3AAVA

Bovine beta-trypsin bound to meta-diamidino schiff base copper (ii) chelate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Structural basis for the design of novel Schiff base metal chelate inhibitors of trypsin
pubmed doi rcsb
total genus 57
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3aavA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3aavA02
2BHGA 3KQDA 4LZ1H 4PROA 4RKJB 3QGJA 6GCHF 2ZHFH 3RXOA 1VCPA 5EQQA 4A1XA 2WV5A 4K69A 1AE8H 2B0FA 3A7TA 3KF2A 1C5OH 2FTLE 3UNSA 2FM2A 4XDEA 2ZO3H 1SLWB 5E2OA 1G3EA 3STIA 3PWBA 3A8BA 2JH0D 1PJPA 1J9CH 1YKTA 2ZF0H 2YNBA 1OX1A 1H9IE 5EG4A 3EQ0H 1KXCA 4NIVA 5IDKA 2VNTA 2PTCE 3Q3XA 1EAIA 1AFEH 4Y71A 4MPUA 1BA8B 2H5CA 4O3TA 1C5ZB 1P03A 2Z3DA 4Y8XA 2VWNA 1L0ZA 2WPJS 5AHGH 3UY9A 4X1RU 1VGCB 1A5GH 1KLTA 1OYTH 2A32A 2BVSH 4DVAU 3ATMA 1K1LA 1OPHB 3UWIA 4ISNA 1C4V2 2J2UA 1P06A 3SUEA 2BD9A 2A31A 2PGQB 1O2ZA 5FBIA 1AVGH 1MBQA 2A7JA 1T7CA 2BQ6B 2TGPZ 4YOIA 2RDLA 1A0LA 2A45B 2A4QA 1TMTH 2BM2A 1RFNA 1T32A 2OC8A 3I77A 1VGCC 1SFIA 1VJAU 5LPRA 1O36A 3ZZAA 2F3CE 1FIZA 1VZQH 2J38A 5EU8A 1K1NA 2ZTZA 1LDTT 3TH4H 1P3EA 1UK4A 4ZKNU 1HYLA 2I6SA 3T62A 4O97A 4INHA 1EP6A 3PLPA 1GHWH 4ABDA 1BRCE 1GCTB 5DP7A 1Z6EA 1O3NA 5DGJA 1LHGH 1O3BA 1O3PB 2Z6BD 1ZPZA 4I8KA 4ABBA 4DCDA 1XUJA 5ETXA 5EOKA 2BD8A 4Y7AA 2Z7FE 1QBVH 2FZZA 1GDNA 4AOQA 1DM4B 3DHKH 1DPOA 1KXBA 1YLDA 3ENSB 3BN9A 4NIXA 1O3AA 1C1QA 1NESE 2ZQ1A 1GCTC 1UO6A 1EB2A 4MPXA 2J34A 1MTSA 3RXIA 5FHTA 1O2PA 2ZCLP 4B71A 1Z8IB 2AGGX 2FOFA 3SJ8A 1GJAB 2ZDLA 4YLUA 3K2UA 3RU4E 2FI3E 2J92A 1AIXH 2HRVA 1ZSJA 1P02A 2VVVA 1F7ZA 1QJ1B 1O3OA 1A0JA 1TOMH 4NA9H 1S5SA 2Z3EA 4Q2KA 2ZHWH 5I46H 1O38A 1OWDA 4XBCA 1S82A 1TA2A 4TWWA 3GY6A 5C5NA 3V13A 4FUHA 4INKA 2ZPQA 4ZXXH 3H7TA 3U9AH 1GHAG 1HXEH 4ISIH 1LPGB 1DXPA 1PQ7A 4O9VA 1ELGA 5GCHG 4F4OC 2ZGJA 1HRTH 1O2XA 4HGCA 1ARBA 1ELTA 8GCHF 4KGAA 1C4Y2 2R0KA 1ZMLA 1YLCA 1E36B 1NFXA 2LNCA 2YOLA 7LPRA 1V2NT 4NWKA 5G4BA 2TIOA 1BJVA 3VGCB 1TPSA 1NS3A 2IN2A 5K7RA 2UWLA 3PTBA 4MLFB 1YGCH 3GDSA 2BVXH 3A7ZA 4AGJA 3BTHE 2G51A 2W26A 1GMHG 2XBVA 1W10U 3F9HA 3E0NB 5T6DA 2Q6DA 2A4GA 1A0HB 3HGPA 3LOXA 3A87A 3L6PA 1TALA 2VWLA 2XBWA 2FX6A 3EA9A 1K21H 3LGWA 2UUKB 4D9RA 5T3HA 1SQOA 3VGCC 3ZZ4A 1GBAA 3RMLH 1MMJN 2BY7X 4IS5A 2ZI2H 4X0WU 5FBEA 1XMNB 1ABJH 4YO9A 4H6TA 1Y5BT 1BDAA 4IC5A 1EUFA 3M3VA 1Y59T 1UK3A 1GI9B 2OLGA 1N8OB 1RS0A 1ABIH 1H1BA 2R9PA 5EW2H 4X6OA 4OS5A 4JZDH 3KNXA 5TCAA 4A1TA 1JBUH 1SGRE 1QY6A 1SL3A 3ZZ6A 2D1JA 1ETSH 2WINI 4H4FA 3P6ZB 1T8LA 2OD3B 1LHFH 2ZGBH 4UE7H 2BD7A 5LGOA 4KELA 1V2JT 1HLTH 1SLVB 4GPGA 4AB9A 1TGTA 3ITIA 2QXIA 2FS9A 1B0FA 2ZHEH 3B9FH 2ANKH 3FZZA 2FI5E 5C67A 5A0BA 1GMDF 2P3UB 3GYMA 1A7SA 1JRTA 2O8WA 1P2JA 3UOUA 3MO6A 1UTOA 2ZTYA 1FJSA 2QC2A 4B73A 4MTBA 4X6PA 1LVYA 1W7XH 3SNBA 3NKKA 1ZRKA 3U8OH 1KTSB 2D8WA 1HV7A 1ANCA 2W5EA 2GT7A 1UVUH 3O8CA 4CRBA 1OKXA 4A7IB 3UIRA 2GD4B 3MNXA 5TJXA 1MAYA 1NO9H 1O3CA 2HGTH 4MNYA 5A2MH 1DLEA 1O30A 1FV9A 1T8MA 3MNBA 4NA8A 4WXIA 2XBYA 2F83A 1X7AC 1F0UA 1YCPM 4KTUA 1S6FA 1QFKH 5EXMA 4JYUH 1RIWB 1GI1A 2ODPA 2P94A 2BD2A 1KIGH 3BV9B 4K1EA 4X1SU 3KGPA 5SGAE 1LKBA 1G3CA 1HAPH 1CHOF 1SOTA 1SGNE 1WBGB 3V0XA 1UK2A 2FMJA 3SNAA 1W0ZU 2VH6A 3CP7A 4Q7ZA 2CXVA 3RM0H 1AVWA 3H7OA 2NU3E 2XYAA 2THFB 3TH2H 1JWTA 3V7TA 2SNVA 1MQ6A 3TIUA 1N6XA 1V2WT 1T4UH 1V2RT 4Y8YA 1PYTD 1RIWC 1O2WA 4UFDH 5EXLA 1W7GH 3SZNA 3E8LA 3SUDA 2OXSA 3MNCA 2I6QA 1UTKA 3LIWA 1QRWA 2FYQA 5K0HA 3SU5A 4CH2B 1EAUA 2PUQH 4K5ZA 1AGJA 1A3BH 2BD3A 1BRAA 1QCPA 2VIOA 1ZHPA 3N7OA 2PKAB 2KAIB 1G3BA 1GJ4H 1HAYB 4OS7A 4B2BA 2ZFFH 1V2PT 4AFZA 3KL6A 3S7HB 1O2NA 4ZHLU 5GWZA 1WCZA 4IBLH 2BLVA 3GCTG 2ZGXH 1TNKA 4BXSA 4AG1A 1SI5H 2PFEA 1Z1JA 1FAXA 3LC5A 4OGXA 2Y7XA 2FS8A 3SU6A 4I8HA 3V3MA 1P9SA 1IQIA 3LKWA 2QXHA 1WTHD 1P3CA 2IPHA 1GDUA 1KSNA 5CE1A 2ZDNA 2G52A 1GJ5H 3VFEA 4E7NA 1ZHMA 4D9QA 1P01A 1KTTB 1VR1H 1ZGVA 4X1NU 3MU5A 2CV3A 1FZZA 4AORA 2OBOA 3ZYDA 1P04A 2AERH 3LPRA 2ZFRH 1OYQA 1EASA 3AASA 3TJVA 3TGKE 1SGCA 3RC6A 2AH4X 4X1QU 3RXBA 2R0LA 3AAUA 2Z9JA 2ILNA 4I33A 3PROA 3LU9B 4B1TA 1O5AB 1WUNH 3VXFH 7GCHG 4BAMB 3UREA 1WAYB 1ELVA 1HJAB 3QDZB 4U2WA 1EAWA 1CE5A 1GBLA 1EQ9A 4CRGA 4AYVB 1G2LA 1GGDB 1TGBA 1C5LH 2C8WB 2PUXB 3M5OA 1SGFA 3M61U 3LONA 2BDHA 1V2UT 1YPKH 2ZZUH 3SGAE 4WMEA 3PLBA 2ZQ2A 5DG6A 1T8NA 3UR6A 3RC4A 4NZQA 1HJAC 4KTCA 3BTKE 3MWIU 1O32A 1S85A 4Q7XA 1GGDC 4XOJA 3M7QA 3BTFE 1FPHH 3RLWH 8ESTE 3C1KA 3T25A 1H4WA 4Y0ZE 5DP4A 2FI4E 1YCPH 3AW0A 3TPIZ 1QURH 2RA3A 3PWCA 4B2CA 1SHHB 2JKHA 4I31A 4E06H 1O5CB 1ELFA 3SJKA 3E16B 4JCNA 3PTNA 5FXLA 4D7FA 4HI3A 1K1JA 3RLYH 2P8OB 2FOHA 1HAVA 1BJUA 2P3TB 1D4PB 1KXEA 2GCHG 3M3TA 1FDPA 3LGTA 2BZ6H 1LPZB 2GX4A 2PWXA 5FCKA 1P2MA 3PMBB 4MPWA 4BAHB 4BNRA 2HVXA 4J2YB 1C4U2 2G5VA 3MH6A 1OP2A 5BPEA 5I25A 1GHYH 2A5AA 4ZKRU 2VB0A 1BRUP 3GCNA 1F2SE 1EKBB 5JB8S 3TJOA 1EOLA 1NRNH 1NY22 1CGHA 2QCYA 1C5RA 2P8OC 2NU2E 1C5YB 1S83A 1IQMA 4QT8C 3IITA 3GDVA 1GHBG 5TCCA 1ANBA 5EXNA 2SGPE 2SGDE 3BTDE 3SV2H 3ZV9A 1ZHRA 1SGPE 3PMHB 3RXGA 2FOCA 4K1TA 1NC6A 1TNJA 1TPPA 2XCFA 1F0TA 1FY1A 3SHCH 1YYY1 1G9IE 1GJBB 4OS2A 