2B0FA

Nmr structure of the human rhinovirus 3c protease (serotype 14) with covalently bound ace-lealfq-ethylpropionate inhibitor
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
182
structure length
182
Chain Sequence
GPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYFVEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Picornain 3C (Protease 3C) (P3C)
publication title NMR solution structures of the apo and peptide-inhibited human rhinovirus 3C protease (Serotype 14): structural and dynamic comparison
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 39
structure length 182
sequence length 182
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2b0fA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2b0fA02
1SSXA 4ISHH 1DDJA 1GBIA 4Y11E 1GHBG 4D9QA 3SV9A 1VJAU 5DP8A 2QCYA 6CHAC 2A4RA 1BUIA 2CXVA 2WPLS 1KSNA 4ZHLU 4WMFA 1CQQA 1S85A 1VITG 3W95A 2C4FH 4X8UH 3PWBA 1EQ9A 3RXTA 1O5AB 1DLEA 4F49A 3LU9B 2FM2A 4ZKOU 3F9FA 1O2QA 1Z8IB 2GCTB 3OY5U 1IHTH 1OX1A 1S0RA 4LZ1H 1ZGVA 4WMDA 2GGVB 1V3XA 1O2OA 1GPZA 3Q76A 2BD8A 1C2LA 3P17H 1IQJA 5SGAE 3D62A 2BHGA 2CF8H 4RKOB 4ZUHA 2RA3A 4I8KA 4UE7H 1L0ZA 1K22H 2Z9JA 3ZVFA 5LGOA 3BEUA 3E0PB 1L4ZA 4B75A 4XBBA 4K3JA 3BTQE 4NA9H 1ZTKA 1VJ9U 3U98H 1S6FA 4CRBA 1YP9A 1O3KA 3NUMA 1V2RT 3RU4T 2A2XH 2ULLA 1SQTA 1Y5BT 3QGNB 1TRMA 9ESTA 3TGKE 1Y5UT 1XVMA 3ELAH 1JRSA 1DX5M 2BY6X 3KIDU 3GISB 2W7SA 4ZKSU 3ZVEA 1HNEE 1ORFA 3ZZBA 2ZCKP 1W14U 1O5DH 1KIGH 3MTYA 4BAQB 3MI4A 1GMCF 5HGGA 1SFIA 5A0AE 4Y8ZA 3V13A 1AFQB 1O31A 5A2MH 3UQVA 5CHAC 1W2KH 2DUCA 1THSH 3FVFB 3U69H 3DFLA 1QRXA 4BAHB 1LKAA 3RXHA 3EYDA 4DOQA 2FI4E 1EZUC 1ANCA 2NU0E 4ABGA 1C1UH 3L3TA 3A85A 1O2XA 2BDCA 4J1YA 1WAYB 1QBOA 2PKAB 2BX3A 1RTFB 1C5RA 1NT1A 1L1NA 1W8BH 2VIPA 4X0WU 1Y3XA 3NWUA 2AH4X 2PUXB 3SU1A 3BG4C 1ZJKA 5AVDA 2XWBI 1OP8A 2Y81A 1KXCA 1KLTA 1IOEA 1PQAA 4A1XA 2F9BH 1UVPA 1ELAA 1ELDE 1HJAB 1ZHPA 4HFPB 1DUAA 3SORA 1EAIA 1S84A 3F9EA 1E34B 4NA7A 1DOJA 2BDGA 5HMAA 4YT6H 4NIYA 3H7OA 4CRCA 1IQEA 3K65B 5JBTA 4UONA 2AGIX 3H7TA 1DT2A 2V3OH 2BVSH 3RXEA 2FYQA 4UDWH 1J15A 1F92A 3HATH 2ZTYA 4OS5A 4ZHMU 1FIZA 4Y7BA 2ZPQA 2ZFPH 2ZECA 1BOQA 1W3CA 1NFYA 1C1PA 1VGCB 4Z6AH 1IQLA 1TPPA 2WPHS 5DKMA 4ABJA 4Y79A 1UTOA 2VIQA 2OCVB 1SGDE 2WYGA 4X2XA 1NC6A 2Y82A 3EQ0H 1C2IA 1C4U2 2BD7A 4AFQA 3SJ8A 1HV7A 1Y5AT 2O8UA 3GOVB 1M9UA 4U30A 8GCHF 4XSKU 1A3EH 5EG4A 1GVZA 1KXDA 2UWOA 3U9AH 4E06H 2CMYA 3A8DA 5AFYH 4OGYA 2QIQA 4JZFH 2FTMA 5FAHA 1AKSA 2ODPA 1O2UA 3MHWU 3A7YA 1EZXC 4K60A 2J95A 2VVUA 1C2KA 1O37A 4Q2KA 1AN1E 4HZHA 5GXPA 5F8ZA 2V0BA 1CGIE 2AFQB 2EI8A 1TBQH 1JRTA 1Q31A 1QBVH 1TGNA 4Y71A 1TONA 1GGDB 2BD5A 1DWDH 1T4VH 1CT4E 2XWAA 1A7SA 2QXHA 4O97A 3RXVA 2FS9A 2OUAA 3RXRA 2ZHDA 3RXMA 3Q3YA 1EB1H 1BJVA 1RIWB 2H5CA 2IJOB 3VXEH 4SGBE 3G01A 4WVPE 4BAMB 1LHCH 2GKVE 1HJ9A 4ABIA 2ZFQH 1BTXA 2Z9IA 1EJNA 1RXPA 1HLTH 1LVOA 2WINI 3NXPA 2ZHWH 2BTCE 1F0SA 2CHAB 3M35A 1KXFA 2O8MA 2R2WU 1F5KU 2G00A 1HB0B 1Y3VA 3UR9A 5TCCA 1F0UA 1GMCG 1BBRH 1FMGA 1BTWA 1MBQA 2Y7XA 1GJBB 2ANWA 2P16A 3A84A 3URCA 1SG8B 2J9NA 3E16B 1PPFE 1Z8RA 5DP7A 2PTCE 3A88A 3LGTA 3SU5A 5EQRA 3LT3A 1UTPA 3GCHC 1P02A 3MNSA 2ILNA 1QURH 4B76A 2FTLE 2ZPSA 2VVVA 2VWMA 1SPJA 2Z94A 2VINA 2C8YB 4ZHAA 4GSOA 1Z1IA 1TNKA 1EP5A 1E35B 3EE0B 7KMEH 2VIDA 1GBLA 4INHA 2VWLA 4CH2B 1PPGE 1YPJH 2GV7A 3KQCA 3M3SA 2GMTB 1IAUA 3A87A 1OWJA 1VR1H 1QJ7B 2R0KA 1O5EH 6LPRA 1SLWB 4YOGA 1O2RA 3M7TA 4HTCH 4OS6A 3RC4A 1C5TA 1N8OB 3RXKA 1EZQA 1YPGH 1ZPCA 2HNTC 1L2EA 4BAOB 3ZVDA 4Q80A 5E0GA 4FUBA 1TA2A 4FU8A 1AIXH 1WV7H 1EJAA 1V2WT 1CE5A 1D3TB 1QBNA 2CGAA 3GY6A 1LHFH 3A80A 3RDZA 2A45B 1HAVB 1H4WA 3SQEE 4X8TH 2VGCC 1SLVB 2C3SA 1DVAH 5E2PA 5BRRE 1MKWH 2FLRH 4E05H 1GI5A 1EP6A 2QF3A 2C8WB 2G4UA 3LONA 1LO6A 1TB6H 2SGAA 1D3PB 3SI4H 3SJ9A 1GBDA 3PO1B 4KP0A 1NRQH 1CBWB 1RFNA 1TOCB 3RMMH 4D76A 1YGCH 5EW2H 1DICA 1UTNA 3T29A 2ZO3H 1BRUP 1PPHE 3BTEE 1MBMA 1D3QB 4XE4A 3HGNA 1YCPH 3MH4A 4XBDA 2WUBA 1TGBA 3JZ1B 4O03A 2C8ZB 3RC6A 3FP8E 2VIOA 1GHXH 4E7RG 2D2DA 4AGKA 5JB9S 1G2LA 4JZDH 1MD8A 1K28D 4NG9H 1W11U 1Z7KA 2Y5HA 6GCHF 3V7TA 4YLUA 4K1TA 1EASA 1UCYH 4I33A 2IOTA 3SU2A 4CBNA 1ZRBA 1HRTH 2ALVA 2FX6A 3PLBA 1TABE 4TWWA 2QXGA 2FZZA 2A7CA 2P93A 2OD3B 2QF0A 1A0HB 1GBTA 1YC0A 5DP9A 2XC0A 4X6MA 2AS9A 1CGHA 4OS2A 2A0QB 2FOAA 5DG6A 3TITA 3NCLA 3M3TA 2UUKB 1G30B 4X1SU 1SGFA 2UWPA 1A61H 2ZF0H 1MU8B 1FV9A 2I6QA 4YTAA 5L2YH 1C1RA 4K1SA 1P11E 1W13U 5EPYA 2ZFTA 1O5CB 1PYTC 3MOCA 1W7XH 3HK3B 1ZPZA 1RTKA 4FUEA 4Q7XA 2ASUB 4GUXA 3BG8A 3VPKA 1QFKH 3T62A 1SGRE 2PKSC 1NS3A 1QHRB 1A0JA 1QJ6B 2P3TB 3LJOA 4ZKRU 5A09A 1O3IA 1KXBA 1GI7B 4XDEA 2UWLA 3CENA 1HXEH 1YLDA 2VVCA 1W12U 2FPZA 4ZAEA 4R8TB 4WH6A 3TLOA 4AFUA 4GAWA 3SV6A 3ATKA 3EGKH 5G4BA 2EA3A 1GDQA 1QL7A 4TPIZ 2BLVA 3T25A 1GMHF 1EKBB 1NFXA 1EB2A 1DPOA 1HAPH 1O3GA 5HM9A 2GZ8A 2G4TA 3TK5A 1AVGH 3MU1A 3RXDA 2ZDMA 1Z8GA 3VB3A 2SGFE 2FOCA 4NSYA 1AMHA 3RXAA 2AMDA 2BYAX 2G51A 1CHOF 1H8IH 3UREA 3C27B 1GCTB 3SU4A 2H5DA 2P8OC 4NWLA 2JETB 4Z0KA 3Q77A 2KAIB 3AASA 1GHYH 1AI8H 3S69A 1ZMJA 3A7WA 3ZVAA 1ETTH 1TGCA 5E2OA 4BANB 5LPRA 3SV7A 1IQKA 1ZRKA 5T3HA 1ETRH 