMA 1Y5UT 3TNSA 5LPRA 3BTHE 1MZAA 2Y80A 1Y3WA 5PTPA 4FU8A 2NU2E 5AVDA 5A2MH 2GX4A 1NTPA 1E36B 1ZTLA 1TPOA 2WYJA 1MUEB 1CA0C 1NFWA 4LOYH 5LPFA 2P3UB 3LJJA 1M9UA 1SGCA 3GISB 1O2TA 2DUCA 1NC6A 5GIBA 4TYDA 5CHAB 3KL6A 4Y6DA 4FUBA 3A8BA 1SOZA 1TRNA 1L4ZA 3ZV9A 1P2IA 1RS0A 4UONA 4BTTB 3S9AA 3SW2B 3ATWA 4K60A 1FIWA 2WYGA 2YNAA 3SUDA 2LNCA 4HZHA 1GG6B 2D2DA 1G37A 5ESBA 1KXAA 5DP4A 1RD3B 1HFDA 2ZU4A 4X2WA 3SZNA 4ZKOU 2ANKH 4CHAC 1O0DH 1T32A 1WYKA 2PTNA 1DUAA 1ELAA 5GJ4B 6LPRA 1DS2E 1CHOF 1OP8A 2QN5T 2HNTF 3U1IB 1TNIA 4JZEH 2GT7A 1ZTKA 2JKHA 1DY9A 4NFFA 1AUJA 3TU7H 1BJUA 1GBFA 1SL3A 3DHKH 4CRGA 4X1SU 1UTJA 2B9LA 4IGDA 2BOHB 2G5NA 2VB0A 4AYYB 1O2VA 4ZXYH 2Q6GA 5JPMH 1GI6A 2FEQH 4CR9A 1XVMA 1KXFA 2OXSA 4YT7H 1FY8E 2NWNA 4WMFA 4NG9H 1N1LA 2SNWA 1O3OA 4DT7B 2C4FH 3UFAA 1GBDA 4GHQA 3FANA 4FXGH 3RM0H 2A7HA 4B75A 5EXLA 2XCFA 5EPNA 2FESH 1XM1A 1ZHMA 4Q80A 3GYLB 1ELTA 4FUFA 4Y0ZE 4B73A 5F6MA 1ZGIA 2W5EA 4NA9H 5HM9A 2FOCA 5L2ZH 2GD4B 1H9HE 2PFEA 2R9PA 3DD2H 1UMAH 2ANYA 4E06H 4A1VA 3ELAH 4JK5A 1YCPM 4TPYA 4ISLA 1BHXB 1PPEE 5FCRA 3UUZA 5DO4H 3EAJA 3SO3A 1CGIE 2W7UA 3ZZ8A 1YPJH 2P8OB 3SGAE 2FIRH 4X6OA 2DE8A 1TBRH 1OPHB 1QBVH 2G51A 1PPFE 1XUKA 3S7HB 1D6RA 2CF9H 1DVAH 3EDXB 1NFYA 3LGYA 5DP8A 4MNVA 1DXPA 1CGHA 1O2OA 3DFLA 1DWBH 2M5TA 1AZ8A 1KDQA 2F3CE 2BLVA 1IQFA 1U6QA 1YYY1 2SGDE 4GHTA 4NCYA 5JB9S 2XYAA 1SFIA 1JIRA 1ZHPA 3SHAH 1INCA 4CBNA 4D7GA 2ZHQH 1O33A 3CS7A 1LDTT 1QJ7B 2BY6X 2HPPH 3C1KA 1Y5AT 4JZIA 1TE0A 5DP7A 3SNCA 2CGAA 4KTCA 3TK6A 2OTVA 1V2MT 1WTGH 3URDA 1UK4A 3R0FA 1P57B 2A2QH 2O8TA 1AE5A 4NGAH 4FU7A 1YC0A 3T26A 1OP0A 4TY7A 1TNLA 2WPKS 5DP6A 1EXFA 2A2XH 4K1EA 3ZZAA 1F0RA 5A0CA 3SGQE 2BDIA 2ZFQH 1BRBE 1YPGH 1AU8A 3A85A 4UE7H 1VGCC 3K6YA 4ZKSU 3ZZBA 1C2DA 2SNVA 3M37A 7ESTE 1T8NA 3FP7E 3VGCB 3BTKE 5E0HA 3GCTG 1V2RT 3SJIA 2FX6A 1G2LA 2FS9A 1EX3A 5DGJA 4ZUHA 3DA9B 2ZC9H 1AKSB 1GHZA 3KF2A 3KGPA 5F03A 5JBCS 5A8XA 3LGWA 1LQEA 4ZKNU 6GCHG 2ASUB 3RP2A 3H5CB 2KAIB 5IDKA 5C1UA 1GGDB 1ZRKA 1AUTC 1AB9C 3Q3YA 2C93B 2OBQA 1Q2WA 4BXSA 2UWOA 4Y71A 4DJZB 1FAXA 3OY6U 3L6PA 3STIA 2FOHA 3P8OA 2FI4E 3SU6A 1O30A 1VJAU 1LHFH 3F9EA 1EOLA 4AFZA 5ETXA 1SC8U 1SR5C 3P70B 4U30A 2ZWLH 1PQ5A 1K2I1 2CHAB 1LHCH 4CBOA 3Q00A 1DXWA 1WBGB 2FOMB 1F5RA 2OC7A 2GZ8A 5C1XA 1FUJA 3PB1E 4D7FA 3PMJA 1GMDF 1O3CA 3SJ9A 1K1PA 4GVUA 3EYDA 1GI1A 2UWLA 3OX7U 3E0NB 1EZSC 3SV8A 4O97A 1ELEE 4DCDA 1TBZH 3A88A 2HALA 2EI7A 1D3QB 2V6NA 5GXPA 2GV6A 1QBOA 3E90B 2XBXA 4Q7YA 1UCYH 1JRSA 3BTWE 1HAOH 2VGCC 5FBEA 3QUMP 1C1QA 5H4IB 1MKXK 2PLXA 2FYQA 2ZFSA 1GI0A 5G4BA 2XC5A 2XXLA 1ACBE 1IQEA 4ABDA 1GVKB 1O3JA 1PQ8A 3QWCH 3VEQB 1GBMA 3RXAA 4BTIB 2F91A 1SGYE 3OTJE 1OWDA 3UOPA 1C4U2 3PMBB 1SGDE 2A7CA 4I8KA 4WMEA 1C2HA 1C1TA 5F8TA 4X8VH 3F9HA 2FDAA 3RC5A 1TX7A 2BVXH 1YLCA 4PROA 2QXHA 2ZF0H 1PQ7A 4OS5A 1C5OH 4TWYA 3FZDA 5F8XA 1PFXC 3GY8A 3TGKE 3VB7A 4XSKU 1DLKB 2JH5D 3MO3A 2ZHDA 5ABWA 1JXPA 2A7JA 4K1TA 1BCUH 1THPB 1V2TT 1BRCE 5B6OA 3QDZB 2PKAA 1ID5H 3M5LA 1FJSA 1OWIA 3E16B 2O8UA 4I33A 5E2OA 1O3IA 1LHEH 6GCHF 1BB0B 4ABIA 1VJ9U 1IQJA 1H8DH 2VU8E 4MQAA 4D76A 3MU8A 3SJOA 3M3SA 3KNXA 2STBE 1TX6A 1GMCF 3TGIE 1O5CB 1GHXH 1KLIH 3RC6A 4FUJA 1GI3A 1MKWK 2VVCA 1MZDA 4UD9H 3S7KB 3LT3A 1N8OC 1CT4E 2SGPE 3I77A 1C4Y2 1O37A 4ASHA 2C3SA 5E2PA 3LKWA 3L33A 4O3TA 4SGBE 3SU5A 2QV1A 5HYOA 1SGPE 1XKBC 3QZRA 3CS0A 1FMGA 3AVZA 1C1OA 2ZKSA 1RIWC 1BUIA 1B0FA 4X6MA 1AN1E 1ZOMA 2FTMA 1F2SE 1TONA 1FY4A 4OS4A 2HPQH 5JBTA 1SGTA 1WTHD 5JBAS 1Z1JA 1V2KT 1ZSJA 1CGJE 1V2QT 1AE8H 1DX5M 1O2QA 2P93A 4JZ1A 5DP9A 2H2ZA 2BDHA 1SBWA 2H9EH 4IW4E 2FODA 2JETC 4NIWA 4AG1A 3QTVH 1ETRH 4F4OC 1W3CA 4O9VA 2OC0A 4CR5A 3SI3H 4JK6A 2SGAA 1BTZA 3LC3A 2J95A 1K9OE 1HIAB 3ENSB 4OS7A 3VXEH 4OS1A 1DOJA 1H9LB 3SJ8A 4CH8B 1QNJA 2VIWA 3RXOA 1TPSA 3A7XA 4IMQA 1G9IE 4OS2A 2IN2A 2ODYB 3TH2H 3MNXA 5EXNA 2BD3A 1S82A 4WJG2 2BD8A 2YNBA 3PTBA 4DVAU 1BBRH 3MOCA 2PWXA 2A5KA 3SNDA 1YPLH 1AFQC 1W7XH 3BG4B 2BX4A 3V7TA 3N7OA 1XUGA 2CMYA 3VB3A 1O2UA 1PJPA 3FAOA 1O5FH 1IHSH 5JBBS 2R2MB 3L3TA 2VWMA 4INKA 4Y10E 1HJAC 1O38A 2QY0B 1O2WA 1Z71A 1ANDA 3O8CA 2GZ9A 1F0UA 3MH5A 1LPKB 1LVYA 1EOJA 4WH6A 3O8DA 1LKBA 3GY3A 1ESBA 1QBNA 1HAPH 1EZXC 2ZIQH 2GT8A 1GBJA 1GDUA 2ZDNA 2GCHF 2F9OA 5T6GA 3RXTA 