4WJG2 7ESTE 1FAKH 1HFDA 4K3JA 3B23B 1LQDB 1PPHE 3VXEH 1YPGH 2VIQA 1O35A 5FCRA 1KLJH 2J4IA 1D9IA 2GZ8A 2WPHS 1GI8B 3S9AA 1RXPA 4TYDA 1ORFA 2BDBA 3EE0B 1LVOA 1D3QB 3T29A 3QX5H 2OUAA 3H5CB 2WUCA 1O2YA 3IWMA 1GG6B 1TNIA 5C20A 2ZU2A 1QB9A 2QGRA 5DKMA 1OWEA 2P95A 1ELCA 2C4FH 1Z8JB 1OSSA 1HAZB 1A46H 2P16A 1VITG 1A5HA 1NTPA 1V3XA 4FVDA 3ZZ9A 5JYIA 3CENA 3BIUH 1P2KA 3T28A 1L1NA 2GKVE 1DS2E 1TFXA 1XKAC 1BB0B 1AY6H 2BQWB 3VB7A 1MH0A 3SORA 4ASHA 2A2QH 5E0GA 2AFQB 4CRDA 1GG6C 4U30A 3SU0A 1GHVH 3U8RH 3ZZDA 1NZQH 4GSOA 1C1OA 3MTYA 5C1YA 3TK9A 3S9BA 1Z7KA 4M7GA 1QJ7B 1G37A 1ZJDA 3MU8A 3SW2B 2ZFPH 2W7SA 2HPQH 3MH7A 1FY5A 4J1YA 3UNQA 3BG8A 1KXFA 3DA9B 2V3HH 1BMMH 1J15A 1MAXA 1V2QT 1ELDE 2C8YB 3SUFA 3ZZ8A 1TQ0B 2OC0A 3NK8A 4Y0YE 1P57B 1V2TT 3VB3A 2J95A 1HAHH 1MD7A 1AWHB 3ZYEA 2D2DA 1C5WB 5DP5A 1FLEE 4AN7A 3M3SA 4YT7H 3D65E 5HMAA 1B7XB 1CSOE 3BG4B 1PQ8A 4K2YA 3A89A 1GBJA 2BMGB 3SO3A 1PPBH 1T31A 1O34A 1GVZA 1GBCA 2GZ9A 1QL8A 2ODQA 2ANWA 1CGIE 1SGDE 1THPB 3SU3A 4UONA 1NRPH 3FAOA 5EPYA 2BDCA 4A1VA 1THRH 4AFQA 5F6MA 2XRCA 3RDZA 2OC1A 4JYVH 2O8MA 3RXPA 1EATA 1LPKB 2OCVB 3BTTE 1G32B 2OP9A 1AUTC 3SQEE 3BG4C 2WYJA 1UTPA 3RXKA 2ZHDA 2GV6A 1O0DH 3ZZCA 4ZHMU 4B76A 3CS7A 3RXCA 1FUJA 2FTMA 4WXVA 1L2EA 3MU0A 4JK6A 2JH6D 1S6HA 1KXDA 1OP8A 3JZ1B 1ACBE 1O3FA 1J14A 5A09A 2G4UA 4RN6A 1W11U 4IW4E 3O8DA 3KQEA 1QL9A 2VH0A 1SGFG 2Y82A 4NIYA 1MCTA 1NROH 2FXRA 1CA8B 2GCTB 2FLBH 1W0YH 1DLKB 1MTWA 3MO3A 3SNDA 2Y80A 4CREA 1F0SA 1UVSH 5T6FA 5JBBS 5HXFA 1MKXH 1ZSLA 3QTOH 4X8SH 1UCYH 1WQVH 1MUEB 1BTWA 3NXPA 1J8AA 1IQGA 1BOQA 4JZFH 3SU1A 1Z6JH 2CHAB 3HK3B 3M5NA 5EODA 8LPRA 2CF8H 3ODDA 5DK1A 1O2IA 4UFEH 3SI3H 3RM2H 3MNSA 1GJ6A 1SLUB 2GCTC 2SNWA 1BZXE 3OU0A 3U8TH 1LTOA 1AN1E 1C5UA 2B7DH 3QUMP 3E90B 1C1NA 1JOUB 3LT3A 5JBCS 1GBHA 8GCHG 1HXFH 3FZDA 2BY9X 1C1UH 2CHAC 2HOBA 4K8BA 2C93B 1QB6A 3ATWA 5A8ZA 2BX4A 1TIOA 3U1JB 1JXPA 2TBSA 5DP8A 2F9OA 1THSH 2J94A 2HALA 3F6UH 4CBNA 2OINA 1BTHH 3E0PB 3LJJA 1GI7B 1WOFA 2C90B 3K9XB 1HJ8A 4X2YA 3I78A 1GCDA 1GJ7B 1IAUA 2VIVA 3C27B 4ESTE 4YLQH 1BTUA 5JDUB 2ODYB 1PPGE 1ELBA 4NFEA 2SFAA 3P8OA 1EOJA 3SU2A 3P70B 2B8OH 1PPEE 1K1PA 1ZZZA 4D8NA 1GHAF 4K60A 1EPTA 3UWJH 4HTCH 1LVMA 1L1JA 2NU0E 1SPJA 5FPSA 3T26A 3BEFB 1GJCB 5GCHF 2VVCA 1ZGIA 3EDXB 1BITA 1SGTA 4DW2U 1Y3VA 1C2IA 3D23A 3VB6A 5DP9A 1CA0B 4ISOA 2ZDMA 4E7RG 4DURA 1OWHA 2A7CA 2Y5HA 1J17T 2GT8A 5GJ4B 1MTUA 2ZIQH 3KHVA 1GBBA 1GJDB 1YPMH 3SQHE 4AB8A 4AYYB 2NWNA 2EI7A 1C2FA 1O2VA 3PO1B 4I8JA 1JIMA 1GMHF 1WYKA 1OXGA 1UTLM 4CRFA 5DO4H 1C5PA 1F92A 3UNRA 1CA0C 3RXTA 1QIXB 1ZMJA 2ULLA 1E38B 3DFJA 4ZKOU 2Y81A 2XBXA 2F9PA 1PQAA 3D62A 1OWIA 1O5DH 4IGDA 4CRAA 1TRMA 3KCGH 1GMDG 1XUKA 1AZZA 3LDXH 3RU4T 4K8YA 2WPMS 1FXYA 3TGJE 5FPYA 1A3EH 4JZIA 1RRKA 5HM2A 2A7HA 1N1LA 1XUFA 2O8UA 1O5BB 2H9EH 2B9LA 2UWOA 1TNLA 3RMOH 3PO1C 3URCA 2Y5FA 1OWJA 4ABIA 2ZDAH 1MTNB 1L4ZA 1LMWB 4BXWA 1HAOH 3RXLA 3SGBE 1DY9A 1WSSH 3SBKA 1F5LA 1DY8A 5J4SA 1EPTB 1AE5A 1SR5C 4A5TS 1C9PA 1QQUA 1OS8A 5CHAB 1C1VH 3RXJA 5C2ZA 2C3SA 1SOZA 1BQYA 2XCNA 1HDTH 2Z9GA 1LHDH 1UTMA 2Z9LA 5F03A 3TU7H 3BTGE 3RXHA 3A82A 1TGNA 1SGQE 1AZ8A 2EI8A 3T2NA 1MTNC 3ZVBA 3VB4A 3MOCA 4CHAB 4X8UH 5ESBA 1G36A 1E0FD 1C2GA 2R3UA 5C1XA 1EPTC 3A7WA 1K22H 2V35A 1N6YA 1O2SA 4UDWH 1FNIA 3RU4D 2EC9H 3MHWU 5CHAC 1IQHA 2QA9E 4H6SB 1YPHE 1GDQA 1Y5AT 2XW9A 1Z8GA 1CBWB 2PR3A 2ZEBA 3CS0A 1LHCH 2BY6X 3PMJA 3UOPA 1YBWA 1LQEA 3MO9A 3UQOA 2H1UA 1FY4A 1C5VA 4RSPA 3ZVCA 4OS6A 2STBE 3U98H 3PYHA 4CHAC 2TGTA 4YOGA 3GCHB 3SV7A 3A80A 2HWLB 1U6QA 1QA0A 3BF6H 1KLIH 4JZEH 3V12A 2ZCHP 1FY3A 1BBRH 5L6NH 5DJ7A 3AW1A 1IHTH 3BEUA 3PLKA 1CBWC 2M5TA 3O8BA 1EZSC 3T27A 1ESAA 3I29A 2ZFQH 1CHGA 1C1SA 3GY8A 2GV7A 1BCUH 5GPIB 1QQ4A 4BOHA 1QHRB 3GCHC 2Q6GA 1Y3UA 5E2PA 4LZ4B 4UFFH 3ZVAA 1O5GH 1GMCG 1FIWA 3W94A 3E3TA 1O3GA 1HBTH 2SGFE 6CHAC 1TE0A 1W13U 1W12U 1O2KA 1O3JA 2A5KA 3QZQA 1YM0A 1O3IA 3BTEE 1K2I1 2ZU5A 1H8DH 2FP7B 1PYTC 4UD9H 2QN5T 1HCGA 3SJOA 3DT0H 1INCA 1NU9A 2SGEE 9LPRA 2P59A 1UCYE 4YESB 3RXUA 1QRXA 1QNJA 1TOCB 4TPIZ 1O3HA 1D3DB 5F8ZA 1V2ST 1V2KT 1P2QA 1DWDH 1O37A 2G55A 1SGYE 3P8NA 1FN6A 1W2KH 3RMNH 1ELAA 2DE8A 1ID5H 2VJ1A 4E05H 1P10A 1W14U 2F91A 2VVUA 1NFYA 4FU8A 4I8GA 3GOVB 2ZNKH 1QB1A 2ZTXA 4DY7B 1AHTH 3QLPH 1H9LB 2FEQH 2OQUA 1SVPA 2Z9KA 5E0HA 3S0NA 2AMQA 1C9TA 1O3DA 3MH5A 2BB4A 3ODFA 3QWCH 2A4RA 3P92A 1NT1A 4WY3A 2ZC9H 2HLCA 2BZAA 3TJNA 2VINA 2DE9A 1MKWK 2G81E 3GISB 1SQTA 2BX3A 3G01A 1XKBC 1NM6A 3UR9A 1YPEH 2IJOB 2XTTB 5FX5A 3UTUH 1GPZA 2FOGA 2W3KA 5AFYH 6ESTA 3MU4A 2H2ZA 2BDAA 2FWWA 2BD5A 4AG2A 2ZDKA 4BAQB 1AMHA 1D6RA 3SN8A 3FFGA 1W8BH 5LPEA 2ZG0H 1PFXC 3ZZ7A 1Z71A 2ZP0H 1MU6B 3M7TA 3NWUA 3HGNA 4ZH8A 4WH8A 3S9CA 1UTQA 4BTUB 3K6ZA 3U69H 4GCHG 1DOJA 3ZVFA 3P17H 3TK6A 2PTNA 1QL7A 1AVXA 1DT2A 2PW8H 1LVBA 1AKSA 4Y6DA 1Q2WA 2BDYA 2ZGHA 1BTXA 1HIAA 4FU9A 4MPVA 1XX9A 2QIQA 4DG4A 1S84A 2RCEA 3Q00A 2ZU4A 1DSUA 2XC5A 1EJMA 2FPZA 4B75A 2Q1JA 1D3TB 1Z1IA 1TPAE 1DWEH 1YPHC 1A2CH 4JZ1A 2PSYA 2FOAA 1GBIA 3QK1A 4SGBE 3TGIE 1BMLA 2BTCE 4CR5A 4Y76A 1HPGA 4DOQA 3A8DA 1HAIH 1TA6A 2G8TA 2Z9IA 2VIPA 1K28D 