2SFAA

Serine proteinase from streptomyces fradiae atcc 14544
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
191
structure length
191
Chain Sequence
IAGGEAIYAAGGGRCSLGFNVRSSSGATYALTAGHCTEIASTWYTNSGQTSLLGTRAGTSFPGNDYGLIRHSNASAADGRVYLYNGSYRDITGAGNAYVGQTVQRSGSTTGLHSGRVTGLNATVNYGGGDIVSGLIQTNVCAEPGDSGGALFAGSTALGLTSGGSGNCRTGGTTFFQPVTEALSAYGVSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEINASE
publication title Purification, characterization, primary structure, crystallization and preliminary crystallographic study of a serine proteinase from Streptomyces fradiae ATCC 14544.
pubmed doi rcsb
molecule tags Hydrolase
total genus 49
structure length 191
sequence length 191
ec nomenclature ec 3.4.21.-:
pdb deposition date 1994-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sfaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sfaA01
1EZXC 2KAIA 1E36B 1ZRBA 4DIHH 4FUFA 5J4QA 2LPRA 3LGTA 1S6FA 8LPRA 1NRNH 2FESH 3A80A 3P8NA 3IITA 2VWOA 1P04A 1O3MA 2H9TH 2OCVB 2W7SA 2A5KA 1FUJA 3QX5H 3PO1B 3BTKE 1CHGA 2C8XB 2VNTA 1TPPA 1C2EA 1GI8B 1BDAA 4A1VA 1SGYE 4D9QA 1OWHA 3ZZ7A 1TE0A 3VB7A 4A1XA 1CO7E 2AS9A 4FUBA 1O3OA 3T25A 2ZGJA 3LT3A 1NRQH 1O2TA 1O3FA 1FONA 3SU5A 1EAXA 3ZVAA 3BG4C 1NROH 1QJ7B 2BOHB 2OQUA 3Q3KA 2BHGA 4XFQA 1HXFH 3P70B 1ZHRA 2PGBB 1AD8H 2A5IA 3RXAA 5A0AE 3ZZAA 1P05A 3CS0A 3F68H 2W3IA 1PYTD 2C3SA 1GJ9B 3FP6E 4VGCC 1K28D 3LGUA 3PLPA 4I8GA 1AVGH 3ZZ8A 4NIWA 2Y7XA 2Y7ZA 2VVCA 1BBRK 3BTWE 1GHWH 1C2FA 3K2UA 1C1OA 1BTWA 4I8LA 2P3UB 1C5VA 4YO9A 1K21H 2BDHA 3TJNA 1GGDB 2VIOA 1CHOF 3EYDA 3K6YA 4JYTA 2O9QA 2FLRH 1THRH 2WPKS 1TPSA 1EP6A 4WWYA 1G36A 3K9XB 2B7DH 2Q6DA 3U69H 5GJ4B 3VEQB 1A5GH 2IJOB 4FUIA 1TNJA 1P2MA 4MPUA 1C4V2 1W7GH 3L3TA 1DUAA 1LVOA 1V2PT 4TWWA 1SPJA 3A7TA 1V2UT 1CHOG 3BN9A 1Z8JB 1W0ZU 3T28A 3SNDA 4ABFA 4AYVB 4JYUH 2OTVA 1PJPA 3SU1A 3P8FA 1TQ7B 2FS8A 1ZMLA 2QF3A 1KLJH 2BYAX 1K9OE 1F0TA 2GMTC 2BD7A 1IQGA 1XX9A 2Q1JA 3URDA 4I8JA 4CREA 4GCHF 3RXQA 4B73A 1SGNE 4B74A 2BX3A 1HRTH 2P8OB 4Q7YA 3GY2A 3TLOA 2VIQA 2P95A 3SI3H 3G01A 2OD3B 3P17H 3KHVA 2CHAC 2CF8H 4GSOA 1O3NA 1O30A 2ZNKH 4IMZA 3QLPH 1IHSH 1PPGE 2GT8A 3KCGH 3ZZ6A 1N8OB 3HK6B 1GJ5H 5FCRA 1C2JA 1O3GA 1ZGIA 4SGAE 2BM2A 1AGJA 5LPRA 1S6HA 3GY6A 3HPTB 4X1PU 4R8TB 1KSNA 1PFXC 1YKTA 1DWDH 3DFJA 3AW1A 3CENA 2UUJB 4E7RG 1C2LA 5F8TA 2TGDA 5AHGH 1N1LA 5C5OA 1INCA 2OC0A 4ABAA 1O3IA 2Z9KA 2O8WA 3S9CA 2O8MA 1P2IA 1GDNA 1XKBC 2TPIZ 1C5LH 3MH5A 5DP8A 2O8UA 3ENSB 1LPKB 3T62A 1DSUA 1IQNA 1O3CA 2ZA5A 1C1RA 1HV7A 1MUEB 1EASA 1WBGB 2BVXH 4CHAC 2CV3A 4AORA 1Y5UT 2PUXB 2BDCA 1SLWB 4UONA 1IQMA 1TONA 2GZ8A 5GCHF 1TX8A 3T26A 2A5AA 1JMOH 3A7ZA 4MVNA 2H9HA 3TGKE 3NXPA 3QZQA 1C5WB 1Y3XA 1B7XB 1C1WH 1BMNH 1CT4E 4NFEA 5H4IB 2YOLA 3EAJA 1OWKA 1RTLA 1LHEH 1ZPBA 1P57B 2GV6A 4B76A 1PPZA 3M61U 3C1KA 1CT2E 2WYGA 1GHZA 2C8WB 5C1XA 2FYRA 3A8AA 4U01A 5AVDA 3UNRA 1SI5H 5GCHG 1KXAA 1EPTA 4NZLA 2Y6TA 3I77A 3RLYH 3ZZ5A 4Q7ZA 3UR9A 1O5EH 2RDLA 4IW4E 1O2QA 4NWLA 1UTOA 4JZ1A 5A8ZA 1AIXH 3MU0A 4CRAA 1P2OA 1MAXA 2QY0B 4LXBH 1ELEE 2BX4A 4INHA 1HAIH 1LHDH 1TAWA 1YCPH 4YT6H 5DP7A 2AGIX 2PTNA 3RXBA 4CH2B 2XC0A 2ZU5A 4Q7XA 1QB6A 1YPHC 1J17T 4NFFA 4IN1A 1JRSA 1B0EA 4MPXA 1LHGH 1ORFA 4TYDA 2BVRH 2G00A 1IOEA 3NCLA 2ZCLP 1GBFA 1ZTLA 2HRVA 2FOBA 3V3MA 4UFGH 3A8CA 2KAIB 3SNAA 1ZZZA 4KKDA 1YPMH 4HTCH 5ETXA 3SQHE 2FX6A 1YPGH 4AOQA 1K1IA 2I6QA 3K65B 2A31A 2ZPSA 1QRXA 3F9GA 5ESTE 1YP9A 1AE8H 3MI4A 1OWJA 2HWLB 1C5XB 2ZFPH 2UUFB 3B8JA 2Z94A 3KL6A 1H9LB 3PM3A 5A2MH 2BTCE 1MTNC 2GMTB 9LPRA 2BXUH 2GZ7A 3QK1A 1UTLM 1TRMA 4UE7H 4AFQA 1ELDE 1TBZH 1K1NA 3UTUH 2STAE 1HUTH 1LHFH 4MG3A 1F0RA 1BITA 2Q6FA 3LKWA 2BLVA 3D23A 2ZTYA 1L1NA 1A3EH 5B6OA 3QUMP 1SB1H 3ZZ9A 1DDJA 4A1TA 1SGFA 3SGBE 1G37A 1G32B 4ZHLU 1C1SA 2RA3A 1DX5M 1OKXA 1CA0B 1AI8H 2ZDKA 1GI2A 1ETRH 1EPTC 2Z9IA 1O2GH 1PQ8A 4K1TA 3ZV8A 2EI8A 4RSPA 1DUEA 2J34A 3ZYDA 4E7NA 4BANB 1G3EA 1E35B 3ODFA 1K1OA 2BVSH 4X6NA 5T6GA 1FN6A 4UD9H 1DT2A 1UHBA 1Q31A 4ZXXH 3MMGA 1SGPE 2BY7X 3QTVH 1FPCH 2ASUB 3RXHA 3BTME 2ZGXH 2NU0E 2D26C 1BBRH 1C5PA 1PPFE 1F7ZA 1T8LA 2HNTC 4GVUA 1KYNA 1O34A 3QN7A 2ZGBH 3TJVA 3D49H 5JDUB 1PYTC 3E3TA 5JBAS 1DVAH 1AUTC 2HGTH 4BTIB 2ZI2H 1F5RA 2V3HH 5TCAA 1BJUA 5A09A 2G55A 1SFQB 1T4VH 2XXLA 2SGPE 3HKJB 1O3JA 1TMBH 4DGJA 1RIWC 1Y3UA 3FAOA 3VB6A 3PYHA 3ATLA 2ZGCA 3VGCB 3U98H 2ZHFH 1DY9A 2NU3E 2OC1A 1O2PA 3SJ8A 1TGBA 3BF6H 1FI8A 1O5AB 1E37B 2BY9X 1EOJA 1BTPA 3F1SB 1TLDA 5TCCA 1C5RA 4TPYA 1ELCA 4ABEA 3FP7E 1K2I1 4ZUHA 4AGJA 2A4OA 3KNXA 4Z0KA 1O3EA 1F2SE 1TB6H 4NWKA 2Y5HA 2FOFA 1LQEA 2WUCA 3FFGA 4H6TA 1EZUC 4AFUA 2B5TB 1TOMH 2P59A 3BEUA 1MTWA 1DY8A 1L4ZA 1Z1JA 1FAXA 2BY5X 2GCHF 2WPLS 2TGAA 4F4OC 4KGAA 2H9EH 1C5SA 1UK2A 2ZFSA 1ZMNA 2A2XH 1JIMA 1P03A 2ZPQA 3VB3A 2AMPA 2XWAA 1VJ9U 4MQAA 1M9UA 1BBRE 1TPAE 1GBBA 1TNGA 3BEFB 4CRGA 2GKVE 2Y82A 5L2ZH 1HIAA 2VVUA 1D9IA 1HAZB 1OS8A 4NSYA 2Z3DA 5EQSA 5F03A 1TBQH 2QYIA 1AO5A 1IAUA 1EATA 2FOCA 1EJAA 1MKWK 1T8MA 2GCHG 1TFXA 2G51A 3BEIB 4AZ2B 3BIUH 1O5DH 1O36A 1QL9A 1QURH 2R2WU 3Q77A 3PLBA 2FIRH 3EE0B 4HI3A 4I8KA 5AF9H 1O2UA 1FV9A 1C5QA 1ZSJA 1W10U 3SU3A 1LO6A 5BPEA 4MPWA 1NTPA 1EOLA 