5DP3A 1GJCB 3C1KA 1O3MA 4ABFA 3BF6H 2NWNA 3SU3A 1S5SA 1O2GH 3RXOA 1MAXA 1K2I1 2THFB 1KXAA 3MNCA 3SNBA 3UOPA 5I46H 4NIXA 1O2WA 4I8HA 4WF8A 1A1RA 1T8LA 1EATA 4ISNA 1LHEH 4NZQA 1ABJH 1YPMH 1CGJE 2AIQA 1P2KA 3OU0A 2EC9H 1LPKB 3ZZ7A 1OWIA 1G37A 1A46H 1BJUA 2QXIA 4ISLA 4JZ1A 5F8TA 1E38B 4NA8A 3SNEA 2XCFA 3I77A 4KTSA 1THPB 1UVSH 2ZKSA 1XMNB 3GDUA 1AO5A 1SHHB 4UFGH 5C1XA 2ANMH 1A2CH 2ZA5A 1B7XB 4A7IB 1Y3YA 5EQQA 2GV6A 3KQDA 1P12E 4IMZA 3TK6A 2J38A 2G81E 4JYTA 2F3CE 2HRVA 2PTNA 2BLWA 2W7UA 2BMGB 1DITH 1FUJA 5A0CA 1UHBB 1AE8H 5EODA 1O35A 1NU7B 4AYYB 3V0XA 2XNIA 2J4IA 9LPRA 4WXIA 1GBCA 1C2DA 3PMBB 2ZDNA 3QO6A 3LGVA 1WUNH 3RXBA 1QQ4A 3LOXA 3U8TH 3KHVA 4TY7A 1XM1A 1OYTH 3GCTF 1DUEA 1LVYA 4FU7A 1SL3A 3L33A 3RMOH 1P10A 5IDKA 1MTNB 1G32B 5A0BA 4ABBA 1TLDA 2ZU2A 4B74A 1H9IE 4MTBA 4RKJB 3A81A 2BLQA 3SGBE 2FESH 1T4UH 1D6WA 1NM6A 1V2KT 1HIAB 1MTSA 4B71A 1QRWA 4VGCB 4UFFH 2ZGXH 4ABEA 3VB4A 3VXFH 1GJ9B 2ZGBH 3QTVH 4D7FA 1SOZA 4A92A 1O3BA 2FI5E 3UWJH 1MMJN 5IYTA 4YO9A 1GI9B 2ZP0H 2XBYA 4ZROA 1JXPA 1PQ7A 5FX5A 1HCGA 1IQMA 3ZZ9A 3BTWE 1GG6C 2Z9KA 3A89A 3SU6A 3F9GA 1MZDA 2Y80A 3E3TA 4CHAB 1HAIH 1SR5C 1VGCC 2VH6A 1O2LA 1QCPA 2F9PA 3R3GB 1O2VA 1KDQA 2FOFA 3HKIB 3GCOA 1NU9A 2A5IA 1BQYA 2K1QA 3GYLB 1G36A 1GMHG 3RU4E 5GIBA 2PLXA 1TALA 3ZZ4A 2EI6A 4H4FA 2QAAA 3EAJA 1HAYB 3TH2H 3TK9A 2FMJA 3GY3A 3KGPA 2ZG0H 1GI2A 4GCHG 5LPFA 1GHWH 2F91A 2ZDVH 1C2MA 4I31A 1CHOG 1GI8B 3NZIA 5FBIA 4I7YH 1VCQA 1MKXH 1P03A 3A8CA 4FUGA 2D26C 4KKDA 5DP4A 2ZTZA 5L30H 5AHGH 2J34A 1HAXB 1QIXB 1YYY1 1L1JA 2B7DH 1C1VH 3TGJE 5E8EH 1EJMA 1J16A 3GDVA 3AAUA 5FXLA 1BRCE 4CR9A 2FOBA 1DSUA 2ZHQH 2GCHF 6CHAB 5JDUB 1W7GH 4FUFA 1T8NA 1GGDC 1GBHA 1UO6A 4DW2U 2QV1A 1XXDA 2F9VA 4Y10E 1V2ST 1O3AA 1P57B 4IN2A 2PWXA 4MG3A 1TGSZ 2GD4B 1EOLA 1W0YH 4B73A 1TNHA 1HBTH 1P3EA 2WV5A 3GY2A 1QNJA 2TBSA 1V2MT 3UNSA 1ZLRA 3RMNH 1E36B 1AFEH 3P70B 1HAOH 1SHYA 1GBEA 2CHAC 1GJAB 2HALA 2RDLA 3BTFE 5FBEA 1VCWA 2XBVA 3ZZ6A 1C5YB 3LGYA 1K1JA 2BD3A 1P2QA 2BOKA 1GI4A 3IWMA 3F68H 5FHTA 3UIRA 1QL8A 1UTQA 1B5GH 2JKHA 2BY7X 1HGTH 4GLYA 1GI6A 4DURA 2ANYA 1D6RA 1GJ7B 4CREA 1ACBE 2WPJS 2Y5FA 1WTHD 4BOHA 1C5XB 2CJIA 3LH3A 1G3DA 3MO9A 4X6OA 3K6YA 4INLA 1SLUB 4U01A 1OWEA 3M5MA 2PUQH 3RXCA 1AWFH 1ELGA 1LQEA 1QTFA 4GVUA 3UFAA 1AZZA 1PYTD 2CV3A 1WCZA 1C4Y2 3ZZ5A 1GDNA 1OWHA 3GCTG 5L6NH 4MNVA 4OS4A 3S0NA 4ABDA 1CVWH 2ZDLA 3LDXH 1C4V2 2P59A 4JK5A 1TNIA 2UUJB 3DUXH 1V2PT 3FANA 1MH0A 3UUZA 2BZAA 3ZZDA 2GVFA 1EOJA 3UR6A 4I8GA 4D7GA 2BDIA 1D9IA 3GY7A 3SGQE 1B0EA 3N7OA 4MQAA 5C2ZA 1C5VA 2QA9E 4PROA 4ASHA 4X2VA 4H42U 5JBCS 2C93B 2CN0H 1FXYA 4NFEA 2W26A 4FXGH 1TX8A 3TJOA 1YCPK 1ETSH 1ZTJA 2ZGCA 1DXWA 1O2PA 1SGTA 4WJG2 3W94A 2FX4A 1S0QA 4KTUA 3FFGA 1O2NA 5FCKA 4CRDA 2VB0A 1MUEB 2WPKS 2GT8A 2OP9A 2FP7B 2ODYB 4IC6A 5FPSA 3BG4B 3NPSA 3TPIZ 4Y7AA 2PKAA 3M5LA 3PWCA 4OGXA 1O3HA 1GI1A 2R3UA 4U32A 2ZGHA 1QL9A 2C8XB 4B2CA 2F9OA 4Y76A 3SOSA 2ALPA 4NGAH 1OWDA 1EPTB 1GHZA 1PPBH 3GY5A 4NIVA 3PO1C 1ELVA 1FY8E 2FOGA 4K8BA 4U2WA 1CT2E 4K5ZA 1GI0A 1VZQH 3BIUH 2OBOA 1YF4A 5AF9H 1CA0B 1C1OA 1TMTH 4SGAE 1EAWA 2WYJA 3BTME 3WY8A 2VIVA 1SGEE 1BTZA 1SFQB 1TPOA 1UK3A 1XUIA 1C5PA 3U8OH 2A31A 1FDPA 1O39A 5E0JA 2TGTA 3ZZ3A 4ZXYH 2NU1E 1NY22 3S9AA 3O8CA 4FUJA 2FODA 2A5AA 2RA0A 2TIOA 4MLFB 4WH8A 4MPXA 3A8BA 3MH6A 1INCA 4O9VA 1P2OA 1UTJA 3SU0A 4Q7YA 2OC8A 2AEIH 1K21H 4TPYA 2XCNA 4CRGA 2GCHG 1O36A 4X1RU 1MU6B 5DGJA 1ZMLA 3PTNA 5JB8S 5HYOA 4MDSA 1CSOE 4NCYA 2P3FH 3OSYA 1THRH 3TH3H 1P2MA 2OINA 1P9SA 3KL6A 5H4IB 1ESBA 2ZDKA 2GZ7A 4YZUA 1TIOA 3PM3A 3D23A 1CU1A 2VJ1A 1ZGIA 1C2GA 2FYRA 3MWIU 4WXVA 3STJA 4H6SB 4AN7A 2HWLB 3K9XB 4DVAU 3CS7A 3SO3A 4BNRA 5K0HA 4I32A 3SN8A 2JH5D 2IN2A 2FDAA 4OS1A 1LQDB 1C5LH 3P8OA 1F5RA 3OYPA 2BY5X 3T27A 3TJVA 1AUJA 1ZYOA 1EAXA 3MMGA 1O2MA 3SGAE 2OBQA 1OXGA 3SNAA 5CMXH 1ZPBA 3BTKE 1T8MA 2LPRA 3VB5A 2OTVA 1NRRH 1YPKH 2SGQE 2XXLA 4ABAA 3RXLA 1P9UA 3FP6E 1V2VT 5BPEA 3RXPA 3AAVA 1ESAA 3P8GA 1JWTA 2HPPH 2SNWA 2OC7A 8GCHG 2RG3A 1NESE 1TQ7B 1BTYA 2TPIZ 1P05A 3GDSA 4K2YA 1FY1A 1CHGA 3ZZAA 5EW1H 4YOJA 2WPMS 1V2NT 3LKWA 2FIRH 2F9UA 1O2SA 1CO7E 1GCTC 1NRPH 1OP0A 3VFEA 4AFZA 1CT0E 1HPGA 1O3PB 1OS8A 3MO3A 2JETC 1TAWA 1UVUH 3RXQA 2G5VA 1Q2WA 3LGIA 2H9TH 1HJ8A 2BD2A 1O5BB 3T28A 2ZFSA 3LGUA 1C5NH 1O0DH 1RTLA 3EA7A 3GCHB 3M37A 2BB4A 1OWKA 1K1PA 1HAHH 3SNCA 1G3CA 1GHBF 1DSTA 4MNXA 5EOKA 1F5LA 1C1SA 5AFZH 2FXRA 2ZCHP 2XC4A 1WYKA 1FNIA 2UUYA 1WBGB 1HAGE 1WSSH 3E0NB 1FY3A 1P2IA 3P8FA 3UWIA 3FZDA 1G3BA 1SVPA 2Y5GA 1O2TA 1AD8H 2YNBA 3KEEA 2BY9X 3P92A 1FQ3A 3AVZA 1C2EA 1DY8A 3DT0H 1BCUH 1XXFA 3EA8A 3NKKA 4O3TA 2QN5T 3SJIA 3GCNA 3QWCH 2ZI2H 3TNTA 3TVJB 2SFAA 5TCAA 3A8AA 1MTWA 2R0LA 2JH0D 1C2JA 3PLPA 3MYWA 1QR3E 4YESB 4X1QU 4TYDA 1O2HA 3F1SB 2OC0A 3ZV8A 1FZZA 1SB1H 4D9RA 4XOJA 4DJZB 2A4QA 1OOKB 3SHCH 1BRBE 1DM4B 1GBFA 4D8NA 4XFQA 2TGPZ 2G52A 3M7QA 2STAE 5C1UA 2R3YA 1Y59T 3ZYEA 1BRAA 5EGMA 4JYUH 1TBRH 2VGCB 2ZHFH 3PB1E 2ZWLH 1LHDH 4B2AA 1P0SH 1AU8A 1BBRE 2F9NA 3TGIE 3TJUA 2Y6TA 1XX9A 3TU7H 4XBCA 1RGQA 5FCRA 1O3DA 1YPHE 1GJ5H 1K9OE 1ELEE 1HAVA 4IS5A 2GCTC 1WOFA 1F2SE 2JH6D 1TX7A 5JBBS 2Q6GA 2B5TB 1AQ7A 3ZV9A 1FJSA 