3SV6A 1V6DA 1RGQA 2FOBA 1Y3XA 5ESTE 3WY8A 5JPMH 2AMPA 2BOHB 1HUTH 3RC5A 1EXFA 3A84A 2GCHF 1ZYOA 4ZMAH 5HM9A 3M7UA 1IQNA 9ESTA 4FUJA 1IQJA 1XXDA 1TMUH 5AF9H 3HPTB 3LGUA 1SC8U 1YCPK 1LKAA 2SGQE 1BHXB 3NUMA 2BXTH 4ISLA 3RXQA 3S69A 4OS4A 1QTFA 2H9HA 5EW1H 1Q31A 3M37A 5GXPA 4TY6A 1BIOA 5T6GA 3RXDA 2V0BA 3OTJE 2PV9B 2BYAX 2XC0A 1XUIA 3SUGA 1RTKA 1UVPA 1YP9A 1G30B 2O8LA 3MU1A 3MYWA 6GCHG 4ZKSU 1HAVB 4FVBA 3MH4A 1O2JA 4MDSA 1IQEA 1O2QA 2AS9A 1ZR0A 3F68H 1QRZA 2Z3CA 1OP0A 4ZUHA 4Y7BA 1QJ6B 3BTWE 2OBQA 1NFWA 3EA7A 3EA8A 2TPIZ 2ASUB 1PPFE 5EPNA 1BBRE 4I8LA 1GI4A 4NG9H 1TGCA 1O2OA 1SFQB 1MD8A 2ZU1A 4CRCA 1AD8H 4DJZB 3KN2A 1SHYA 4BANB 4YT6H 3RXVA 1C2MA 1ZTKA 1NU7B 4NWLA 4X8VH 2CN0H 4XBBA 3OY6U 4OS1A 2BOKA 3QTVH 1YF4A 4X2XA 3A83A 1RTFB 4KTSA 5DP3A 4DIHH 1DSTA 3T5FH 1CT0E 3RXMA 5IYTA 2ZPRA 4D76A 4KP0A 1ZTLA 1UJ1A 1NPMA 1GWAA 1VITF 3SJIA 1TX7A 2QXGA 3URDA 1K1OA 2UUYA 4WMDA 4X2WA 1VJ9U 3BIVH 3RXEA 1CT4E 2FYRA 1F5RA 1GL1A 1TQ7B 3P8FA 3O8RA 2TGDA 4LOYH 1O3EA 2AIQA 3M36A 1C1TA 4CR9A 1CGJE 3MMGA 5E8EH 1V2MT 1GBTA 4TWYA 5L30H 2G4TA 1NFUA 2SGAA 1WTGH 1GHZA 1AO5A 1SGEE 4X1PU 3DD2H 1TX8A 3L33A 1D3PB 4WH6A 1BUIA 4AFUA 3R3GB 2DUCA 1AUJA 1GI3A 2WPKS 1AWFH 3TLOA 4BTIB 5GDSH 2XXLA 4VGCB 2XNIA 1MCVA 3PV4A 4CBOA 1LO6A 2VU8E 1GHXH 5AVDA 4IN1A 4JMYA 1A1RA 2ALPA 4O3UA 2GP9B 4AX9H 3EAJA 3RXRA 4GUXA 4NGAH 2Z94A 2BLOA 4WVPE 4DGJA 4ZXYH 1O31A 1O3LA 4BAOB 1TBRH 3TJUA 1DX5M 2G5NA 4VGCC 4TPYA 2AGEX 2ALVA 1Y5UT 4IC6A 1TB6H 3RP2A 4XSKU 8KME2 1O2HA 3L3TA 3GICB 2BY5X 4AZ2B 3UPEA 2V6NA 1TYNA 2JETB 3F9FA 1DDJA 4XBDA 1JIRA 1C5XB 4ABFA 2ZECA 2WPIS 2FESH 1KXAA 1IQFA 2XWBI 1ESBA 2ZU3A 3GY2A 1XXFA 4X2VA 1O2RA 3UUZA 1XVOA 2GDDA 3M35A 3SOSA 2FIRH 1ESTA 1O2TA 2W3IA 5BRRE 1FQ3A 3UQVA 2F9VA 4DIIH 1TNGA 3UFAA 3NCLA 3NPSA 2JETC 2QY0B 2VIDA 3Q76A 2AIPA 4B74A 1V2OT 3F1SB 3TK5A 1UTNA 1FPCH 1MTVA 1RJXB 1A61H 1GBKA 1G3DA 5J4QA 1AU8A 1MZDA 2P3FH 1PPZA 3HK6B 1C5TA 4INLA 1QBNA 2HNTE 3ELAH 4ABAA 2A5IA 2FOMB 1SSXA 1CQQA 1M9UA 3LJOA 1HNEE 1BHXF 2ZFSA 1QR3E 2GDEH 1MKXK 2BLQA 1ELEE 1ZTJA 2CGAA 4YZUA 4SGAE 1TGSZ 2FDAA 1UCYK 2NU1E 2QF0A 1SB1H 2O8TA 1XVMA 1CT2E 2BD4A 3ZV8A 1NRRH 1QGFA 1CU1A 1FY8E 4WF8A 2Q6FA 4O03A 3S7KB 3GY3A 3RXAA 5CMXH 1TNHA 2AYWA 2FX4A 1H9HE 3PMAB 5DP6A 1MZAA 5PTPA 1DWBH 3AAVA 4Y11E 1TPOA 5C1UA 1TX6A 5A8YA 1T8OA 2TRMA 1YC0A 2BXUH 3A7YA 1NRQH 4HZHA 4ZAEA 2WUBA 4B2AA 2UWPA 3SJ9A 4ABGA 3GCOA 2GMTB 3ATLA 1DWCH 3GDUA 1C1WH 4Q7YA 3SHAH 2WPLS 4FXGH 2FO9A 3D49H 4GHQA 1ETRH 3BTME 3E91A 1FI8A 1SBWA 3A7VA 4JK5A 1EB1H 1EZQA 4R0IA 1MQ5A 1Z8RA 2GZ7A 1VCQA 2F9NA 1O33A 3ESTA 2AEIH 1TBZH 1WV7H 4FUGA 5F8XA 3EGKH 2ANMH 3VB5A 1IQKA 1DFPA 2BY8X 3P8GA 4NIWA 1GJ8B 1Y8TA 4NA7A 5A0CA 4JYTA 2GGVB 4F49A 5AFZH 2GMTC 5LH8A 1JRSA 2QF3A 1V2LT 3GY4A 1P2IA 1GBDA 4NZLA 3ZZ5A 1A5IA 3A8AA 4NSVA 3LGYA 2VWMA 1LHEH 1N8OC 1P11E 1O2GH 1L1GA 1P05A 3M5LA 1EP5A 7KMEH 1O5FH 3A8CA 1ETTH 4U32A 4THNH 3DUXH 1F5KU 1CO7E 2ZFTA 3BSQA 1DVAH 1HB0B 1HJ9A 2P93A 2KAIA 2PKAA 4IN2A 1CHOG 1DUEA 1TRNA 1GVKB 1A4WH 2BQ7B 1GI0A 1RD3B 3RUOA 2Y6TA 3SNEA 1O2UA 4A6LA 4MG3A 2QXJA 5A8XA 2OQ5A 2RG3A 3SV9A 1K9OE 2EI6A 2WYGA 3JZ2B 3FANA 4GAWA 3K6YA 1C1PA 4X6NA 4ABJA 2B5TB 4MNVA 2FLRH 3TH3H 2ZPSA 2A2XH 4UEHH 2QYIA 4XFQA 3TITA 3A88A 4UFGH 2YNAA 1ZJKA 2K1QA 6CHAB 4WMFA 3A7XA 4LK4A 2H5DA 1G2MA 1C1RA 5B6OA 4NCYA 1XUHA 4Y79A 4DT7B 1ZSKA 1C5NH 3EYDA 2VGCB 3RXSA 3ZVGA 6LPRA 1QBOA 4BTTB 4X8TH 3Q3KA 3K65B 2R2MB 3RXFA 3Q77A 4Y8ZA 2QV1A 1VCWA 1TAWA 1NRSH 4A92A 4Z0KA 2R2WU 2TGAA 2ZDVH 3HATH 2HNTC 3BEIB 4MNWA 2BVRH 1SQAA 3VPKA 2A4OA 2CF9H 5JBTA 1ARCA 2EEKA 2ZWLH 1TWXB 2ZKSA 4U01A 1WU1A 3PB1E 1C2HA 2CMYA 2VGCC 3LC3A 1AFQB 1CVWH 1P9UA 3FP7E 5EQRA 5FX6A 5HGGA 3QGNB 3W95A 1UHBA 1C1MA 4MNXA 1MBMA 5EGMA 3OSYA 4HFPB 2CJIA 1WQSA 3AVZA 5L2ZH 4BAKB 1MKWH 1GI6A 1JMOH 3KQBA 2PGBB 3QZRA 1FONA 5L2YH 3GCTF 1ANEA 2QAAA 1GMCF 1Q3XA 2AGIX 1BBRK 3A86A 5C5OA 3TNTA 1P12E 2G00A 1DUAA 1O3MA 1AFQC 2V3OH 4FUCA 2LPRA 1KYNA 1Y3WA 4FUBA 1UTJA 1BMNH 2BLWA 4Y10E 4RKOB 3STJA 5ABWA 1C2DA 1PPCE 5H4IB 1FN8A 1IOEA 1FMGA 2C8ZB 1EJNA 5DPAA 1C5MD 1C5SA 1DE7H 3FP8E 1J16A 4YOJA 3QN7A 5HYOA 1B5GH 4AFSA 2FODA 3ZVDA 3U1IB 3IG6B 1BRBE 1O39A 3GYLB 3F9GA 4NSYA 1S0RA 4IMQA 4FUDA 3LGVA 4D7GA 4WWYA 2O9QA 1H8IH 2BDIA 2Y5GA 1S81A 5EQSA 1UVTH 1C2JA 1E37B 5JBAS 3B8JA 1ZLRA 1P8VC 3HKJB 3RMMH 1P2NA 4FUIA 7GCHF 1YPLH 1ANDA 2J9NA 3KQCA 2BDGA 2XC4A 1C2KA 3SGQE 1UHBB 3KIDU 1LCYA 3SNCA 1BTYA 4FUEA 1KY9A 1S0QA 3LH1A 4YTAA 1GVLA 3MI4A 1GI5A 4H42U 1SG8B 3ZZBA 1ZPBA 3TVJB 5C3NA 1TLDA 2F9UA 1TRYA 1T4VH 4R8TB 2H6MA 5FAHA 1GBMA 3P95A 1K1IA 2ANYA 1BT7A 3SU4A 3KEEA 3LGIA 1UMAH 1C2LA 5A0AE 2H9TH 1TABE 1P0SH 1SLXB 4FUFA 1BMAA 1GL0E 3ZVEA 2PLXA 3MFJA 5E0JA 4I7YH 2ZCKP 2OTVA 1QA7A 2AMDA 4YM9A 3FP6E 2PKSB 3FVFB 1O2MA 1GBFA 3E1XB 1OOKB 1TMBH 1L4DA 4ISHH 2STAE 4GCHF 1GBEA 2R3YA 2RA0A 1C5QA 3GY7A 1KDQA 1P2OA 5LPFA 2PHBA 4ABHA 2EA3A 1O3KA 1SMFE 1XM1A 4FU7A 3SI4H 3SV8A 2IOTA 4TY7A 4GVUA 2XWAA 1XUGA 4IMZA 1W3CA 3R0FA 1E34B 4GHTA 1DXWA 1SGIB 3TNSA 3E6PH 2D26C 1DANH 1EAXA 2UUJB 3ATKA 3M5MA 3PM3A 2W7UA 1HGTH 1HAGE 3Q3YA 1GJ9B 2PKSC 3A81A 1DICA 1BTZA 3F9EA 1AB9B 1IHSH 1O2LA 2A1DB 3ZZ3A 2GVFA 4NFFA 1MU8B 1OWKA 4X6MA 3LH3A 1DITH 3ATIA 1EZXC 2VIWA 1B0EA 4I32A 1F0RA 3GY5A 5FPTA 2ZGCA 3BTQE 1IQLA 2GTBA 5F8TA 2ZHQH 2UUFB 4AGKA 1V2VT 2Y7ZA 1ZRBA 1Y3YA 1D6WA 3VEQB 2HNTF 1AKSB 4MVNA 3A85A 1GI2A 1K1MA 1TBQH 1HIAB 4OGYA 2ESTE 1UVOA 3HKIB 4XE4A 1HAXB 1AB9C 1C2EA 3QO6A 1GHBF 1AQ7A 5GIBA 3OY5U 4LXBH 3OX7U 1O5EH 3DFLA 2OC7A 1TONA 1ZPCA 1EZUC 2JH5D 1BTPA 1NN6A 1P09A 1ZOMA 2WV4A 2A0QB 2FOEA 1ZMNA 2PSXA 4CH8B 1EJAA 1KDQB 4Z6AH 1AI8H 4KKDA 2VWOA 2ZA5A 4ZROA 1PQ5A 4K1SA 2NU4E 1VITH 3OYPA 4ZHAA 2HPPH 4ABEA 3NZIA 1YPJH 4GLYA 1EX3A 4MQAA 2C8XB 4Q80A 1RTLA 2F9BH 1E35B 5JB9S