1ZHMA 1HNEE 4MDSA 3UUZA 1BMAA 3RXKA 2C90B 2F9UA 3GYLB 1C1NA 3OSYA 3AVZA 4NA9H 3U1IB 4KELA 4FUGA 3UFAA 1XVMA 3A81A 3A7XA 3GCTF 2K1QA 3ELAH 4JK5A 5E2PA 1UTJA 2C8ZB 3ATWA 1BHXB 1MTVA 5JBCS 3F9FA 4MTBA 1P11E 4B2BA 1AFQB 3BTEE 3SU4A 4B75A 2SNVA 2BXTH 4XBDA 4I7YH 3UWJH 1EPTB 1OWEA 2FI3E 3E0NB 3NK8A 3GCNA 2FZZA 1KDQA 2G81E 1W0YH 1VCQA 4ISHH 4IS5A 1O2IA 1HJAB 2H2ZA 2RG3A 4AG1A 3GCTG 1UMAH 3TIUA 2FTLE 3SQEE 1C5YB 2B9LA 1NRPH 3RC4A 2FP7B 2ZZUH 1VJAU 3M5LA 1HXEH 1X7AC 1Y3WA 5GDSH 4MNWA 3VFEA 1OP2A 2FX4A 3HGPA 2A0QB 1ZYOA 2H1UA 4BTTB 4UEHH 1HJ9A 1G9IE 1SLXB 4ABJA 3UR6A 2FO9A 2W26A 3NPSA 2P16A 3Q00A 2YNBA 5EPNA 1ID5H 4IGDA 3ZVBA 2STBE 1O2JA 1WQSA 1RGQA 1TQ0B 1B5GH 1FAKH 1QQUA 2G4TA 3SV2H 2EA3A 1O2HA 1TGCA 1O32A 1WV7H 1T8NA 3PWBA 1LPZB 1Y3YA 1MZDA 1YPHE 5DJ7A 3TITA 1C5UA 3VB4A 3PMHB 2XTTB 1GBMA 5C2ZA 1CT0E 1N6YA 1C5OH 2HVXA 1HDTH 5L6NH 2ZTXA 2OBQA 2ZHWH 5LPFA 1GBIA 1PQ5A 1P01A 1XVOA 4Y79A 2BLQA 1AZ8A 1S0RA 3VXEH 1OP8A 1NU9A 3S9AA 1CVWH 3W95A 4MNYA 4K8YA 3MNXA 4HGCA 2XBWA 1GJCB 1NN6A 4AN7A 5HGGA 1GBTA 1SGFG 7ESTE 2C4FH 5EQRA 1GI3A 1O2LA 2BQWB 1L0ZA 1SSXA 1FPHH 2BQ7B 3EA9A 4XBCA 1Y8TA 1S84A 3SJ9A 1GBAA 3LU9B 3STJA 1P2NA 1D6WA 3O8DA 3VXFH 1O5FH 3EA8A 2A2QH 2A4QA 1BUIA 2PSYA 1NFYA 1AVXA 1ESTA 5IDKA 1GWAA 2PKAA 2UUYA 3E6PH 1H9IE 3HKIB 1HLTH 2ZQ1A 1WSSH 3SUEA 1G3BA 2GCTB 5FBIA 1ELAA 1UVOA 1SHHB 1UHBB 1MU8B 1O3LA 3RXFA 1BTZA 4IC6A 3V7TA 2HALA 1A0LA 3RC6A 3RXMA 2XCFA 2O8TA 1MMJN 3GCOA 3GISB 1O35A 4MNXA 1C4Y2 3E0PB 1SGIB 1Q3XA 5LGOA 4HZHA 1V2LT 1FZZA 3MTYA 1WU1A 1GJAB 1IQIA 2A4GA 1O3HA 1VZQH 3OY6U 4Y0YE 1SOZA 3RXGA 1GI6A 1E34B 5DP4A 3TK6A 3P92A 1C1UH 1A5HA 3SN8A 1MQ6A 1BT7A 1GG6B 1D3QB 1F0SA 1LDTT 3GCHC 1YPJH 2O8LA 1J8AA 3T5FH 2WPHS 2UUKB 2UWOA 1HGTH 4OGXA 1QRWA 2JKHA 2OLGA 2ANMH 4JZDH 1SLVB 5JYIA 1SGRE 4TY7A 2FI5E 3H7OA 2CF9H 2TRMA 3TJOA 2HNTE 2PR3A 2EC9H 3NKKA 3VPKA 1BTUA 8ESTE 1T7CA 1W7XH 2QIQA 1LVYA 2Y5FA 4Q2KA 2G8TA 1ETTH 4DIIH 4K69A 1TNHA 1V6DA 5E0JA 4ZKSU 3SV7A 1ANBA 2PHBA 9ESTA 4PROA 1C2KA 4DY7B 2VIVA 3SV8A 3UNSA 2WPJS 1ABJH 1WCZA 4E06H 2XCNA 4X2VA 1MTSA 1VR1H 1XUHA 2SGAA 2ZC9H 3SGAE 3TJUA 4DT7B 4NIVA 2NU2E 1V2QT 3DT0H 3B9FH 1FY5A 1SQOA 4IMQA 5K0HA 1K22H 1S83A 3A8DA 2A1DB 3UQOA 2AMDA 2CMYA 1UVPA 3QGJA 1U6QA 1GJ4H 1A4WH 5DG6A 1UTMA 3FZZA 1HIAB 3Q3YA 5I25A 4FXGH 5HYOA 1Y59T 1TBRH 1CGHA 1VGCB 2FXRA 2ZF0H 4XOJA 3RMLH 4F49A 3A8BA 3PWCA 3CS7A 2XBXA 3FANA 4X6OA 3RXRA 3A88A 4O3TA 5K7RA 3OY5U 3GY4A 4DW2U 1GBEA 1KXCA 3RXUA 3LIWA 5DP3A 1SR5C 1NM6A 3RMNH 3UY9A 2R9PA 2WYJA 1JXPA 4B71A 1H9HE 2ZDMA 1UTNA 2BDAA 4Y7AA 4AFSA 1ETSH 1UCYH 4MPVA 1FJSA 1MKWH 3LC3A 2VH0A 4J2YB 2BLWA 4ZHMU 2ODYB 3OX7U 3LONA 2FOHA 3L6PA 1H1BA 4ISNA 2J2UA 3E8LA 5PTPA 3SORA 1HJ8A 2VINA 5E8EH 5FCKA 5SGAE 1D6RA 1GCTC 1GBDA 1KDQB 2Y80A 3BIVH 1XUKA 1GJDB 4XBBA 3D62A 3BG4B 1G2MA 2XC4A 3I78A 1QB9A 1DOJA 1OPHB 1F92A 4ESTE 2ZO3H 4K3JA 1Y5BT 2D8WA 3BSQA 1E38B 1OWDA 2FS9A 2OUAA 1A2CH 2A4RA 2VWMA 1P2KA 3RU4D 4DOQA 1BOQA 7LPRA 4X1RU 1IQJA 3EQ0H 1SGDE 1Z8GA 3M37A 2UWLA 1BIOA 4FVBA 4VGCB 3TK9A 3ATKA 2WUBA 4Y10E 4CRCA 1JRTA 3ZZBA 4CH8B 2VGCC 3PV4A 1C1MA 2BD9A 2CGAA 4INKA 3GOVB 4X8SH 5F8ZA 5EXNA 3EA7A 1MBQA 2J95A 1XUIA 2ESTE 4ABHA 1TMUH 1ZGVA 4Y71A 4FUJA 3HK3B 1QCPA 3QTOH 1SQAA 3UOUA 3E91A 1DITH 2BD2A 1O5CB 1TGSZ 1YLDA 2FPZA 4RKOB 2ULLA 2BDIA 1UVTH 2ZCHP 1GJ8B 3RXIA 3UPEA 2R2MB 2PSXA 1GBHA 2ZPRA 3L33A 1UCYE 1BCUH 2PGQB 4UFFH 1ABIH 1MZAA 2XBYA 4Y6DA 5FPSA 3S0NA 1A7SA 2P3TB 1TRNA 2FWWA 3A87A 3M7TA 3RXJA 1TWXB 4MNVA 3WY8A 1GPZA 1HAYB 2W7UA 1NS3A 2OP9A 4I32A 1ZPCA 4K5ZA 1V2JT 1YPKH 3P6ZB 3ZZ4A 2ZDLA 1UVUH 2ANKH 3JZ1B 3QO6A 1AWHB 3R3GB 1V2MT 1W12U 1QFKH 5I46H 5GWZA 1RS0A 4XDEA 3TNSA 1TA2A 1F0UA 3V13A 3V0XA 2ZHEH 2BQ6B 2ZTZA 1WTHD 3GDSA 1S0QA 2BOKA 1PPEE 1MQ5A 5EGMA 3SUFA 1GBLA 1EAIA 2CHAB 3PTBA 2FOEA 2PKAB 2AGEX 3M3VA 5LH8A 1GI4A 4TPIZ 5JBTA 1DWEH 5A8XA 4YM9A 2ZIQH 1B0FA 4BXWA 4NA8A 3KQCA 4X1QU 4IC5A 2JETC 4YOIA 1V2OT 1C1PA 3ZZ3A 3A83A 3BTHE 3RM2H 2PKSC 1GMCF 1C1QA 2SGEE 3F6UH 4ZROA 1Z1IA 3T29A 4Y11E 1UK3A 1L1GA 2JH0D 1JBUH 1C5ZB 1FXYA 5L30H 1O3KA 1O3BA 3UNQA 2GZ9A 1PPCE 6LPRA 1ACBE 4ISLA 4OS2A 5LPEA 4I8HA 1MD8A 3RC5A 3SJOA 1AN1E 3DUXH 1BMMH 1V2NT 1DS2E 3ZVGA 3D65E 2PTCE 1V3XA 2WV5A 4U32A 4CHAB 1RFNA 1A1RA 1GMCG 1RRKA 2F9BH 3SHAH 3SJIA 1V2KT 2OINA 2AGGX 1SGQE 4OS5A 1AB9C 4WVPE 2G4UA 2ZFRH 4CBNA 2XYAA 8GCHF 1NC6A 2QF0A 1D4PB 2D2DA 3EGKH 3BTQE 3MNBA 2CJIA 3ESTA 2F9PA 1C1VH 1AE5A 1IQLA 1EP5A 3MWIU 4A6LA 2EI7A 2R3YA 3TVJB 1YPLH 3LGVA 4ABDA 2SGFE 1BTXA 1W13U 1ELBA 1HBTH 3CP7A 3S69A 1AKSA 1L4DA 1A3BH 8GCHG 1SG8B 3UIRA 6GCHF 3RXEA 1GL1A 1FNIA 1L2EA 3E1XB 3O8CA 1J14A 3ZVFA 1OX1A 5FPYA 2ZFFH 1O2OA 3BV9B 4NIYA 2J94A 4FUCA 2LNCA 2XNIA 4K2YA 3KIDU 4KP0A 1TABE 3H5CB 4BAQB 1HFDA 1EJNA 3EDXB 2ZU2A 4OS7A 1H4WA 1GL0E 3ZVEA 4X0WU 5FX5A 5EW1H 6GCHG 1BQYA 3LJJA 1V2VT 3ODDA 1P9UA 3SV6A 1HAHH 3RXTA 1QGFA 2AEIH 1WUNH 1GI5A 3W94A 3SV9A 2F9OA 3GDVA 3PO1C 3O8RA 1GHVH 1DWBH 1H8DH 4GUXA 4H6SB 5EU8A 3M5OA 1V2TT 3SU6A 4CRBA 1E0FD 2VB0A 1BZXE 1SQTA 1GI0A 1W3CA 2C93B 4U2WA 1UCYK 1CGIE 1FIWA 2BDYA 6ESTA 2G5NA 3SNEA 1BA8B 2WINI 2GVFA 5DP5A 1MTNB 1FDPA 4KTCA 3MYWA 3A86A 1QA7A 1LVBA 