2ZQ1A 4IN2A 1FV9A 5I25A 2GVFA 1C2EA 4WXIA 3FVFB 3BTTE 2BLWA 3ESTA 2PGQB 4I8LA 1OYQA 2CN0H 2ZGHA 3GOVB 4K69A 4AB9A 4Y79A 3UR9A 4JZDH 3UQOA 1AVWA 4FUHA 5CHAC 2W26A 1AY6H 1OWKA 4X1PU 3C27B 2BQWB 3BEIB 4DOQA 2O8MA 1FXYA 1XUIA 3V12A 1C1PA 1ZTJA 3NUMA 5EW2H 1S6FA 4D8NA 3M36A 5HM2A 1L1JA 3VXFH 2ZDKA 3T5FH 1C1MA 1W10U 4YTAA 3U8TH 1SLWB 4BAHB 4DW2U 4YLUA 3ZVCA 4OGXA 2STAE 1HAVB 1PQAA 2A45B 2XNIA 1TNGA 1GG6C 1QB1A 2A31A 1V2VT 2GCTC 2XW9A 2BXUH 1J15A 1CT2E 1NROH 1EB1H 3RXHA 3SBKA 1KTSB 1P03A 2SGEE 4GAWA 4ISIH 2TGDA 2PSYA 2ZDLA 4XOJA 1W12U 1WOFA 2FYRA 1V6DA 1O5DH 1HRTH 3AASA 3U98H 3GCOA 5FCKA 3RXGA 2LPRA 3AAUA 3UTUH 1V2PT 2Y7ZA 3K6ZA 2AGIX 3LGUA 1GWAA 9ESTA 2FP7B 1SHYA 1QL9A 2UUYA 1SFQB 2H5CA 3F6UH 1GL0E 1LHDH 1MQ6A 4OS6A 1Y3VA 3ZZ4A 2BTCE 1BMMH 1CSOE 3ATLA 2ZU2A 2TGPZ 1W11U 2Y5FA 2B7DH 2FI3E 1UTMA 1BTWA 1XUFA 4INHA 3ZV8A 3PV4A 1AIXH 5A8YA 1B0EA 1EATA 1HAXB 2C8WB 1FONA 3TITA 1EJNA 1P02A 1TABE 2BD5A 1WU1A 1O5BB 4RKOB 1GDNA 2GMTB 3PROA 1S81A 5F8ZA 4A6LA 2J92A 1OYTH 3DFJA 3KQCA 1OWHA 1A7SA 1FY1A 4BANB 3TPIZ 2WV4A 1AKSA 3MWIU 3MYWA 1L1GA 1HAZB 4X6PA 1GI8B 1JBUH 2A4OA 1DFPA 1XMNB 2KAIA 1RTLA 2P59A 2FZZA 2BOKA 3B23B 4B71A 3VB5A 2BZAA 3P8NA 5FPYA 1E35B 2PKSB 3QX5H 4B74A 4U01A 3GY7A 1TGTA 5FX6A 3ZZDA 2EI8A 3V0XA 3S0NA 1GI7B 4ZROA 1E34B 5I46H 3CP7A 1C5LH 4IMZA 4XDEA 1EAUA 1J9CH 2EC9H 4MLFB 4ABFA 2C8XB 1N6XA 2AGEX 1JWTA 1D4PB 1EZUC 1VCPA 4NA8A 4LZ1H 3BN9A 1GCTB 2ZCLP 4GLYA 4RSPA 3QO6A 1YM0A 1HAGE 3RDZA 2WINI 4NFEA 4CRCA 1SMFE 4A1XA 2P3TB 5FPTA 1O3DA 1VR1H 3A80A 1TNKA 1HAYB 2VIOA 5C5OA 1DM4B 1C2IA 2ZG0H 4JCNA 1MU8B 3SU2A 4Q7ZA 1C5NH 1ZYOA 4I8GA 1V2UT 5GDSH 3KCGH 2ZU1A 1V2JT 2BD9A 1P10A 2A1DB 3MHWU 3TJNA 1THSH 3RXLA 2ZFTA 2ODQA 2ANMH 4WH8A 3E0PB 4X8UH 1NRQH 2AIPA 4NSVA 3UNRA 1C2GA 1TBQH 1EJMA 1UTQA 3UPEA 1KXBA 4HTCH 1BTUA 3AAVA 3KHVA 3T29A 2FOAA 1J16A 1O32A 1C1RA 2ODPA 5C3NA 7GCHF 1DSTA 5EQQA 2A4GA 1QA0A 2AH4X 2VWNA 4SGAE 1A5HA 1O39A 1GMDG 1TYNA 4FVDA 3EA8A 1N6YA 3E3TA 3V13A 1MTUA 2BQ7B 3A86A 1VITF 3A83A 1BMLA 3KQDA 4UEHH 3HPTB 4Z6AH 4NIXA 3EA9A 2OINA 1S6HA 2ZECA 1O35A 3D65E 1EAXA 2RCEA 5TJXA 5LGOA 2ZCKP 1C1UH 1NRRH 4ZHMU 1GI4A 4K2YA 1OX1A 4ZHLU 1W14U 8LPRA 2Z9IA 1AWHB 1ETTH 1DWDH 2THFB 2XWBI 2VVUA 2VNTA 3PLKA 1GGDC 2YOLA 3MI4A 3MH4A 2A5AA 2TGAA 3ATIA 1GBTA 1QIXB 1TOCB 2ZGCA 4X8TH 5J4QA 3BTFE 1FQ3A 3HK6B 1WUNH 1K1MA 3H7OA 3LONA 3UIRA 2AERH 2GTBA 4AGJA 1TPPA 4AN7A 2VVVA 1NO9H 2B5TB 2OLGA 1ABJH 2FMJA 2FOBA 1QY6A 1Y8TA 1C5YB 2CHAC 2ZDAH 4AFSA 4ZMAH 4IS5A 5HGGA 3TJVA 5EU8A 4R0IA 1CBWB 3PWCA 3PYHA 1O3KA 4NZQA 3U8OH 7LPRA 2PUXB 2O8LA 3GCNA 4BAOB 3DT0H 5EPYA 4K3JA 4Q2KA 3V3MA 1EJAA 2TRMA 4AFQA 1O3PB 3NZIA 4QT8C 1BTXA 1C2FA 2HNTC 3M7TA 1SLVB 4YLQH 2HLCA 2NU0E 1ARBA 1D3PB 2J9NA 2D8WA 1ZRBA 2G00A 1P2QA 3SV6A 1L2EA 1O3EA 2DE9A 5AHGH 2ANWA 1ELBA 3LC5A 2BVRH 2R3YA 2WV5A 4KELA 3BSQA 2ZTZA 2XC4A 2FOGA 1PYTC 1UVUH 2Z3CA 3A7VA 1S0RA 1NPMA 3SU4A 2PTCE 2AGGX 2TBSA 1DY8A 1O2YA 1ETSH 1GMCG 4X1QU 4THNH 2Y6TA 1NS3A 1BIOA 2ZHFH 4B76A 2A5IA 3W95A 3MH6A 1IQLA 1P3EA 3GY6A 2BY9X 3M5NA 2HGTH 1JMOH 2NU4E 4I31A 1VCQA 1Q31A 8ESTE 5IYTA 5DK1A 1HIAA 1P3CA 1HAHH 1ELDE 1UCYE 1FDPA 3RXVA 1UTKA 1W7GH 1SHHB 2FS8A 4NWKA 4YOGA 2BM2A 1Z8IB 3MU4A 1K1JA 3P6ZB 1EASA 3BTQE 3S9BA 1SOTA 2AMDA 4YOJA 3TK5A 1Z1IA 3OU0A 1UVOA 5BRRE 5ESTE 1SVPA 1HV7A 3RM2H 3BG8A 1GHBF 2AMQA 2ZTXA 4LXBH 1DUEA 3OSYA 3QK1A 3LGVA 2G4UA 1SQOA 3BV9B 1E38B 1V3XA 3I29A 1HUTH 4YO9A 1PPBH 2CF8H 5FX5A 1OXGA 3A7ZA 3P8FA 2CJIA 1K28D 2P94A 2UUJB 1GI9B 1H9IE 4R8TB 5DG6A 1MTNC 1TQ0B 2BD2A 1YBWA 1CQQA 1YPHC 4YM9A 1H8IH 4WMDA 3MNCA 2O9QA 2QXJA 3ATKA 4U32A 1ARCA 3SV7A 1T31A 2ZO3H 3LIWA 2Z7FE 1XUJA 1GPZA 1S5SA 1P11E 1AI8H 2Z9LA 4HI3A 2ZFRH 1EAIA 1OWJA 3OYPA 1GJDB 4MNWA 1O5EH 4MPVA 1QA7A 4ZKRU 1TAWA 4X1NU 4I8HA 1PPCE 2XWAA 3SI4H 2H5DA 1GMHF 3LPRA 3ZVGA 3PM3A 3PO1B 1T8LA 2UUKB 3A8DA 4AZ2B 1YPKH 5JDUB 1HAVA 5AFZH 3UQVA 1LPZB 2ZU5A 4D9RA 1GJ5H 2GCHG 4MG3A 4DGJA 3NPSA 3RXBA 4ABGA 1ZMLA 4GCHG 1C9TA 1LKAA 3RXEA 4CRDA 1BJVA 1KTTB 1VCWA 1HAIH 1AFEH 3AW0A 5GCHF 1TRMA 1Z6EA 5TCAA 4CRAA 4A1TA 2TPIZ 1O2XA 1QTFA 1LVBA 2ZPRA 2A4QA 1TFXA 4KTUA 2XC0A 3ZZCA 1TQ7B 2H6MA 5LH8A 2F9UA 1O2JA 3TNTA 4VGCB 4E7NA 1C2MA 1NRPH 2QAAA 3B8JA 2ZDVH 3BG4C 2FTLE 3KQBA 1O5GH 1GBKA 2ZDMA 1CT0E 1SQTA 1ELGA 1TOMH 2BY7X 1UK2A 1NM6A 2QYIA 1T7CA 1HXEH 1ZPZA 1DANH 2BD7A 1DDJA 5E0GA 5JYIA 4I8JA 5GWZA 3FP8E 1G2MA 3U8RH 2HNTE 6CHAC 1UCYK 1G3CA 2BVSH 2IPHA 1F7ZA 4F49A 1ANCA 2RG3A 1ESTA 1BMAA 3D23A 4H6SB 2OQUA 1O5AB 1UTNA 2Y81A 1O2GH 1CVWH 3A89A 1S84A 4UDWH 3RXPA 1GDQA 2XBYA 3BIUH 3Q3KA 4KKDA 3A7TA 2GZ7A 1BBRE 2OBOA 3A8CA 3M7UA 1C5QA 2BX3A 1DT2A 3D62A 1TA6A 1EB2A 4FUIA 3U9AH 5EG4A 3KN2A 3RXCA 1G3BA 3UNSA 1GBIA 3RLWH 1P05A 1MAYA 3MFJA 1PPHE 2OD3B 1MD7A 5A09A 4FUEA 1B5GH 4D9QA 4E05H 8GCHF 4X2YA 1AZZA 1MMJN 2PUQH 1SPJA 3QTOH 3IWMA 1PYTD