chains in the Genus database with same CATH superfamily
2BHGA 3KQDA 4LZ1H 4PROA 4RKJB 3QGJA 6GCHF 2ZHFH 3RXOA 3OE7D 1VCPA 5EQQA 4A1XA 2WV5A 4K69A 1AE8H 2B0FA 3A7TA 3KF2A 1C5OH 2FTLE 3UNSA 2FM2A 4XDEA 2ZO3H 1SLWB 5E2OA 1G3EA 5EIYA 3STIA 3PWBA 3A8BA 2JH0D 1PJPA 1J9CH 5B6LA 1YKTA 2ZF0H 2YNBA 1OX1A 1H9IE 5EG4A 3EQ0H 1KXCA 4NIVA 5IDKA 2VNTA 2PTCE 3Q3XA 1EAIA 1AFEH 4Y71A 3PV2A 4MPUA 1BA8B 2H5CA 4O3TA 1C5ZB 1VKYA 1P03A 2Z3DA 4Y8XA 2VWNA 1L0ZA 2WPJS 5AHGH 3UY9A 4X1RU 3W1EA 1VGCB 1A5GH 1KLTA 1OYTH 2A32A 2BVSH 4DVAU 1OHHD 3ATMA 1K1LA 1OPHB 3UWIA 4ISNA 1C4V2 2J2UA 1P06A 3SUEA 2BD9A 2A31A 2PGQB 1O2ZA 5FBIA 1AVGH 1MBQA 2A7JA 1T7CA 2BQ6B 2TGPZ 4YOIA 2RDLA 1A0LA 2A45B 2A4QA 1TMTH 2BM2A 1RFNA 1T32A 2OC8A 3I77A 1VGCC 1SFIA 1VJAU 5LPRA 1O36A 3ZZAA 2F3CE 1FIZA 1VZQH 2J38A 5EU8A 1K1NA 2ZTZA 1LDTT 3TH4H 1P3EA 1UK4A 4ZKNU 1HYLA 2I6SA 3T62A 4O97A 4INHA 1EP6A 3PLPA 1GHWH 4ABDA 1BRCE 1GCTB 5DP7A 1Z6EA 1O3NA 5DGJA 1LHGH 1O3BA 1O3PB 2Z6BD 1ZPZA 4I8KA 4ABBA 4DCDA 1XUJA 5ETXA 5EOKA 2BD8A 4Y7AA 2Z7FE 1QBVH 2FZZA 1GDNA 4AOQA 1DM4B 3DHKH 1DPOA 1KXBA 1YLDA 1WDIA 3ENSB 3BN9A 4NIXA 1O3AA 1C1QA 1NESE 2ZQ1A 1GCTC 1UO6A 1EB2A 4MPXA 2J34A 1MTSA 3RXIA 5FHTA 1O2PA 2ZCLP 2IJD1 4B71A 1Z8IB 2AGGX 2FOFA 3SJ8A 1GJAB 2ZDLA 4YLUA 5KECA 3K2UA 3RU4E 2FI3E 2YMSB 2J92A 1AIXH 2HRVA 1ZSJA 1P02A 2VVVA 1F7ZA 1QJ1B 1O3OA 1A0JA 1TOMH 4NA9H 1S5SA 2Z3EA 4Q2KA 3FN8A 2ZHWH 5I46H 1O38A 1OWDA 4XBCA 1S82A 1TA2A 2J97A 4TWWA 3GY6A 5C5NA 2HLDD 4FUHA 3V13A 4INKA 2ZPQA 4ZXXH 3H7TA 1K0HA 3U9AH 1GHAG 1HXEH 4ISIH 1LPGB 1DXPA 1PQ7A 4O9VA 2YMSC 1ELGA 5GCHG 4F4OC 2ZGJA 1HRTH 1O2XA 4HGCA 5KEDA 1ARBA 1ELTA 8GCHF 4KGAA 1C4Y2 2R0KA 1ZMLA 1YLCA 1E36B 1NFXA 2LNCA 2YOLA 7LPRA 1V2NT 4NWKA 5G4BA 2TIOA 1BJVA 3VGCB 1TPSA 1NS3A 2IN2A 5K7RA 2UWLA 3PTBA 4MLFB 1YGCH 3GDSA 2BVXH 3A7ZA 4AGJA 3BTHE 2G51A 2W26A 1GMHG 2XBVA 1W10U 2KR7A 3F9HA 3E0NB 5T6DA 2Q6DA 2A4GA 1A0HB 3HGPA 3LOXA 3A87A 3L6PA 1TALA 2VWLA 2XBWA 2FX6A 3EA9A 1K21H 3LGWA 2UUKB 4D9RA 5T3HA 1SQOA 3VGCC 3ZZ4A 1GBAA 3RMLH 1MMJN 2BY7X 4IS5A 2ZI2H 4X0WU 5FBEA 1XMNB 1ABJH 4YO9A 3WW7A 4H6TA 1Y5BT 1BDAA 4IC5A 1EUFA 3M3VA 1Y59T 1UK3A 1GI9B 2OLGA 1N8OB 1RS0A 1ABIH 1H1BA 2R9PA 5EW2H 4X6OA 3DSOA 4OS5A 4JZDH 3KNXA 5TCAA 4A1TA 1JBUH 1SGRE 1QY6A 1SL3A 3ZZ6A 2D1JA 1ETSH 1KMHB 2WINI 4H4FA 3P6ZB 1T8LA 2OD3B 1LHFH 5C0UA 2ZGBH 4UE7H 2BD7A 5LGOA 4KELA 1V2JT 1HLTH 1SLVB 4GPGA 4AB9A 1TGTA 3ITIA 2QXIA 2FS9A 1B0FA 2ZHEH 3B9FH 2ANKH 3FZZA 2FI5E 5C67A 5A0BA 1GMDF 2P3UB 3GYMA 1A7SA 1JRTA 2O8WA 1P2JA 3UOUA 3MO6A 1UTOA 2ZTYA 5IK2D 1FJSA 2QC2A 4B73A 4MTBA 1FX0B 4X6PA 1LVYA 1W7XH 3SNBA 3NKKA 5HIYA 1ZRKA 3U8OH 1KTSB 5CDFE 2D8WA 1HV7A 1ANCA 2W5EA 2GT7A 1UVUH 3O8CA 4CRBA 1OKXA 4A7IB 3UIRA 2GD4B 3MNXA 5TJXA 2F4LA 1MAYA 1NO9H 1O3CA 2HGTH 4MNYA 5A2MH 1DLEA 1O30A 3UAIC 1FV9A 1T8MA 3MNBA 4NA8A 4WXIA 2W6ID 2XBYA 2F83A 1X7AC 5HIZA 1F0UA 1YCPM 4KTUA 1S6FA 1QFKH 5EXMA 4JYUH 1RIWB 1GI1A 2ODPA 2P94A 2BD2A 1KIGH 3BV9B 4K1EA 4X1SU 4YXWD 3KGPA 5SGAE 1LKBA 1G3CA 1HAPH 1CHOF 1SOTA 1SGNE 1WBGB 3N7EA 3V0XA 1UK2A 2FMJA 3SNAA 1W0ZU 2VH6A 3CP7A 4Q7ZA 2CXVA 3RM0H 1AVWA 3H7OA 2NU3E 2XYAA 2THFB 3TH2H 2WZQA 1JWTA 3V7TA 2SNVA 1MQ6A 5HKKD 3TIUA 1N6XA 1V2WT 1T4UH 1V2RT 4Y8YA 1PYTD 1RIWC 1O2WA 4UFDH 5EXLA 1W7GH 1SKYE 3SZNA 3E8LA 3SUDA 2OXSA 3MNCA 2I6QA 1UTKA 3LIWA 1QRWA 2FYQA 2WPDD 5K0HA 3SU5A 4CH2B 1EAUA 2PUQH 4K5ZA 1AGJA 1A3BH 2BD3A 1BRAA 1QCPA 2VIOA 1ZHPA 3N7OA 2KAIB 2PKAB 1G3BA 1GJ4H 1HAYB 4OS7A 4B2BA 2ZFFH 1V2PT 4AFZA 3KL6A 3S7HB 1O2NA 4ZHLU 5GWZA 1WCZA 4IBLH 2BLVA 3GCTG 2ZGXH 1TNKA 4BXSA 3GS9A 4AG1A 1SI5H 2PFEA 1Z1JA 2CK3D 1FAXA 3PRDA 3LC5A 4OGXA 2Y7XA 2FS8A 3SU6A 4I8HA 3V3MA 1P9SA 1IQIA 3LKWA 2QXHA 1WTHD 1P3CA 2IPHA 1GDUA 4Z1MD 1KSNA 5CE1A 2ZDNA 2G52A 1GJ5H 2M2AA 3VFEA 4E7NA 1ZHMA 4D9QA 1P01A 1KTTB 1VR1H 1ZGVA 4X1NU 3MU5A 5FL7D 2CV3A 1FZZA 4AORA 2OBOA 3ZYDA 1P04A 2AERH 3LPRA 2ZFRH 1OYQA 1EASA 3AASA 3TJVA 3TGKE 2QF5A 1SGCA 3RC6A 2AH4X 4X1QU 3RXBA 2R0LA 3AAUA 2Z9JA 2ILNA 4I33A 3PROA 3LU9B 4B1TA 2K0QA 3UB0A 1O5AB 1WUNH 3VXFH 7GCHG 4BAMB 3UREA 1WAYB 2WSSD 1ELVA 1HJAB 1NBME 3QDZB 4U2WA 1EAWA 1CE5A 1GBLA 1EQ9A 4CRGA 4AYVB 1G2LA 1GGDB 1TGBA 1C5LH 2C8WB 2PUXB 3M5OA 1SGFA 3M61U 3LONA 2BDHA 1V2UT 1YPKH 2ZZUH 3SGAE 4WMEA 3PLBA 2ZQ2A 5DG6A 1T8NA 3UR6A 3RC4A 4NZQA 1HJAC 4KTCA 3BTKE 3MWIU 1O32A 1S85A 4Q7XA 1GGDC 4XOJA 3M7QA 3BTFE 1FPHH 3RLWH 8ESTE 3C1KA 3T25A 1H4WA 4Y0ZE 5DP4A 2FI4E 1YCPH 