3DFLA 3MU5A 1O2ZA 2GGVB 4BAMB 4WF8A 2ALPA 1EB2A 3ITIA 1DLEA 1RD3B 1HPGA 4WH6A 1O3DA 2ZFTA 1GBJA 1JIRA 3T27A 2QAAA 2AYWA 1C9TA 1HAOH 1AUJA 1OSSA 2TGPZ 3TGJE 1A0HB 5EQQA 1GBCA 3SUGA 1ZPZA 2ZP0H 4OS4A 1PQ7A 4UFEH 4X8UH 1O2YA 4YLQH 4AG2A 1QHRB 4FU8A 3ZYEA 1GBKA 4GHQA 3B23B 1TX6A 1ESBA 1BJVA 4J1YA 4KTSA 1QB1A 1LTOA 2HNTF 3MFJA 1GGDC 2ZU3A 2M5TA 3BTFE 3RXDA 4OS6A 1O38A 3AAUA 2P94A 1W8BH 1PPBH 2ZDAH 1O33A 1XXDA 1GVZA 2XWBI 3C27B 3URCA 2ZQ2A 4B2AA 3F9HA 2J92A 3KQBA 3RDZA 1KXFA 2ZG0H 4OS1A 4A92A 4WH8A 5GIBA 4M7GA 1ZSKA 2RA0A 5C3NA 2WPMS 3QGNB 2ZDNA 1W2KH 2PFEA 3ATIA 1A61H 4GPGA 3AW0A 5C1UA 3TH4H 1DXPA 1JOUB 3M7UA 3SO3A 3UOPA 5DO4H 3U8TH 4BNRA 2BZAA 2YNAA 4K60A 3SUDA 5G4BA 1QL8A 1YLCA 4ZHAA 5AFYH 4FUHA 1EQ9A 3JZ2B 3GY3A 3S9BA 2FM2A 4D9RA 1OYQA 7GCHF 4I31A 3SU0A 1ZTJA 3NUMA 1RIWB 4NZQA 3GDUA 4X8VH 1GJ7B 4O97A 5E0GA 3MU1A 3ZV9A 2FTMA 3SZNA 2QV1A 1QL7A 1EAWA 2XW9A 1YYY1 1TOCB 4FUEA 1TX7A 2TBSA 5JB8S 2F3CE 1L1JA 4YOGA 4O03A 5A0BA 5L2YH 2Z9LA 1QJ6B 4LZ4B 1XM1A 5A0CA 1N8OC 2AH4X 2H6MA 1QBOA 3U9AH 3NZIA 7GCHG 2D1JA 1BMLA 3M5NA 5E2OA 1ZSLA 1ELTA 4UFDH 2TGTA 3K6ZA 2FEQH 1EZQA 2QXIA 3FZDA 4NG9H 1YGCH 1O2KA 1TIOA 5FAHA 1D3DB 1N6XA 2VIPA 5FHTA 1Q2WA 3KQDA 5EXLA 2A7JA 3A85A 3DHKH 4LK4A 3STIA 1FQ3A 4Z6AH 3ZZDA 1P12E 1UO6A 4A5TS 1P10A 2BD3A 3SGQE 3GY7A 1EKBB 3UQVA 5JB9S 5HM2A 1O2XA 1VCPA 4K8BA 2GT7A 1F5KU 4ISOA 1NFUA 1IQEA 1NU7B 2BDGA 2GV7A 3U8OH 2RCEA 2AMQA 1YF4A 1YCPM 1DSTA 4NSVA 2FLBH 2ZWLH 1C5MD 1UK4A 4CRDA 4ABIA 1THPB 1O5BB 4GHTA 3SOSA 5ESBA 2NU1E 3MNSA 1C2MA 1QIXB 1ZRKA 2CN0H 3GY8A 1VITH 4WJG2 1HCGA 2AERH 2QXGA 1EB1H 4TWYA 2FOGA 3N7OA 1C2GA 1XKAC 3TH3H 2DUCA 1WTGH 4NIXA 3RXOA 1TGTA 2Z9GA 1SOTA 3R0FA 1GJBB 1QBVH 1NY22 3A89A 1P2QA 4UDWH 1QJ1B 1H8IH 1NZQH 1V2RT 5DK1A 3T2NA 1AHTH 1Z71A 1WQVH 2W3KA 4DCDA 2NWNA 1AKSB 2SFAA 1XXFA 4AB9A 3RXLA 1ANEA 4D7FA 2QXJA 3RLWH 2I6SA 3PMJA 1THSH 1P9SA 1MKXK 1LKAA 2A32A 1SMFE 1TGNA 1TYNA 2J4IA 1GDUA 3GY5A 2J38A 2PV9B 2QGRA 3V12A 1J16A 1O31A 1XUFA 3FP8E 1DWCH 2GD4B 3MHWU 1P8VC 2XRCA 2JH6D 4E05H 1D3TB 1EUFA 1MD7A 5C5NA 5FXLA 5IYTA 3SHCH 3TH2H 3ZVCA 1HAPH 1UTPA 4ABGA 2Z7FE 1KIGH 2BY8X 2ILNA 3RMOH 3BTTE 1A5IA 1NT1A 4A7IB 4XSKU 1ANCA 2BDBA 5E0HA 2ZHQH 2VIDA 4NA7A 2FMJA 2QXHA 2ZDVH 3AASA 4D76A 3LGWA 4D8NA 4GLYA 2VWNA 4Q80A 2R0KA 5C67A 4X1NU 4WMEA 1O2WA 1AVWA 1O3PB 5EG4A 4INLA 5EODA 1GDQA 2A45B 2GDDA 3A82A 1ZJKA 4K1SA 4ISIH 3PROA 4IBLH 4Y8XA 5FX6A 2VH6A 4DURA 2TIOA 1LKBA 3IG6B 1P02A 2ODQA 1GJ6A 5BRRE 1NFWA 1MAYA 5CHAC 3RU4T 4X2XA 3SW2B 4WMDA 1TALA 4YLUA 4THNH 3LH3A 2ODPA 1LVMA 4Y8ZA 3BTGE 1O2MA 1C5NH 3QZRA 5JPMH 4GCHG 2Q6GA 1XMNB 1CA0C 1EZSC 1K1PA 2SGDE 4YT7H 3A7VA 7KMEH 1NRSH 4JMYA 1BRAA 1W14U 1F5LA 1IHTH 3PB1E 4QT8C 2BMGB 2BD5A 1AFEH 3NWUA 2Y5GA 2ZHDA 2HPQH 1P0SH 1GVKB 1NRRH 1OP0A 1DFPA 2SGQE 5DGJA 4Y76A 3MH6A 3IWMA 1BRCE 2Z3CA 3OU0A 1CA8B 1HB0B 3SBKA 1QBNA 1KY9A 1Z8RA 3RUOA 1KTTB 3KQEA 3PMBB 1ZHPA 3M35A 3LPRA 2PW8H 1HAVA 1YC0A 1EXFA 1VCWA 1GHAF 4BOHA 4ZKOU 5C20A 1Z6EA 4ABBA 3FVFB 4FUDA 4B1TA 2H5DA 5DP6A 1LPGB 1ARBA 1AZZA 1K1LA 1D3PB 1RTFB 3TK5A 2FDAA 4TY6A 1ELFA 3DD2H 1BB0B 1QNJA 2GP9B 2UWPA 4CBOA 1LCYA 1SHYA 1OXGA 2PWXA 1SGEE 4AFZA 1G3DA 2EEKA 1TRYA 2P3FH 2IPHA 2WPIS 1QTFA 4X8TH 1TPOA 3VGCC 4FU7A 5HM9A 2ZCKP 1KLTA 1GHAG 1ELGA 1QA0A 2BLOA 3M5MA 3GCHB 1O2VA 1MBMA 2V35A 1OWIA 3Q76A 3RXSA 1NPMA 4CRFA 4X2YA 5C1YA 4D7GA 2ZFQH 1V2WT 4X1SU 5T6FA 3RU4E 1SGTA 4WY3A 4Y0ZE 5DPAA 1XUJA 1K1JA 1S5SA 3MO6A 4AX9H 3ATMA 4AGKA 1IQHA 2F9NA 2IOTA 1MCTA 1P09A 2IN2A 3MH7A 3PMAB 1CU1A 4RKJB 1GHXH 2QN5T 1GHBF 2EI6A 5HXFA 4H4FA 1C2HA 1Y3VA 1G2LA 1NO9H 1WAYB 1DPOA 1WOFA 2A7HA 5T3HA 1ZTKA 4O3UA 1TNKA 1KXEA 1GHYH 1HYLA 4WMFA 1FN8A 4I33A 4BTUB 4X6MA 3MO9A 1CBWC 1GI7B 4AYYB 5F6MA 2XC5A 2OXSA 4OGYA 1QR3E 1T32A 1GHBG 2BZ6H 2Z9JA 4JCNA 4B2CA 1IQKA 4JZEH 2XBVA 2Y81A 3M3SA 4U30A 4CR9A 1HAGE 1CQQA 1YBWA 5T6DA 2ZKSA 5FBEA 2V6NA 2F91A 2VU8E 1O3AA 3O8BA 2OBOA 1OOKB 1CE5A 2ALVA 3TNTA 6CHAC 2R3UA 3M3TA 5J4SA 1DANH 1C1TA 5CHAB 1AWFH 5GPIB 4IN2A 4GAWA 2ANYA 1ANDA 1SVPA 3UWIA 5ABWA 1YM0A 1DLKB 1FMGA 1YPEH 3SI4H 2FOMB 4YTAA 1AFQC 1K1MA 1FY3A 1LMWB 1KTSB 3OYPA 5A8YA 1JWTA 3BTDE 1G30B 1S85A 5EOKA 2Z6BD 2V0BA 2ZGHA 1BRUP 2C8YB 3HATH 1A0JA 1HJAC 1O2NA 2G52A 2QCYA 4RN6A 1AMHA 1QRZA 3MO3A 4FU9A 3RM0H 1KXDA 2F9VA 1GCTB 1O2SA 4ZAEA 3KEEA 3LDXH 1SFIA 1OYTH 4K1EA 1NFXA 1G3CA 2W5EA 1O37A 2BD8A 1BTYA 3A7WA 3H7TA 1P3EA 3LC5A 4XE4A 1AQ7A 1DICA 2DE9A 4YZUA 4X2WA 1C2IA 1GMHF 2ZU4A 3TGIE 4BAOB 1GCDA 1ELVA 2JH5D 3ZVDA 3MOCA 1MKXH 2HOBA 4NCYA 2VGCB 4NGAH 1GMDF 1O2RA 1DM4B 4ZKNU 1T31A 2VJ1A 1RTKA 3KGPA 1CSOE 3PLKA 1C9PA 1EAUA 3LJOA 1ZLRA 2VWLA 1MU6B 3DA9B 4ZXYH 1GMHG 1S82A 4YESB 2OQ5A 1T8OA 5DP9A 4LOYH 2DE8A 3SJKA 1QY6A 5CE1A 1SL3A 3SNBA 1XUGA 3SNCA 1GMDG 2BY6X 2BB4A 1SC8U 4ZKRU 4AB8A 2HPPH 2ZU1A 5EXMA 1UJ1A 3S7KB 3U1JB 1AY6H 3E90B 3LOXA 2QA9E 2AFQB 5TJXA 2FOAA 4H42U 1EX3A 3U8RH 4DJZB 5F8XA 2VIWA 1KLIH 1GVLA 1T4UH 1FLEE 1BRBE 3A84A 2PLXA 3M36A 2VVVA 4WXVA 4JYVH 4Y8YA 2G5VA 2CXVA 4R0IA 1ZOMA 1SBWA 2J9NA 3ZZCA 1CBWB 2GCTC 1GI9B 3LH1A 1DXWA 4WXIA 5EW2H 3UREA 5FPTA 3VB5A 1TNIA 3RXVA 2FI4E 2ZECA 1BHXF 1UTQA 2PUQH 3P95A 1SLUB 1AU8A 3RXCA 