chains in the Genus database with same CATH superfamily
4WVPE 2BD4A 3BTME 1MTSA 2BY8X 2Y82A 2ZP0H 3BEUA 2VIQA 3H7TA 3BIVH 1ZMJA 2YMSD 4YZUA 2D1JA 3G01A 2XBWA 1GL1A 2G55A 2HOBA 2EA3A 3TLOA 1O2RA 1AGJA 3GCHB 1QQ4A 3B9FH 4GPGA 1EP5A 1IQIA 3QN7A 3QGNB 4UFGH 2O8WA 4MVNA 1GJAB 3OAAD 4GCHF 3GY2A 3OY5U 3RMNH 1TRYA 4IBLH 4WY3A 3RXRA 3GY4A 2FOEA 2P3FH 4ZXXH 4X2VA 1MBQA 3F3BA 2KR7A 4HG6A 3TIUA 2Q1JA 3UOUA 1O3AA 1E37B 4GSOA 2ZEBA 3RXSA 4RKJB 3T28A 2A4RA 3TH4H 4JZFH 1TB6H 2GMTC 1A1RA 1H4WA 1YPHE 2Z9GA 3A82A 4M7GA 2A0QB 1BRAA 1FPCH 2FM2A 2R2WU 1UTPA 3HKIB 4JYUH 5HMAA 3S69A 2Z94A 2JH6D 1YPEH 3SUFA 5AF9H 1TX8A 5B6LA 1RGQA 3NK8A 1LCYA 3RMMH 2Z6BD 1GBAA 2WPMS 4AYVB 1XXDA 3SJKA 3SN8A 5EJ1A 4DG4A 1OS8A 1QHRB 1UHBB 2PKSC 3SGBE 5C67A 4TY6A 1LMWB 1P9UA 1KXEA 3RXIA 7GCHG 4X0WU 4ABEA 3GYMA 1HYLA 4WWYA 1THRH 5T6FA 4ZAEA 1P2NA 3P95A 2IOTA 1HCGA 1O3GA 1SGQE 4ABBA 1VITG 1MD8A 1GCTC 1C5MD 1IQHA 3VB6A 1ORFA 1F0SA 3RLYH 4NIVA 2GDDA 3GICB 4A5TS 1QQUA 1C5SA 2GV7A 4NIYA 1TLDA 2QF3A 3M5OA 1FAKH 2UUFB 3RC4A 4ABJA 1BT7A 1A0LA 4ABAA 4Y8XA 2AS9A 4DURA 4XBCA 1XX9A 3SU0A 3QZQA 3R3GB 2WPJS 1F92A 1C5RA 1HPGA 2J2UA 5DP3A 1BBRK 1FIZA 3SU1A 4UFEH 1ELFA 1QRWA 2VWOA 2ZQ2A 3PV2A 4FOUC 3MNBA 4BAMB 1EAWA 4KTSA 4FUCA 3SQHE 1C2JA 2PSXA 2ZTYA 1KLJH 5A0BA 3EE0B 1SGIB 2W3IA 1A3BH 5L2YH 2QCYA 3NCLA 1YF4A 3NRLA 3PLPA 4Z0KA 3FP6E 2VINA 1KXCA 1YP9A 2H9HA 2ZU3A 1C5VA 1QB9A 5DPAA 5EOKA 1QURH 4TPIZ 3SNBA 2KFWA 1TGSZ 2HRVA 2XCNA 1W0JD 2WPIS 2SGFE 4K8YA 1UK3A 1T4UH 1A0JA 1GJ8B 1AD8H 1HNEE 3W94A 2BY5X 1H1BA 1P04A 1S83A 2P8OC 3A8AA 1ZSKA 5C2ZA 1V2ST 5L30H 1MQ5A 2GCTB 2WHXA 1O3FA 1SB1H 4ZHAA 2OQ5A 1LO6A 1IQMA 1EUFA 3ZYEA 2ZGJA 3MO9A 3M3VA 2XTTB 3VPKA 1EPTB 1Y3YA 1OSSA 1TPAE 1SGRE 5K0HA 1ELCA 3EA7A 3P8GA 1HB0B 1HJ8A 1O3MA 1KYNA 1V2NT 5C20A 1LVOA 1F0TA 1ZZZA 1GHVH 4CRFA 2OC8A 3IITA 4AORA 1Y5BT 5E0JA 1GJ4H 1WCZA 3NWUA 3A84A 1BTHH 3ZZ6A 4J1YA 5C17A 1QL8A 5DKMA 2NU1E 1E0FD 6ESTA 2PW8H 4NSYA 3KEEA 5CMXH 3QLPH 1W2KH 4B2AA 3EQ0H 1XUHA 2BDGA 4X1RU 1DICA 2Y7XA 3TJOA 1BMNH 4FU9A 1CA0B 1UJ1A 1LPGB 3BTEE 1OKXA 2G52A 1ZPBA 4MPWA 1GBBA 1FZZA 1NFUA 1IAUA 2VJ1A 1YCPH 1LQDB 3SUGA 3A7WA 4ABHA 2FO9A 3LDXH 1NU7B 3MNSA 5FBIA 2SGQE 3UR6A 1DWCH 4DIIH 2ZI2H 3ZVEA 4JYVH 1QFKH 1UVSH 4J2YB 1CBWC 1LTOA 4NWLA 3LH3A 5K7RA 1C1NA 3MU0A 2F9VA 4FUGA 3VGCC 3ITIA 1FNIA 1ZPCA 3E91A 4O03A 3SV9A 1O2NA 4CHAB 1QJ6B 4BXWA 4X8SH 2QC2A 2FLRH 1IOEA 1T8MA 5DP5A 1KY9A 1NESE 1J17T 4B1TA 1AO5A 3MU1A 1GHAG 2RDLA 1RTFB 1DWEH 2GP9B 3MO6A 1FY5A 2FXRA 3UY9A 3RXQA 9LPRA 1A0HB 1K1OA 1ZGVA 4BAKB 1ANEA 4AGKA 1YGCH 1D3DB 1FPHH 4B2BA 1T8OA 3OEED 2QXIA 3ODFA 1GHBG 2B8OH 1A46H 3N7EA 4B2CA 1JOUB 2PR3A 3ZZ7A 2BHGA 4LK4A 5CE1A 1CO7E 3M3TA 1Q3XA 3PWBA 4CREA 3UWJH 2Z3DA 3FKSD 3TJUA 1X7AC 1AHTH 2W6JD 3ZYDA 1WV7H 1MKXH 1A5IA 4Y11E 1AWFH 3RU4E 4DT4A 1KLTA 2BDAA 2RA3A 1RRKA 1TGNA 4UFFH 1SG8B 3PMAB 5BPEA 2R0KA 1NZQH 2ZPQA 4H6TA 1ZLRA 3WW7A 3O8BA 2P16A 3STJA 1GI2A 3TVJB 5JB8S 2OUAA 4B6EA 4OM9A 1DPOA 4U2WA 2BYAX 2G81E 1GCDA 1S85A 2BXTH 4ISNA 2IJD1 3ZZ9A 3LH1A 1P09A 3TK9A 3ZZ3A 5EGMA 5KEDA 1SI5H 4XBDA 1HGTH 3KIDU 1GBCA 2EEKA 1Y3XA 1DE7H 2ZHEH 4YT6H 2LELA 1TNHA 3K9XB 1MCTA 3M7QA 1P12E 4ISHH 1BRUP 1D9IA 1GVZA 1A61H 2ZCHP 3RU4D 2TGTA 2AEIH 1O2ZA 3JZ1B 7KMEH 1ZSLA 1GMHG 1K1LA 1GJ6A 3SNEA 2J4IA 1GBEA 2G4TA 3P17H 5T1VA 4JYTA 1RFNA 3S9CA 3PLBA 3T2NA 4WF8A 1L0ZA 3IG6B 5FHTA 1GJCB 2OCVB 3AW1A 1S0QA 1HBTH 3TGJE 1O3BA 2ALPA 1BOQA 2XRCA 2QXGA 1AMHA 1P2OA 3SV2H 5TCCA 1AVGH 1MCVA 1QR3E 2VIPA 1W0ZU 3Q76A 1ZJKA 1YPMH 2VH0A 5GPIB 1C4V2 2ESTE 2WUBA 1O2IA 1NRNH 1BITA 4AB8A 5GCHG 4NZLA 3ZVFA 1J14A 1SKYE 1YCPK 3T25A 3FFGA 