3OTJE 2ZGJA 3RXJA 2PHBA 3BTTE 5JYIA 1Z8JB 1NZQH 3D65E 1H9HE 1K1OA 2GX4A 4NIWA 3IITA 3S9CA 3GICB 1IQNA 1O34A 1ELCA 2Z9LA 1FONA 4Y8XA 1PPCE 1PQ5A 1F0TA 3VB7A 1XKBC 1MAYA 3LJJA 1J8AA 1KYNA 1IQHA 2V6NA 4FU9A 2AMPA 1JOUB 1HAZB 1UTLM 1BIOA 1G3EA 1O2JA 1AY6H 1UTKA 3RXIA 2B8OH 1AUTC 3VGCB 4O3UA 4BAKB 1BMAA 4DIHH 1GBJA 4F4OC 1MCTA 4NFFA 4CHAC 3HPTB 1QRZA 2Z3CA 2BDYA 1UTMA 1YM0A 3EA9A 3LC3A 3B9FH 2AMQA 1GJ6A 2ZDAH 4AYVB 3DFJA 1Y3WA 3SJKA 1MTVA 4Y0ZE 1QB9A 1BA8B 1AFQC 1H1BA 1ABIH 1BTUA 2AIPA 3GY4A 1P2JA 5A8YA 2PSXA 4AZ2B 1SGCA 3RUOA 1IQIA 4ZXXH 1PJPA 2Z3DA 1C5QA 1LDTT 4AX9H 1TMBH 2BD4A 5F03A 3SNDA 3SQHE 3Q00A 1KLIH 4HGCA 1V2UT 2PKSB 3E8LA 1TNJA 2BDBA 1O3FA 3KCGH 1D4PB 3R0FA 3SUDA 1NROH 1JBUH 2EI7A 3LIWA 4DT7B 1TGTA 5C3NA 1SLXB 6GCHG 4B1TA 4UFEH 1L4DA 4X2WA 3TJNA 3VEQB 4JCNA 5J4QA 3RXSA 3A82A 1P8VC 1V2TT 2Q6DA 1S6HA 1TFXA 4CR5A 3I29A 4DY7B 2ZU5A 3QGJA 1MD7A 5HM2A 4ZKNU 1V6DA 1TRYA 1EUFA 2Q1JA 1ZZZA 1NN6A 1PQ8A 1HJAC 1ANBA 3S7HB 2XBXA 4Y8YA 1UMAH 5PTPA 1ID5H 2ZEBA 1PPZA 2D8WA 1FI8A 3IG6B 1XUJA 4UD9H 2AERH 1TX6A 2P8OB 1AB9B 1UCYE 8ESTE 2PGQB 2BX4A 1P09A 4A1VA 3URDA 4YM9A 3ODFA 7GCHF 1RD3B 3B23B 1YBWA 2ANKH 3DD2H 1QJ1B 3O8RA 2WUCA 1DFPA 1JIMA 5EQSA 1WU1A 1GBAA 1MQ6A 1G2MA 3MH5A 3LPRA 4INKA 5T6GA 3RC5A 1IQGA 2Q6FA 1KY9A 1XUFA 3O8BA 1ZTLA 4LXBH 2KAIA 1FPHH 3E6PH 3KF2A 3RM2H 2GZ9A 3SHAH 1N6XA 1OYQA 3MU4A 2HLCA 4AB9A 1TOMH 3LGWA 1NFUA 5T6FA 2D1JA 5C5OA 1O3CA 1XKAC 1AKSB 1XUGA 2A7JA 4QT8C 2ZTXA 1G9IE 1AWHB 1C1MA 1NPMA 3PV4A 1UK4A 2XC5A 2XTTB 1A3BH 3M61U 5DK1A 3Q3KA 1GHAF 4R0IA 3SJOA 3MU8A 1FN6A 4X6NA 2FI3E 2FWWA 3V3MA 1HXFH 2DE9A 5K7RA 1C2FA 1OP2A 1GHVH 3M36A 1Q3XA 2O8LA 1ELFA 1BBRK 7ESTE 2VNTA 2G55A 3T2NA 1LMWB 2ZQ2A 2G8TA 5C5NA 1YLCA 2I6SA 4X2YA 5ESBA 1AGJA 2FOEA 1DE7H 3QLPH 4Y6DA 1C1NA 4MPVA 2ZNKH 3V12A 5EXNA 4MNWA 4DGJA 1BTHH 1BHXB 5FPTA 1A5IA 4AOQA 3HKJB 1FAXA 3E91A 1V2OT 1BMMH 1UHBA 2BLOA 2W5EA 3BTDE 1T8OA 1RIWC 1LVBA 7LPRA 5LPEA 1BMLA 1ZSJA 1SGNE 4UEHH 1HDTH 2QGRA 1TE0A 1EPTC 3ZYDA 1Z6EA 3RLYH 1V2LT 3PMAB 1LPGB 3U8RH 3E1XB 1JIRA 3M5NA 3B8JA 1UVTH 4B2BA 1BTPA 4MPUA 3QK1A 1TMUH 1O2ZA 1CA0C 3ATMA 1NO9H 3GY8A 3ENSB 1J9CH 3M5OA 1UK2A 2IPHA 2BXTH 3ATLA 4IC5A 2A32A 5C1YA 5EU8A 4AB8A 1HIAA 2QY0B 2YOLA 1O2YA 1GMDF 1ARCA 6ESTA 1ANEA 1XVOA 4ZMAH 1GG6B 2H6MA 2Y7ZA 1GBBA 4BTIB 4RSPA 4WMEA 4FUCA 1S82A 2BDAA 4H6TA 1SBWA 2R2MB 1IQFA 3RLWH 3OY6U 2HNTF 3OX7U 2GDEH 5I25A 2AGGX 1N6YA 1DWEH 1EXFA 1NRSH 1P01A 1YPLH 2NU3E 2XRCA 5GCHF 1MKWK 4LOYH 3SW2B 2V35A 4ZH8A 4BXSA 4JYVH 2GMTC 2BY8X 5CHAB 3RM0H 5EXMA 2BXUH 5DP6A 1XUHA 2VWNA 2H9HA 1W10U 1B0FA 1N8OC 1MTUA 2GT7A 3MNXA 1VCPA 1GJ8B 1ZSLA 5ESTE 2HPQH 5DPAA 3ZZCA 2XYAA 5ETXA 4ISOA 1SGFG 7GCHG 2O9QA 1UJ1A 2A2QH 2FOMB 1O3LA 1MQ5A 1C1WH 4A1TA 3SZNA 3L6PA 2J94A 1K1IA 3T5FH 4RN6A 4X1NU 1V2QT 2Z7FE 1C5WB 4LZ4B 5F6MA 5C67A 3O8DA 4X1PU 3A7ZA 5DJ7A 1ZHRA 2J92A 2WV4A 1N1LA 1UCYK 2ZFRH 2BQ7B 2OQ5A 1DS2E 1FY4A 3ITIA 3P8NA 1O2IA 1ZMNA 1KXEA 1P06A 1J14A 4K1EA 4FUHA 1XUKA 4YOIA 1CBWC 1PPEE 3AW0A 1Z6JH 2BQ6B 2OLGA 2ZIQH 3QZRA 2ZPRA 2ODQA 1QGFA 4WWYA 1WQSA 1LTOA 2EEKA 3BEFB 4FVDA 3RP2A 4J2YB 1O3NA 3A7TA 4KELA 1GHAG 2GP9B 3P95A 4Q7ZA 5L2ZH 1IHSH 1LKBA 2J2UA 2ZC9H 4FUDA 5EPNA 2BQWB 2BVRH 3VB6A 4AORA 4DG4A 3ZVBA 1BB0B 1NRNH 2FO9A 2GDDA 4JZIA 1GI3A 3PTBA 4AFSA 3AW1A 1O3OA 1PFXC 1TPAE 1T7CA 3ATWA 1QB6A 2SGPE 2ZU1A 3BEIB 5B6OA 4IN1A 4DIIH 2BM2A 3RU4D 5A8ZA 2ZQ1A 3PMHB 1O32A 2FLBH 2QXJA 1HFDA 2FEQH 4BTTB 1W0ZU 1C5ZB 3UNRA 2Z9GA 5T6DA 1E0FD 2XW9A 3K2UA 1BZXE 2B9LA 4K69A 1OPHB 8KME2 2BDHA 1U6QA 3E90B 1C5SA 4I8JA 2P3UB 1MZAA 1MCVA 3A7VA 1HUTH 4JZEH 1GBKA 2O8WA 5GPIB 2VU8E 3UTUH 1KTTB 3U1IB 2OC1A 1Z71A 1C1TA 2P94A 1L1GA 2NU2E 1SGPE 3MH7A 3PMJA 1FPCH 1RS0A 1K1MA 4ESTE 1T31A 1KTSB 2BVXH 4WY3A 1C9TA 4M7GA 2WPIS 4E7NA 2GTBA 3ZZ8A 4JMYA 3A86A 4OS7A 1P3CA 1TA6A 2ZZUH 1LPZB 5ABWA 4FVBA 4TY6A 1C2HA 4BTUB 2VWOA 1J17T 3S7KB 2A5KA 2OQUA 3PROA 3GYMA 2XBWA 3UOUA 4ABHA 2G5NA 1ZSKA 4BXWA 1E37B 1SGYE 2Z3EA 3HK6B 5GDSH 1C9PA 1QQUA 1GMDG 2QYIA 2W3KA 1KLJH 3F6UH 1RRKA 1LCYA 1TNGA 1WTGH 5C20A 3CS0A 2OXSA 3M3VA 3STIA 2BZ6H 1TBZH 3SV2H 5CE1A 2Z6BD 2HGTH 1H8DH 3UNQA 1SQAA 1YPHC 2YNAA 5GCHG 4UFDH 1AHTH 1O2KA 4GHQA 1SGIB 2PGBB 2PV9B 4NZLA 3CP7A 2HVXA 3PLKA 4I8LA 3HGPA 1GL1A 2B0FA 4CH8B 1ELBA 3BV9B 5FPYA 1ESTA 2TGDA 1A4WH 2A1DB 3ODDA 1ANDA 1EPTA 1V2JT 4AG1A 1AE5A 5DO4H 2PFEA 4AG2A 1AVWA 4MVNA 5J4SA 4FUIA 1DY9A 1C5UA 2F83A 2BD9A 1QA0A 1EZSC 4Y0YE 2PSYA 3S9BA 1JMOH 4NSVA 1Y8TA 1EX3A 1OKXA 1VITF 4A5TS 1TNLA 2ZCLP 1O38A 1X7AC 5JPMH 3H5CB 2TGAA 1OSSA 3VGCC 5GWZA 3FP7E 2H9EH 2HOBA 2ZU3A 2H1UA 3JZ2B 1GBMA 4LK4A 3Q3XA 1DLKB 1DXPA 1S81A 1C1QA 5FX6A 1GL0E 1UVOA 2ZU4A 1Y3UA 1DANH 1O5FH 1FAKH 4THNH 4YT7H 1BHXF 3P6ZB 4IW4E 4AGJA 4K8YA 1BITA 3ZVCA 3TIUA 3BSQA 3UY9A 2PW8H 3LC5A 2STBE 1H9LB 1GDUA 1S83A 3BTHE 3LH1A 4DCDA 3MO6A 2HNTE 4MNYA 3RMLH 4CBOA 3ESTA 4GPGA 1GJDB 1YCPM 3PYHA 1GCDA 3KNXA 1VITH 4GHTA 3SUFA 1BT7A 3BTGE 4JK6A 1TYNA 1P04A 3FAOA 1F7ZA 1A0LA 2SNVA 3SV8A 3KQEA 1LVMA 1ZR0A 1T32A 1ELTA 3BN9A 2NU4E 2UUFB 1TRNA 3QDZB 5A8XA 4X8SH 3A7XA 5TJXA 3MNBA 3SUEA 3T26A 1O3EA 3MFJA 4CRFA 3KQBA 2VIWA 4TWYA 1WQVH 4X8VH 