1PQAA 1EJMA 5GXPA 1UVSH 1Z7KA 1WYKA 1ESAA 1FIZA 1FY8E 1O0DH 3SU2A 4MLFB 1HAVB 1KXBA 2HLCA 1FY1A 3AAVA 2B8OH 3PTNA 1RJXB 5CMXH 2SNWA 3P8OA 2JETB 4HFPB 2WV4A 6CHAB 4KTUA 4Y7BA 5DKMA 1O5GH 2PKSB 1GG6C 3LGIA 2A7CA 3TPIZ 3I29A 2GDEH 4CR5A 1P2JA 3KN2A 1CGJE 1J9CH 1SGCA 3Q3XA 3BG8A 1TNLA 1P3CA 5JBBS 2F83A 2THFB 3GYMA 4LZ1H 1J15A 3MNCA 2OC7A 2H5CA 1GI1A 4BAHB 2FODA 2R0LA 1RXPA 3QDZB 1S81A 4BAKB 3MH4A 4DG4A 4BXSA 5AFZH 4ASHA 2GX4A 3MU4A 2V3OH 4YOJA 1Z6JH 2QC2A 1TMTH 3QWCH 1ARCA 1ZR0A 1W11U 4O9VA 1NESE 1AB9B 3A7YA 1FY4A 2OC8A 1MTUA 3GICB 2AIPA 5EPYA 1P06A 5HMAA 1YCPK 1TA6A 1HAXB 1QQ4A 4JZIA 1C4U2 1VITF 3MU8A 3F9EA 4DVAU 2P8OC 3HGNA 1MH0A 3RMMH 1C2DA 3RP2A 2ANWA 1V2ST 3TU7H 3KF2A 2FYQA 2BD4A 1BTHH 1LQDB 1Z8IB 3RXPA 1DE7H 2B0FA 1IQFA 1MCVA 3S7HB 1LHCH 3E16B 4JZFH 8KME2 1O39A 4X6PA 4ZH8A 1ZMJA 3M7QA 4FVDA 1VGCC 1VITG 4JK6A 4SGBE 1ZJDA 1PPHE 3P8GA 1UTKA 2AIQA 2P93A 2NU4E 1Y5AT 2Z3EA 2ZEBA 3OTJE 1A46H 4ZMAH 3LGYA 1C5TA 2GTBA
chains in the Genus database with same CATH superfamily
1EZXC 2KAIA 1E36B 5HIZA 1ZRBA 4DIHH 4FUFA 5J4QA 2LPRA 3GS9A 3LGTA 1S6FA 8LPRA 1NRNH 2FESH 1E1QD 3A80A 3P8NA 3IITA 2VWOA 1P04A 1O3MA 2H9TH 4YXWD 2OCVB 2W7SA 2A5KA 1FUJA 3QX5H 3PO1B 3BTKE 1CHGA 2C8XB 2VNTA 1TPPA 1C2EA 1GI8B 1BDAA 4A1VA 1SGYE 4D9QA 1OWHA 3ZZ7A 1TE0A 3VB7A 4A1XA 1CO7E 2AS9A 4FUBA 1O3OA 3T25A 2ZGJA 3LT3A 1NRQH 1O2TA 1O3FA 1FONA 3SU5A 1EAXA 3ZVAA 3BG4C 1NROH 1QJ7B 2BOHB 2OQUA 3Q3KA 2BHGA 4XFQA 2PP6A 1HXFH 3P70B 1ZHRA 2PGBB 1AD8H 2A5IA 3RXAA 5A0AE 3ZZAA 1P05A 3CS0A 3F68H 2W3IA 1PYTD 2C3SA 1GJ9B 3FP6E 4VGCC 1K28D 3LGUA 3PLPA 4I8GA 1AVGH 3ZZ8A 4NIWA 2Y7XA 2Y7ZA 2VVCA 1BBRK 3BTWE 1GHWH 1C2FA 3K2UA 1C1OA 1BTWA 4I8LA 2P3UB 1C5VA 4YO9A 1K21H 5DN6D 2BDHA 3TJNA 3FOAA 1GGDB 2VIOA 1CHOF 3EYDA 3K6YA 4JYTA 2O9QA 2FLRH 1THRH 2WPKS 1TPSA 1EP6A 4WWYA 1G36A 3K9XB 2B7DH 2Q6DA 3U69H 5GJ4B 3VEQB 1A5GH 2IJOB 4FUIA 1TNJA 1P2MA 2WZQA 4MPUA 1C4V2 1VKYA 1W7GH 3L3TA 1DUAA 1LVOA 1V2PT 4TWWA 1SPJA 3A7TA 1V2UT 1CHOG 3BN9A 1Z8JB 1W0ZU 3T28A 3UAIC 3SNDA 4ABFA 4AYVB 4JYUH 2J5UA 2OTVA 1PJPA 3SU1A 3P8FA 1TQ7B 2FS8A 1ZMLA 2QF3A 1KLJH 2BYAX 1K9OE 1F0TA 2GMTC 2BD7A 1IQGA 1XX9A 2Q1JA 2QE7D 3URDA 4I8JA 4CREA 4GCHF 3RXQA 4B73A 4I86A 1SGNE 4B74A 5B6LA 2BX3A 1HRTH 2P8OB 4Q7YA 3GY2A 3TLOA 2VIQA 4ZCNA 2P95A 3SI3H 3G01A 2OD3B 3P17H 3KHVA 2CHAC 2CF8H 4GSOA 1O3NA 1O30A 2ZNKH 4IMZA 3QLPH 1IHSH 1PPGE 2GT8A 3KCGH 3WWBA 3ZZ6A 1N8OB 3HK6B 1GJ5H 5FCRA 1C2JA 1O3GA 1ZGIA 4SGAE 2BM2A 1AGJA 5LPRA 1S6HA 3GY6A 3HPTB 4X1PU 4R8TB 1KSNA 1PFXC 1YKTA 1DWDH 3DFJA 3F0PA 3AW1A 3CENA 2UUJB 4E7RG 1C2LA 5F8TA 2TGDA 2HVYB 5AHGH 1N1LA 5C5OA 1INCA 2OC0A 4ABAA 4Z1MD 1O3IA 2Z9KA 2O8WA 3S9CA 2O8MA 1P2IA 1GDNA 1XKBC 2TPIZ 1C5LH 3MH5A 5DP8A 2O8UA 3ENSB 1SQRA 1LPKB 3T62A 1DSUA 1IQNA 1O3CA 2ZA5A 2OK5A 1C1RA 1HV7A 1MUEB 1EASA 1WBGB 2BVXH 4CHAC 2CV3A 4AORA 1Y5UT 2PUXB 2BDCA 1SLWB 5GNDA 4UONA 1IQMA 1TONA 2GZ8A 5GCHF 1TX8A 3T26A 2A5AA 1JMOH 2YMSD 3A7ZA 4MVNA 2H9HA 3TGKE 3NXPA 3QZQA 1C5WB 1Y3XA 1B7XB 1C1WH 1BMNH 1CT4E 4NFEA 1COWD 2YOLA 5H4IB 3EAJA 1OWKA 1RTLA 1LHEH 1ZPBA 1P57B 2GV6A 4B76A 1PPZA 3M61U 3C1KA 1CT2E 2WYGA 1GHZA 2C8WB 5C1XA 2FYRA 3A8AA 4U01A 5AVDA 3UNRA 1SI5H 5GCHG 1KXAA 1EPTA 4NZLA 2Y6TA 3I77A 3RLYH 3ZZ5A 4Q7ZA 3UR9A 1O5EH 2RDLA 4IW4E 1O2QA 4NWLA 1UTOA 4JZ1A 5A8ZA 1AIXH 3MU0A 2KCOA 4CRAA 1P2OA 1MAXA 2QY0B 4LXBH 1ELEE 2BX4A 4INHA 1HAIH 1LHDH 1TAWA 1YCPH 4YT6H 3F2HA 5DP7A 2LP6A 2AGIX 2PTNA 3RXBA 4CH2B 2XC0A 2ZU5A 4Q7XA 1QB6A 1YPHC 1J17T 4NFFA 4IN1A 1JRSA 1B0EA 4MPXA 1LHGH 1ORFA 4TYDA 2BVRH 2G00A 1IOEA 3NCLA 2ZCLP 1GBFA 1ZTLA 2HRVA 2FOBA 3V3MA 4UFGH 3A8CA 2KAIB 3SNAA 1ZZZA 4KKDA 1YPMH 4HTCH 5ETXA 3SQHE 2FX6A 1YPGH 4AOQA 1K1IA 2I6QA 3K65B 2A31A 2ZPSA 1QRXA 3F9GA 5ESTE 1YP9A 1AE8H 3MI4A 1OWJA 2HWLB 1C5XB 2ZFPH 2UUFB 3B8JA 2Z94A 3KL6A 1H9LB 1KMHB 3PM3A 5A2MH 2BTCE 1MTNC 2GMTB 9LPRA 2BXUH 2GZ7A 3QK1A 1UTLM 3OAAD 1TRMA 4UE7H 4AFQA 5F53A 1ELDE 1TBZH 1K1NA 3UTUH 2STAE 1HUTH 1LHFH 1E1RD 4MG3A 1F0RA 1BITA 2Q6FA 3LKWA 2BLVA 3D23A 2ZTYA 1L1NA 4RT0A 1A3EH 5B6OA 3QUMP 1SB1H 3ZZ9A 1DDJA 4A1TA 1SGFA 3SGBE 1G37A 1G32B 4ZHLU 1C1SA 2RA3A 1DX5M 1OKXA 1CA0B 1AI8H 2ZDKA 1GI2A 1ETRH 1EPTC 2Z9IA 1O2GH 1PQ8A 4K1TA 3ZV8A 2EI8A 4RSPA 1DUEA 1NBMD 2J34A 3ZYDA 4E7NA 4BANB 1G3EA 1E35B 3ODFA 1K1OA 2BVSH 1MABB 4X6NA 5T6GA 1FN6A 4UD9H 1DT2A 1UHBA 1Q31A 4ZXXH 3MMGA 1SGPE 2BY7X 3QTVH 1FPCH 2ASUB 3RXHA 4ASUD 3BTME 2ZGXH 2NU0E 3N99A 4M9FA 2D26C 1BBRH 1C5PA 2KCYA 1PPFE 1F7ZA 1T8LA 2HNTC 4GVUA 2RDEA 1KYNA 1O34A 3QN7A 2ZGBH 3TJVA 3D49H 5JDUB 1PYTC 3E3TA 5JBAS 1DVAH 1AUTC 2HGTH 4BTIB 2ZI2H 1F5RA 2V3HH 5TCAA 1BJUA 5A09A 2G55A 1SFQB 1T4VH 2XXLA 2SGPE 3HKJB 1O3JA 3UB0A 1TMBH 4DGJA 5KGOA 1RIWC 1Y3UA 3FAOA 3VB6A 3PYHA 3ATLA 2ZGCA 3VGCB 3U98H 2ZHFH 4DT4A 1DY9A 2NU3E 2OC1A 1O2PA 3SJ8A 1TGBA 3BF6H 1FI8A 5C0TA 1O5AB 1E37B 2BY9X 1EOJA 1BTPA 4P02A 3F1SB 1TLDA 5TCCA 1C5RA 4TPYA 5HKKD 1ELCA 4ABEA 3FP7E 1K2I1 4ZUHA 4AGJA 2A4OA 3KNXA 4Z0KA 1O3EA 1F2SE 1TB6H 4NWKA 2Y5HA 2FOFA 1LQEA 2WUCA 3FFGA 4H6TA 1EZUC 4AFUA 2B5TB 1TOMH 2P59A 3BEUA 3WW7A 1MTWA 1DY8A 1L4ZA 1Z1JA 1FAXA 2BY5X 2GCHF 2WPLS 2TGAA 4F4OC 4KGAA 2H9EH 1C5SA 1UK2A 2ZFSA 