1Y3UA 2F9NA 4HGCA 4OGYA 3VFEA 2KCOA 1ELVA 2K0QA 2BZ6H 1C5XB 2C8ZB 4YESB 1GI5A 2G5VA 1FN6A 2J94A 1Y59T 1SGFG 1B7XB 1MKWH 1Z7KA 4RI0A 2WUCA 1C1VH 3LGIA 3SQEE 3F2HA 2Z9KA 3M35A 1XKAC 1XVOA 3MH7A 3Q3XA 1BDAA 1C5PA 3LGTA 1Z6JH 1T4VH 1W13U 1UVPA 1FI8A 1VGCB 5EJZA 3H09A 1GHAF 1HXFH 1QB6A 1P06A 1BA8B 3TH3H 1CE5A 3MU5A 1GJ7B 3PO1C 3URCA 3E1XB 3NXPA 1P2KA 2ULLA 1HLTH 2UWPA 1RXPA 4AX9H 4IN1A 1IQNA 3UNQA 2XBVA 2ZNKH 3E8LA 2I6SA 3CNRA 5C5NA 2Q6DA 3GDVA 1GBLA 2Z9JA 1C5UA 4I32A 2V3HH 3K2UA 4WXVA 3FOAA 3Q77A 3RMLH 1F5KU 3LJOA 1AB9B 4BOHA 1C2LA 1YKTA 4Y7BA 3RXJA 1MTVA 1Z8JB 3BEFB 1C9PA 1E1RD 5FAHA 4VGCC 1O34A 2ZA5A 2JH0D 1TWXB 3F68H 3A7YA 2QGRA 4A7IB 1C1SA 1NU9A 2Y5GA 8GCHG 2FPZA 4MTBA 2SFAA 3DCLA 4K8BA 4Y76A 2Q6FA 1OP2A 3OTPA 2VIDA 4BNRA 1MBMA 2V0BA 1G3DA 4XFQA 4E7RG 5EODA 1AQ7A 1ZMNA 5C1YA 2D26C 1A3EH 2V3OH 3HATH 1O3HA 1KDQB 2H9TH 1IQGA 1MTWA 3T27A 5HXFA 4K5ZA 1GJBB 1TMBH 1GVLA 1CA8B 4DIHH 4H4FA 1K0HA 1QRZA 4MNYA 1GHWH 2AMPA 1G3EA 2WPHS 1BTYA 1Z8RA 3GCTF 1PPZA 3SOSA 1NFXA 1EKBB 1TMUH 4ISOA 1RJXB 1SSXA 5EXMA 1QCPA 2FOFA 2F9BH 3HK3B 4Y8YA 5HIZA 1LHGH 1HJ9A 4TWWA 3PMHB 2VIVA 1UHBA 1FN8A 5DJ7A 5SGAE 1A4WH 1G36A 3ZVDA 1JRTA 2VGCB 2V35A 1TIOA 1EP6A 3SU3A 1TGBA 2HVXA 2GDEH 3UREA 1O2LA 2PV9B 2BQ6B 2RDEA 8KME2 3M5MA 3QGJA 1QJ1B 4AG2A 1OOKB 1NRSH 3U69H 1F5LA 4K1SA 4BTUB 4AFUA 2M2AA 1P0SH 1KSNA 4IC6A 3VB4A 1O2MA 2HWLB 1TALA 1G30B 3CENA 4LZ4B 1MTNB 2NU3E 4H42U 1ABIH 1Z8GA 4YXWD 2WPLS 2IJOB 1QRXA 2BDYA 4X2XA 1A5GH 2F4LA 1NN6A 1WQSA 1ZHRA 2BMGB 3HKJB 5FXLA 3SORA 3SUEA 4GUXA 2FWWA 2BDBA 3KQEA 2QA9E 3BTGE 1O2PA 1NY22 2J38A 1K22H 2ZPSA 3ATMA 1NT1A 3ZVAA 3GCHC 1YLDA 4Q63A 2QF0A 1BMFD 4Y8ZA 4Y7AA 1QGFA 1YLNA 1P2MA 1P01A 3BTDE 1ZR0A 2Z3EA 5HIYA 2A32A 1SGFA 1V2WT 4MDSA 3ZZ5A 1AVXA 2K1QA 1P8VC 4O3UA 3E6PH 2F9PA 1BQYA 1MAXA 2J34A 5FPSA 4BAQB 1C5ZB 5T3HA 5L6NH 1CHGA 2CV3A 5EW1H 3DUXH 1UTOA 1DLEA 1P2JA 1FLEE 2FLBH 1C5TA 4B6FA 3RXFA 1IHTH 4MNXA 3UWIA 3MMGA 1UO6A 3EGKH 2EI6A 3LU9B 1EPTA 1O31A 2HVYB 1O2KA 5AFYH 1SQAA 5T6DA 1N8OB 3RXDA 2C90B 1WSSH 1SGNE 3HGPA 2PHBA 1O36A 3RXMA 1TGCA 1WQVH 3SHCH 1EZQA 3RXKA 2GGVB 2QIQA 1D6WA 1PPGE 3BF6H 3KQ5A 1SLUB 1OWEA 1FY3A 2RA0A 3RMOH 1MU6B 5A8ZA 2ALVA 1TA2A 5A0AE 3WY8A 1CU1A 4FVBA 5J4SA 3A81A 1BHXF 3GDUA 4KGAA 3JZ2B 4TT3D 1RIWB 2Y5HA 4HFPB 1SLXB 4YOIA 5E8EH 2I6QA 2F83A 2JIZD 1WXRA 2P95A 4I7YH 2JJ1D 4RT0A 3F1SB 1ANBA 2ZFPH 1KIGH 1TMTH 2PGBB 3ODDA 1YWUA 1ESAA 3U1JB 1KXDA 3LOXA 2TIOA 3RU4T 2R3UA 4UFDH 2AYWA 3NKKA 4RN6A 4CH2B 6CHAB 1TNJA 2FX4A 1CHOG 1BTPA 1HDTH 2OC1A 1MH0A 1GHYH 4MPXA 1VITH 4P00A 1V2OT 2JETB 2B0FA 3GY5A 1IQKA 1K1NA 3HGNA 3P92A 4ZH8A 2W7SA 1J8AA 2BLQA 1C5WB 2C8YB 4A92A 1P9SA 2ZHWH 1DSUA 1O2SA 3A87A 3PRBA 4AOQA 3GDSA 5EIYA 1G32B 2AFQB 3F9GA 3ZVBA 2VWLA 1UTLM 3T62A 4MPUA 2PKAB 3K65B 4XBBA 3FZZA 4Y0YE 3MTYA 3I78A 3SZEA 1QL7A 4CRBA 1W0YH 3PTNA 3RUOA 1W8BH 3F9FA 1C2KA 2CXVA 1AFQB 1DITH 2G8TA 4IC5A 1A2CH 4XE4A 2BB4A 1WAYB 1RTKA 1YY3A 1BZXE 3RXUA 1GJ9B 1SGEE 1VZQH 3SNAA 4NA7A 2ZFFH 1EQ9A 1UVTH 4ESTE 1O2HA 1D3TB 2ZGXH 1JIMA 5EQSA 3O8RA 1L1NA 1ZJDA 5LPEA 3D49H 2VH6A 1K21H 4X6NA 4JMYA 1C1WH 1L4DA 2OP9A 4INLA 1HJAB 1EPTC 2GKVE 1K1IA 2AIQA 1O3NA 2ILNA 4FUDA 5EQRA 3M61U 2BLOA 2ZZUH 1GBHA 1O3LA 1XXFA 2H1UA 2R0LA 2ZGBH 4KP0A 1V2LT 4Q7XA 2FI5E 1MABB 4DY7B 2W3KA 2BDCA 1LVMA 1Y5UT 3TNSA 5LPRA 3BTHE 1MZAA 2Y80A 1Y3WA 5PTPA 4FU8A 4ACAA 2NU2E 5AVDA 5A2MH 2GX4A 1EFRD 1NTPA 1E36B 1ZTLA 1TPOA 2WYJA 1MUEB 1CA0C 1NFWA 4LOYH 5LPFA 2P3UB 3LJJA 1M9UA 1SGCA 3GISB 1O2TA 2DUCA 1NC6A 5GIBA 4TYDA 5CHAB 2EQNA 3KL6A 4Y6DA 4FUBA 3A8BA 1SOZA 1TRNA 3OEHD 1L4ZA 3ZV9A 1P2IA 1RS0A 4UONA 4BTTB 3S9AA 3SW2B 3ATWA 4K60A 1FIWA 4P02A 2WYGA 2YNAA 3SUDA 2LNCA 4HZHA 1GG6B 2D2DA 1G37A 5ESBA 1KXAA 5DP4A 1RD3B 1HFDA 2ZU4A 4X2WA 3SZNA 4ZKOU 2ANKH 4CHAC 1O0DH 1T32A 1WYKA 2PTNA 1DUAA 1ELAA 5GJ4B 6LPRA 1DS2E 1CHOF 1OP8A 2QN5T 2HNTF 3U1IB 1TNIA 4JZEH 2GT7A 1ZTKA 2JKHA 1DY9A 4NFFA 5EJLA 1AUJA 3TU7H 1BJUA 1GBFA 1SL3A 3DHKH 4CRGA 4X1SU 1UTJA 2B9LA 4IGDA 4Q4LA 2BOHB 2G5NA 2VB0A 4AYYB 1O2VA 4ZXYH 2Q6GA 5JPMH 1GI6A 2FEQH 4CR9A 1XVMA 1KXFA 2OXSA 4YT7H 1FY8E 2NWNA 4WMFA 4NG9H 1N1LA 2SNWA 1O3OA 5GNDA 4DT7B 2C4FH 2V3MA 3UFAA 1GBDA 4GHQA 3FANA 4FXGH 3RM0H 2A7HA 4B75A 5EXLA 2XCFA 