3AW0A 2KCAA 3TPIZ 1QURH 2RA3A 3F2FA 3PWCA 4B2CA 1SHHB 2JKHA 4I31A 4E06H 1O5CB 1ELFA 3SJKA 3E16B 4JCNA 3SZEA 3PTNA 4DT4A 5FXLA 4D7FA 4HI3A 1K1JA 3RLYH 2P8OB 2FOHA 1HAVA 1BJUA 2P3TB 1D4PB 1KXEA 2GCHG 3M3TA 1FDPA 3LGTA 2BZ6H 1LPZB 2GX4A 2PWXA 5FCKA 1P2MA 3PMBB 2J5UA 4MPWA 4BAHB 4BNRA 2HVXA 4J2YB 1C4U2 2G5VA 3MH6A 1OP2A 2JIZD 5BPEA 5I25A 1GHYH 2A5AA 4ZKRU 2VB0A 1BRUP 3H09A 3GCNA 1F2SE 1EKBB 5JB8S 3TJOA 1EOLA 3EE7A 1NRNH 1NY22 1CGHA 2QCYA 1C5RA 2P8OC 2NU2E 1C5YB 1S83A 3FO8D 1IQMA 4QT8C 3IITA 3GDVA 1GHBG 1UW7A 5TCCA 1ANBA 5EXNA 3WWBA 2SGPE 2SGDE 3BTDE 3SV2H 3OAAD 4B6EA 3ZV9A 1ZHRA 1SGPE 3PMHB 3RXGA 2FOCA 4K1TA 1NC6A 1TNJA 1TPPA 2XCFA 1F0TA 1FY1A 3SHCH 1YYY1 1G9IE 1GJBB 4OS2A 4WJG2 7ESTE 1FAKH 1HFDA 4K3JA 3B23B 1LQDB 1PPHE 3VXEH 1YPGH 2VIQA 1O35A 5FCRA 1KLJH 2J4IA 1D9IA 2GZ8A 2WPHS 1GI8B 3FKSD 3S9AA 1RXPA 4TYDA 1ORFA 2BDBA 3EE0B 1LVOA 1D3QB 3T29A 3QX5H 2OUAA 3H5CB 2WUCA 1O2YA 3IWMA 1GG6B 1TNIA 5C20A 2ZU2A 1QB9A 2QGRA 5DKMA 1OWEA 2P95A 1ELCA 2C4FH 1Z8JB 1OSSA 1HAZB 1S6LA 1A46H 2P16A 1VITG 1A5HA 1NTPA 1V3XA 4FVDA 3ZZ9A 5JYIA 3CENA 3BIUH 1P2KA 3T28A 1L1NA 2GKVE 1DS2E 1TFXA 1XKAC 1BB0B 1AY6H 2BQWB 3VB7A 1MH0A 3SORA 4ASHA 2A2QH 5E0GA 2AFQB 4CRDA 1GG6C 4U30A 3SU0A 1GHVH 3U8RH 3ZZDA 1NZQH 4GSOA 2J98B 1C1OA 3MTYA 5C1YA 3TK9A 3S9BA 1Z7KA 4M7GA 1QJ7B 1G37A 1ZJDA 3MU8A 3SW2B 2ZFPH 2W7SA 2HPQH 3MH7A 1FY5A 4J1YA 3UNQA 3BG8A 1KXFA 3DA9B 2V3HH 1BMMH 1J15A 1MAXA 1V2QT 1ELDE 2C8YB 3SUFA 3ZZ8A 1TQ0B 2OC0A 3NK8A 4Y0YE 1P57B 1V2TT 3VB3A 2J95A 1HAHH 1MD7A 1AWHB 3ZYEA 2D2DA 1C5WB 5DP5A 1FLEE 4AN7A 3M3SA 4YT7H 3D65E 5HMAA 1B7XB 1CSOE 3BG4B 1PQ8A 4K2YA 3A89A 1GBJA 2BMGB 3SO3A 1PPBH 1T31A 1O34A 1GVZA 1GBCA 2GZ9A 1QL8A 2ODQA 2ANWA 1CGIE 1SGDE 1THPB 3SU3A 4UONA 1NRPH 4OM9A 3FAOA 5EPYA 2BDCA 4A1VA 1THRH 4AFQA 5F6MA 2XRCA 3RDZA 2OC1A 4JYVH 2O8MA 3RXPA 1EATA 1LPKB 2OCVB 3BTTE 1G32B 2OP9A 1AUTC 3SQEE 3BG4C 2WYJA 1UTPA 3RXKA 2ZHDA 2GV6A 1O0DH 3ZZCA 4ZHMU 4B76A 3CS7A 3RXCA 1FUJA 2FTMA 4WXVA 1L2EA 3MU0A 4JK6A 2JH6D 1S6HA 1KXDA 1OP8A 3JZ1B 1ACBE 1O3FA 1J14A 5A09A 2G4UA 4RN6A 1W11U 4IW4E 3O8DA 3KQEA 1QL9A 2VH0A 1SGFG 2Y82A 4NIYA 1MCTA 1NROH 2FXRA 1CA8B 2GCTB 2FLBH 4ACBA 1W0YH 1DLKB 1MTWA 3MO3A 3SNDA 2Y80A 4CREA 1F0SA 1UVSH 5T6FA 5JBBS 5HXFA 1MKXH 1ZSLA 3QTOH 4X8SH 1UCYH 1WQVH 1MUEB 1BTWA 3NXPA 1J8AA 1IQGA 1BOQA 4JZFH 3SU1A 1Z6JH 5CHBA 2CHAB 3HK3B 3M5NA 5EODA 8LPRA 2CF8H 3ODDA 5DK1A 1O2IA 4UFEH 3SI3H 3RM2H 3MNSA 1GJ6A 1SLUB 2GCTC 2SNWA 1BZXE 3OU0A 3U8TH 1LTOA 1AN1E 1C5UA 1W0JD 2B7DH 3QUMP 3E90B 1C1NA 1JOUB 3LT3A 5JBCS 1GBHA 8GCHG 1HXFH 3FZDA 2BY9X 1C1UH 2CHAC 2HOBA 4K8BA 4Q4LA 2C93B 1QB6A 3ATWA 5A8ZA 2EQNA 2BX4A 1TIOA 3U1JB 1JXPA 2TBSA 2HVYB 5DP8A 2F9OA 1THSH 2J94A 1E1QD 2HALA 3F6UH 2JDID 2OINA 1BTHH 3E0PB 3LJJA 4CBNA 1GI7B 1WOFA 2C90B 3K9XB 1E1RD 1HJ8A 4X2YA 3I78A 1GCDA 1GJ7B 1IAUA 2VIVA 3C27B 4ESTE 4YLQH 1BTUA 5JDUB 2ODYB 1PPGE 1ELBA 4NFEA 2SFAA 1YWUA 3P8OA 1EOJA 3SU2A 3P70B 2B8OH 1PPEE 1K1PA 1ZZZA 4D8NA 1GHAF 4K60A 1EPTA 2IPQX 3UWJH 4HTCH 1LVMA 1L1JA 2NU0E 1SPJA 5FPSA 3T26A 3BEFB 1GJCB 5GCHF 2VVCA 1ZGIA 3EDXB 1BITA 1SGTA 4DW2U 1Y3VA 1C2IA 3D23A 3VB6A 5DP9A 1CA0B 4ISOA 2ZDMA 4E7RG 3MQKC 4DURA 1OWHA 2A7CA 2Y5HA 1J17T 2GT8A 5GJ4B 1MTUA 2ZIQH 3KHVA 1GBBA 1GJDB 3F3BA 1YPMH 3SQHE 4AB8A 4AYYB 2NWNA 2EI7A 1C2FA 1O2VA 3PO1B 4I8JA 1JIMA 1GMHF 1WYKA 1OXGA 1UTLM 4CRFA 5DO4H 1C5PA 1F92A 3UNRA 1CA0C 3RXTA 1QIXB 1ZMJA 2ULLA 1E38B 3DFJA 4ZKOU 2Y81A 3OFND 2XBXA 2F9PA 1PQAA 3D62A 1OWIA 1O5DH 4IGDA 4CRAA 1TRMA 3KCGH 1GMDG 1XUKA 1AZZA 3LDXH 3RU4T 4K8YA 2WPMS 1YY3A 1FXYA 3TGJE 5FPYA 1A3EH 4JZIA 1RRKA 5HM2A 2A7HA 1N1LA 1XUFA 4FETA 2O8UA 1O5BB 2H9EH 2B9LA 2UWOA 1TNLA 3RMOH 3PO1C 1YLNA 3URCA 2Y5FA 1OWJA 4ABIA 2ZDAH 1MTNB 1L4ZA 1LMWB 4BXWA 1HAOH 3RXLA 3SGBE 2PP6A 1DY9A 1WSSH 3SBKA 1F5LA 1DY8A 5J4SA 1EPTB 1AE5A 1SR5C 4A5TS 1C9PA 4P02A 1QQUA 1OS8A 5CHAB 1C1VH 3RXJA 5C2ZA 2C3SA 1SOZA 1BQYA 2XCNA 1HDTH 2Z9GA 1LHDH 1UTMA 2Z9LA 5F03A 3F2GA 4Q63A 5DSFA 5GNDA 3TU7H 3BTGE 3RXHA 3A82A 1TGNA 1SGQE 1AZ8A 2EI8A 3T2NA 1MTNC 3ZVBA 3VB4A 3MOCA 4CHAB 4X8UH 5ESBA 1G36A 1E0FD 1C2GA 2R3UA 2L6OA 5C1XA 1EPTC 3A7WA 1K22H 2V35A 1N6YA 1O2SA 4UDWH 1FNIA 3RU4D 2EC9H 3DSGA 3MHWU 5CHAC 1IQHA 2QA9E 4H6SB 1YPHE 1GDQA 1Y5AT 2XW9A 1Z8GA 1CBWB 2PR3A 2ZEBA 3CS0A 1LHCH 2BY6X 2JJ2D 3PMJA 2WHXA 3UOPA 1YBWA 1LQEA 3MO9A 3UQOA 2H1UA 1FY4A 1C5VA 4RSPA 3ZVCA 4OS6A 2STBE 3U98H 3PYHA 4CHAC 2TGTA 4YOGA 4B6FA 3GCHB 3SV7A 3A80A 2HWLB 1U6QA 1QA0A 3BF6H 1KLIH 4JZEH 3V12A 2ZCHP 1FY3A 1BBRH 5L6NH 5DJ7A 3AW1A 1IHTH 3BEUA 3PLKA 1CBWC 2M5TA 3O8BA 1EZSC 3T27A 1ESAA 3I29A 2ZFQH 1CHGA 1C1SA 3GY8A 2GV7A 1BCUH 5GPIB 1WXRA 1QQ4A 2XNDD 4BOHA 4RT1A 1QHRB 3GCHC 2Q6GA 1Y3UA 5E2PA 4LZ4B 4UFFH 3ZVAA 1O5GH 1GMCG 1FIWA 2V3MA 3E3TA 3W94A 1O3GA 1HBTH 2SGFE 6CHAC 1TE0A 1W13U 1W12U 1O2KA 1O3JA 2A5KA 3QZQA 1YM0A 1O3IA 3BTEE 1K2I1 2ZU5A 1H8DH 2FP7B 1PYTC 4UD9H 2QN5T 1HCGA 3SJOA 3DT0H 1INCA 1NU9A 2AHME 2SGEE 9LPRA 2P59A 1UCYE 4YESB 3RXUA 1QRXA 1QNJA 1TOCB 2RDEA 4TPIZ 1O3HA 1D3DB 5F8ZA 1V2ST 2LELA 1V2KT 1P2QA 1DWDH 1O37A 2G55A 5F53A 1SGYE 3P8NA 1FN6A 1W2KH 