3MU0A 3QUMP 1MTNC 2RCEA 1YPEH 4ISIH 5F8XA 3SBKA 2R9PA 1DWCH 1FIWA 1SOTA 2AYWA 3NK8A 2VH0A 5HXFA 1TPSA 3BIVH 5E0HA 2TRMA 1O33A 3QX5H 1GVKB 3U1JB 4GCHF 2QC2A 1A5GH 3D49H 1EAUA 3EDXB 2H2ZA 4IMQA 3UQOA 1ZOMA 2P95A 1A5HA 4VGCC 1SI5H 2A4OA 1AB9C 1O3JA 1QB1A 3TH4H 3UPEA 3I78A 2ZHEH 2BOHB 3RXGA 1AVXA 1SMFE 3QTOH 1P2NA 1KDQB 1MKXK 1TWXB 2O8TA 1RJXB 3FZZA 3DHKH 3F9HA 1ZJDA 1SC8U 3SUGA 2FOHA 4MPWA 1CA8B 1SQOA 1GJ4H 1AZ8A 3K6ZA 1ZHMA 1YKTA 1QY6A 3RXUA 3TNSA 1TQ0B 1K1NA 1HYLA 1FLEE 1QA7A 2CF9H 3DA9B 5DP5A 3SI3H 2LNCA 4A6LA 1O5GH 2FS8A 3A83A 4NWKA 1C5MD 1GWAA 1K1LA 4IBLH 4IGDA 1LHGH 1DWBH 4HI3A 1SGQE 1BDAA 4CRAA 1C5OH 4X6PA 3MU5A 2SGDE 2M5TA 2A4GA 3ZVGA 1GVLA 2PR3A 2SGEE 1FN8A 4YLQH 3ATIA 4KGAA 1FY5A 2C90B 1NTPA 1NFWA 3QZQA 5LH8A 3RXFA 3QN7A 8LPRA 5GJ4B 1O30A 2A7HA 3KN2A 1BMNH 2ESTE 2AGEX 5EXLA 1D3DB 1F0RA 2DE8A 2W3IA 1Z1JA 2ZFFH 4KTCA 2V3HH 3M7UA 5JBAS 1ARBA
chains in the Genus database with same CATH superfamily
1SSXA 1KMHB 4ISHH 1DDJA 1GBIA 4Y11E 1GHBG 4D9QA 3SV9A 1VJAU 5DP8A 2QCYA 6CHAC 2A4RA 1BUIA 2CXVA 2WPLS 4Q4LA 1KSNA 4ZHLU 4WMFA 1CQQA 1S85A 1VITG 3W95A 2WSSD 2C4FH 4X8UH 3UAIC 3PWBA 1EQ9A 3RXTA 1O5AB 1DLEA 5C17A 4F49A 3LU9B 2FM2A 4ZKOU 3F9FA 1O2QA 1Z8IB 2GCTB 4TT3D 1NBMD 3OY5U 1IHTH 1OX1A 1S0RA 4LZ1H 1ZGVA 4WMDA 2GGVB 1V3XA 1O2OA 1GPZA 3Q76A 2BD8A 1C2LA 3P17H 1IQJA 5SGAE 3D62A 2BHGA 2CF8H 4RKOB 4ZUHA 1E1QD 2RA3A 4I8KA 4UE7H 1L0ZA 1K22H 2Z9JA 3ZVFA 5LGOA 3BEUA 3E0PB 1L4ZA 4B75A 4XBBA 4K3JA 3BTQE 4NA9H 1ZTKA 1VJ9U 3U98H 1S6FA 4CRBA 1YP9A 1O3KA 3NUMA 1V2RT 3RU4T 4YXWD 2A2XH 2ULLA 1SQTA 1Y5BT 3QGNB 1TRMA 9ESTA 3TGKE 1Y5UT 1XVMA 3ELAH 1JRSA 1DX5M 2BY6X 3KIDU 3GISB 2W7SA 4ZKSU 3ZVEA 1HNEE 1ORFA 3ZZBA 2ZCKP 1W14U 1O5DH 1KIGH 3MTYA 4BAQB 3MI4A 1GMCF 5HGGA 1SFIA 5A0AE 4Y8ZA 1SKYE 3V13A 1AFQB 1O31A 5A2MH 3UQVA 5CHAC 1W2KH 2DUCA 1THSH 3FVFB 3U69H 3DFLA 1QRXA 4BAHB 1LKAA 3RXHA 3EYDA 4DOQA 2FI4E 1EZUC 1ANCA 2NU0E 4ABGA 1C1UH 3L3TA 3A85A 1O2XA 2BDCA 4J1YA 1WAYB 1QBOA 2PKAB 2BX3A 1RTFB 4M9FA 1C5RA 1NT1A 1L1NA 1W8BH 3EE7A 2VIPA 4X0WU 1Y3XA 3NWUA 2AH4X 2PUXB 3SU1A 3BG4C 1ZJKA 5AVDA 2XWBI 1OP8A 2Y81A 1KXCA 1KLTA 1IOEA 1PQAA 4A1XA 2F9BH 1QZ8A 1UVPA 1ELAA 1ELDE 1HJAB 1ZHPA 4FETA 1DUAA 4HFPB 3SORA 1EAIA 1S84A 3F9EA 1E34B 4NA7A 4P02A 1DOJA 2BDGA 5HMAA 4YT6H 4NIYA 3H7OA 4CRCA 1IQEA 2F43B 3K65B 3FN8A 5JBTA 4UONA 2AGIX 3H7TA 1DT2A 2V3OH 2BVSH 3RXEA 2FYQA 4UDWH 1J15A 1F92A 3HATH 2ZTYA 4OS5A 4ZHMU 3NRLA 1FIZA 4Y7BA 2ZPQA 2ZFPH 2ZECA 3CNRA 1BOQA 2K8IA 1W3CA 1NFYA 1C1PA 1VGCB 4Z6AH 3DCLA 1IQLA 1TPPA 2WPHS 5DKMA 4ABJA 4Y79A 3KYGA 1UTOA 2VIQA 2OCVB 1SGDE 2WYGA 2LELA 4X2XA 1NC6A 2Y82A 3EQ0H 1C2IA 1C4U2 2BD7A 3WWBA 4AFQA 3SJ8A 1HV7A 1Y5AT 2O8UA 3GOVB 1M9UA 4U30A 2J97A 2WV9A 8GCHF 4XSKU 1A3EH 5EG4A 1GVZA 1KXDA 2UWOA 3U9AH 4E06H 2CMYA 3A8DA 5AFYH 4OGYA 2QIQA 4JZFH 1E1RD 2FTMA 5FAHA 1AKSA 2ODPA 1O2UA 3MHWU 3A7YA 1EZXC 4K60A 2J95A 2VVUA 2XOKD 4B6EA 1C2KA 1O37A 4Q2KA 1AN1E 4HZHA 5GXPA 4RI0A 5F8ZA 2V0BA 1CGIE 3KYFA 2AFQB 2EI8A 1TBQH 1JRTA 1Q31A 1QBVH 1TGNA 4Y71A 1TONA 1GGDB 2BD5A 1DWDH 1T4VH 1CT4E 2XWAA 1A7SA 2QXHA 4O97A 3RXVA 2FS9A 2OUAA 3RXRA 2ZHDA 3RXMA 5IK2D 3Q3YA 1EB1H 1BJVA 1RIWB 2H5CA 2IJOB 3VXEH 4SGBE 3G01A 4WVPE 4BAMB 1LHCH 2GKVE 1HJ9A 4ABIA 2ZFQH 1BTXA 2Z9IA 1EJNA 1RXPA 1HLTH 1LVOA 2WINI 3NXPA 2ZHWH 2BTCE 1F0SA 2CHAB 3UB0A 3M35A 3F3BA 1KXFA 1UW7A 2O8MA 2R2WU 3N7EA 1F5KU 2G00A 1HB0B 1Y3VA 3UR9A 5TCCA 1F0UA 1GMCG 1BBRH 1FMGA 1BTWA 1MBQA 2Y7XA 1GJBB 2ANWA 2P16A 3A84A 3URCA 4Z1MD 1SG8B 2J9NA 3E16B 1PPFE 1Z8RA 5DP7A 1W0JD 2PTCE 3A88A 3LGTA 3SU5A 1H8ED 5EQRA 3LT3A 1UTPA 3GCHC 1P02A 3MNSA 2ILNA 1QURH 2M2AA 4B76A 2FTLE 2ZPSA 2VVVA 2VWMA 1SPJA 2Z94A 2VINA 2C8YB 4ZHAA 4GSOA 1Z1IA 1TNKA 2OK5A 1EP5A 1E35B 3EE0B 7KMEH 2VIDA 1GBLA 4INHA 2VWLA 4CH2B 1PPGE 1YPJH 2GV7A 3KQCA 3M3SA 2GMTB 1IAUA 3A87A 1OWJA 1VR1H 1QJ7B 2R0KA 1O5EH 6LPRA 1SLWB 4YOGA 1O2RA 3M7TA 4HTCH 4OS6A 3RC4A 1C5TA 1N8OB 3RXKA 5KECA 1EZQA 1YPGH 1ZPCA 2HNTC 1L2EA 4BAOB 3ZVDA 4Q80A 5E0GA 4FUBA 1TA2A 4FU8A 1AIXH 1WV7H 1EJAA 1V2WT 1CE5A 1D3TB 1QBNA 2CGAA 3GY6A 1LHFH 3A80A 3RDZA 2A45B 1HAVB 1H4WA 3SQEE 4X8TH 5C0TA 2VGCC 1SLVB 2C3SA 1DVAH 5E2PA 5BRRE 1MKWH 2FLRH 4E05H 1GI5A 1EP6A 2QF3A 2C8WB 2G4UA 3LONA 3F2FA 1LO6A 1TB6H 2SGAA 1D3PB 3SI4H 3SJ9A 1GBDA 3PO1B 4KP0A 1NRQH 1CBWB 1RFNA 1TOCB 3RMMH 4D76A 1YGCH 5EW2H 1DICA 1UTNA 3T29A 2ZO3H 1BRUP 1PPHE 3BTEE 1MBMA 1D3QB 4XE4A 3HGNA 4TSFD 1YCPH 3MH4A 4XBDA 2WUBA 1TGBA 3JZ1B 4O03A 2C8ZB 3RC6A 3FP8E 2VIOA 1GHXH 4E7RG 2D2DA 4AGKA 5JB9S 1G2LA 2WHXA 4P00A 4JZDH 1MD8A 1NBME 1K28D 4NG9H 1W11U 1Z7KA 2Y5HA 6GCHF 3V7TA 4F48B 4YLUA 4K1TA 1EASA 1UCYH 4I33A 2IOTA 3SU2A 4CBNA 1ZRBA 1HRTH 2ALVA 2FX6A 3PLBA 1TABE 3OFND 4TWWA 2QXGA 2FZZA 2A7CA 2P93A 2OD3B 2QF0A 1A0HB 1GBTA 1YC0A 5DP9A 2VBCA 2XC0A 2KX4A 2AS9A 1CGHA 4X6MA 4OS2A 2A0QB 2FOAA 5DG6A 3TITA 3NCLA 3M3TA 2UUKB 1G30B 4X1SU 1SGFA 2UWPA 1A61H 2ZF0H 1MU8B 1FV9A 2I6QA 4YTAA 5L2YH 1C1RA 4K1SA 1P11E 1W13U 5EPYA 2ZFTA 1O5CB 1PYTC 3MOCA 1W7XH 2QE7D 3HK3B 1ZPZA 1RTKA 4FUEA 4Q7XA 2ASUB 4GUXA 3BG8A 3VPKA 1QFKH 3T62A 1SGRE 2PKSC 1NS3A 1QHRB 1A0JA 1QJ6B 2P3TB 3LJOA 4ZKRU 5A09A 