1ZMNA 2A2XH 1JIMA 1P03A 2ZPQA 3VB3A 2AMPA 2XWAA 1VJ9U 4MQAA 1M9UA 1BBRE 1TPAE 1GBBA 1TNGA 3BEFB 4CRGA 2GKVE 2Y82A 5L2ZH 1HIAA 2VVUA 1D9IA 1HAZB 1OS8A 4NSYA 2Z3DA 5EQSA 5F03A 1TBQH 2QYIA 1AO5A 1IAUA 1EATA 2FOCA 1EJAA 1MKWK 1T8MA 2GCHG 1TFXA 2G51A 3BEIB 4AZ2B 3OFND 3BIUH 1O5DH 1O36A 1QL9A 1QURH 2R2WU 3Q77A 3PLBA 2FIRH 3EE0B 4HI3A 4I8KA 5AF9H 1O2UA 1FV9A 2KX4A 1C5QA 1ZSJA 1W10U 3SU3A 1LO6A 3PRDA 5BPEA 4XD7D 4MPWA 1NTPA 1EOLA 1ZHMA 1HNEE 4MDSA 3UUZA 1BMAA 3RXKA 2C90B 2F9UA 3GYLB 1C1NA 3OSYA 3AVZA 4NA9H 3U1IB 4KELA 4FUGA 3UFAA 1XVMA 3A81A 3A7XA 3GCTF 2K1QA 3ELAH 4JK5A 5E2PA 1UTJA 2C8ZB 3ATWA 1BHXB 1MTVA 5JBCS 3F9FA 4MTBA 1P11E 4B2BA 1AFQB 3BTEE 3SU4A 4B75A 2SNVA 2BXTH 5C0UA 4XBDA 4I7YH 3UWJH 1EPTB 1OWEA 2FI3E 3E0NB 3NK8A 3GCNA 2FZZA 1KDQA 2G81E 1W0YH 1VCQA 4ISHH 4IS5A 1O2IA 1HJAB 2H2ZA 2RG3A 4AG1A 3GCTG 1UMAH 5CDFE 3TIUA 2FTLE 3SQEE 1C5YB 2B9LA 1NRPH 3RC4A 2FP7B 2ZZUH 1VJAU 4ACAA 3M5LA 1HXEH 1X7AC 1Y3WA 5GDSH 4MNWA 3VFEA 3ZIAD 1OP2A 4FETA 2FX4A 3HGPA 2A0QB 1ZYOA 2H1UA 4BTTB 4UEHH 4FOUC 1HJ9A 1G9IE 1SLXB 4ABJA 3UR6A 2FO9A 3OTPA 2W26A 3OEHD 3NPSA 2P16A 3Q00A 2YNBA 5EPNA 1ID5H 4IGDA 3ZVBA 2STBE 1O2JA 1WQSA 1RGQA 1TQ0B 1B5GH 1FAKH 1QQUA 2G4TA 3SV2H 2EA3A 1O2HA 1TGCA 1O32A 1WV7H 1T8NA 3N7DA 3PWBA 1LPZB 1Y3YA 1MZDA 1YPHE 5DJ7A 3TITA 1C5UA 3VB4A 3PMHB 2XTTB 1GBMA 5C2ZA 2K8IA 1CT0E 1N6YA 1C5OH 2HVXA 1HDTH 5L6NH 2ZTXA 2OBQA 2ZHWH 5LPFA 1GBIA 1PQ5A 1P01A 1XVOA 4Y79A 2BLQA 1AZ8A 1S0RA 3VXEH 4RT1A 1OP8A 1NU9A 3S9AA 1CVWH 3W95A 4MNYA 4K8YA 3MNXA 4HGCA 2XBWA 3AK5A 1GJCB 1NN6A 4AN7A 2QF5A 5HGGA 1GBTA 1SGFG 7ESTE 2C4FH 5EQRA 1GI3A 1O2LA 2BQWB 1L0ZA 1SSXA 1FPHH 2BQ7B 3EA9A 4XBCA 1Y8TA 1S84A 3SJ9A 1GBAA 3LU9B 3STJA 4P00A 1P2NA 1D6WA 3O8DA 3VXFH 1O5FH 3EA8A 2A2QH 2A4QA 1BUIA 2PSYA 1NFYA 1AVXA 1ESTA 5IDKA 1GWAA 2PKAA 2UUYA 3E6PH 1H9IE 3HKIB 1HLTH 2ZQ1A 1WSSH 3SUEA 1G3BA 2GCTB 5FBIA 1ELAA 1UVOA 1SHHB 1UHBB 1MU8B 1O3LA 3RXFA 1BTZA 4IC6A 3V7TA 2HALA 1A0LA 3RC6A 3RXMA 2XCFA 3MQKC 2O8TA 1MMJN 3KYFA 3GCOA 3GISB 1O35A 4MNXA 1C4Y2 3E0PB 1SGIB 1Q3XA 5LGOA 4HZHA 1V2LT 1FZZA 3MTYA 1WU1A 1GJAB 1IQIA 2A4GA 1O3HA 1VZQH 3OY6U 4Y0YE 1SOZA 3RXGA 1GI6A 1E34B 5DP4A 3TK6A 3P92A 1C1UH 1A5HA 3SN8A 1MQ6A 1BT7A 2XOKD 1GG6B 1D3QB 1F0SA 1LDTT 3GCHC 1YPJH 2O8LA 1J8AA 3T5FH 2WPHS 2UUKB 2UWOA 1HGTH 4OGXA 1QRWA 2JKHA 2OLGA 2ANMH 4JZDH 1SLVB 5JYIA 1SGRE 4TY7A 2FI5E 3H7OA 2CF9H 2TRMA 3TJOA 2HNTE 2PR3A 2EC9H 3NKKA 3VPKA 1BTUA 8ESTE 1T7CA 1W7XH 2QIQA 1LVYA 2Y5FA 4Q2KA 2G8TA 1ETTH 4DIIH 4K69A 1TNHA 1V6DA 5E0JA 4ZKSU 3SV7A 1ANBA 2PHBA 9ESTA 4PROA 1C2KA 4DY7B 1YY3A 2YMSB 2VIVA 3SV8A 3UNSA 2WPJS 1ABJH 1WCZA 4E06H 2L6OA 2XCNA 4X2VA 1MTSA 1VR1H 1XUHA 2SGAA 2ZC9H 3SGAE 3TJUA 4DT7B 4NIVA 2NU2E 1V2QT 3DT0H 1E79D 3B9FH 1FY5A 1SQOA 4IMQA 5K0HA 1K22H 2V7QD 3OE7D 1S83A 3A8DA 4TT3D 2A1DB 3UQOA 2AMDA 2CMYA 1UVPA 2CK3D 3QGJA 1U6QA 1GJ4H 1A4WH 5DG6A 1UTMA 3FZZA 1HIAB 3Q3YA 5I25A 4FXGH 4HG6A 5HYOA 1Y59T 1TBRH 1CGHA 1VGCB 2FXRA 2ZF0H 4XOJA 3RMLH 4F49A 3A8BA 3PWCA 4F48B 3DSGA 3CS7A 2XBXA 3FANA 4X6OA 3RXRA 3A88A 4O3TA 5K7RA 3OY5U 3GY4A 4DW2U 1GBEA 1KXCA 3RXUA 3LIWA 5DP3A 1SR5C 1H8HD 1NM6A 3RMNH 3UY9A 2R9PA 2WYJA 1JXPA 3WWFA 4B71A 1H9HE 2ZDMA 1UTNA 2BDAA 4Y7AA 4AFSA 1ETSH 1UCYH 4MPVA 1FJSA 1MKWH 3LC3A 2VH0A 4J2YB 2BLWA 4ZHMU 2ODYB 3OX7U 4B6FA 3LONA 2FOHA 3L6PA 1H1BA 4ISNA 2J2UA 3E8LA 5PTPA 3SORA 1HJ8A 2VINA 5E8EH 5FCKA 5SGAE 1D6RA 1GCTC 1GBDA 1KDQB 2Y80A 3BIVH 1XUKA 1GJDB 4XBBA 3D62A 3BG4B 1G2MA 2XC4A 3I78A 1QB9A 1DOJA 1OPHB 1F92A 4ESTE 2ZO3H 4K3JA 1Y5BT 2D8WA 3BSQA 1E38B 1OWDA 2FS9A 2OUAA 4B6EA 1A2CH 2A4RA 2VWMA 1P2KA 3RU4D 4DOQA 1BOQA 1OHHD 7LPRA 4X1RU 1IQJA 3EQ0H 5C17A 2J97A 1SGDE 1Z8GA 3M37A 2UWLA 1BIOA 4FVBA 4VGCB 3TK9A 3ATKA 2WUBA 4Y10E 4CRCA 1JRTA 3ZZBA 4CH8B 2VBCA 2VGCC 1YLNA 3PV4A 1C1MA 2BD9A 2CGAA 4INKA 3GOVB 4X8SH 5F8ZA 5EXNA 3EA7A 1MBQA 2J95A 1XUIA 2ESTE 4ABHA 1TMUH 2WSSD 1ZGVA 4Y71A 4FUJA 3HK3B 1QCPA 3QTOH 1SQAA 3UOUA 3E91A 1DITH 2BD2A 1O5CB 1TGSZ 1YLDA 2FPZA 3PV2A 4RKOB 2ULLA 2BDIA 1UVTH 2ZCHP 1GJ8B 3RXIA 3UPEA 2R2MB 2PSXA 1GBHA 2ZPRA 3L33A 1UCYE 1BCUH 2PGQB 4UFFH 1ABIH 1MZAA 2XBYA 4Y6DA 5FPSA 3S0NA 1A7SA 2P3TB 1TRNA 2FWWA 3A87A 3M7TA 3RXJA 1TWXB 4MNVA 3WY8A 1GPZA 1HAYB 2W7UA 1NS3A 3SYJA 2OP9A 4I32A 1ZPCA 4K5ZA 1V2JT 1YPKH 3P6ZB 3ZZ4A 2ZDLA 1UVUH 2ANKH 3JZ1B 3QO6A 1AWHB 3R3GB 1V2MT 1W12U 1QFKH 5I46H 5GWZA 1RS0A 4XDEA 3TNSA 1TA2A 1F0UA 3V13A 4ACBA 3V0XA 2ZHEH 2BQ6B 2ZTZA 1WTHD 3GDSA 1S0QA 2BOKA 1PPEE 1MQ5A 5EGMA 2M2AA 3SUFA 1GBLA 1EAIA 2CHAB 3PTBA 2FOEA 2PKAB 2AGEX 3M3VA 5LH8A 1GI4A 4TPIZ 5JBTA 1DWEH 5A8XA 4YM9A 2ZIQH 1B0FA 4BXWA 4NA8A 3KQCA 4X1QU 4IC5A 2JETC 4YOIA 1V2OT 1C1PA 3ZZ3A 3A83A 3BTHE 3RM2H 2PKSC 1GMCF 1C1QA 2SGEE 3F6UH 4ZROA 1Z1IA 3T29A 4Y11E 2J98A 1UK3A 1L1GA 2JH0D 1JBUH 1C5ZB 1FXYA 5IK2D 5L30H 1O3KA 1O3BA 3UNQA 2GZ9A 1PPCE 6LPRA 1ACBE 4ISLA 4OS2A 5T1VA 5LPEA 4I8HA 1MD8A 3RC5A 3SJOA 1AN1E 3DUXH 1BMMH 1V2NT 1DS2E 3ZVGA 3D65E 2PTCE 1V3XA 2LELA 2WV5A 4U32A 4CHAB 1RFNA 1A1RA 1GMCG 1RRKA 2F9BH 3SHAH 3SJIA 1V2KT 2OINA 2AGGX 1SGQE 4OS5A 1AB9C 4WVPE 2G4UA 2ZFRH 4CBNA 2XYAA 8GCHF 1NC6A 2QF0A 1D4PB 1NBME 2D2DA 2JDID 3EGKH 2GJGA 2KCAA 