5EPNA 2FESH 1XM1A 1ZHMA 2WZQA 4Q80A 3GYLB 1ELTA 4FUFA 4Y0ZE 4B73A 5F6MA 1ZGIA 2W5EA 4NA9H 5HM9A 2FOCA 5L2ZH 2GD4B 1H9HE 2PFEA 2R9PA 3DD2H 5FL7D 1UMAH 2ANYA 4E06H 2KZ4A 4A1VA 3ELAH 4JK5A 1YCPM 4TPYA 4ISLA 1BHXB 1PPEE 5FCRA 3UUZA 5DO4H 3EAJA 3SO3A 1CGIE 2W7UA 3ZZ8A 1YPJH 3F0OA 2P8OB 3SGAE 2FIRH 4X6OA 2DE8A 1TBRH 5DSFA 1OPHB 1QBVH 2G51A 1PPFE 1XUKA 3S7HB 3PRDA 1D6RA 2CF9H 1DVAH 3EDXB 1NFYA 3LGYA 5DP8A 4MNVA 1DXPA 1CGHA 1O2OA 3DFLA 1DWBH 2M5TA 1AZ8A 3OE7D 1KDQA 2F3CE 2BLVA 3AK5A 1IQFA 1U6QA 1YYY1 2SGDE 4GHTA 4NCYA 5JB9S 2XYAA 1SFIA 1JIRA 1ZHPA 3SHAH 1INCA 4AC9A 4CBNA 4D7GA 2ZHQH 1O33A 3CS7A 1LDTT 1QJ7B 2BY6X 2HPPH 3C1KA 1Y5AT 4JZIA 1TE0A 5DP7A 3SNCA 2CGAA 4KTCA 3TK6A 2OTVA 1V2MT 1WTGH 3URDA 1UK4A 3R0FA 1P57B 2A2QH 2O8TA 1AE5A 4NGAH 4FU7A 1YC0A 3T26A 1OP0A 4TY7A 4I86A 1TNLA 2WPKS 5DP6A 1EXFA 2A2XH 4K1EA 3ZZAA 1F0RA 5A0CA 3SGQE 2BDIA 2ZFQH 1BRBE 1YPGH 1AU8A 3A85A 4UE7H 1VGCC 3K6YA 4ZKSU 3ZZBA 1C2DA 2SNVA 3M37A 7ESTE 1T8NA 3FP7E 3VGCB 3BTKE 5E0HA 2AHME 3GCTG 1V2RT 5IK2D 3SJIA 2FX6A 1G2LA 2FS9A 1EX3A 5DGJA 4ZUHA 3DA9B 2ZC9H 1AKSB 1GHZA 3KF2A 3KGPA 5F03A 5JBCS 5A8XA 3LGWA 1LQEA 2J98B 4ZKNU 6GCHG 2ASUB 3RP2A 3H5CB 2LP6A 2KAIB 5IDKA 5C1UA 1GGDB 1ZRKA 1AUTC 1AB9C 2JDID 3Q3YA 2C93B 2OBQA 1Q2WA 4BXSA 2UWOA 4Y71A 4DJZB 1FAXA 2IPQX 3OY6U 3L6PA 3STIA 2FOHA 3P8OA 2FI4E 3SU6A 1O30A 1VJAU 1LHFH 3F9EA 1EOLA 4AFZA 5ETXA 1SC8U 1SR5C 3P70B 4U30A 2ZWLH 1PQ5A 1K2I1 2CHAB 1LHCH 4CBOA 3Q00A 1DXWA 1WBGB 2FOMB 3F0PA 1F5RA 2OC7A 2GZ8A 5C1XA 1FUJA 3PB1E 4F48B 4D7FA 3PMJA 1GMDF 1O3CA 3SJ9A 1K1PA 4GVUA 3EYDA 1GI1A 2UWLA 3OX7U 3E0NB 3FO8D 1EZSC 3SV8A 4O97A 1ELEE 4DCDA 1TBZH 3A88A 2HALA 2EI7A 1D3QB 2V6NA 5GXPA 2GV6A 1QBOA 3E90B 2XBXA 4Q7YA 1UCYH 1JRSA 3BTWE 1HAOH 2VGCC 5FBEA 3QUMP 1C1QA 5H4IB 1MKXK 2PLXA 2FYQA 2ZFSA 1GI0A 5G4BA 2XC5A 2XXLA 1ACBE 1IQEA 3OFND 4ABDA 1GVKB 1O3JA 1PQ8A 3QWCH 3VEQB 1GBMA 3RXAA 4BTIB 2F91A 1SGYE 3OTJE 1OWDA 3UOPA 2PP6A 2YMSB 1C4U2 3PMBB 1SGDE 2A7CA 4I8KA 4WMEA 1C2HA 1C1TA 1FX0B 5F8TA 4X8VH 3W1EA 3F9HA 2FDAA 3RC5A 1TX7A 2BVXH 1YLCA 4PROA 2QXHA 2ZF0H 1PQ7A 4OS5A 1C5OH 4TWYA 3FZDA 5F8XA 1PFXC 3GY8A 3TGKE 3VB7A 4XSKU 1DLKB 2JH5D 3MO3A 3N7DA 2ZHDA 5ABWA 1JXPA 2A7JA 4K1TA 1BCUH 1THPB 2HLDD 1V2TT 1BRCE 5B6OA 3QDZB 2PKAA 1ID5H 3M5LA 1FJSA 1OWIA 3E16B 2O8UA 4I33A 5E2OA 1O3IA 1LHEH 6GCHF 4XRNA 1BB0B 4ABIA 1VJ9U 1IQJA 1H8DH 2VU8E 4MQAA 4D76A 3MU8A 3SJOA 3M3SA 3KNXA 2STBE 1TX6A 1GMCF 3TGIE 1O5CB 1GHXH 1KLIH 3RC6A 4FUJA 1GI3A 1MKWK 2VVCA 1MZDA 4UD9H 3S7KB 3LT3A 1N8OC 1CT4E 4ASUD 2SGPE 3I77A 2L74A 1C4Y2 1O37A 4ASHA 1VKYA 2C3SA 5E2PA 3LKWA 3L33A 4O3TA 4SGBE 1S6LA 3SU5A 2JJ2D 2J5UA 2QV1A 2W6ID 1SGPE 5HYOA 1XKBC 3MQKC 3QZRA 3CS0A 1FMGA 3AVZA 1QZ8A 1C1OA 2ZKSA 1RIWC 1BUIA 1B0FA 2RFKC 4X6MA 1AN1E 1ZOMA 2FTMA 1F2SE 1TONA 1FY4A 4OS4A 2HPQH 5JBTA 1SGTA 1WTHD 5JBAS 1Z1JA 1V2KT 1ZSJA 1CGJE 1V2QT 1AE8H 1DX5M 1O2QA 2P93A 4JZ1A 5DP9A 2H2ZA 2BDHA 1SBWA 2H9EH 2QF4A 4IW4E 2FODA 2JETC 4NIWA 3SYJA 4AG1A 3QTVH 1ETRH 4F4OC 1W3CA 5C0UA 4O9VA 2OC0A 4CR5A 3SI3H 2GJGA 4JK6A 2SGAA 1BTZA 3LC3A 2J95A 1K9OE 1HIAB 3ENSB 4OS7A 4Z1MD 3VXEH 4OS1A 1DOJA 1H9LB 3SJ8A 3UAIC 4CH8B 1QNJA 2VIWA 3RXOA 1TPSA 2L6OA 3A7XA 4IMQA 1G9IE 4OS2A 2IN2A 2ODYB 3TH2H 3MNXA 5EXNA 2BD3A 1S82A 4WJG2 2BD8A 3PV5A 2YNBA 3PTBA 4DVAU 1BBRH 3MOCA 2PWXA 2A5KA 3SNDA 1YPLH 1AFQC 5HKKD 1W7XH 3BG4B 2BX4A 3V7TA 3N7OA 1XUGA 2CMYA 3VB3A 1O2UA 1PJPA 3FAOA 1O5FH 1IHSH 1E79D 5JBBS 2R2MB 3L3TA 2VWMA 4INKA 4Y10E 1HJAC 1O38A 2QY0B 1O2WA 1Z71A 1ANDA 1W0KD 3O8CA 2GZ9A 5C0TA 1F0UA 3MH5A 1LPKB 1LVYA 1EOJA 4WH6A 3O8DA 1LKBA 3GY3A 5CDFE 1ESBA 1QBNA 1HAPH 1EZXC 3KYFA 2ZIQH 2GT8A 1GBJA 1GDUA 2ZDNA 2GCHF 2F9OA 5T6GA 3RXTA 2ZQ1A 4IN2A 1FV9A 5I25A 2GVFA 1C2EA 4WXIA 3FVFB 3BTTE 2BLWA 3ESTA 2PGQB 4I8LA 1OYQA 1NBME 2CN0H 2ZGHA 3GOVB 4K69A 4AB9A 4Y79A 3UR9A 1KMHB 4JZDH 3UQOA 1AVWA 4FUHA 2QF5A 5CHAC 2W26A 1AY6H 1OWKA 4X1PU 3C27B 2BQWB 3BEIB 4DOQA 2O8MA 1FXYA 1XUIA 3V12A 1C1PA 1ZTJA 3NUMA 5EW2H 1S6FA 4D8NA 3M36A 5HM2A 1L1JA 3VXFH 2EY4C 2ZDKA 3T5FH 1C1MA 1W10U 4YTAA 3U8TH 1SLWB 2XNDD 4BAHB 4DW2U 4YLUA 3ZVCA 4OGXA 2STAE 1HAVB 1PQAA 2A45B 2XNIA 1TNGA 1GG6C 1QB1A 2GCTC 1NBMD 1V2VT 2A31A 2BXUH 2WV9A 2XW9A 1J15A 1CT2E 1NROH 1EB1H 3RXHA 