1O3IA 1KXBA 1GI7B 4XDEA 2UWLA 3CENA 1HXEH 1YLDA 2VVCA 1W12U 2FPZA 4ZAEA 4R8TB 4WH6A 3TLOA 4AFUA 4GAWA 3SV6A 3ATKA 3EGKH 5G4BA 2EA3A 1GDQA 1QL7A 4TPIZ 2BLVA 3T25A 1GMHF 1EKBB 1NFXA 1EB2A 1DPOA 1HAPH 1O3GA 5HM9A 2GZ8A 2G4TA 3TK5A 1AVGH 3MU1A 3RXDA 2ZDMA 1Z8GA 3VB3A 2SGFE 2FOCA 3OE7D 4NSYA 1EFRD 1AMHA 3RXAA 2AMDA 2BYAX 2G51A 1CHOF 1H8IH 3UREA 3C27B 1GCTB 3SU4A 2H5DA 2P8OC 2QF4A 4NWLA 2JETB 4Z0KA 3Q77A 2KAIB 3AASA 1GHYH 1AI8H 3S69A 1ZMJA 3A7WA 3ZVAA 1ETTH 1TGCA 5E2OA 4BANB 5LPRA 3SV7A 1IQKA 3GS9A 1ZRKA 5T3HA 1ETRH 5DP3A 1GJCB 3C1KA 1O3MA 4I86A 4ABFA 3BF6H 2NWNA 3SU3A 1S5SA 1O2GH 3RXOA 1MAXA 1K2I1 2THFB 1KXAA 3MNCA 3SNBA 3UOPA 5I46H 4NIXA 1O2WA 4I8HA 4WF8A 1A1RA 1T8LA 1EATA 4ISNA 1LHEH 4NZQA 1ABJH 2W6ID 1YPMH 1CGJE 2AIQA 1P2KA 3OU0A 2EC9H 1LPKB 3ZZ7A 2KCOA 1OWIA 2W6JD 1G37A 1A46H 1BJUA 2QXIA 4ISLA 4JZ1A 5F8TA 1E38B 4NA8A 3SNEA 2XCFA 3I77A 4KTSA 1THPB 1UVSH 2ZKSA 1XMNB 3GDUA 5FL7D 1AO5A 1SHHB 4UFGH 5C1XA 2ANMH 1A2CH 2ZA5A 1B7XB 4A7IB 1Y3YA 5EQQA 2GV6A 3KQDA 1P12E 4IMZA 5B6LA 3PV2A 3TK6A 2J38A 2G81E 4JYTA 1WDIA 2F3CE 2HRVA 2PTNA 2BLWA 2W7UA 2KZ4A 2BMGB 1DITH 1FUJA 5A0CA 1UHBB 3F0PA 1AE8H 5EODA 1O35A 1NU7B 4AYYB 3V0XA 3F0OA 2XNIA 2J4IA 9LPRA 4WXIA 1GBCA 1C2DA 3PMBB 2ZDNA 3QO6A 3LGVA 1WUNH 3RXBA 1QQ4A 3LOXA 3U8TH 3KHVA 4TY7A 1XM1A 1OYTH 3GCTF 1DUEA 1LVYA 4FU7A 1SL3A 3L33A 3RMOH 1P10A 5IDKA 1MTNB 1G32B 5A0BA 4ABBA 1TLDA 2ZU2A 4B74A 1H9IE 4MTBA 4RKJB 3A81A 2BLQA 3SGBE 2WPDD 2FESH 1T4UH 1D6WA 1NM6A 1V2KT 1HIAB 1MTSA 4B71A 1QRWA 4VGCB 4UFFH 2ZGXH 4ABEA 3VB4A 3VXFH 2L74A 1GJ9B 2ZGBH 3QTVH 4D7FA 2EY4C 1SOZA 4A92A 1O3BA 2FI5E 3UWJH 1MMJN 3H09A 5IYTA 4YO9A 1GI9B 2ZP0H 2XBYA 4ZROA 1JXPA 1PQ7A 5FX5A 1HCGA 1IQMA 5HIZA 3ZZ9A 3BTWE 1GG6C 2Z9KA 3A89A 3SU6A 3F9GA 1MZDA 2Y80A 3E3TA 4CHAB 1HAIH 1SR5C 1VGCC 2VH6A 1O2LA 1QCPA 2F9PA 3R3GB 1O2VA 1KDQA 2FOFA 3HKIB 3GCOA 1NU9A 2A5IA 1BQYA 2K1QA 3GYLB 2L6OA 2PP6A 2AHME 1G36A 1GMHG 3RU4E 5GIBA 2PLXA 1TALA 3ZZ4A 2EI6A 4H4FA 2QAAA 3EAJA 1HAYB 3TH2H 3TK9A 2FMJA 3GY3A 3KGPA 2ZG0H 1GI2A 4GCHG 5LPFA 1GHWH 2F91A 2ZDVH 3ZIAD 1C2MA 4I31A 1CHOG 2JIZD 1GI8B 3NZIA 5FBIA 4I7YH 1VCQA 1MKXH 1P03A 3A8CA 4FUGA 2D26C 4KKDA 5DP4A 2ZTZA 5L30H 4Q63A 5AHGH 2J34A 1HAXB 1QIXB 1YYY1 1L1JA 2B7DH 1C1VH 3TGJE 5E8EH 2KFWA 1EJMA 1J16A 3GDVA 3AAUA 5FXLA 1BRCE 4CR9A 2FOBA 1DSUA 2ZHQH 2GCHF 6CHAB 5JDUB 1W7GH 4FUFA 1T8NA 1GGDC 1GBHA 1UO6A 4DW2U 2QV1A 1XXDA 2F9VA 4Y10E 1V2ST 1O3AA 1P57B 4IN2A 2PWXA 4MG3A 1TGSZ 2GD4B 2IJD1 1S6LA 1EOLA 1BMFD 1W0YH 4B73A 1TNHA 1HBTH 1P3EA 2WV5A 3GY2A 1QNJA 2TBSA 1V2MT 3UNSA 1ZLRA 3RMNH 1E36B 3OAAD 1AFEH 3P70B 1HAOH 1SHYA 1GBEA 2V3MA 2CHAC 1GJAB 2HALA 2RDLA 3BTFE 5FBEA 1VCWA 2XBVA 3ZZ6A 1C5YB 3LGYA 5CHBA 1K1JA 1YLNA 2BD3A 1P2QA 2BOKA 1GI4A 3IWMA 3F68H 5FHTA 3UIRA 1QL8A 1UTQA 1B5GH 2JKHA 2BY7X 1HGTH 4GLYA 1GI6A 4DURA 2ANYA 1D6RA 1GJ7B 4CREA 1ACBE 2WPJS 2Y5FA 2JJ2D 1WTHD 4BOHA 1C5XB 2CJIA 3LH3A 1G3DA 3MO9A 4X6OA 3K6YA 4INLA 1SLUB 4U01A 1OWEA 3M5MA 2PUQH 3RXCA 1AWFH 1ELGA 1LQEA 1QTFA 2KCPA 4GVUA 3UFAA 1AZZA 1PYTD 2CV3A 1WCZA 1C4Y2 3ZZ5A 1GDNA 1OWHA 3GCTG 5L6NH 4MNVA 4OS4A 3S0NA 4ABDA 1CVWH 2ZDLA 3LDXH 1C4V2 2P59A 4JK5A 1TNIA 2UUJB 3DUXH 1V2PT 3FANA 1MH0A 3UUZA 2BZAA 3ZZDA 2GVFA 1EOJA 3UR6A 4I8GA 4D7GA 2BDIA 2F4LA 1D9IA 3GY7A 3SGQE 1B0EA 4ACAA 3N7OA 4MQAA 5C2ZA 1C5VA 2QA9E 4PROA 4ASHA 4X2VA 4H42U 5JBCS 2C93B 2CN0H 1FXYA 4NFEA 2W26A 4ZCNA 4FXGH 1TX8A 3TJOA 1YCPK 1ETSH 1ZTJA 2ZGCA 1DXWA 1O2PA 1SGTA 4WJG2 3W94A 2FX4A 1S0QA 4KTUA 3FFGA 1O2NA 5FCKA 4CRDA 2VB0A 1MUEB 2WPKS 2GT8A 3AK5A 2OP9A 2FP7B 2ODYB 4IC6A 5FPSA 3BG4B 3NPSA 3TPIZ 4Y7AA 2PKAA 3M5LA 3PWCA 4OGXA 1O3HA 1GI1A 2R3UA 2YMSC 4U32A 2ZGHA 1QL9A 2C8XB 4B2CA 2F9OA 4Y76A 3SOSA 2ALPA 4NGAH 1OWDA 1EPTB 1GHZA 1PPBH 3GY5A 4NIVA 3PO1C 1ELVA 1FY8E 2FOGA 4K8BA 4U2WA 1CT2E 4K5ZA 3F2HA 1GI0A 1VZQH 3BIUH 3SYJA 2OBOA 1YF4A 5AF9H 1CA0B 1C1OA 1TMTH 4SGAE 1EAWA 2WYJA 3BTME 3WY8A 2VIVA 1SGEE 1BTZA 1SFQB 1TPOA 1UK3A 1XUIA 1C5PA 3U8OH 2A31A 1FDPA 1O39A 5E0JA 2TGTA 3ZZ3A 4ZXYH 2NU1E 1NY22 3S9AA 3O8CA 1W0KD 4FUJA 2FODA 2A5AA 2RA0A 2TIOA 4MLFB 4WH8A 4MPXA 3A8BA 3MH6A 1INCA 4O9VA 1P2OA 4HG6A 2JJ1D 1UTJA 3SU0A 4Q7YA 2OC8A 2AEIH 2IPQX 1K21H 4TPYA 2XCNA 4CRGA 2GCHG 1O36A 4X1RU 1MU6B 5DGJA 1ZMLA 3PTNA 5JB8S 5HYOA 4MDSA 1CSOE 4NCYA 2P3FH 3U28C 3OSYA 1THRH 3TH3H 1P2MA 2OINA 1P9SA 3KL6A 5H4IB 1ESBA 2ZDKA 2GZ7A 4YZUA 1TIOA 3PM3A 3D23A 1CU1A 2VJ1A 1ZGIA 1C2GA 2FYRA 3MWIU 4WXVA 4XD7D 4H6SB 3STJA 2HWLB 3K9XB 4AN7A 4DVAU 3CS7A 3SO3A 4BNRA 5K0HA 4I32A 4AC9A 3SN8A 2JH5D 2IN2A 3WW7A 2FDAA 4OS1A 1H8HD 1LQDB 1C5LH 3PRDA 3P8OA 2RFKC 1F5RA 3OYPA 2BY5X 3T27A 3TJVA 1AUJA 1ZYOA 1EAXA 3MMGA 1O2MA 3SGAE 2OBQA 1OXGA 3SNAA 5CMXH 1ZPBA 3BTKE 1T8MA 2LPRA 3VB5A 2OTVA 1NRRH 4DT4A 5C94A 1YPKH 2SGQE 2XXLA 4ABAA 3RXLA 1P9UA 3FP6E 1V2VT 5BPEA 3RXPA 3AAVA 1ESAA 3P8GA 1JWTA 2HPPH 2SNWA 5KEDA 2OC7A 8GCHG 2RG3A 1NESE 1TQ7B 1BTYA 2J98B 2TPIZ 1P05A 3GDSA 4K2YA 1FY1A 1CHGA 3ZZAA 5EW1H 4YOJA 2WPMS 1V2NT 3LKWA 4OM9A 2FIRH 2F9UA 1O2SA 1CO7E 1GCTC 1NRPH 1OP0A 3OEHD 3VFEA 4AFZA 1CT0E 1HPGA 1O3PB 1OS8A 3MO3A 2JETC 1TAWA 1UVUH 3RXQA 2G5VA 1Q2WA 3LGIA 2H9TH 1HJ8A 2BD2A 