3BTQE 3MNBA 2CJIA 3ESTA 2F9PA 2EY4C 1C1VH 1AE5A 1IQLA 1EP5A 3MWIU 4A6LA 2EI7A 2R3YA 3TVJB 3SZEA 1YPLH 2KR7A 3LGVA 4ABDA 2SGFE 1BTXA 1W13U 1ELBA 1HBTH 3CP7A 3S69A 1AKSA 1L4DA 1A3BH 8GCHG 1SG8B 3UIRA 6GCHF 3RXEA 1GL1A 3KYGA 1FNIA 1L2EA 3E1XB 3O8CA 1J14A 3ZVFA 1OX1A 5FPYA 2ZFFH 1O2OA 3BV9B 4NIYA 3U28C 2J94A 4FUCA 2LNCA 2XNIA 4K2YA 3KIDU 4KP0A 1TABE 3H5CB 4BAQB 1HFDA 1EJNA 3EDXB 2ZU2A 4OS7A 1H4WA 1GL0E 3ZVEA 4X0WU 5FX5A 5EW1H 6GCHG 1BQYA 3LJJA 1V2VT 3ODDA 1P9UA 3SV6A 1HAHH 3RXTA 2XNDD 1QGFA 2AEIH 4Q63A 1WUNH 1GI5A 3W94A 3SV9A 2F9OA 3GDVA 3PO1C 3O8RA 1GHVH 3DSOA 1DWBH 1H8DH 4GUXA 4H6SB 1H8ED 5EU8A 1K0HA 3M5OA 1V2TT 3SU6A 3VG8A 4CRBA 1E0FD 2VB0A 1BZXE 1SQTA 1GI0A 1W3CA 2C93B 4U2WA 1UCYK 1CGIE 1FIWA 2BDYA 6ESTA 2G5NA 3SNEA 1BA8B 2WINI 2GVFA 5DP5A 1MTNB 1FDPA 2IJD1 4KTCA 3MYWA 3A86A 1QA7A 1LVBA 3DFLA 3MU5A 1O2ZA 2GGVB 4BAMB 4WF8A 2ALPA 1EB2A 3ITIA 1DLEA 1RD3B 1HPGA 4WH6A 1O3DA 2ZFTA 1GBJA 1JIRA 3T27A 2QAAA 2AYWA 1C9TA 1HAOH 1AUJA 1OSSA 2TGPZ 3TGJE 1A0HB 5EQQA 1GBCA 3SUGA 1ZPZA 2ZP0H 4OS4A 1PQ7A 4UFEH 4X8UH 1O2YA 4YLQH 4AG2A 1QHRB 2V3MA 4FU8A 3ZYEA 1GBKA 4GHQA 3B23B 1TX6A 1ESBA 1BJVA 4J1YA 4KTSA 1QB1A 1LTOA 2HNTF 3MFJA 1GGDC 2ZU3A 2M5TA 3BTFE 3RXDA 4OS6A 1O38A 3AAUA 2P94A 1W8BH 1PPBH 2ZDAH 1O33A 1XXDA 1GVZA 2XWBI 3C27B 3URCA 2ZQ2A 4B2AA 3F9HA 2J92A 3KQBA 3RDZA 1KXFA 2ZG0H 4OS1A 4A92A 4WH8A 5GIBA 4M7GA 1ZSKA 2RA0A 2KZ4A 5C3NA 2WPMS 3QGNB 2ZDNA 1W2KH 2PFEA 3ATIA 3F2GA 1A61H 2JJ1D 2AHME 4GPGA 4F55A 3AW0A 5C1UA 3TH4H 1DXPA 1JOUB 3M7UA 3SO3A 3UOPA 5DO4H 3U8TH 4BNRA 2BZAA 2YNAA 4K60A 5C94A 3SUDA 5G4BA 1QL8A 1YLCA 4ZHAA 5AFYH 4FUHA 1EQ9A 3JZ2B 3GY3A 3S9BA 2FM2A 4D9RA 1OYQA 7GCHF 4I31A 3SU0A 1ZTJA 3NUMA 2WPDD 1RIWB 4NZQA 3GDUA 4X8VH 1GJ7B 4O97A 5E0GA 3MU1A 3ZV9A 2FTMA 3SZNA 2QV1A 1QL7A 1EAWA 2XW9A 4TSFD 1YYY1 1TOCB 4FUEA 1TX7A 2TBSA 5JB8S 2F3CE 1L1JA 4YOGA 4RI0A 4O03A 5A0BA 5L2YH 2Z9LA 3CNRA 1QJ6B 4LZ4B 1XM1A 5A0CA 1N8OC 2AH4X 2H6MA 3PV5A 1QBOA 3U9AH 3NZIA 7GCHG 2D1JA 1BMLA 3M5NA 5E2OA 1ZSLA 1ELTA 4UFDH 2TGTA 3K6ZA 2FEQH 1EZQA 2QXIA 3FZDA 4NG9H 1YGCH 1O2KA 1TIOA 5FAHA 1D3DB 1N6XA 2VIPA 5FHTA 1Q2WA 3F3BA 3KQDA 5EXLA 2A7JA 3A85A 3DHKH 4LK4A 3STIA 1FQ3A 4Z6AH 3ZZDA 1P12E 1UO6A 4A5TS 1P10A 2BD3A 3SGQE 3GY7A 1EKBB 3UQVA 5JB9S 5HM2A 1O2XA 1VCPA 2J98B 4K8BA 2GT7A 1F5KU 4ISOA 1NFUA 1IQEA 1NU7B 2BDGA 2GV7A 3U8OH 2RCEA 2AMQA 1YF4A 1YCPM 1DSTA 4NSVA 2FLBH 2ZWLH 1C5MD 1UK4A 4CRDA 4ABIA 1THPB 1O5BB 4GHTA 3SOSA 5ESBA 2NU1E 5EJZA 3MNSA 2JIZD 1C2MA 1QIXB 1ZRKA 1UW7A 2CN0H 3GY8A 1VITH 4WJG2 1HCGA 2QF4A 2AERH 2QXGA 1EB1H 4TWYA 2FOGA 3N7OA 1C2GA 1XKAC 3TH3H 2DUCA 1WTGH 4NIXA 3RXOA 1TGTA 2EQNA 2KM0A 2Z9GA 1SOTA 3R0FA 1GJBB 1QBVH 1SKYE 1NY22 3A89A 1P2QA 2RFKC 4UDWH 1QJ1B 1H8IH 1NZQH 1V2RT 5DK1A 3FN8A 3T2NA 1AHTH 1Z71A 1WQVH 2W3KA 4DCDA 2NWNA 1AKSB 2SFAA 1XXFA 4AB9A 3RXLA 1ANEA 4D7FA 2QXJA 3RLWH 1FX0B 2I6SA 3PMJA 1THSH 1P9SA 2K0QA 1MKXK 1LKAA 2A32A 1SMFE 1TGNA 1TYNA 2J4IA 1GDUA 3OEED 3GY5A 2J38A 2PV9B 2QGRA 5DSFA 1J16A 1O31A 3V12A 1XUFA 3FP8E 1DWCH 3DCLA 2GD4B 3MHWU 1P8VC 2XRCA 2JH6D 4E05H 1D3TB 1EUFA 1MD7A 5C5NA 5FXLA 5IYTA 2F43B 3SHCH 3TH2H 3ZVCA 1HAPH 1UTPA 4ABGA 2Z7FE 1KIGH 2BY8X 2ILNA 3RMOH 3BTTE 1A5IA 1NT1A 4A7IB 4XSKU 1ANCA 2BDBA 5E0HA 2ZHQH 2VIDA 4NA7A 2FMJA 2QXHA 2ZDVH 3AASA 4D76A 3LGWA 4D8NA 4GLYA 3DSPA 3F0OA 2VWNA 4Q80A 2R0KA 5C67A 4X1NU 4WMEA 1O2WA 4AC9A 1AVWA 1O3PB 5EG4A 3W1EA 4INLA 5EODA 1GDQA 2A45B 2GDDA 3A82A 1ZJKA 4K1SA 4ISIH 3PROA 4IBLH 4Y8XA 5FX6A 2VH6A 1YWUA 4DURA 2TIOA 1LKBA 3IG6B 1P02A 1GJ6A 2ODQA 5BRRE 1NFWA 1MAYA 5CHAC 3RU4T 4X2XA 3SW2B 4WMDA 1TALA 4YLUA 4THNH 3LH3A 2ODPA 1LVMA 4Y8ZA 3BTGE 1O2MA 1C5NH 3QZRA 5JPMH 4GCHG 2Q6GA 1XMNB 1CA0C 1EZSC 1K1PA 2SGDE 4YT7H 3A7VA 7KMEH 1NRSH 4JMYA 1BRAA 2KCPA 1F5LA 1IHTH 1W14U 3PB1E 2BMGB 4QT8C 2BD5A 1AFEH 3NWUA 2Y5GA 2ZHDA 2HPQH 1P0SH 1GVKB 1NRRH 1OP0A 1DFPA 2SGQE 5DGJA 4Y76A 3MH6A 3IWMA 1BRCE 2Z3CA 3OU0A 1CA8B 1HB0B 3SBKA 1QBNA 1KY9A 1Z8RA 3RUOA 1KTTB 5FL7D 3KQEA 3PMBB 1ZHPA 3M35A 3LPRA 2PW8H 1HAVA 1YC0A 1EXFA 1QZ8A 1GHAF 1VCWA 4BOHA 4ZKOU 5C20A 1Z6EA 4ABBA 3FVFB 4FUDA 4B1TA 2H5DA 5DP6A 1LPGB 1ARBA 1AZZA 1K1LA 1D3PB 1RTFB 3N7EA 3TK5A 2FDAA 4TY6A 1ELFA 3DD2H 1BB0B 1QNJA 2GP9B 2UWPA 4CBOA 2WV9A 1LCYA 1SHYA 1OXGA 2PWXA 2W6JD 1SGEE 4AFZA 1G3DA 2EEKA 1TRYA 2P3FH 2IPHA 2WPIS 1QTFA 4X8TH 1TPOA 3VGCC 4FU7A 5HM9A 2ZCKP 1KLTA 1BMFD 1GHAG 1ELGA 1QA0A 2BLOA 5KEDA 3M5MA 2KFWA 1O2VA 3GCHB 1MBMA 2V35A 1OWIA 3Q76A 3RXSA 1NPMA 4CRFA 4X2YA 5C1YA 4D7GA 2ZFQH 1V2WT 4X1SU 5T6FA 3RU4E 5EJ1A 3FKSD 1SGTA 4WY3A 4Y0ZE 5DPAA 1XUJA 1K1JA 1S5SA 3MO6A 4AX9H 3ATMA 4AGKA 1IQHA 2F9NA 2IOTA 1MCTA 1P09A 2IN2A 3MH7A 3PMAB 1CU1A 4RKJB 1GHXH 2QN5T 1GHBF 2EI6A 5HXFA 4OM9A 4H4FA 5EJLA 1C2HA 1Y3VA 1G2LA 1NO9H 2W6ID 1WAYB 1DPOA 1WOFA 2A7HA 5T3HA 1ZTKA 4O3UA 1TNKA 1KXEA 1GHYH 1HYLA 4WMFA 1FN8A 4I33A 4BTUB 4X6MA 3MO9A 1CBWC 1GI7B 4AYYB 5F6MA 2XC5A 2OXSA 4OGYA 1QR3E 1T32A 1GHBG 2BZ6H 2Z9JA 4JCNA 4B2CA 1IQKA 4JZEH 2XBVA 2Y81A 3M3SA 2F4LA 4U30A 2IPQX 4CR9A 1HAGE 1CQQA 1YBWA 5T6DA 2ZKSA 5FBEA 2V6NA 5EIYA 2F91A 2VU8E 1O3AA 3O8BA 2OBOA 3H09A 1OOKB 1CE5A 2ALVA 3TNTA 6CHAC 2R3UA 5CHBA 3M3TA 5J4SA 1DANH 