3SBKA 1KTSB 1P03A 2SGEE 4GAWA 4ISIH 2TGDA 2PSYA 2ZDLA 4XOJA 1W12U 1WOFA 2FYRA 1V6DA 1O5DH 1HRTH 2WSSD 3AASA 1H8HD 3U98H 3GCOA 5FCKA 3RXGA 2LPRA 3AAUA 3UTUH 1V2PT 2Y7ZA 3K6ZA 2AGIX 3LGUA 1GWAA 9ESTA 3FN8A 2FP7B 1SHYA 1QL9A 2UUYA 1SFQB 2H5CA 3F6UH 1GL0E 1LHDH 1MQ6A 4ZCNA 4OS6A 1Y3VA 3ZZ4A 2BTCE 1BMMH 2CK3D 1CSOE 3ATLA 2ZU2A 2TGPZ 1W11U 2Y5FA 2B7DH 2FI3E 3DSGA 1UTMA 1BTWA 1XUFA 4INHA 3ZV8A 3PV4A 1AIXH 5A8YA 1B0EA 1EATA 1HAXB 2C8WB 1FONA 3TITA 1EJNA 1P02A 1TABE 2BD5A 1WU1A 1O5BB 4RKOB 1GDNA 2GMTB 3PROA 1S81A 5F8ZA 4A6LA 2J92A 1OYTH 3DFJA 3KQCA 1OWHA 1A7SA 1FY1A 4BANB 3TPIZ 2WV4A 1AKSA 3MWIU 3MYWA 1L1GA 1HAZB 4X6PA 2J98A 1GI8B 1JBUH 2A4OA 1DFPA 1XMNB 2KAIA 1RTLA 2P59A 2FZZA 2BOKA 3B23B 4B71A 3VB5A 2BZAA 3P8NA 5FPYA 1E35B 2PKSB 3QX5H 4B74A 4U01A 3GY7A 1TGTA 5FX6A 3ZZDA 2EI8A 3V0XA 3S0NA 1GI7B 5KGOA 4ZROA 1E34B 5I46H 3CP7A 1C5LH 4IMZA 3VG8A 4XDEA 1EAUA 1J9CH 2EC9H 4MLFB 4ABFA 2C8XB 1N6XA 2AGEX 1JWTA 1D4PB 1EZUC 1VCPA 4NA8A 4LZ1H 3BN9A 1GCTB 2ZCLP 4GLYA 4RSPA 3QO6A 1YM0A 1HAGE 2KCPA 2WINI 4NFEA 3RDZA 1SQRA 4CRCA 1SMFE 4A1XA 2P3TB 5FPTA 1O3DA 1VR1H 3A80A 2KCAA 1TNKA 1HAYB 2VIOA 5C5OA 1DM4B 1C2IA 2ZG0H 4JCNA 1MU8B 3SU2A 4Q7ZA 1C5NH 4F55A 1ZYOA 4I8GA 1V2UT 5GDSH 3KCGH 2ZU1A 1V2JT 2BD9A 1P10A 2A1DB 3MHWU 3TJNA 1THSH 3RXLA 2ZFTA 5CHBA 2ODQA 2ANMH 4WH8A 3E0PB 4X8UH 1NRQH 3WWFA 2AIPA 4NSVA 3UNRA 1C2GA 1TBQH 1EJMA 1UTQA 3UPEA 1KXBA 4HTCH 3UB0A 1BTUA 3AAVA 3KHVA 3T29A 2FOAA 1J16A 1O32A 1C1RA 2ODPA 5C3NA 7GCHF 1DSTA 5EQQA 2A4GA 1QA0A 2QE7D 2AH4X 2VWNA 4SGAE 1A5HA 1O39A 1GMDG 1TYNA 4FVDA 3EA8A 1N6YA 3DSOA 3E3TA 3V13A 1MTUA 2BQ7B 3A86A 3DSPA 1VITF 2K8IA 3A83A 1BMLA 3KQDA 4UEHH 3HPTB 4Z6AH 4NIXA 3EA9A 2OINA 1S6HA 2ZECA 1O35A 3D65E 1EAXA 2RCEA 5TJXA 5LGOA 2ZCKP 1C1UH 1NRRH 4ZHMU 1GI4A 4K2YA 1OX1A 4ZHLU 1W14U 8LPRA 2Z9IA 2XOKD 1AWHB 1ETTH 1DWDH 2THFB 2XWBI 2VVUA 2VNTA 3PLKA 1GGDC 2YOLA 3MI4A 3MH4A 2A5AA 2TGAA 3ATIA 1GBTA 1QIXB 1TOCB 2ZGCA 4X8TH 5J4QA 3BTFE 1FQ3A 3GS9A 3HK6B 1WUNH 1K1MA 3H7OA 3LONA 3UIRA 2AERH 2GTBA 4AGJA 1TPPA 4AN7A 2VVVA 1WDIA 1NO9H 2B5TB 2OLGA 1ABJH 2FMJA 2FOBA 1QY6A 4RT1A 1Y8TA 1C5YB 2CHAC 2ZDAH 4AFSA 4ZMAH 3F2GA 4IS5A 5HGGA 3TJVA 5EU8A 4R0IA 1CBWB 3PWCA 3PYHA 1O3KA 4NZQA 3U8OH 5KECA 7LPRA 2PUXB 2O8LA 3GCNA 4BAOB 3DT0H 5EPYA 4K3JA 4Q2KA 3V3MA 1EJAA 2TRMA 4AFQA 1O3PB 3NZIA 4QT8C 1BTXA 1C2FA 2HNTC 3M7TA 1SLVB 2KM0A 4YLQH 2HLCA 2NU0E 1ARBA 1D3PB 2OK5A 2J9NA 2D8WA 1ZRBA 2G00A 1P2QA 3SV6A 1L2EA 1O3EA 2DE9A 5AHGH 2ANWA 1ELBA 3LC5A 2BVRH 2R3YA 2WV5A 2F43B 4KELA 3BSQA 2ZTZA 4TSFD 3WWBA 2XC4A 2FOGA 1PYTC 1UVUH 2Z3CA 3A7VA 1S0RA 2KCYA 1NPMA 3SU4A 2PTCE 2AGGX 2TBSA 1DY8A 1O2YA 1ETSH 1GMCG 2WPDD 4THNH 2VBCA 4X1QU 2Y6TA 2YMSC 1NS3A 1BIOA 2ZHFH 4B76A 2A5IA 3W95A 3MH6A 1IQLA 1P3EA 3GY6A 2BY9X 3M5NA 2HGTH 1JMOH 2NU4E 4I31A 1VCQA 1Q31A 8ESTE 5IYTA 5DK1A 1COWD 1HIAA 1P3CA 1HAHH 1ELDE 1UCYE 1FDPA 3RXVA 1UTKA 1W7GH 1SHHB 4XD7D 2FS8A 5C94A 4NWKA 4YOGA 2BM2A 1Z8IB 3MU4A 1K1JA 3P6ZB 1EASA 3BTQE 3S9BA 1SOTA 1E1QD 2AMDA 4YOJA 3TK5A 1Z1IA 3OU0A 1UVOA 5BRRE 5ESTE 1SVPA 1HV7A 3RM2H 3BG8A 1GHBF 2AMQA 2ZTXA 4LXBH 1DUEA 3OSYA 3QK1A 3LGVA 2G4UA 1SQOA 3BV9B 1E38B 1V3XA 3I29A 1HUTH 4YO9A 1PPBH 2CF8H 5FX5A 1OXGA 3A7ZA 3P8FA 2CJIA 1K28D 2P94A 2UUJB 4M9FA 1GI9B 1H9IE 3EE7A 4R8TB 5DG6A 1MTNC 1TQ0B 2BD2A 1YBWA 1CQQA 1YPHC 4YM9A 1H8IH 4WMDA 3MNCA 2O9QA 2QXJA 3ATKA 4U32A 1ARCA 3SV7A 1T31A 2ZO3H 3LIWA 2Z7FE 1XUJA 1GPZA 1S5SA 1P11E 1UW7A 5F53A 1AI8H 2Z9LA 4HI3A 2ZFRH 1EAIA 1OWJA 3OYPA 1GJDB 4MNWA 1O5EH 4MPVA 1QA7A 3F2FA 4ZKRU 1TAWA 4X1NU 4I8HA 1PPCE 2XWAA 3SI4H 2H5DA 1GMHF 3LPRA 3ZVGA 3PM3A 3PO1B 1T8LA 2UUKB 3A8DA 4AZ2B 1YPKH 5JDUB 1HAVA 5AFZH 3UQVA 1LPZB 4FETA 2ZU5A 4D9RA 1GJ5H 2GCHG 4MG3A 4DGJA 3NPSA 3RXBA 4ABGA 1ZMLA 4GCHG 1C9TA 1LKAA 3RXEA 4CRDA 1BJVA 1KTTB 1VCWA 1HAIH 1AFEH 3AW0A 5GCHF 2V7QD 1TRMA 1Z6EA 5TCAA 4CRAA 4A1TA 2TPIZ 1O2XA 1QTFA 1LVBA 2ZPRA 2A4QA 1TFXA 4KTUA 2XC0A 3ZZCA 1TQ7B 2H6MA 5LH8A 2F9UA 1OHHD 1O2JA 3TNTA 4VGCB 4E7NA 1C2MA 1NRPH 2QAAA 3B8JA 2ZDVH 3BG4C 2FTLE 3KQBA 1O5GH 1GBKA 2ZDMA 1CT0E 1SQTA 1ELGA 1TOMH 2BY7X 1UK2A 1NM6A 2QYIA 1T7CA 1HXEH 1ZPZA 1DANH 2BD7A 1DDJA 5E0GA 5JYIA 4ACBA 4I8JA 5GWZA 3FP8E 2KX4A 1G2MA 3U8RH 2HNTE 6CHAC 1UCYK 1G3CA 2BVSH 2IPHA 5DN6D 1F7ZA 4F49A 1ANCA 2RG3A 1ESTA 1BMAA 3D23A 4H6SB 2OQUA 1O5AB 1UTNA 2Y81A 1O2GH 1CVWH 3A89A 1S84A 4UDWH 3RXPA 1GDQA 2XBYA 3BIUH 3Q3KA 4KKDA 3A7TA 3ZIAD 2GZ7A 1BBRE 2OBOA 3A8CA 3M7UA 1C5QA 2BX3A 1DT2A 3D62A 1TA6A 1EB2A 4FUIA 3U9AH 5EG4A 3KN2A 2J97A 3RXCA 1G3BA 3UNSA 1GBIA 3RLWH 1P05A 1MAYA 3MFJA 1PPHE 2OD3B 1MD7A 5A09A 1H8ED 4FUEA 1B5GH 4D9QA 4E05H 8GCHF 4X2YA 3KYGA 1AZZA 1MMJN 3N99A 2PUQH 1SPJA 3QTOH 3IWMA 1PYTD 3U28C