1O5BB 3T28A 2ZFSA 3LGUA 1C5NH 1O0DH 1RTLA 2LP6A 3EA7A 3GCHB 3M37A 2BB4A 1OWKA 1K1PA 1HAHH 3SNCA 1G3CA 1GHBF 1DSTA 4MNXA 5EOKA 1F5LA 4RT0A 1C1SA 5AFZH 2FXRA 2ZCHP 2XC4A 1WYKA 1FNIA 2UUYA 1WBGB 1HAGE 1WSSH 3E0NB 1FY3A 1P2IA 3P8FA 3UWIA 3FZDA 1G3BA 5EJLA 1SVPA 2Y5GA 1O2TA 1AD8H 2YNBA 1YWUA 3KEEA 2BY9X 3P92A 1FQ3A 3AVZA 1C2EA 1DY8A 3DT0H 1BCUH 1XXFA 3EA8A 3NKKA 4O3TA 2QN5T 3SJIA 3GCNA 3QWCH 2ZI2H 3TNTA 3TVJB 2SFAA 5TCAA 3A8AA 1MTWA 2R0LA 5DSFA 2JH0D 1C2JA 3PLPA 3MYWA 1QR3E 2KR7A 4YESB 4X1QU 4TYDA 1O2HA 2HLDD 3F1SB 2OC0A 3ZV8A 1FZZA 1SB1H 4D9RA 4XOJA 4DJZB 2A4QA 2QF5A 1OOKB 3SHCH 1BRBE 1DM4B 1GBFA 4D8NA 2V7QD 4XFQA 2TGPZ 2G52A 3M7QA 2STAE 5C1UA 2R3YA 1Y59T 3ZYEA 1BRAA 5EGMA 4JYUH 1TBRH 2VGCB 2ZHFH 3PB1E 2ZWLH 1LHDH 4B2AA 1P0SH 1AU8A 1BBRE 2F9NA 3TGIE 3TJUA 2Y6TA 1XX9A 3TU7H 4XBCA 1RGQA 5FCRA 1O3DA 1YPHE 1GJ5H 1K9OE 1ELEE 1HAVA 4IS5A 2J5UA 2GCTC 1WOFA 1F2SE 2JH6D 1TX7A 5JBBS 2Q6GA 2B5TB 1AQ7A 5T1VA 3ZV9A 1FJSA 3OTJE 2ZGJA 3RXJA 2PHBA 3BTTE 5JYIA 1Z8JB 1NZQH 3D65E 1H9HE 1K1OA 2GX4A 4NIWA 3IITA 3S9CA 3GICB 1IQNA 1O34A 1ELCA 2Z9LA 1FONA 4Y8XA 1PPCE 1PQ5A 1F0TA 3VB7A 1XKBC 1MAYA 3LJJA 1J8AA 1KYNA 1IQHA 2V6NA 4FU9A 1FX0B 2AMPA 1JOUB 1HAZB 1UTLM 1BIOA 1G3EA 1O2JA 3OTPA 1AY6H 1UTKA 3RXIA 2B8OH 1AUTC 3VGCB 4O3UA 4BAKB 1BMAA 3MQKC 4DIHH 1GBJA 4F4OC 1MCTA 4NFFA 4CHAC 2JDID 3HPTB 1QRZA 2Z3CA 2BDYA 1UTMA 1YM0A 3EA9A 3LC3A 3B9FH 2AMQA 4F55A 1GJ6A 2ZDAH 4AYVB 3DFJA 1Y3WA 3SJKA 1MTVA 4Y0ZE 1QB9A 1BA8B 1AFQC 1H1BA 1ABIH 1BTUA 2AIPA 4RT1A 2RDEA 3GY4A 1P2JA 5A8YA 2PSXA 4AZ2B 1SGCA 3RUOA 1IQIA 4ZXXH 2KCYA 1PJPA 2Z3DA 1C5QA 1LDTT 4AX9H 1TMBH 2BD4A 5F03A 3SNDA 3SQHE 3Q00A 1KLIH 4HGCA 1V2UT 2PKSB 3E8LA 1TNJA 2BDBA 1O3FA 3KCGH 5CDFE 1D4PB 3R0FA 2GJGA 3SUDA 1NROH 1JBUH 2EI7A 3LIWA 4DT7B 1TGTA 5C3NA 1SLXB 6GCHG 4B1TA 4UFEH 1L4DA 4X2WA 3TJNA 3VEQB 2YMSD 4JCNA 5J4QA 3RXSA 3A82A 1P8VC 1V2TT 2Q6DA 1S6HA 1TFXA 4CR5A 3I29A 4DY7B 2ZU5A 3QGJA 1MD7A 5HM2A 4ZKNU 1V6DA 1TRYA 1EUFA 2Q1JA 1ZZZA 1NN6A 1PQ8A 1HJAC 1ANBA 3S7HB 2XBXA 4Y8YA 1UMAH 5PTPA 1ID5H 1E79D 2ZEBA 1PPZA 2D8WA 1FI8A 3IG6B 1XUJA 4UD9H 2AERH 1TX6A 2P8OB 1AB9B 1UCYE 8ESTE 2PGQB 2BX4A 2K0QA 1P09A 4A1VA 3URDA 4YM9A 3ODFA 7GCHF 1RD3B 3B23B 1YBWA 2ANKH 3DD2H 1QJ1B 3O8RA 2WUCA 1DFPA 1JIMA 5EQSA 1WU1A 1GBAA 1MQ6A 1G2MA 3MH5A 3LPRA 4INKA 5T6GA 3RC5A 1IQGA 2Q6FA 1KY9A 1XUFA 3O8BA 1ZTLA 4LXBH 2KAIA 1FPHH 3E6PH 3KF2A 3RM2H 2GZ9A 3SHAH 1N6XA 1OYQA 3MU4A 2HLCA 4XRNA 4AB9A 1TOMH 3LGWA 1NFUA 5T6FA 2D1JA 5C5OA 1O3CA 1XKAC 1AKSB 1XUGA 2A7JA 4QT8C 2ZTXA 1G9IE 1AWHB 1C1MA 1NPMA 3PV4A 1UK4A 2XC5A 2XTTB 1A3BH 3M61U 5DK1A 3Q3KA 1GHAF 4R0IA 3SJOA 3MU8A 1FN6A 4X6NA 3FKSD 2FI3E 2FWWA 3V3MA 1HXFH 2DE9A 3W1EA 1C2FA 1OP2A 5K7RA 1GHVH 3M36A 1Q3XA 2O8LA 1ELFA 1BBRK 7ESTE 2VNTA 2G55A 3T2NA 1LMWB 2ZQ2A 2G8TA 5C5NA 5HKKD 1YLCA 2I6SA 4X2YA 5ESBA 1AGJA 2FOEA 1DE7H 3QLPH 4Y6DA 1C1NA 4MPVA 2ZNKH 3V12A 5EXNA 4MNWA 4DGJA 1BTHH 1BHXB 5FPTA 1A5IA 4AOQA 3HKJB 1FAXA 3E91A 1V2OT 1BMMH 1MABB 1UHBA 2BLOA 2W5EA 3BTDE 1T8OA 1RIWC 1LVBA 7LPRA 5LPEA 1BMLA 1ZSJA 1SGNE 5DN6D 4UEHH 1HDTH 2QGRA 1TE0A 2HVYB 1EPTC 3ZYDA 1Z6EA 3RLYH 1V2LT 3PMAB 1LPGB 1OHHD 3U8RH 3E1XB 1JIRA 3M5NA 3B8JA 1UVTH 4B2BA 1BTPA 4MPUA 3QK1A 1TMUH 1O2ZA 1CA0C 3ATMA 1SQRA 1NO9H 3GY8A 3ENSB 1J9CH 3M5OA 1UK2A 2IPHA 2BXTH 3ATLA 4IC5A 2A32A 5C1YA 5EU8A 4AB8A 1HIAA 2QY0B 2YOLA 1O2YA 1GMDF 1ARCA 6ESTA 1ANEA 1XVOA 4ZMAH 1GG6B 2H6MA 2Y7ZA 1GBBA 4BTIB 4RSPA 4WMEA 4FUCA 1S82A 2BDAA 4H6TA 1SBWA 2R2MB 1IQFA 3RLWH 3OY6U 2HNTF 3OX7U 2GDEH 5I25A 2AGGX 1N6YA 1DWEH 1EXFA 1NRSH 1P01A 1YPLH 2NU3E 2XRCA 5GCHF 1MKWK 4LOYH 3SW2B 2V35A 4ACBA 4ZH8A 4BXSA 4JYVH 2GMTC 2BY8X 5CHAB 3RM0H 5EXMA 2BXUH 5GNDA 5DP6A 1XUHA 2VWNA 2H9HA 1W10U 1B0FA 1N8OC 2KCAA 1MTUA 5EIYA 2GT7A 3MNXA 1VCPA 1GJ8B 1ZSLA 5ESTE 2HPQH 5DPAA 3ZZCA 3PRBA 2XYAA 5ETXA 4ISOA 1SGFG 7GCHG 2O9QA 1UJ1A 2A2QH 2FOMB 1O3LA 1MQ5A 1C1WH 4A1TA 3SZNA 3L6PA 2J94A 1K1IA 3T5FH 4RN6A 4X1NU 1V2QT 2Z7FE 1C5WB 4LZ4B 5F6MA 5C67A 3O8DA 4X1PU 3A7ZA 5DJ7A 1ZHRA 2J92A 2WV4A 1N1LA 1UCYK 2ZFRH 2BQ7B 2OQ5A 1DS2E 1FY4A 3ITIA 4ASUD 3P8NA 1O2IA 1ZMNA 1KXEA 1P06A 1J14A 4K1EA 4FUHA 1XUKA 4YOIA 1CBWC 1PPEE 3AW0A 1Z6JH 2BQ6B 2OLGA 2ZIQH 3QZRA 2ZPRA 2ODQA 1QGFA 4WWYA 1WQSA 1LTOA 2EEKA 3BEFB 4FVDA 3RP2A 4J2YB 1O3NA 3A7TA 4KELA 1GHAG 2GP9B 3P95A 4Q7ZA 5L2ZH 1IHSH 1LKBA 2J2UA 2ZC9H 4FUDA 5EPNA 2BQWB 2BVRH 3VB6A 4AORA 4DG4A 3ZVBA 3FOAA 1BB0B 1NRNH 2FO9A 2GDDA 4JZIA 1GI3A 3PTBA 4AFSA 3AW1A 1O3OA 1PFXC 1TPAE 2EQNA 1T7CA 3ATWA 1QB6A 2SGPE 2ZU1A 3BEIB 5B6OA 4IN1A 4DIIH 2BM2A 3RU4D 5A8ZA 2ZQ1A 3WWFA 3PMHB 1O32A 2FLBH 2QXJA 1HFDA 2FEQH 4BTTB 1W0ZU 1C5ZB 3UNRA 2Z9GA 5KGOA 5T6DA 3PV5A 1COWD 1E0FD 2XW9A 3K2UA 1BZXE 2B9LA 4K69A 1OPHB 3F2GA 8KME2 2BDHA 5F53A 1U6QA 3E90B 1C5SA 4I8JA 2P3UB 1MZAA 1MCVA 3A7VA 1HUTH 4JZEH 2KM0A 1GBKA 3DSOA 2O8WA 5GPIB 2VU8E 3UTUH 1KTTB 3U1IB 2OC1A 1Z71A 1C1TA 2WZQA 2P94A 1L1GA 2NU2E 1SGPE 4B6FA 3MH7A 3PMJA 1FPCH 1RS0A 1K1MA 4ESTE 1T31A 1KTSB 2BVXH 4WY3A 1C9TA 4M7GA 2WPIS 4E7NA 2GTBA 3ZZ8A 4JMYA 3A86A 4OS7A 1P3CA 5HIYA 1TA6A 2ZZUH 1LPZB 1YY3A 5ABWA 4FVBA 4TY6A 1C2HA 4BTUB 2VWOA 3FO8D 1J17T 3S7KB 