1C1TA 5CHAB 1AWFH 5GPIB 4IN2A 4GAWA 2ANYA 1ANDA 1SVPA 3UWIA 5ABWA 1YM0A 1DLKB 1FMGA 1YPEH 3SI4H 2FOMB 4YTAA 1AFQC 1K1MA 1FY3A 1LMWB 1KTSB 3OYPA 5A8YA 3NRLA 1JWTA 3BTDE 1G30B 1S85A 5EOKA 2Z6BD 2V0BA 2ZGHA 1BRUP 2C8YB 3HATH 1A0JA 1HJAC 1O2NA 2G52A 2QCYA 4RN6A 1AMHA 1QRZA 1W0KD 3MO3A 4FU9A 3RM0H 1KXDA 2F9VA 1GCTB 1O2SA 4ZAEA 3F2FA 3KEEA 3LDXH 1SFIA 1OYTH 4K1EA 1NFXA 1G3CA 2W5EA 3EE7A 1O37A 2BD8A 1BTYA 3A7WA 3H7TA 1P3EA 3LC5A 4XE4A 1AQ7A 1DICA 2DE9A 4YZUA 1WDIA 4X2WA 1C2IA 1GMHF 2ZU4A 3TGIE 4BAOB 1GCDA 1ELVA 2JH5D 3ZVDA 3MOCA 1MKXH 2HOBA 2WHXA 4NCYA 2VGCB 4NGAH 1GMDF 1O2RA 2JJ2D 1DM4B 4ZKNU 1T31A 2VJ1A 1W0JD 1RTKA 3KGPA 5KECA 1CSOE 3PLKA 1C9PA 1EAUA 3LJOA 1ZLRA 2VWLA 1MU6B 3DA9B 4ZXYH 1GMHG 1S82A 4YESB 2OQ5A 1T8OA 1WXRA 5DP9A 4LOYH 2DE8A 4Q4LA 3SJKA 1QY6A 5CE1A 1SL3A 3SNBA 1XUGA 3SNCA 1GMDG 2BY6X 2BB4A 1SC8U 4ZKRU 4AB8A 2HPPH 2ZU1A 5EXMA 1UJ1A 3S7KB 3U1JB 1AY6H 3E90B 3LOXA 2QA9E 2AFQB 5TJXA 2FOAA 4H42U 1EX3A 3U8RH 4DJZB 5F8XA 2VIWA 1EFRD 1KLIH 1GVLA 1T4UH 1FLEE 1BRBE 3A84A 2PLXA 3M36A 2VVVA 4WXVA 4JYVH 4Y8YA 2G5VA 2CXVA 4R0IA 1ZOMA 1SBWA 2J9NA 3ZZCA 1CBWB 2GCTC 1GI9B 3LH1A 1DXWA 4WXIA 5EW2H 3UREA 5FPTA 3VB5A 1TNIA 3RXVA 2FI4E 2ZECA 1BHXF 1UTQA 2PUQH 3P95A 1SLUB 1AU8A 3RXCA 1PQAA 1EJMA 5GXPA 1UVSH 1Z7KA 1WYKA 1ESAA 1FIZA 1FY8E 1O0DH 3SU2A 4MLFB 1HAVB 1KXBA 2HLCA 1FY1A 3AAVA 3PRBA 2B8OH 3PTNA 1RJXB 5CMXH 2SNWA 3P8OA 2JETB 4HFPB 2WV4A 6CHAB 3KQ5A 4KTUA 4Y7BA 5DKMA 1O5GH 2PKSB 1GG6C 3LGIA 2A7CA 3TPIZ 3I29A 2GDEH 4CR5A 1P2JA 3KN2A 1CGJE 1J9CH 1SGCA 3Q3XA 3BG8A 1TNLA 2L74A 1P3CA 5JBBS 2F83A 2THFB 3GYMA 4LZ1H 1J15A 3MNCA 3FO8D 2OC7A 2H5CA 1GI1A 4BAHB 2FODA 2R0LA 1RXPA 3QDZB 1S81A 4BAKB 3MH4A 4DG4A 4BXSA 5AFZH 4ASHA 2GX4A 1S6LA 3MU4A 2V3OH 4YOJA 1Z6JH 2QC2A 1TMTH 3QWCH 1ARCA 1ZR0A 1W11U 2HLDD 4O9VA 1NESE 2YMSC 1AB9B 3A7YA 1FY4A 2OC8A 1MTUA 3GICB 2AIPA 5EPYA 1P06A 5HMAA 1YCPK 1TA6A 1HAXB 1QQ4A 4JZIA 1C4U2 1VITF 3MU8A 3F9EA 4DVAU 2P8OC 5HIYA 3HGNA 1MH0A 3RMMH 1C2DA 4XRNA 3RP2A 2ANWA 1V2ST 3TU7H 3KF2A 2FYQA 2BD4A 1BTHH 1LQDB 1Z8IB 3RXPA 1DE7H 2B0FA 1IQFA 1MCVA 3S7HB 1LHCH 3E16B 4JZFH 8KME2 1O39A 4X6PA 4ZH8A 1ZMJA 3M7QA 4FVDA 1VGCC 1VITG 4JK6A 4SGBE 1ZJDA 1PPHE 3P8GA 1UTKA 2AIQA 2P93A 2NU4E 1Y5AT 2Z3EA 2ZEBA 3OTJE 1A46H 4ZMAH 3LGYA 1C5TA 2GTBA
chains in the Genus database with same CATH topology
1EZXC 2KAIA 1E36B 1ZRBA 4DIHH 4FUFA 5J4QA 2LPRA 3LGTA 1S6FA 8LPRA 1NRNH 2FESH 3A80A 3P8NA 3IITA 2VWOA 1P04A 1O3MA 2H9TH 2OCVB 2W7SA 2A5KA 1FUJA 3QX5H 3PO1B 3BTKE 1CHGA 2C8XB 2VNTA 1TPPA 1C2EA 1GI8B 1BDAA 4A1VA 1SGYE 4D9QA 1OWHA 3ZZ7A 1TE0A 3VB7A 4A1XA 1CO7E 2AS9A 4FUBA 1O3OA 3T25A 2ZGJA 3LT3A 1NRQH 1O2TA 1O3FA 1FONA 3SU5A 1EAXA 3ZVAA 3BG4C 1NROH 1QJ7B 2BOHB 2OQUA 3Q3KA 2BHGA 4XFQA 1HXFH 3P70B 1ZHRA 2PGBB 1AD8H 2A5IA 3RXAA 5A0AE 3ZZAA 1P05A 3CS0A 3F68H 2W3IA 1PYTD 2C3SA 1GJ9B 3FP6E 4VGCC 1K28D 3LGUA 3PLPA 4I8GA 1AVGH 3ZZ8A 4NIWA 2Y7XA 2Y7ZA 2VVCA 1BBRK 3BTWE 1GHWH 1C2FA 3K2UA 1C1OA 1BTWA 4I8LA 2P3UB 1C5VA 4YO9A 1K21H 2BDHA 3TJNA 1GGDB 2VIOA 1CHOF 3EYDA 3K6YA 4JYTA 2O9QA 2FLRH 1THRH 2WPKS 1TPSA 1EP6A 4WWYA 1G36A 3K9XB 2B7DH 2Q6DA 3U69H 5GJ4B 3VEQB 1A5GH 2IJOB 4FUIA 1TNJA 1P2MA 4MPUA 1C4V2 1W7GH 3L3TA 1DUAA 1LVOA 1V2PT 4TWWA 1SPJA 3A7TA 1V2UT 1CHOG 3BN9A 1Z8JB 1W0ZU 3T28A 3SNDA 4ABFA 4AYVB 4JYUH 2OTVA 1PJPA 3SU1A 3P8FA 1TQ7B 2FS8A 1ZMLA 2QF3A 1KLJH 2BYAX 1K9OE 1F0TA 2GMTC 2BD7A 1IQGA 1XX9A 2Q1JA 3URDA 4I8JA 4CREA 4GCHF 3RXQA 4B73A 1SGNE 4B74A 2BX3A 1HRTH 2P8OB 4Q7YA 3GY2A 3TLOA 2VIQA 2P95A 3SI3H 3G01A 2OD3B 3P17H 3KHVA 2CHAC 2CF8H 4GSOA 1O3NA 1O30A 2ZNKH 4IMZA 3QLPH 1IHSH 1PPGE 2GT8A 3KCGH 3ZZ6A 1N8OB 3HK6B 1GJ5H 5FCRA 1C2JA 1O3GA 1ZGIA 4SGAE 2BM2A 1AGJA 5LPRA 1S6HA 3GY6A 3HPTB 4X1PU 4R8TB 1KSNA 1PFXC 1YKTA 1DWDH 3DFJA 3AW1A 3CENA 2UUJB 4E7RG 1C2LA 5F8TA 2TGDA 5AHGH 1N1LA 5C5OA 1INCA 2OC0A 4ABAA 1O3IA 2Z9KA 2O8WA 3S9CA 2O8MA 1P2IA 1GDNA 1XKBC 2TPIZ 1C5LH 3MH5A 5DP8A 2O8UA 3ENSB 1LPKB 3T62A 1DSUA 1IQNA 1O3CA 2ZA5A 1C1RA 1HV7A 1MUEB 1EASA 1WBGB 2BVXH 4CHAC 2CV3A 4AORA 1Y5UT 2PUXB 2BDCA 1SLWB 4UONA 1IQMA 1TONA 2GZ8A 5GCHF 1TX8A 3T26A 2A5AA 1JMOH 3A7ZA 4MVNA 2H9HA 3TGKE 3NXPA 3QZQA 1C5WB 1Y3XA 1B7XB 1C1WH 1BMNH 1CT4E 4NFEA 5H4IB 2YOLA 3EAJA 1OWKA 1RTLA 1LHEH 1ZPBA 1P57B 2GV6A 4B76A 1PPZA 3M61U 3C1KA 1CT2E 2WYGA 1GHZA 2C8WB 5C1XA 2FYRA 3A8AA 4U01A 5AVDA 3UNRA 1SI5H 5GCHG 1KXAA 1EPTA 4NZLA 2Y6TA 3I77A 3RLYH 3ZZ5A 4Q7ZA 3UR9A 1O5EH 2RDLA 4IW4E 1O2QA 4NWLA 1UTOA 4JZ1A 5A8ZA 1AIXH 3MU0A 4CRAA 1P2OA 1MAXA 2QY0B 4LXBH 1ELEE 2BX4A 4INHA 1HAIH 1LHDH 1TAWA 1YCPH 4YT6H 5DP7A 2AGIX 2PTNA 3RXBA 4CH2B 2XC0A 2ZU5A 4Q7XA 1QB6A 1YPHC 1J17T 4NFFA 4IN1A 1JRSA 1B0EA 4MPXA 1LHGH 1ORFA 4TYDA 2BVRH 2G00A 1IOEA 3NCLA 2ZCLP 1GBFA 1ZTLA 2HRVA 2FOBA 3V3MA 4UFGH 3A8CA 2KAIB 3SNAA 1ZZZA 4KKDA 1YPMH 4HTCH 5ETXA 3SQHE 2FX6A 1YPGH 4AOQA 1K1IA 2I6QA 3K65B 2A31A 2ZPSA 1QRXA 3F9GA 5ESTE 1YP9A 1AE8H 3MI4A 1OWJA 2HWLB 1C5XB 2ZFPH 2UUFB 3B8JA 2Z94A 3KL6A 1H9LB 3PM3A 5A2MH 2BTCE 1MTNC 2GMTB 9LPRA 2BXUH 2GZ7A 3QK1A 1UTLM 1TRMA 4UE7H 4AFQA 1ELDE 1TBZH 1K1NA 3UTUH 2STAE 1HUTH 1LHFH 4MG3A 1F0RA 1BITA 2Q6FA 3LKWA 2BLVA 3D23A 2ZTYA 1L1NA 1A3EH 