chains in the Genus database with same CATH topology
4WVPE 2BD4A 3BTME 1MTSA 2BY8X 2Y82A 2ZP0H 3BEUA 2VIQA 3H7TA 3BIVH 1ZMJA 4YZUA 2D1JA 3G01A 2XBWA 1GL1A 2G55A 2HOBA 2EA3A 3TLOA 1O2RA 1AGJA 3GCHB 1QQ4A 3B9FH 4GPGA 1EP5A 1IQIA 3QN7A 3QGNB 4UFGH 2O8WA 4MVNA 1GJAB 4GCHF 3GY2A 3OY5U 3RMNH 1TRYA 4IBLH 4WY3A 3RXRA 3GY4A 2FOEA 2P3FH 4ZXXH 4X2VA 1MBQA 3TIUA 2Q1JA 3UOUA 1O3AA 1E37B 4GSOA 2ZEBA 3RXSA 4RKJB 3T28A 2A4RA 3TH4H 4JZFH 1TB6H 2GMTC 1A1RA 1H4WA 1YPHE 2Z9GA 3A82A 4M7GA 2A0QB 1BRAA 1FPCH 2FM2A 2R2WU 1UTPA 3HKIB 4JYUH 5HMAA 3S69A 2Z94A 2JH6D 1YPEH 3SUFA 5AF9H 1TX8A 1RGQA 3NK8A 1LCYA 3RMMH 2Z6BD 1GBAA 2WPMS 4AYVB 1XXDA 3SJKA 3SN8A 4DG4A 1OS8A 1QHRB 1UHBB 2PKSC 3SGBE 5C67A 4TY6A 1LMWB 1P9UA 1KXEA 3RXIA 7GCHG 4X0WU 4ABEA 3GYMA 1HYLA 4WWYA 1THRH 5T6FA 4ZAEA 1P2NA 3P95A 2IOTA 1HCGA 1O3GA 1SGQE 4ABBA 1VITG 1MD8A 1GCTC 1C5MD 1IQHA 3VB6A 1ORFA 1F0SA 3RLYH 4NIVA 2GDDA 3GICB 4A5TS 1QQUA 1C5SA 2GV7A 4NIYA 1TLDA 2QF3A 3M5OA 1FAKH 2UUFB 3RC4A 4ABJA 1BT7A 1A0LA 4ABAA 4Y8XA 2AS9A 4DURA 4XBCA 1XX9A 3SU0A 3QZQA 3R3GB 2WPJS 1F92A 1C5RA 1HPGA 2J2UA 5DP3A 1BBRK 1FIZA 3SU1A 4UFEH 1ELFA 1QRWA 2VWOA 2ZQ2A 4BAMB 3MNBA 1EAWA 4KTSA 4FUCA 3SQHE 1C2JA 2PSXA 2ZTYA 1KLJH 5A0BA 3EE0B 1SGIB 2W3IA 1A3BH 5L2YH 2QCYA 3NCLA 1YF4A 4Z0KA 3PLPA 3FP6E 2VINA 1KXCA 1YP9A 2H9HA 2ZU3A 1C5VA 1QB9A 5DPAA 5EOKA 1QURH 4TPIZ 3SNBA 2XCNA 1TGSZ 2HRVA 2WPIS 2SGFE 4K8YA 1UK3A 1T4UH 1A0JA 1GJ8B 1AD8H 1HNEE 3W94A 2BY5X 1H1BA 1P04A 1S83A 2P8OC 3A8AA 1ZSKA 5C2ZA 1V2ST 5L30H 1MQ5A 2GCTB 1O3FA 1SB1H 4ZHAA 2OQ5A 1LO6A 1IQMA 1EUFA 3ZYEA 2ZGJA 3MO9A 3M3VA 2XTTB 3VPKA 1EPTB 1Y3YA 1OSSA 1TPAE 1SGRE 5K0HA 1ELCA 3EA7A 3P8GA 1HB0B 1HJ8A 1O3MA 1KYNA 1V2NT 5C20A 1LVOA 1F0TA 1ZZZA 1GHVH 4CRFA 2OC8A 3IITA 4AORA 1Y5BT 5E0JA 1GJ4H 1WCZA 3NWUA 3A84A 1BTHH 3ZZ6A 4J1YA 1QL8A 5DKMA 2NU1E 1E0FD 6ESTA 2PW8H 4NSYA 3KEEA 5CMXH 3QLPH 1W2KH 4B2AA 3EQ0H 1XUHA 2BDGA 4X1RU 1DICA 2Y7XA 3TJOA 1BMNH 4FU9A 1CA0B 1UJ1A 1LPGB 3BTEE 1OKXA 2G52A 1ZPBA 4MPWA 1GBBA 1FZZA 1NFUA 1IAUA 2VJ1A 1YCPH 1LQDB 3SUGA 3A7WA 4ABHA 2FO9A 3LDXH 1NU7B 3MNSA 5FBIA 2SGQE 3UR6A 1DWCH 4DIIH 2ZI2H 3ZVEA 4JYVH 1QFKH 1UVSH 4J2YB 1CBWC 1LTOA 4NWLA 3LH3A 5K7RA 1C1NA 3MU0A 2F9VA 4FUGA 3VGCC 3ITIA 1FNIA 1ZPCA 3E91A 4O03A 3SV9A 1O2NA 4CHAB 1QJ6B 4BXWA 4X8SH 2QC2A 2FLRH 1IOEA 1T8MA 5DP5A 1KY9A 1NESE 1J17T 4B1TA 1AO5A 3MU1A 1GHAG 2RDLA 1RTFB 1DWEH 2GP9B 3MO6A 1FY5A 2FXRA 3UY9A 3RXQA 9LPRA 1A0HB 1K1OA 1ZGVA 4BAKB 1ANEA 4AGKA 1YGCH 1D3DB 1FPHH 4B2BA 1T8OA 2QXIA 3ODFA 1GHBG 2B8OH 1A46H 4B2CA 1JOUB 2PR3A 3ZZ7A 2BHGA 4LK4A 5CE1A 1CO7E 3M3TA 1Q3XA 3PWBA 4CREA 3UWJH 2Z3DA 3TJUA 1X7AC 1AHTH 3ZYDA 1WV7H 1MKXH 1A5IA 4Y11E 1AWFH 3RU4E 1KLTA 2BDAA 2RA3A 1RRKA 1TGNA 4UFFH 1SG8B 3PMAB 5BPEA 2R0KA 1NZQH 2ZPQA 4H6TA 1ZLRA 3O8BA 2P16A 3STJA 1GI2A 3TVJB 5JB8S 2OUAA 1DPOA 4U2WA 2BYAX 2G81E 1GCDA 1S85A 2BXTH 4ISNA 3ZZ9A 3LH1A 1P09A 3TK9A 3ZZ3A 5EGMA 1SI5H 4XBDA 1HGTH 3KIDU 1GBCA 2EEKA 1Y3XA 1DE7H 2ZHEH 4YT6H 1TNHA 3K9XB 1MCTA 3M7QA 1P12E 4ISHH 1BRUP 1D9IA 1GVZA 1A61H 2ZCHP 3RU4D 2TGTA 2AEIH 1O2ZA 3JZ1B 7KMEH 1ZSLA 1GMHG 1K1LA 1GJ6A 3SNEA 2J4IA 1GBEA 2G4TA 3P17H 4JYTA 1RFNA 3S9CA 3PLBA 3T2NA 4WF8A 1L0ZA 3IG6B 5FHTA 1GJCB 2OCVB 3AW1A 1S0QA 1HBTH 3TGJE 1O3BA 2ALPA 1BOQA 2XRCA 2QXGA 1AMHA 1P2OA 3SV2H 5TCCA 1AVGH 1MCVA 1QR3E 2VIPA 1W0ZU 3Q76A 1ZJKA 1YPMH 2VH0A 5GPIB 1C4V2 2ESTE 2WUBA 1O2IA 1NRNH 1BITA 4AB8A 5GCHG 4NZLA 3ZVFA 1J14A 1YCPK 3T25A 3FFGA 1Y3UA 2F9NA 4HGCA 4OGYA 3VFEA 1ELVA 2BZ6H 1C5XB 2C8ZB 4YESB 1GI5A 2G5VA 1FN6A 2J94A 1Y59T 1SGFG 1B7XB 1MKWH 1Z7KA 2WUCA 1C1VH 3LGIA 3SQEE 2Z9KA 3M35A 1XKAC 1XVOA 3MH7A 3Q3XA 1BDAA 1C5PA 3LGTA 1Z6JH 1T4VH 1W13U 1UVPA 1FI8A 1VGCB 1GHAF 1HXFH 1QB6A 1P06A 1BA8B 3TH3H 1CE5A 3MU5A 1GJ7B 3PO1C 3URCA 3E1XB 