2A5KA 2OQUA 3PROA 3GYMA 2XBWA 3UOUA 4ABHA 2G5NA 1ZSKA 4BXWA 3VG8A 5C0UA 1E37B 1SGYE 2Z3EA 3HK6B 5GDSH 1VKYA 1C9PA 1QQUA 1GMDG 2QYIA 2W3KA 1KLJH 3F6UH 1RRKA 1LCYA 1TNGA 1WTGH 5C20A 3CS0A 2OXSA 3M3VA 3STIA 2BZ6H 1TBZH 3SV2H 5CE1A 2YMSB 2Z6BD 2HGTH 1H8DH 3UNQA 1SQAA 1YPHC 2YNAA 5GCHG 4UFDH 1AHTH 1O2KA 4GHQA 1SGIB 2PGBB 2PV9B 4NZLA 3CP7A 2HVXA 3PLKA 4I8LA 3HGPA 1GL1A 2B0FA 4CH8B 1ELBA 3BV9B 5FPYA 1ESTA 2TGDA 1A4WH 2A1DB 3ODDA 1ANDA 1EPTA 1V2JT 4AG1A 1AE5A 5DO4H 2PFEA 4AG2A 1AVWA 4MVNA 5J4SA 4FUIA 1DY9A 1C5UA 2F83A 2BD9A 1QA0A 1EZSC 3OEED 4Y0YE 2PSYA 3S9BA 1JMOH 4NSVA 1Y8TA 1EX3A 1OKXA 1VITF 4A5TS 1TNLA 2ZCLP 1O38A 1X7AC 3SZEA 5JPMH 3H5CB 2TGAA 1OSSA 3VGCC 5GWZA 3FP7E 5EJ1A 2H9EH 2HOBA 2ZU3A 2H1UA 3JZ2B 1GBMA 2XNDD 4LK4A 3Q3XA 1DLKB 1DXPA 1S81A 1C1QA 5FX6A 1GL0E 1UVOA 2ZU4A 1Y3UA 1DANH 1O5FH 1FAKH 4THNH 4YT7H 1BHXF 3P6ZB 4IW4E 4AGJA 4K8YA 1BITA 3ZVCA 3TIUA 3BSQA 3UY9A 2PW8H 3LC5A 2STBE 1H9LB 1GDUA 1S83A 3BTHE 3LH1A 4DCDA 3MO6A 2HNTE 4MNYA 3RMLH 4CBOA 3ESTA 4GPGA 1GJDB 1YCPM 3PYHA 1GCDA 3KNXA 1VITH 2CK3D 4GHTA 3SUFA 1BT7A 3BTGE 4JK6A 1TYNA 1P04A 3FAOA 3N7DA 1F7ZA 1A0LA 2SNVA 3SV8A 3KQEA 1LVMA 1ZR0A 1T32A 1ELTA 3BN9A 2NU4E 2UUFB 1WXRA 1TRNA 1K0HA 3QDZB 5A8XA 4X8SH 3A7XA 5TJXA 3MNBA 3SUEA 3T26A 3DSGA 1O3EA 3MFJA 4CRFA 3KQBA 2VIWA 4TWYA 1WQVH 4X8VH 3MU0A 3QUMP 1MTNC 2RCEA 1YPEH 4ISIH 5F8XA 3SBKA 2R9PA 1DWCH 1FIWA 3N99A 1SOTA 2AYWA 3NK8A 2VH0A 5HXFA 1TPSA 3BIVH 5E0HA 2TRMA 1O33A 3QX5H 1GVKB 3U1JB 4GCHF 2QC2A 1A5GH 3D49H 1EAUA 3EDXB 2H2ZA 4IMQA 3UQOA 1ZOMA 3DSPA 2P95A 1A5HA 4VGCC 1SI5H 2A4OA 1AB9C 1O3JA 1QB1A 3TH4H 3UPEA 3I78A 2ZHEH 2BOHB 3RXGA 1AVXA 1SMFE 3QTOH 2J98A 1P2NA 1KDQB 1MKXK 1TWXB 2O8TA 1RJXB 3FZZA 3DHKH 3F9HA 1ZJDA 1SC8U 3SUGA 4FOUC 2FOHA 4MPWA 1CA8B 1SQOA 1GJ4H 1AZ8A 3K6ZA 1ZHMA 1YKTA 1QY6A 3RXUA 3TNSA 1TQ0B 3KQ5A 1K1NA 1HYLA 1FLEE 1QA7A 2CF9H 3DA9B 5EJZA 5DP5A 3SI3H 2LNCA 4A6LA 1O5GH 2FS8A 3A83A 4NWKA 1C5MD 1GWAA 1K1LA 4IBLH 4IGDA 1LHGH 1DWBH 4HI3A 1SGQE 1BDAA 4CRAA 1C5OH 4X6PA 3MU5A 2SGDE 2M5TA 2A4GA 3ZVGA 1GVLA 2PR3A 2SGEE 1FN8A 4YLQH 3ATIA 4KGAA 1FY5A 2C90B 1NTPA 1NFWA 3QZQA 5LH8A 3RXFA 3QN7A 8LPRA 5GJ4B 1O30A 2A7HA 3KN2A 1BMNH 2ESTE 2AGEX 5EXLA 1D3DB 1F0RA 2DE8A 2W3IA 1Z1JA 2ZFFH 4KTCA 2V3HH 3M7UA 5JBAS 1ARBA
chains in the Genus database with same CATH topology
1SSXA 4ISHH 1DDJA 1GBIA 4Y11E 1GHBG 4D9QA 3SV9A 1VJAU 5DP8A 2QCYA 6CHAC 2A4RA 1BUIA 2CXVA 2WPLS 1KSNA 4ZHLU 4WMFA 1CQQA 1S85A 1VITG 3W95A 2C4FH 4X8UH 3PWBA 1EQ9A 3RXTA 1O5AB 1DLEA 4F49A 3LU9B 2FM2A 4ZKOU 3F9FA 1O2QA 1Z8IB 2GCTB 3OY5U 1IHTH 1OX1A 1S0RA 4LZ1H 1ZGVA 4WMDA 2GGVB 1V3XA 1O2OA 1GPZA 3Q76A 2BD8A 1C2LA 3P17H 1IQJA 5SGAE 3D62A 2BHGA 2CF8H 4RKOB 4ZUHA 2RA3A 4I8KA 4UE7H 1L0ZA 1K22H 2Z9JA 3ZVFA 5LGOA 3BEUA 3E0PB 1L4ZA 4B75A 4XBBA 4K3JA 3BTQE 4NA9H 1ZTKA 1VJ9U 3U98H 1S6FA 4CRBA 1YP9A 1O3KA 3NUMA 1V2RT 3RU4T 2A2XH 2ULLA 1SQTA 1Y5BT 3QGNB 1TRMA 9ESTA 3TGKE 1Y5UT 1XVMA 3ELAH 1JRSA 1DX5M 2BY6X 3KIDU 3GISB 2W7SA 4ZKSU 3ZVEA 1HNEE 1ORFA 3ZZBA 2ZCKP 1W14U 1O5DH 1KIGH 3MTYA 4BAQB 3MI4A 1GMCF 5HGGA 1SFIA 5A0AE 4Y8ZA 3V13A 1AFQB 1O31A 5A2MH 3UQVA 5CHAC 1W2KH 2DUCA 1THSH 3FVFB 3U69H 3DFLA 1QRXA 4BAHB 1LKAA 3RXHA 3EYDA 4DOQA 2FI4E 1EZUC 1ANCA 2NU0E 4ABGA 1C1UH 3L3TA 3A85A 1O2XA 2BDCA 4J1YA 1WAYB 1QBOA 2PKAB 2BX3A 1RTFB 1C5RA 1NT1A 1L1NA 1W8BH 2VIPA 4X0WU 1Y3XA 3NWUA 2AH4X 2PUXB 3SU1A 3BG4C 1ZJKA 5AVDA 2XWBI 1OP8A 2Y81A 1KXCA 1KLTA 1IOEA 1PQAA 4A1XA 2F9BH 1UVPA 1ELAA 1ELDE 1HJAB 1ZHPA 4HFPB 1DUAA 3SORA 1EAIA 1S84A 3F9EA 1E34B 4NA7A 1DOJA 2BDGA 5HMAA 4YT6H 4NIYA 3H7OA 4CRCA 1IQEA 3K65B 5JBTA 4UONA 2AGIX 3H7TA 1DT2A 2V3OH 2BVSH 3RXEA 2FYQA 4UDWH 1J15A 1F92A 3HATH 2ZTYA 4OS5A 4ZHMU 1FIZA 4Y7BA 2ZPQA 2ZFPH 2ZECA 1BOQA 1W3CA 1NFYA 1C1PA 1VGCB 4Z6AH 1IQLA 1TPPA 2WPHS 5DKMA 4ABJA 4Y79A 1UTOA 2VIQA 2OCVB 1SGDE 2WYGA 4X2XA 1NC6A 2Y82A 3EQ0H 1C2IA 1C4U2 2BD7A 4AFQA 3SJ8A 1HV7A 1Y5AT 2O8UA 3GOVB 1M9UA 4U30A 8GCHF 4XSKU 1A3EH 5EG4A 1GVZA 1KXDA 2UWOA 3U9AH 4E06H 2CMYA 3A8DA 5AFYH 4OGYA 2QIQA 4JZFH 2FTMA 5FAHA 1AKSA 2ODPA 1O2UA 3MHWU 3A7YA 1EZXC 4K60A 2J95A 2VVUA 1C2KA 1O37A 4Q2KA 1AN1E 4HZHA 5GXPA 5F8ZA 2V0BA 1CGIE 2AFQB 2EI8A 1TBQH 1JRTA 1Q31A 1QBVH 1TGNA 4Y71A 1TONA 1GGDB 2BD5A 1DWDH 1T4VH 1CT4E 2XWAA 1A7SA 2QXHA 4O97A 3RXVA 2FS9A 2OUAA 3RXRA 2ZHDA 3RXMA 3Q3YA 1EB1H 1BJVA 1RIWB 2H5CA 2IJOB 3VXEH 4SGBE 3G01A 4WVPE 4BAMB 1LHCH 2GKVE 1HJ9A 4ABIA 2ZFQH 1BTXA 2Z9IA 1EJNA 1RXPA 1HLTH 1LVOA 2WINI 3NXPA 2ZHWH 2BTCE 1F0SA 2CHAB 3M35A 1KXFA 2O8MA 2R2WU 1F5KU 2G00A 1HB0B 1Y3VA 3UR9A 5TCCA 1F0UA 1GMCG 1BBRH 1FMGA 1BTWA 1MBQA 2Y7XA 1GJBB 2ANWA 2P16A 3A84A 3URCA 1SG8B 2J9NA 3E16B 1PPFE 1Z8RA 5DP7A 2PTCE 3A88A 3LGTA 3SU5A 5EQRA 3LT3A 1UTPA 3GCHC 1P02A 3MNSA 2ILNA 1QURH 4B76A 2FTLE 2ZPSA 2VVVA 2VWMA 1SPJA 2Z94A 2VINA 2C8YB 4ZHAA 4GSOA 1Z1IA 1TNKA 1EP5A 1E35B 3EE0B 7KMEH 2VIDA 1GBLA 4INHA 2VWLA 4CH2B 1PPGE 1YPJH 2GV7A 3KQCA 3M3SA 2GMTB 1IAUA 3A87A 1OWJA 1VR1H 1QJ7B 2R0KA 1O5EH 6LPRA 1SLWB 4YOGA 1O2RA 3M7TA 4HTCH 4OS6A 3RC4A 1C5TA 1N8OB 3RXKA 1EZQA 1YPGH 1ZPCA 2HNTC 1L2EA 4BAOB 3ZVDA 4Q80A 5E0GA 4FUBA 1TA2A 4FU8A 1AIXH 1WV7H 1EJAA 