3RMNH 3KYGA 1ELAA 2DE8A 1ID5H 3VG8A 2VJ1A 4E05H 1P10A 1W14U 2F91A 2VVUA 1NFYA 4FU8A 4I8GA 3GOVB 2ZNKH 1QB1A 2ZTXA 4DY7B 1AHTH 3QLPH 1H9LB 2FEQH 2OQUA 2JJ1D 1SVPA 2Z9KA 5E0HA 3S0NA 2AMQA 1C9TA 1O3DA 3MH5A 2BB4A 3ODFA 3QWCH 2A4RA 3P92A 3OEHD 1NT1A 4WY3A 2ZC9H 2HLCA 2BZAA 3TJNA 2VINA 2DE9A 1COWD 1MKWK 2G81E 3GISB 1SQTA 2BX3A 3G01A 1XKBC 1NM6A 3UR9A 1YPEH 2IJOB 2XTTB 5FX5A 3UTUH 1GPZA 2FOGA 2W3KA 5AFYH 6ESTA 3MU4A 2H2ZA 2BDAA 2FWWA 2BD5A 4AG2A 2ZDKA 4BAQB 1AMHA 1D6RA 3SN8A 3FFGA 1W8BH 5LPEA 2ZG0H 1PFXC 3ZZ7A 1Z71A 2ZP0H 1MU6B 3M7TA 3NWUA 5EJ1A 3HGNA 4ZH8A 4WH8A 3S9CA 1UTQA 4XD7D 4BTUB 3K6ZA 3U69H 4GCHG 1DOJA 4ZCNA 3ZVFA 3P17H 3TK6A 2PTNA 3KQ5A 1QL7A 1AVXA 1DT2A 2PW8H 2V7QD 1LVBA 2W6JD 1AKSA 4Y6DA 1Q2WA 2BDYA 2ZGHA 1BTXA 1HIAA 4FU9A 4MPVA 1XX9A 2QIQA 4DG4A 1S84A 2RCEA 3Q00A 2ZU4A 1DSUA 5C17A 2XC5A 1EJMA 2FPZA 4B75A 2Q1JA 1D3TB 1Z1IA 1TPAE 1DWEH 1YPHC 1A2CH 4JZ1A 2PSYA 2FOAA 1GBIA 3QK1A 4SGBE 3TGIE 1BMLA 2BTCE 4CR5A 4Y76A 1HPGA 4DOQA 3A8DA 1HAIH 1TA6A 2G8TA 2Z9IA 2VIPA 1K28D 3SV6A 1V6DA 1RGQA 3N7DA 2FOBA 1Y3XA 5ESTE 3WY8A 1E79D 2AMPA 2BOHB 5JPMH 1HUTH 3RC5A 1EXFA 3A84A 2GCHF 2QE7D 1ZYOA 4ZMAH 5HM9A 3F0OA 3M7UA 1IQNA 9ESTA 4FUJA 1IQJA 1XXDA 1TMUH 5AF9H 3HPTB 3LGUA 1SC8U 1YCPK 1LKAA 2SGQE 1BHXB 3NUMA 2BXTH 4ISLA 3RXQA 3S69A 4OS4A 1QTFA 2H9HA 5EW1H 1Q31A 3M37A 5GXPA 4TY6A 1BIOA 5T6GA 3RXDA 2V0BA 3OTJE 2PV9B 2BYAX 2XC0A 1XUIA 3SUGA 1RTKA 1UVPA 1YP9A 1G30B 2O8LA 3MU1A 3MYWA 6GCHG 4ZKSU 1HAVB 4FVBA 3MH4A 1O2JA 4MDSA 1IQEA 1O2QA 2AS9A 1ZR0A 3F68H 1QRZA 3SYJA 2Z3CA 1OP0A 4ZUHA 4Y7BA 1QJ6B 3BTWE 2OBQA 1NFWA 3EA7A 3EA8A 3WWFA 2TPIZ 2ASUB 2WV9A 1PPFE 4F48B 5EPNA 1BBRE 4I8LA 1GI4A 4NG9H 2RFKC 1NBMD 1TGCA 1O2OA 1SFQB 1MD8A 2ZU1A 4CRCA 1AD8H 2GJGA 4DJZB 3KN2A 1SHYA 4BANB 4YT6H 2F43B 3RXVA 1C2MA 1ZTKA 1NU7B 4NWLA 4X8VH 4FOUC 2CN0H 4XBBA 5DN6D 3OY6U 4OS1A 2BOKA 3QTVH 1YF4A 4X2XA 3A83A 1RTFB 4KTSA 5DP3A 4DIHH 1DSTA 3T5FH 1CT0E 3RXMA 3PV5A 5IYTA 2ZPRA 4D76A 4KP0A 1ZTLA 1UJ1A 1NPMA 1GWAA 4AC9A 1VITF 3SJIA 1TX7A 2QXGA 3URDA 1K1OA 1BMFD 2UUYA 4WMDA 4X2WA 1VJ9U 3BIVH 2OK5A 3RXEA 1CT4E 2FYRA 1F5RA 1GL1A 1TQ7B 3P8FA 3O8RA 2TGDA 4LOYH 1O3EA 2AIQA 3M36A 1C1TA 4CR9A 1CGJE 3MMGA 5E8EH 1V2MT 1GBTA 4TWYA 5L30H 2G4TA 1NFUA 2SGAA 1WTGH 1GHZA 1AO5A 1SGEE 4X1PU 3DD2H 1TX8A 3L33A 1D3PB 4WH6A 1BUIA 4AFUA 3R3GB 2DUCA 1AUJA 1GI3A 2WPKS 1AWFH 3AK5A 3TLOA 4BTIB 5GDSH 2XXLA 4VGCB 2KFWA 2XNIA 1MCVA 3PV4A 4CBOA 1LO6A 5EJLA 2VU8E 1GHXH 5AVDA 4IN1A 4JMYA 1A1RA 2ALPA 4O3UA 2GP9B 4AX9H 3EAJA 3RXRA 4GUXA 4NGAH 2Z94A 2BLOA 4F55A 4WVPE 4DGJA 4ZXYH 1O31A 1O3LA 4BAOB 1TBRH 3TJUA 1DX5M 2G5NA 4VGCC 4TPYA 2AGEX 2ALVA 1Y5UT 4IC6A 1TB6H 3RP2A 4XSKU 8KME2 1O2HA 3L3TA 3GICB 2BY5X 2KZ4A 4AZ2B 3UPEA 2V6NA 1TYNA 2JETB 3NRLA 3F9FA 1DDJA 5C0TA 4XBDA 1JIRA 1C5XB 4ABFA 2QF4A 2LP6A 1MABB 2ZECA 2WPIS 2FESH 1KXAA 1IQFA 2XWBI 1ESBA 2ZU3A 3GY2A 1XXFA 3U28C 4X2VA 1O2RA 3UUZA 1XVOA 2GDDA 3M35A 3SOSA 2YMSD 2FIRH 1ESTA 1O2TA 2W3IA 5BRRE 1FQ3A 3UQVA 2F9VA 4DIIH 1TNGA 2KX4A 3UFAA 3NCLA 3NPSA 2JETC 2QY0B 2VIDA 3Q76A 2AIPA 4B74A 1V2OT 3F1SB 3TK5A 1UTNA 1FPCH 1MTVA 1RJXB 1A61H 1GBKA 1G3DA 5J4QA 1AU8A 1MZDA 2P3FH 3F2HA 4RT0A 1PPZA 3HK6B 1C5TA 4INLA 1QBNA 2HNTE 3ELAH 4ABAA 2A5IA 2FOMB 1SSXA 1CQQA 1M9UA 3LJOA 1HNEE 1BHXF 2ZFSA 1QR3E 2GDEH 1MKXK 2BLQA 1ELEE 1ZTJA 2CGAA 4YZUA 4SGAE 1TGSZ 2FDAA 1UCYK 2NU1E 2QF0A 1SB1H 2O8TA 1XVMA 1CT2E 2BD4A 3ZV8A 1NRRH 1QGFA 1CU1A 1FY8E 4WF8A 2Q6FA 4O03A 3S7KB 3GY3A 3RXAA 5CMXH 1TNHA 2AYWA 2FX4A 1H9HE 3PMAB 5DP6A 1MZAA 5PTPA 1DWBH 2EY4C 3AAVA 4Y11E 1TPOA 5C1UA 1TX6A 5A8YA 1T8OA 2TRMA 1YC0A 2BXUH 3A7YA 1NRQH 4HZHA 4ZAEA 2WUBA 5C94A 4B2AA 2UWPA 3SJ9A 4ABGA 3GCOA 2GMTB 3ATLA 1DWCH 3GDUA 1C1WH 4Q7YA 3SHAH 2WPLS 4FXGH 2FO9A 3D49H 4GHQA 1ETRH 3BTME 3E91A 1FI8A 1SBWA 3A7VA 4JK5A 1EB1H 1EZQA 4R0IA 1MQ5A 3DSPA 1Z8RA 2GZ7A 1VCQA 2F9NA 1O33A 3ESTA 2AEIH 1TBZH 1WV7H 4FUGA 4ASUD 5F8XA 3EGKH 3PRBA 2ANMH 3VB5A 1IQKA 1DFPA 2BY8X 3P8GA 4NIWA 1GJ8B 1Y8TA 4NA7A 5A0CA 4JYTA 2GGVB 4F49A 5AFZH 2GMTC 5LH8A 1JRSA 2QF3A 1V2LT 3GY4A 1H8HD 1P2IA 2KCOA 1GBDA 4NZLA 3ZZ5A 1A5IA 3A8AA 4NSVA 3LGYA 1QZ8A 2VWMA 1LHEH 1N8OC 1P11E 1O2GH 1L1GA 1P05A 1EFRD 3M5LA 1EP5A 7KMEH 1O5FH 3A8CA 1ETTH 4M9FA 4U32A 4THNH 3DUXH 1F5KU 1CO7E 4HG6A 2ZFTA 3BSQA 1DVAH 1HB0B 1HJ9A 2P93A 2KAIA 2PKAA 4IN2A 1CHOG 1DUEA 1TRNA 1GVKB 1A4WH 2BQ7B 1GI0A 1RD3B 3RUOA 2Y6TA 4P00A 3SNEA 1O2UA 4A6LA 4MG3A 2QXJA 5A8XA 2OQ5A 2RG3A 3SV9A 1K9OE 2EI6A 3OTPA 2WYGA 3JZ2B 3FANA 4GAWA 3K6YA 1C1PA 4X6NA 4ABJA 2B5TB 4MNVA 2FLRH 3TH3H 2ZPSA 2A2XH 4UEHH 2QYIA 4XFQA 3TITA 3A88A 4UFGH 2YNAA 1ZJKA 2K1QA 6CHAB 4WMFA 3A7XA 4LK4A 2H5DA 1G2MA 1C1RA 5B6OA 4NCYA 1XUHA 4Y79A 4DT7B 1ZSKA 1C5NH 3EYDA 2VGCB 3RXSA 3ZVGA 2K8IA 6LPRA 1QBOA 4BTTB 4X8TH 3Q3KA 3K65B 2R2MB 3RXFA 3Q77A 4Y8ZA 2QV1A 1VCWA 5T1VA 1TAWA 1NRSH 4A92A 4Z0KA 2R2WU 2TGAA 2ZDVH 2XOKD 3HATH 2HNTC 3BEIB 4MNWA 2BVRH 1SQAA 3VPKA 2A4OA 2CF9H 5JBTA 1ARCA 2EEKA 2ZWLH 1TWXB 2ZKSA 4U01A 1WU1A 3PB1E 1C2HA 2CMYA 2VGCC 3LC3A 1AFQB 1CVWH 1P9UA 3FP7E 5EQRA 5FX6A 5HGGA 3QGNB 3W95A 1UHBA 1C1MA 4MNXA 1MBMA 5EGMA 