3NXPA 1P2KA 2ULLA 1HLTH 2UWPA 1RXPA 4AX9H 4IN1A 1IQNA 3UNQA 2XBVA 2ZNKH 3E8LA 2I6SA 5C5NA 2Q6DA 3GDVA 1GBLA 2Z9JA 1C5UA 4I32A 2V3HH 3K2UA 4WXVA 3Q77A 3RMLH 1F5KU 3LJOA 1AB9B 4BOHA 1C2LA 1YKTA 4Y7BA 3RXJA 1MTVA 1Z8JB 3BEFB 1C9PA 5FAHA 4VGCC 1O34A 2ZA5A 2JH0D 1TWXB 3F68H 3A7YA 2QGRA 4A7IB 1C1SA 1NU9A 2Y5GA 8GCHG 2FPZA 4MTBA 2SFAA 4K8BA 4Y76A 2Q6FA 1OP2A 2VIDA 4BNRA 1MBMA 2V0BA 1G3DA 4XFQA 4E7RG 5EODA 1AQ7A 1ZMNA 5C1YA 2D26C 1A3EH 2V3OH 3HATH 1O3HA 1KDQB 2H9TH 1IQGA 1MTWA 3T27A 5HXFA 4K5ZA 1GJBB 1TMBH 1GVLA 1CA8B 4DIHH 4H4FA 1QRZA 4MNYA 1GHWH 2AMPA 1G3EA 2WPHS 1BTYA 1Z8RA 3GCTF 1PPZA 3SOSA 1NFXA 1EKBB 1TMUH 4ISOA 1RJXB 1SSXA 5EXMA 1QCPA 2FOFA 2F9BH 3HK3B 4Y8YA 1LHGH 1HJ9A 4TWWA 3PMHB 2VIVA 1UHBA 1FN8A 5DJ7A 5SGAE 1A4WH 1G36A 3ZVDA 1JRTA 2VGCB 2V35A 1TIOA 1EP6A 3SU3A 1TGBA 2HVXA 2GDEH 3UREA 1O2LA 2PV9B 2BQ6B 8KME2 3M5MA 3QGJA 1QJ1B 4AG2A 1OOKB 1NRSH 3U69H 1F5LA 4K1SA 4BTUB 4AFUA 1P0SH 1KSNA 4IC6A 3VB4A 1O2MA 2HWLB 1TALA 1G30B 3CENA 4LZ4B 1MTNB 2NU3E 4H42U 1ABIH 1Z8GA 2WPLS 2IJOB 1QRXA 2BDYA 4X2XA 1A5GH 1NN6A 1WQSA 1ZHRA 2BMGB 3HKJB 5FXLA 3SORA 3SUEA 4GUXA 2FWWA 2BDBA 3KQEA 2QA9E 3BTGE 1O2PA 1NY22 2J38A 1K22H 2ZPSA 3ATMA 1NT1A 3ZVAA 3GCHC 1YLDA 2QF0A 4Y8ZA 4Y7AA 1QGFA 1P2MA 1P01A 3BTDE 1ZR0A 2Z3EA 2A32A 1SGFA 1V2WT 4MDSA 3ZZ5A 1AVXA 2K1QA 1P8VC 4O3UA 3E6PH 2F9PA 1BQYA 1MAXA 2J34A 5FPSA 4BAQB 1C5ZB 5T3HA 5L6NH 1CHGA 2CV3A 5EW1H 3DUXH 1UTOA 1DLEA 1P2JA 1FLEE 2FLBH 1C5TA 3RXFA 1IHTH 4MNXA 3UWIA 3MMGA 1UO6A 3EGKH 2EI6A 3LU9B 1EPTA 1O31A 1O2KA 5AFYH 1SQAA 5T6DA 1N8OB 3RXDA 2C90B 1WSSH 1SGNE 3HGPA 2PHBA 1O36A 3RXMA 1TGCA 1WQVH 3SHCH 1EZQA 3RXKA 2GGVB 2QIQA 1D6WA 1PPGE 3BF6H 1SLUB 1OWEA 1FY3A 2RA0A 3RMOH 1MU6B 5A8ZA 2ALVA 1TA2A 5A0AE 3WY8A 1CU1A 4FVBA 5J4SA 3A81A 1BHXF 3GDUA 4KGAA 3JZ2B 1RIWB 2Y5HA 4HFPB 1SLXB 4YOIA 5E8EH 2I6QA 2F83A 4I7YH 2P95A 3F1SB 1ANBA 2ZFPH 1KIGH 1TMTH 2PGBB 3ODDA 1ESAA 3U1JB 1KXDA 3LOXA 2TIOA 3RU4T 2R3UA 4UFDH 2AYWA 3NKKA 4RN6A 4CH2B 6CHAB 1TNJA 2FX4A 1CHOG 1BTPA 1HDTH 2OC1A 1MH0A 1GHYH 4MPXA 1VITH 1V2OT 2JETB 2B0FA 3GY5A 1IQKA 1K1NA 3HGNA 3P92A 4ZH8A 2W7SA 1J8AA 2BLQA 1C5WB 2C8YB 4A92A 1P9SA 2ZHWH 1DSUA 1O2SA 3A87A 4AOQA 3GDSA 1G32B 2AFQB 3F9GA 3ZVBA 2VWLA 1UTLM 3T62A 4MPUA 2PKAB 3K65B 4XBBA 3FZZA 4Y0YE 3MTYA 3I78A 1QL7A 4CRBA 1W0YH 3PTNA 3RUOA 1W8BH 3F9FA 1C2KA 2CXVA 1AFQB 1DITH 2G8TA 4IC5A 1A2CH 4XE4A 2BB4A 1WAYB 1RTKA 1BZXE 3RXUA 1GJ9B 1SGEE 1VZQH 3SNAA 4NA7A 2ZFFH 1EQ9A 1UVTH 4ESTE 1O2HA 1D3TB 2ZGXH 1JIMA 5EQSA 3O8RA 1L1NA 1ZJDA 5LPEA 3D49H 2VH6A 1K21H 4X6NA 4JMYA 1C1WH 1L4DA 2OP9A 4INLA 1HJAB 1EPTC 2GKVE 1K1IA 2AIQA 1O3NA 2ILNA 4FUDA 5EQRA 3M61U 2BLOA 2ZZUH 1GBHA 1O3LA 1XXFA 2H1UA 2R0LA 2ZGBH 4KP0A 1V2LT 4Q7XA 2FI5E 4DY7B 2W3KA 2BDCA 1LVMA 1Y5UT 3TNSA 5LPRA 3BTHE 1MZAA 2Y80A 1Y3WA 5PTPA 4FU8A 2NU2E 5AVDA 5A2MH 2GX4A 1NTPA 1E36B 1ZTLA 1TPOA 2WYJA 1MUEB 1CA0C 1NFWA 4LOYH 5LPFA 2P3UB 3LJJA 1M9UA 1SGCA 3GISB 1O2TA 2DUCA 1NC6A 5GIBA 4TYDA 5CHAB 3KL6A 4Y6DA 4FUBA 3A8BA 1SOZA 1TRNA 1L4ZA 3ZV9A 1P2IA 1RS0A 4UONA 4BTTB 3S9AA 3SW2B 3ATWA 4K60A 1FIWA 2WYGA 2YNAA 3SUDA 2LNCA 4HZHA 1GG6B 2D2DA 1G37A 5ESBA 1KXAA 5DP4A 1RD3B 1HFDA 2ZU4A 4X2WA 3SZNA 4ZKOU 2ANKH 4CHAC 1O0DH 1T32A 1WYKA 2PTNA 1DUAA 1ELAA 5GJ4B 6LPRA 1DS2E 1CHOF 1OP8A 2QN5T 2HNTF 3U1IB 1TNIA 4JZEH 2GT7A 1ZTKA 2JKHA 1DY9A 4NFFA 1AUJA 3TU7H 1BJUA 1GBFA 1SL3A 3DHKH 4CRGA 4X1SU 1UTJA 2B9LA 4IGDA 2BOHB 2G5NA 2VB0A 4AYYB 1O2VA 4ZXYH 2Q6GA 5JPMH 1GI6A 2FEQH 4CR9A 1XVMA 1KXFA 2OXSA 4YT7H 1FY8E 2NWNA 4WMFA 4NG9H 1N1LA 2SNWA 1O3OA 4DT7B 2C4FH 3UFAA 1GBDA 4GHQA 3FANA 4FXGH 3RM0H 2A7HA 4B75A 5EXLA 2XCFA 5EPNA 2FESH 1XM1A 1ZHMA 4Q80A 3GYLB 1ELTA 4FUFA 4Y0ZE 4B73A 5F6MA 1ZGIA 2W5EA 4NA9H 5HM9A 2FOCA 5L2ZH 2GD4B 1H9HE 2PFEA 2R9PA 3DD2H 1UMAH 2ANYA 4E06H 4A1VA 3ELAH 4JK5A 1YCPM 4TPYA 4ISLA 1BHXB 1PPEE 5FCRA 3UUZA 5DO4H 3EAJA 3SO3A 1CGIE 2W7UA 3ZZ8A 1YPJH 2P8OB 3SGAE 2FIRH 4X6OA 2DE8A 1TBRH 1OPHB 1QBVH 2G51A 1PPFE 1XUKA 3S7HB 1D6RA 2CF9H 1DVAH 3EDXB 1NFYA 3LGYA 5DP8A 4MNVA 1DXPA 1CGHA 1O2OA 3DFLA 1DWBH 2M5TA 1AZ8A 1KDQA 2F3CE 2BLVA 1IQFA 1U6QA 1YYY1 2SGDE 4GHTA 4NCYA 5JB9S 2XYAA 1SFIA 1JIRA 1ZHPA 3SHAH 1INCA 4CBNA 4D7GA 2ZHQH 1O33A 3CS7A 1LDTT 1QJ7B 2BY6X 2HPPH 3C1KA