1V2WT 1CE5A 1D3TB 1QBNA 2CGAA 3GY6A 1LHFH 3A80A 3RDZA 2A45B 1HAVB 1H4WA 3SQEE 4X8TH 2VGCC 1SLVB 2C3SA 1DVAH 5E2PA 5BRRE 1MKWH 2FLRH 4E05H 1GI5A 1EP6A 2QF3A 2C8WB 2G4UA 3LONA 1LO6A 1TB6H 2SGAA 1D3PB 3SI4H 3SJ9A 1GBDA 3PO1B 4KP0A 1NRQH 1CBWB 1RFNA 1TOCB 3RMMH 4D76A 1YGCH 5EW2H 1DICA 1UTNA 3T29A 2ZO3H 1BRUP 1PPHE 3BTEE 1MBMA 1D3QB 4XE4A 3HGNA 1YCPH 3MH4A 4XBDA 2WUBA 1TGBA 3JZ1B 4O03A 2C8ZB 3RC6A 3FP8E 2VIOA 1GHXH 4E7RG 2D2DA 4AGKA 5JB9S 1G2LA 4JZDH 1MD8A 1K28D 4NG9H 1W11U 1Z7KA 2Y5HA 6GCHF 3V7TA 4YLUA 4K1TA 1EASA 1UCYH 4I33A 2IOTA 3SU2A 4CBNA 1ZRBA 1HRTH 2ALVA 2FX6A 3PLBA 1TABE 4TWWA 2QXGA 2FZZA 2A7CA 2P93A 2OD3B 2QF0A 1A0HB 1GBTA 1YC0A 5DP9A 2XC0A 4X6MA 2AS9A 1CGHA 4OS2A 2A0QB 2FOAA 5DG6A 3TITA 3NCLA 3M3TA 2UUKB 1G30B 4X1SU 1SGFA 2UWPA 1A61H 2ZF0H 1MU8B 1FV9A 2I6QA 4YTAA 5L2YH 1C1RA 4K1SA 1P11E 1W13U 5EPYA 2ZFTA 1O5CB 1PYTC 3MOCA 1W7XH 3HK3B 1ZPZA 1RTKA 4FUEA 4Q7XA 2ASUB 4GUXA 3BG8A 3VPKA 1QFKH 3T62A 1SGRE 2PKSC 1NS3A 1QHRB 1A0JA 1QJ6B 2P3TB 3LJOA 4ZKRU 5A09A 1O3IA 1KXBA 1GI7B 4XDEA 2UWLA 3CENA 1HXEH 1YLDA 2VVCA 1W12U 2FPZA 4ZAEA 4R8TB 4WH6A 3TLOA 4AFUA 4GAWA 3SV6A 3ATKA 3EGKH 5G4BA 2EA3A 1GDQA 1QL7A 4TPIZ 2BLVA 3T25A 1GMHF 1EKBB 1NFXA 1EB2A 1DPOA 1HAPH 1O3GA 5HM9A 2GZ8A 2G4TA 3TK5A 1AVGH 3MU1A 3RXDA 2ZDMA 1Z8GA 3VB3A 2SGFE 2FOCA 4NSYA 1AMHA 3RXAA 2AMDA 2BYAX 2G51A 1CHOF 1H8IH 3UREA 3C27B 1GCTB 3SU4A 2H5DA 2P8OC 4NWLA 2JETB 4Z0KA 3Q77A 2KAIB 3AASA 1GHYH 1AI8H 3S69A 1ZMJA 3A7WA 3ZVAA 1ETTH 1TGCA 5E2OA 4BANB 5LPRA 3SV7A 1IQKA 1ZRKA 5T3HA 1ETRH 5DP3A 1GJCB 3C1KA 1O3MA 4ABFA 3BF6H 2NWNA 3SU3A 1S5SA 1O2GH 3RXOA 1MAXA 1K2I1 2THFB 1KXAA 3MNCA 3SNBA 3UOPA 5I46H 4NIXA 1O2WA 4I8HA 4WF8A 1A1RA 1T8LA 1EATA 4ISNA 1LHEH 4NZQA 1ABJH 1YPMH 1CGJE 2AIQA 1P2KA 3OU0A 2EC9H 1LPKB 3ZZ7A 1OWIA 1G37A 1A46H 1BJUA 2QXIA 4ISLA 4JZ1A 5F8TA 1E38B 4NA8A 3SNEA 2XCFA 3I77A 4KTSA 1THPB 1UVSH 2ZKSA 1XMNB 3GDUA 1AO5A 1SHHB 4UFGH 5C1XA 2ANMH 1A2CH 2ZA5A 1B7XB 4A7IB 1Y3YA 5EQQA 2GV6A 3KQDA 1P12E 4IMZA 3TK6A 2J38A 2G81E 4JYTA 2F3CE 2HRVA 2PTNA 2BLWA 2W7UA 2BMGB 1DITH 1FUJA 5A0CA 1UHBB 1AE8H 5EODA 1O35A 1NU7B 4AYYB 3V0XA 2XNIA 2J4IA 9LPRA 4WXIA 1GBCA 1C2DA 3PMBB 2ZDNA 3QO6A 3LGVA 1WUNH 3RXBA 1QQ4A 3LOXA 3U8TH 3KHVA 4TY7A 1XM1A 1OYTH 3GCTF 1DUEA 1LVYA 4FU7A 1SL3A 3L33A 3RMOH 1P10A 5IDKA 1MTNB 1G32B 5A0BA 4ABBA 1TLDA 2ZU2A 4B74A 1H9IE 4MTBA 4RKJB 3A81A 2BLQA 3SGBE 2FESH 1T4UH 1D6WA 1NM6A 1V2KT 1HIAB 1MTSA 4B71A 1QRWA 4VGCB 4UFFH 2ZGXH 4ABEA 3VB4A 3VXFH 1GJ9B 2ZGBH 3QTVH 4D7FA 1SOZA 4A92A 1O3BA 2FI5E 3UWJH 1MMJN 5IYTA 4YO9A 1GI9B 2ZP0H 2XBYA 4ZROA 1JXPA 1PQ7A 5FX5A 1HCGA 1IQMA 3ZZ9A 3BTWE 1GG6C 2Z9KA 3A89A 3SU6A 3F9GA 1MZDA 2Y80A 3E3TA 4CHAB 1HAIH 1SR5C 1VGCC 2VH6A 1O2LA 1QCPA 2F9PA 3R3GB 1O2VA 1KDQA 2FOFA 3HKIB 3GCOA 1NU9A 2A5IA 1BQYA 2K1QA 3GYLB 1G36A 1GMHG 3RU4E 5GIBA 2PLXA 1TALA 3ZZ4A 2EI6A 4H4FA 2QAAA 3EAJA 1HAYB 3TH2H 3TK9A 2FMJA 3GY3A 3KGPA 2ZG0H 1GI2A 4GCHG 5LPFA 1GHWH 2F91A 2ZDVH 1C2MA 4I31A 1CHOG 1GI8B 3NZIA 5FBIA 4I7YH 1VCQA 1MKXH 1P03A 3A8CA 4FUGA 2D26C 4KKDA 5DP4A 2ZTZA 5L30H 5AHGH 2J34A 1HAXB 1QIXB 1YYY1 1L1JA 2B7DH 1C1VH 3TGJE 5E8EH 1EJMA 1J16A 3GDVA 3AAUA 5FXLA 1BRCE 4CR9A 2FOBA 1DSUA 2ZHQH 2GCHF 6CHAB 5JDUB 1W7GH 4FUFA 1T8NA 1GGDC 1GBHA 1UO6A 4DW2U 2QV1A 1XXDA 2F9VA 4Y10E 1V2ST 1O3AA 1P57B 4IN2A 2PWXA 4MG3A 1TGSZ 2GD4B 1EOLA 1W0YH 4B73A 1TNHA 1HBTH 1P3EA 2WV5A 3GY2A 1QNJA 2TBSA 1V2MT 3UNSA 1ZLRA 3RMNH 1E36B 1AFEH 3P70B 1HAOH 1SHYA 1GBEA 2CHAC 1GJAB 2HALA 2RDLA 3BTFE 5FBEA 1VCWA 2XBVA 3ZZ6A 1C5YB 3LGYA 1K1JA 2BD3A 1P2QA 2BOKA 1GI4A 3IWMA 3F68H 5FHTA 3UIRA 1QL8A 1UTQA 1B5GH 2JKHA 2BY7X 1HGTH 4GLYA 1GI6A 4DURA 2ANYA 1D6RA 1GJ7B 4CREA 1ACBE 2WPJS 2Y5FA 1WTHD 4BOHA 1C5XB 2CJIA 3LH3A 1G3DA 3MO9A 4X6OA 3K6YA 4INLA 1SLUB 4U01A 1OWEA 3M5MA 2PUQH 3RXCA 1AWFH 1ELGA 1LQEA 1QTFA 4GVUA 3UFAA 1AZZA 1PYTD 2CV3A 1WCZA 1C4Y2 3ZZ5A 1GDNA 1OWHA 3GCTG 5L6NH 4MNVA 4OS4A 3S0NA 4ABDA 1CVWH 2ZDLA 3LDXH 1C4V2 2P59A 4JK5A 1TNIA 2UUJB 3DUXH 1V2PT 3FANA 1MH0A 3UUZA 2BZAA 3ZZDA 2GVFA 1EOJA 3UR6A 4I8GA 4D7GA 2BDIA 1D9IA 3GY7A 3SGQE 1B0EA 3N7OA 4MQAA 5C2ZA 1C5VA 2QA9E 4PROA 4ASHA 4X2VA 4H42U 5JBCS 2C93B 2CN0H 1FXYA 4NFEA 2W26A 4FXGH 1TX8A 3TJOA 1YCPK 1ETSH 1ZTJA 2ZGCA 1DXWA 1O2PA 1SGTA 4WJG2 3W94A 2FX4A 1S0QA 4KTUA 3FFGA 1O2NA 5FCKA 4CRDA 2VB0A 1MUEB 2WPKS 2GT8A 2OP9A 2FP7B 2ODYB 4IC6A 5FPSA 3BG4B 3NPSA 3TPIZ 4Y7AA 2PKAA 3M5LA 3PWCA 4OGXA 1O3HA 1GI1A 2R3UA 4U32A 2ZGHA 1QL9A 2C8XB 4B2CA 2F9OA 4Y76A 3SOSA 2ALPA 4NGAH 1OWDA 1EPTB 1GHZA 1PPBH 3GY5A 4NIVA 3PO1C 1ELVA 1FY8E 2FOGA 4K8BA 4U2WA 1CT2E 4K5ZA 1GI0A 1VZQH 3BIUH 2OBOA 1YF4A 5AF9H 1CA0B 1C1OA 1TMTH 4SGAE 1EAWA 2WYJA 3BTME 3WY8A 2VIVA 1SGEE 1BTZA 1SFQB 1TPOA 1UK3A 1XUIA 1C5PA 3U8OH 2A31A 1FDPA 1O39A 5E0JA 2TGTA 3ZZ3A 4ZXYH 2NU1E 1NY22 3S9AA 3O8CA 4FUJA 2FODA 2A5AA 2RA0A 2TIOA 4MLFB 4WH8A 4MPXA 3A8BA 3MH6A 1INCA 4O9VA 1P2OA 1UTJA 3SU0A 4Q7YA 2OC8A 2AEIH 1K21H 4TPYA 2XCNA 4CRGA 2GCHG 1O36A 4X1RU 1MU6B 5DGJA 1ZMLA 3PTNA 5JB8S 5HYOA 4MDSA 1CSOE 4NCYA 2P3FH 3OSYA 1THRH 3TH3H 1P2MA 2OINA 1P9SA 3KL6A 5H4IB 1ESBA 2ZDKA 2GZ7A 4YZUA 1TIOA 3PM3A 3D23A 1CU1A 2VJ1A 1ZGIA 1C2GA<