5B6OA 3QUMP 1SB1H 3ZZ9A 1DDJA 4A1TA 1SGFA 3SGBE 1G37A 1G32B 4ZHLU 1C1SA 2RA3A 1DX5M 1OKXA 1CA0B 1AI8H 2ZDKA 1GI2A 1ETRH 1EPTC 2Z9IA 1O2GH 1PQ8A 4K1TA 3ZV8A 2EI8A 4RSPA 1DUEA 2J34A 3ZYDA 4E7NA 4BANB 1G3EA 1E35B 3ODFA 1K1OA 2BVSH 4X6NA 5T6GA 1FN6A 4UD9H 1DT2A 1UHBA 1Q31A 4ZXXH 3MMGA 1SGPE 2BY7X 3QTVH 1FPCH 2ASUB 3RXHA 3BTME 2ZGXH 2NU0E 2D26C 1BBRH 1C5PA 1PPFE 1F7ZA 1T8LA 2HNTC 4GVUA 1KYNA 1O34A 3QN7A 2ZGBH 3TJVA 3D49H 5JDUB 1PYTC 3E3TA 5JBAS 1DVAH 1AUTC 2HGTH 4BTIB 2ZI2H 1F5RA 2V3HH 5TCAA 1BJUA 5A09A 2G55A 1SFQB 1T4VH 2XXLA 2SGPE 3HKJB 1O3JA 1TMBH 4DGJA 1RIWC 1Y3UA 3FAOA 3VB6A 3PYHA 3ATLA 2ZGCA 3VGCB 3U98H 2ZHFH 1DY9A 2NU3E 2OC1A 1O2PA 3SJ8A 1TGBA 3BF6H 1FI8A 1O5AB 1E37B 2BY9X 1EOJA 1BTPA 3F1SB 1TLDA 5TCCA 1C5RA 4TPYA 1ELCA 4ABEA 3FP7E 1K2I1 4ZUHA 4AGJA 2A4OA 3KNXA 4Z0KA 1O3EA 1F2SE 1TB6H 4NWKA 2Y5HA 2FOFA 1LQEA 2WUCA 3FFGA 4H6TA 1EZUC 4AFUA 2B5TB 1TOMH 2P59A 3BEUA 1MTWA 1DY8A 1L4ZA 1Z1JA 1FAXA 2BY5X 2GCHF 2WPLS 2TGAA 4F4OC 4KGAA 2H9EH 1C5SA 1UK2A 2ZFSA 1ZMNA 2A2XH 1JIMA 1P03A 2ZPQA 3VB3A 2AMPA 2XWAA 1VJ9U 4MQAA 1M9UA 1BBRE 1TPAE 1GBBA 1TNGA 3BEFB 4CRGA 2GKVE 2Y82A 5L2ZH 1HIAA 2VVUA 1D9IA 1HAZB 1OS8A 4NSYA 2Z3DA 5EQSA 5F03A 1TBQH 2QYIA 1AO5A 1IAUA 1EATA 2FOCA 1EJAA 1MKWK 1T8MA 2GCHG 1TFXA 2G51A 3BEIB 4AZ2B 3BIUH 1O5DH 1O36A 1QL9A 1QURH 2R2WU 3Q77A 3PLBA 2FIRH 3EE0B 4HI3A 4I8KA 5AF9H 1O2UA 1FV9A 1C5QA 1ZSJA 1W10U 3SU3A 1LO6A 5BPEA 4MPWA 1NTPA 1EOLA 1ZHMA 1HNEE 4MDSA 3UUZA 1BMAA 3RXKA 2C90B 2F9UA 3GYLB 1C1NA 3OSYA 3AVZA 4NA9H 3U1IB 4KELA 4FUGA 3UFAA 1XVMA 3A81A 3A7XA 3GCTF 2K1QA 3ELAH 4JK5A 5E2PA 1UTJA 2C8ZB 3ATWA 1BHXB 1MTVA 5JBCS 3F9FA 4MTBA 1P11E 4B2BA 1AFQB 3BTEE 3SU4A 4B75A 2SNVA 2BXTH 4XBDA 4I7YH 3UWJH 1EPTB 1OWEA 2FI3E 3E0NB 3NK8A 3GCNA 2FZZA 1KDQA 2G81E 1W0YH 1VCQA 4ISHH 4IS5A 1O2IA 1HJAB 2H2ZA 2RG3A 4AG1A 3GCTG 1UMAH 3TIUA 2FTLE 3SQEE 1C5YB 2B9LA 1NRPH 3RC4A 2FP7B 2ZZUH 1VJAU 3M5LA 1HXEH 1X7AC 1Y3WA 5GDSH 4MNWA 3VFEA 1OP2A 2FX4A 3HGPA 2A0QB 1ZYOA 2H1UA 4BTTB 4UEHH 1HJ9A 1G9IE 1SLXB 4ABJA 3UR6A 2FO9A 2W26A 3NPSA 2P16A 3Q00A 2YNBA 5EPNA 1ID5H 4IGDA 3ZVBA 2STBE 1O2JA 1WQSA 1RGQA 1TQ0B 1B5GH 1FAKH 1QQUA 2G4TA 3SV2H 2EA3A 1O2HA 1TGCA 1O32A 1WV7H 1T8NA 3PWBA 1LPZB 1Y3YA 1MZDA 1YPHE 5DJ7A 3TITA 1C5UA 3VB4A 3PMHB 2XTTB 1GBMA 5C2ZA 1CT0E 1N6YA 1C5OH 2HVXA 1HDTH 5L6NH 2ZTXA 2OBQA 2ZHWH 5LPFA 1GBIA 1PQ5A 1P01A 1XVOA 4Y79A 2BLQA 1AZ8A 1S0RA 3VXEH 1OP8A 1NU9A 3S9AA 1CVWH 3W95A 4MNYA 4K8YA 3MNXA 4HGCA 2XBWA 1GJCB 1NN6A 4AN7A 5HGGA 1GBTA 1SGFG 7ESTE 2C4FH 5EQRA 1GI3A 1O2LA 2BQWB 1L0ZA 1SSXA 1FPHH 2BQ7B 3EA9A 4XBCA 1Y8TA 1S84A 3SJ9A 1GBAA 3LU9B 3STJA 1P2NA 1D6WA 3O8DA 3VXFH 1O5FH 3EA8A 2A2QH 2A4QA 1BUIA 2PSYA 1NFYA 1AVXA 1ESTA 5IDKA 1GWAA 2PKAA 2UUYA 3E6PH 1H9IE 3HKIB 1HLTH 2ZQ1A 1WSSH 3SUEA 1G3BA 2GCTB 5FBIA 1ELAA 1UVOA 1SHHB 1UHBB 1MU8B 1O3LA 3RXFA 1BTZA 4IC6A 3V7TA 2HALA 1A0LA 3RC6A 3RXMA 2XCFA 2O8TA 1MMJN 3GCOA 3GISB 1O35A 4MNXA 1C4Y2 3E0PB 1SGIB 1Q3XA 5LGOA 4HZHA 1V2LT 1FZZA 3MTYA 1WU1A 1GJAB 1IQIA 2A4GA 1O3HA 1VZQH 3OY6U 4Y0YE 1SOZA 3RXGA 1GI6A 1E34B 5DP4A 3TK6A 3P92A 1C1UH 1A5HA 3SN8A 1MQ6A 1BT7A 1GG6B 1D3QB 1F0SA 1LDTT 3GCHC 1YPJH 2O8LA 1J8AA 3T5FH 2WPHS 2UUKB 2UWOA 1HGTH 4OGXA 1QRWA 2JKHA 2OLGA 2ANMH 4JZDH 1SLVB 5JYIA 1SGRE 4TY7A 2FI5E 3H7OA 2CF9H 2TRMA 3TJOA 2HNTE 2PR3A 2EC9H 3NKKA 3VPKA 1BTUA 8ESTE 1T7CA 1W7XH 2QIQA 1LVYA 2Y5FA 4Q2KA 2G8TA 1ETTH 4DIIH 4K69A 1TNHA 1V6DA 5E0JA 4ZKSU 3SV7A 1ANBA 2PHBA 9ESTA 4PROA 1C2KA 4DY7B 2VIVA 3SV8A 3UNSA 2WPJS 1ABJH 1WCZA 4E06H 2XCNA 4X2VA 1MTSA 1VR1H 1XUHA 2SGAA 2ZC9H 3SGAE 3TJUA 4DT7B 4NIVA 2NU2E 1V2QT 3DT0H 3B9FH 1FY5A 1SQOA 4IMQA 5K0HA 1K22H 1S83A 3A8DA 2A1DB 3UQOA 2AMDA 2CMYA 1UVPA 3QGJA 1U6QA 1GJ4H 1A4WH 5DG6A 1UTMA 3FZZA 1HIAB 3Q3YA 5I25A 4FXGH 5HYOA 1Y59T 1TBRH 1CGHA 1VGCB 2FXRA 2ZF0H 4XOJA 3RMLH 4F49A 3A8BA 3PWCA 3CS7A 2XBXA 3FANA 4X6OA 3RXRA 3A88A 4O3TA 5K7RA 3OY5U 3GY4A 4DW2U 1GBEA 1KXCA 3RXUA 3LIWA 5DP3A 1SR5C 1NM6A 3RMNH 3UY9A 2R9PA 2WYJA 1JXPA 4B71A 1H9HE 2ZDMA 1UTNA 2BDAA 4Y7AA 4AFSA 1ETSH 1UCYH 4MPVA 1FJSA 1MKWH 3LC3A 2VH0A 4J2YB 2BLWA 4ZHMU 2ODYB 3OX7U 3LONA 2FOHA 3L6PA 1H1BA 4ISNA 2J2UA 3E8LA 5PTPA 3SORA 1HJ8A 2VINA 5E8EH 5FCKA 5SGAE 1D6RA 1GCTC 1GBDA 1KDQB 2Y80A 3BIVH 1XUKA 1GJDB 4XBBA 3D62A 3BG4B 1G2MA 2XC4A 3I78A 1QB9A 1DOJA 1OPHB 1F92A 4ESTE 2ZO3H 4K3JA 1Y5BT 2D8WA 3BSQA 1E38B 1OWDA 2FS9A 2OUAA 1A2CH 2A4RA 2VWMA 1P2KA 3RU4D 4DOQA 1BOQA 7LPRA 4X1RU 1IQJA 3EQ0H 1SGDE 1Z8GA 3M37A 2UWLA 1BIOA 4FVBA 4VGCB 3TK9A 3ATKA 2WUBA 4Y10E 4CRCA 1JRTA 3ZZBA 4CH8B 2VGCC 3PV4A 1C1MA 2BD9A 2CGAA 4INKA 3GOVB 4X8SH 5F8ZA 5EXNA 3EA7A 1MBQA 2J95A 1XUIA 2ESTE 4ABHA 1TMUH 1ZGVA 4Y71A 4FUJA 3HK3B 1QCPA 3QTOH 1SQAA 3UOUA 3E91A 1DITH 2BD2A 1O5CB 1TGSZ 1YLDA 2FPZA 4RKOB 2ULLA 2BDIA 1UVTH 2ZCHP 1GJ8B 3RXIA 3UPEA 2R2MB 2PSXA 1GBHA 2ZPRA 3L33A 1UCYE 1BCUH 2PGQB 4UFFH 1ABIH 1MZAA 2XBYA 4Y6DA 5FPSA 3S0NA 1A7SA 2P3TB 1TRNA 2FWWA 3A87A 3M7TA 3RXJA 1TWXB 4MNVA 3WY8A 1GPZA 1HAYB 2W7UA 1NS3A 2OP9A 4I32A 1ZPCA 4K5ZA 1V2JT 1YPKH 3P6ZB 3ZZ4A 2ZDLA 1UVUH 2ANKH 3JZ1B 3QO6A 1AWHB 3R3GB 1V2MT 1W12U 1QFKH 5I46H 5GWZA 1RS0A 4XDEA 3TNSA 1TA2A 1F0UA 3V13A 3V0XA 2ZHEH