3OSYA 4HFPB 2CJIA 1WQSA 3AVZA 5L2ZH 4BAKB 1MKWH 1GI6A 3N99A 1JMOH 3KQBA 2PGBB 3QZRA 1FONA 5L2YH 3GCTF 1ANEA 2QAAA 1GMCF 1Q3XA 2AGIX 1BBRK 3A86A 5C5OA 3TNTA 1P12E 2G00A 1DUAA 1O3MA 5EJZA 1AFQC 3OEED 2V3OH 4FUCA 2LPRA 1KYNA 1Y3WA 4FUBA 1UTJA 1BMNH 2BLWA 4Y10E 4RKOB 3STJA 5ABWA 1C2DA 2VBCA 1PPCE 5H4IB 1FN8A 1IOEA 1FMGA 2C8ZB 1EJNA 5DPAA 1C5MD 1C5SA 1DE7H 3FP8E 1J16A 4YOJA 1SQRA 3QN7A 5HYOA 1B5GH 4AFSA 2FODA 3ZVDA 3U1IB 3IG6B 1BRBE 4ACAA 1O39A 3GYLB 3F9GA 4NSYA 1S0RA 4IMQA 4FUDA 3LGVA 4D7GA 4WWYA 2O9QA 1H8IH 2BDIA 2Y5GA 1S81A 5EQSA 1UVTH 1C2JA 1E37B 5JBAS 3B8JA 1ZLRA 1P8VC 3HKJB 3RMMH 1P2NA 4FUIA 1W0KD 1YPLH 7GCHF 1ANDA 2J9NA 3KQCA 2BDGA 2XC4A 1C2KA 3SGQE 1UHBB 3KIDU 1LCYA 3SNCA 1BTYA 4FUEA 1KY9A 1S0QA 3LH1A 2KM0A 1H8ED 4YTAA 1GVLA 3MI4A 1GI5A 4H42U 1SG8B 3ZZBA 1ZPBA 3TVJB 5C3NA 1TLDA 2F9UA 1TRYA 1T4VH 4R8TB 2H6MA 5FAHA 1GBMA 3P95A 1K1IA 2ANYA 4TT3D 1BT7A 3SU4A 3KEEA 3LGIA 1UMAH 1C2LA 5A0AE 4XRNA 2H9TH 1TABE 1P0SH 1SLXB 4RI0A 4FUFA 2KCPA 1BMAA 1GL0E 3ZVEA 2PLXA 3DCLA 3MFJA 5E0JA 3ZIAD 4I7YH 2ZCKP 2OTVA 1QA7A 4TSFD 2AMDA 4YM9A 3FP6E 2PKSB 3FVFB 1O2MA 1GBFA 3E1XB 1OOKB 1TMBH 1L4DA 4ISHH 2STAE 4GCHF 1GBEA 2R3YA 2RA0A 1C5QA 5KGOA 3GY7A 1KDQA 1P2OA 5LPFA 2PHBA 4ABHA 2EA3A 1O3KA 1SMFE 1XM1A 4FU7A 3SI4H 3SV8A 2IOTA 3KYFA 4TY7A 4GVUA 2XWAA 2KCYA 1XUGA 3F0PA 1W3CA 3R0FA 1E34B 4GHTA 4IMZA 1DXWA 1SGIB 3TNSA 3E6PH 2D26C 1DANH 1EAXA 2UUJB 3ATKA 3M5MA 3PM3A 2W7UA 1HGTH 1HAGE 3Q3YA 1GJ9B 2PKSC 3A81A 1DICA 1BTZA 3F9EA 1AB9B 1IHSH 1O2LA 2A1DB 3ZZ3A 2GVFA 4NFFA 1MU8B 1OWKA 4X6MA 3LH3A 1DITH 3ATIA 1EZXC 2VIWA 1B0EA 4I32A 1F0RA 3GY5A 5FPTA 2ZGCA 3BTQE 1IQLA 2GTBA 5F8TA 2ZHQH 2UUFB 4AGKA 1V2VT 2Y7ZA 1ZRBA 1Y3YA 1D6WA 3VEQB 2HNTF 1AKSB 4MVNA 2J98A 3A85A 1GI2A 1K1MA 1TBQH 1HIAB 4OGYA 2ESTE 1UVOA 3HKIB 4XE4A 1HAXB 1AB9C 1C2EA 3QO6A 1GHBF 1AQ7A 5GIBA 3OY5U 4LXBH 3OX7U 1O5EH 3DFLA 2OC7A 1TONA 1ZPCA 1EZUC 2JH5D 1BTPA 1NN6A 1P09A 1ZOMA 2WV4A 2A0QB 2FOEA 3FOAA 1ZMNA 2PSXA 4CH8B 1EJAA 1KDQB 4Z6AH 1AI8H 4KKDA 2VWOA 2ZA5A 4ZROA 4I86A 2L74A 1PQ5A 4K1SA 2NU4E 1VITH 3OYPA 4ZHAA 2HPPH 4ABEA 3NZIA 1YPJH 4GLYA 1EX3A 4MQAA 2C8XB 4Q80A 1RTLA 2F9BH 1E35B 5JB9S 3CNRA
chains in the Genus database with same CATH topology
2BHGA 3KQDA 4LZ1H 4PROA 4RKJB 3QGJA 6GCHF 2ZHFH 3RXOA 1VCPA 5EQQA 4A1XA 2WV5A 4K69A 1AE8H 2B0FA 3A7TA 3KF2A 1C5OH 2FTLE 3UNSA 2FM2A 4XDEA 2ZO3H 1SLWB 5E2OA 1G3EA 3STIA 3PWBA 3A8BA 2JH0D 1PJPA 1J9CH 1YKTA 2ZF0H 2YNBA 1OX1A 1H9IE 5EG4A 3EQ0H 1KXCA 4NIVA 5IDKA 2VNTA 2PTCE 3Q3XA 1EAIA 1AFEH 4Y71A 4MPUA 1BA8B 2H5CA 4O3TA 1C5ZB 1P03A 2Z3DA 4Y8XA 2VWNA 1L0ZA 2WPJS 5AHGH 3UY9A 4X1RU 1VGCB 1A5GH 1KLTA 1OYTH 2A32A 2BVSH 4DVAU 3ATMA 1K1LA 1OPHB 3UWIA 4ISNA 1C4V2 2J2UA 1P06A 3SUEA 2BD9A 2A31A 2PGQB 1O2ZA 5FBIA 1AVGH 1MBQA 2A7JA 1T7CA 2BQ6B 2TGPZ 4YOIA 2RDLA 1A0LA 2A45B 2A4QA 1TMTH 2BM2A 1RFNA 1T32A 2OC8A 3I77A 1VGCC 1SFIA 1VJAU 5LPRA 1O36A 3ZZAA 2F3CE 1FIZA 1VZQH 2J38A 5EU8A 1K1NA 2ZTZA 1LDTT 3TH4H 1P3EA 1UK4A 4ZKNU 1HYLA 2I6SA 3T62A 4O97A 4INHA 1EP6A 3PLPA 1GHWH 4ABDA 1BRCE 1GCTB 5DP7A 1Z6EA 1O3NA 5DGJA 1LHGH 1O3BA 1O3PB 2Z6BD 1ZPZA 4I8KA 4ABBA 4DCDA 1XUJA 5ETXA 5EOKA 2BD8A 4Y7AA 2Z7FE 1QBVH 2FZZA 1GDNA 4AOQA 1DM4B 3DHKH 1DPOA 1KXBA 1YLDA 3ENSB 3BN9A 4NIXA 1O3AA 1C1QA 1NESE 2ZQ1A 1GCTC 1UO6A 1EB2A 4MPXA 2J34A 1MTSA 3RXIA 5FHTA 1O2PA 2ZCLP 4B71A 1Z8IB 2AGGX 2FOFA 3SJ8A 1GJAB 2ZDLA 4YLUA 3K2UA 3RU4E 2FI3E 2J92A 1AIXH 2HRVA 1ZSJA 1P02A 2VVVA 1F7ZA 1QJ1B 1O3OA 1A0JA 1TOMH 4NA9H 1S5SA 2Z3EA 4Q2KA 2ZHWH 5I46H 1O38A 1OWDA 4XBCA 1S82A 1TA2A 4TWWA 3GY6A 5C5NA 3V13A 4FUHA 4INKA 2ZPQA 4ZXXH 3H7TA 3U9AH 1GHAG 1HXEH 4ISIH 1LPGB 1DXPA 1PQ7A 4O9VA 1ELGA 5GCHG 4F4OC 2ZGJA 1HRTH 1O2XA 4HGCA 1ARBA 1ELTA 8GCHF 4KGAA 1C4Y2 2R0KA 1ZMLA 1YLCA 1E36B 1NFXA 2LNCA 2YOLA 7LPRA 1V2NT 4NWKA 5G4BA 2TIOA 1BJVA 3VGCB 1TPSA 1NS3A 2IN2A 5K7RA 2UWLA 3PTBA 4MLFB 1YGCH 3GDSA 2BVXH 3A7ZA 4AGJA 3BTHE 2G51A 2W26A 1GMHG 2XBVA 1W10U 3F9HA 3E0NB 5T6DA 2Q6DA 2A4GA 1A0HB 3HGPA 3LOXA 3A87A 3L6PA 1TALA 2VWLA 2XBWA 2FX6A 3EA9A 1K21H 3LGWA 2UUKB 4D9RA 5T3HA 1SQOA 3VGCC 3ZZ4A 1GBAA 3RMLH 1MMJN 2BY7X 4IS5A 2ZI2H 4X0WU 5FBEA 1XMNB 1ABJH 4YO9A 4H6TA 1Y5BT 1BDAA 4IC5A 1EUFA 3M3VA 1Y59T 1UK3A 1GI9B 2OLGA 1N8OB 1RS0A 1ABIH 1H1BA 2R9PA 5EW2H 4X6OA 4OS5A 4JZDH 3KNXA 5TCAA 4A1TA 1JBUH 1SGRE 1QY6A 1SL3A 3ZZ6A 2D1JA 1ETSH 2WINI 4H4FA 3P6ZB 1T8LA 2OD3B 1LHFH 2ZGBH 4UE7H 2BD7A 5LGOA 4KELA 1V2JT 1HLTH 1SLVB 4GPGA 4AB9A 1TGTA 3ITIA 2QXIA 2FS9A 1B0FA 2ZHEH 3B9FH 2ANKH 3FZZA 2FI5E 5C67A 5A0BA 1GMDF 2P3UB 3GYMA 1A7SA 1JRTA 2O8WA 1P2JA 3UOUA 3MO6A 1UTOA 2ZTYA 1FJSA 2QC2A 4B73A 4MTBA 4X6PA 1LVYA 1W7XH 3SNBA 3NKKA 1ZRKA 3U8OH 1KTSB 2D8WA 1HV7A 1ANCA 2W5EA 2GT7A 1UVUH 3O8CA 4CRBA 1OKXA 4A7IB 3UIRA 2GD4B 3MNXA 5TJXA 1MAYA 1NO9H 1O3CA 2HGTH 4MNYA 5A2MH 1DLEA 1O30A 1FV9A 1T8MA 3MNBA 4NA8A 4WXIA 2XBYA 2F83A 1X7AC 1F0UA 1YCPM 4KTUA 1S6FA 1QFKH 5EXMA 4JYUH 1RIWB 1GI1A 2ODPA 2P94A 2BD2A 1KIGH 3BV9B 4K1EA 4X1SU 3KGPA 5SGAE 1LKBA 1G3CA 1HAPH 1CHOF 1SOTA 1SGNE 1WBGB 3V0XA 1UK2A 2FMJA 3SNAA 1W0ZU 2VH6A 3CP7A 4Q7ZA 2CXVA 3RM0H 1AVWA 3H7OA 2NU3E 2XYAA 2THFB 3TH2H 1JWTA 3V7TA 2SNVA 1MQ6A 3TIUA 1N6XA 1V2WT 1T4UH 1V2RT 4Y8YA 1PYTD 1RIWC 1O2WA 4UFDH 5EXLA 1W7GH 3SZNA 3E8LA 3SUDA 2OXSA 3MNCA 2I6QA 1UTKA 3LIWA 1QRWA 2FYQA 5K0HA 3SU5A 4CH2B 1EAUA 2PUQH 4K5ZA 1AGJA 1A3BH 2BD3A 1BRAA 1QCPA 2VIOA 1ZHPA 3N7OA 2PKAB 2KAIB 1G3BA 1GJ4H 1HAYB 4OS7A 4B2BA 2ZFFH 1V2PT 4AFZA 3KL6A 3S7HB 1O2NA 4ZHLU 5GWZA 1WCZA 4IBLH 2BLVA 3GCTG 2ZGXH 1TNKA 4BXSA 4AG1A 1SI5H 2PFEA 1Z1JA 1FAXA 3LC5A 4OGXA 2Y7XA 2FS8A 3SU6A 4I8HA 3V3MA 1P9SA 1IQIA 3LKWA 2QXHA 1WTHD 1P3CA 2IPHA 1GDUA 1KSNA 5CE1A 2ZDNA 2G52A 1GJ5H 3VFEA 4E7NA 1ZHMA 4D9QA 1P01A 1KTTB 1VR1H 1ZGVA 4X1NU 3MU5A 2CV3A 1FZZA 4AORA 2OBOA 3ZYDA 1P04A 2AERH 3LPRA 2ZFRH 1OYQA 1EASA 3AASA 3TJVA 3TGKE 1SGCA 3RC6A 2AH4X 4X1QU 3RXBA 2R0LA 3AAUA 2Z9JA 2ILNA 4I33A 3PROA 3LU9B 4B1TA 1O5AB 1WUNH 3VXFH 7GCHG 4BAMB 3UREA 1WAYB 1ELVA 1HJAB 3QDZB 4U2WA 1EAWA 1CE5A 1GBLA 1EQ9A 4CRGA 4AYVB 1G2LA 1GGDB 1TGBA 1C5LH 2C8WB 2PUXB 3M5OA 1SGFA 3M61U 3LONA 2BDHA 1V2UT 1YPKH 2ZZUH 3SGAE 4WMEA 3PLBA 2ZQ2A 5DG6A 1T8NA 3UR6A 3RC4A 4NZQA 1HJAC 4KTCA 3BTKE 3MWIU 1O32A 1S85A 4Q7XA 1GGDC 4XOJA 3M7QA 3BTFE 1FPHH 3RLWH 8ESTE 3C1KA 3T25A 1H4WA 4Y0ZE 5DP4A 2FI4E 1YCPH 3AW0A 3TPIZ 1QURH 2RA3A 3PWCA 4B2CA 1SHHB 2JKHA 4I31A 4E06H 1O5CB 1ELFA 3SJKA 3E16B 4JCNA 3PTNA 5FXLA 4D7FA 4HI3A 1K1JA 3RLYH 2P8OB 2FOHA 1HAVA 1BJUA 2P3TB 1D4PB 1KXEA 2GCHG 3M3TA 1FDPA 3LGTA 2BZ6H 1LPZB 2GX4A 2PWXA 5FCKA 1P2MA 3PMBB 4MPWA 4BAHB 4BNRA 2HVXA 4J2YB 1C4U2 2G5VA 3MH6A 1OP2A 5BPEA 5I25A 1GHYH 2A5AA 4ZKRU 2VB0A 1BRUP 3GCNA 1F2SE 1EKBB 5JB8S 3TJOA 1EOLA 1NRNH 1NY22 1CGHA 2QCYA 1C5RA 2P8OC 2NU2E 1C5YB 1S83A 1IQMA 4QT8C 3IITA 3GDVA 1GHBG 5TCCA 1ANBA 5EXNA 2SGPE 2SGDE 3BTDE 3SV2H 3ZV9A 1ZHRA 1SGPE 3PMHB 3RXGA 2FOCA 4K1TA 1NC6A 1TNJA 1TPPA 2XCFA 1F0TA 1FY1A 3SHCH 1YYY1 1G9IE 1GJBB 4OS2A 4WJG2 7ESTE 1FAKH 1HFDA 4K3JA 3B23B 1LQDB 1PPHE 3VXEH 1YPGH 2VIQA 1O35A 5FCRA 1KLJH 2J4IA 1D9IA 2GZ8A 2WPHS 1GI8B 3S9AA 1RXPA 4TYDA 1ORFA 2BDBA 3EE0B 1LVOA 1D3QB 3T29A 3QX5H 2OUAA 3H5CB 2WUCA 1O2YA 3IWMA 1GG6B 1TNIA 5C20A 2ZU2A 1QB9A 2QGRA 5DKMA 1OWEA 2P95A 1ELCA 2C4FH 1Z8JB 1OSSA 1HAZB 1A46H 2P16A 1VITG 1A5HA 1NTPA 1V3XA 4FVDA 3ZZ9A 5JYIA 3CENA 3BIUH 1P2KA 3T28A 1L1NA 2GKVE 1DS2E 1TFXA 1XKAC 1BB0B 1AY6H 2BQWB 3VB7A 1MH0A 3SORA 4ASHA 2A2QH 5E0GA 2AFQB 4CRDA 1GG6C 4U30A 3SU0A 1GHVH 3U8RH 3ZZDA 1NZQH 4GSOA 1C1OA 3MTYA 5C1YA 3TK9A 3S9BA 1Z7KA 4M7GA 1QJ7B 1G37A 1ZJDA 3MU8A 3SW2B 2ZFPH 2W7SA 2HPQH 3MH7A 1FY5A 4J1YA 3UNQA 3BG8A 1KXFA 3DA9B 2V3HH 1BMMH 1J15A 1MAXA 1V2QT 1ELDE 2C8YB 3SUFA 3ZZ8A 1TQ0B 2OC0A 3NK8A 4Y0YE 1P57B 1V2TT 3VB3A 2J95A 1HAHH 1MD7A 1AWHB 3ZYEA 2D2DA 1C5WB 5DP5A 1FLEE 4AN7A 3M3SA 4YT7H 3D65E 5HMAA 1B7XB 1CSOE 3BG4B 1PQ8A 4K2YA 3A89A 1GBJA 2BMGB 3SO3A 1PPBH 1T31A 1O34A 1GVZA 1GBCA 2GZ9A 1QL8A 2ODQA 2ANWA 1CGIE 1SGDE 1THPB 3SU3A 4UONA 1NRPH 3FAOA 5EPYA 2BDCA 4A1VA 1THRH 4AFQA 5F6MA 2XRCA 3RDZA 2OC1A 4JYVH 2O8MA 3RXPA 1EATA 1LPKB 2OCVB 3BTTE 1G32B 2OP9A 1AUTC 3SQEE 3BG4C 2WYJA 1UTPA 3RXKA 2ZHDA 2GV6A 1O0DH 3ZZCA 4ZHMU 4B76A 3CS7A 3RXCA 1FUJA 2FTMA 4WXVA 1L2EA 3MU0A 4JK6A 2JH6D 1S6HA 1KXDA 1OP8A 3JZ1B 1ACBE 1O3FA 1J14A 5A09A 2G4UA 4RN6A 1W11U 4IW4E 3O8DA 3KQEA 1QL9A 2VH0A 1SGFG 2Y82A 4NIYA 1MCTA 1NROH 2FXRA 1CA8B 2GCTB 2FLBH 1W0YH 1DLKB 1MTWA 3MO3A 3SNDA 2Y80A 4CREA 1F0SA 1UVSH 5T6FA 5JBBS 5HXFA 1MKXH 1ZSLA 3QTOH 4X8SH 1UCYH 1WQVH 1MUEB 1BTWA 3NXPA 1J8AA 1IQGA 1BOQA 4JZFH 3SU1A 1Z6JH 2CHAB 3HK3B 3M5NA 5EODA 8LPRA 2CF8H 3ODDA 5DK1A 1O2IA 4UFEH 3SI3H 3RM2H 3MNSA 1GJ6A 1SLUB 2GCTC 2SNWA 1BZXE 3OU0A 3U8TH 1LTOA 1AN1E 1C5UA 2B7DH 3QUMP 3E90B 1C1NA 1JOUB 3LT3A 5JBCS 1GBHA 8GCHG 1HXFH 3FZDA 2BY9X 1C1UH 2CHAC 2HOBA 4K8BA 2C93B 1QB6A 3ATWA 5A8ZA 2BX4A 1TIOA 3U1JB 1JXPA 2TBSA 5DP8A 2F9OA 1THSH 2J94A 2HALA 3F6UH 4CBNA 2OINA 1BTHH 3E0PB 3LJJA 1GI7B 1WOFA 2C90B 3K9XB 1HJ8A 4X2YA 3I78A 1GCDA 1GJ7B 1IAUA 2VIVA 3C27B 4ESTE 4YLQH 1BTUA 5JDUB 2ODYB 1PPGE 1ELBA 4NFEA 2SFAA 3P8OA 1EOJA 3SU2A 3P70B 2B8OH 1PPEE 1K1PA 1ZZZA 4D8NA 1GHAF 4K60A 1EPTA 3UWJH 4HTCH 1LVMA 1L1JA 2NU0E 1SPJA 5FPSA 3T26A 3BEFB 1GJCB 5GCHF 2VVCA 1ZGIA 3EDXB 1BITA 1SGTA 4DW2U 1Y3VA 1C2IA 3D23A 3VB6A 5DP9A 1CA0B 4ISOA 2ZDMA 4E7RG 4DURA 1OWHA 2A7CA 2Y5HA 1J17T 2GT8A 5GJ4B 1MTUA 2ZIQH 3KHVA 1GBBA 1GJDB 1YPMH 3SQHE 4AB8A 4AYYB 2NWNA 2EI7A 1C2FA 1O2VA 3PO1B 4I8JA 1JIMA 1GMHF 1WYKA 1OXGA 1UTLM 4CRFA 5DO4H 1C5PA 1F92A 3UNRA 1CA0C 3RXTA 1QIXB 1ZMJA 2ULLA 1E38B 3DFJA 4ZKOU 2Y81A 2XBXA 2F9PA 1PQAA 3D62A 1OWIA 1O5DH 4IGDA 4CRAA 1TRMA 3KCGH 1GMDG 1XUKA 1AZZA 3LDXH 3RU4T 4K8YA 2WPMS 1FXYA 3TGJE 5FPYA 1A3EH 4JZIA 1RRKA 5HM2A 2A7HA 1N1LA 1XUFA 2O8UA 1O5BB 2H9EH 2B9LA 2UWOA 1TNLA 3RMOH 3PO1C 3URCA 2Y5FA 1OWJA 4ABIA 2ZDAH 1MTNB 1L4ZA 1LMWB 4BXWA 1HAOH 3RXLA 3SGBE 1DY9A 1WSSH 3SBKA 1F5LA 1DY8A 5J4SA 1EPTB 1AE5A 1SR5C 4A5TS 1C9PA 1QQUA 1OS8A 5CHAB 1C1VH 3RXJA 5C2ZA 2C3SA 1SOZA 1BQYA 2XCNA 1HDTH 2Z9GA 1LHDH 1UTMA 2Z9LA 5F03A 3TU7H 3BTGE 3RXHA 3A82A 1TGNA 1SGQE 1AZ8A 2EI8A 3T2NA 1MTNC 3ZVBA 3VB4A 3MOCA 4CHAB 4X8UH 5ESBA 1G36A 1E0FD 1C2GA 2R3UA 5C1XA 1EPTC 3A7WA 1K22H