2SFAA

Serine proteinase from streptomyces fradiae atcc 14544
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
191
structure length
191
Chain Sequence
IAGGEAIYAAGGGRCSLGFNVRSSSGATYALTAGHCTEIASTWYTNSGQTSLLGTRAGTSFPGNDYGLIRHSNASAADGRVYLYNGSYRDITGAGNAYVGQTVQRSGSTTGLHSGRVTGLNATVNYGGGDIVSGLIQTNVCAEPGDSGGALFAGSTALGLTSGGSGNCRTGGTTFFQPVTEALSAYGVSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Purification, characterization, primary structure, crystallization and preliminary crystallographic study of a serine proteinase from Streptomyces fradiae ATCC 14544.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords SERINE PROTEINASE
total genus 49
structure length 191
sequence length 191
ec nomenclature ec 3.4.21.-:
pdb deposition date 1994-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sfaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sfaA01
2SGFE 3DD2H 1FIWA 3V7TA 3BSQA 5T3HA 2JETC 5K0HA 1J8AA 6GCHG 4TPYA 4VGCB 4HGCA 3K9XB 2FESH 2H1UA 2PGBB 2ZGXH 1C5XB 4TYDA 3RC4A 3SGBE 5FX5A 1HYLA 3P70B 3E91A 2VWMA 3SV7A 5HGGA 3VB5A 1IHSH 3ZZDA 3TGKE 1MKWH 1P57B 3BTHE 5DP4A 1O2XA 1A7SA 1HBTH 1ESTA 4X8SH 3BV9B 4BAHB 1CA8B 1ZRKA 2IJOB 1O2RA 1IQEA 4AFSA 4RN6A 1GGDB 3TK5A 2SGPE 5AFYH 1BZXE 3RXOA 1P2JA 3A88A 3CP7A 2BQWB 2H6MA 3KL6A 3QZQA 1KTTB 2BD5A 1O5BB 4X2VA 4MTBA 3T29A 2WUCA 1YYY1 4M7GA 2GCHG 4AGJA 2BD7A 1OOKB 1W8BH 4KTCA 1P2IA 1LVOA 2ZHDA 1P10A 1PPEE 3EYDA 2AIQA 2FOHA 4MNYA 3KIDU 4OS1A 1E0FD 2J4IA 1ZMLA 3SBKA 1WTHD 2ZFQH 2XRCA 1AN1E 3K6YA 1F7ZA 2AMQA 5CMXH 1C5SA 4Q80A 2ZTZA 3PMBB 4U2WA 2P3FH 1NS3A 1OWIA 3PTBA 1YPMH 4ABEA 4INKA 1LMWB 1O3PB 1RFNA 1AUJA 2ANMH 3DHKH 1PPCE 3BTFE 4JCNA 1GMCF 2ZGHA 1GJ8B 1TWXB 3ZVBA 1SQAA 2ZU3A 3SNDA 4AFUA 1K9OE 1O3KA 4AORA 2BDCA 3OTJE 3SOSA 3LC3A 1ZTJA 2TGAA 3E1XB 1JOUB 2ZECA 2V6NA 1BUIA 3LH3A 9LPRA 2VH0A 5FBIA 3BTGE 2STBE 1IOEA 2A5KA 3EA8A 1SLWB 5DKMA 1MAYA 3Q77A 1FY1A 1BTXA 1CHOF 1BMLA 2PHBA 2HPPH 4FUGA 4MDSA 1SGRE 4GVUA 1VITF 4TWWA 4CRBA 1T8MA 3O8RA 1UVOA 1O3HA 1SQTA 3SQHE 4CRCA 1WOFA 2ZZUH 3M61U 2G52A 2EEKA 2ZFSA 2A7CA 4NFEA 1FIZA 3QO6A 1RD3B 1OWEA 1MBQA 3RXVA 1XVOA 1GMDG 2WV5A 5EQSA 4A5TS 4WMDA 1KXBA 3A7YA 3M5LA 3ZVCA 4UFDH 3QK1A 4IGDA 3H7OA 1AO5A 3A85A 1KDQB 1GHBF 4DURA 2WYGA 1G3EA 1GBCA 5T6FA 2VWLA 3UWJH 3ZVGA 4UDWH 4THNH 3GYLB 1HXFH 1VJAU 1TNLA 4I8GA 2A5AA 4ZAEA 1P04A 1EAXA 1MBMA 3T25A 1F5RA 2BM2A 1UVTH 4X6PA 4XFQA 3W94A 1C1SA 2WPKS 1YKTA 3MNBA 1V2QT 1EATA 5EW2H 1TNGA 4LXBH 2FM2A 2ODPA 1BJVA 1NFXA 2ALVA 1DY9A 1CE5A 1MTSA 1QJ1B 3IG6B 1EOLA 1TAWA 3HK6B 1G3BA 5LGOA 3BG8A 2GCHF 3F9FA 4MPUA 1O30A 2AYWA 4Y6DA 1C9TA 1KXCA 3RXUA 3ZZAA 3MU4A 3BN9A 1TX6A 2GGVB 1Y5UT 2HOBA 5EU8A 1EP6A 1TX7A 1MTUA 2CHAC 2I6SA 8LPRA 1QNJA 1AHTH 1GBMA 3V13A 3FP6E 2P3UB 2W7UA 3T5FH 3ZVDA 3MFJA 3LKWA 1G3CA 1S5SA 1T32A 4NZQA 1Y5AT 2PKAB 1YBWA 4MLFB 1GDQA 1O2SA 3KQDA 1P05A 3H7TA 3S9AA 3SW2B 3B23B 4Y7BA 1P01A 1KLJH 3LGWA 5DP7A 1XUGA 2F9BH 1AU8A 2FX4A 3TITA 3FANA 2P8OC 1ANCA 2VWOA 3TIUA 4YOGA 3FP8E 2WINI 3PMAB 3E0PB 2SGAA 1MTWA 3Q3XA 1IQMA 1C1NA 4AN7A 1HFDA 4I8JA 1O2KA 4IC5A 5C2ZA 1OP2A 4IS5A 4GPGA 3QUMP 2M5TA 3BTTE 3L6PA 1B5GH 4ISHH 5B6OA 3A86A 3DFJA 2WYJA 4CRGA 2UWLA 2VIVA 2WPHS 2Z9JA 5A0BA 1O35A 4GHTA 5JBAS 2XBYA 2Y80A 3EQ0H 4E7NA 3BEFB 1ZGIA 4R0IA 2Y5GA 4ISNA 4UD9H 4UFEH 2ZGCA 1AWFH 1LHDH 1H9IE 2Y7XA 2FS9A 2BOKA 2O9QA 1UK2A 1SFQB 3SHAH 1C5WB 4JK5A 1Y3VA 2PKSC 3TJUA 1XUFA 4U32A 2TRMA 1PFXC 1WU1A 5CHAB 5E2OA 3F9GA 1O2ZA 1TGTA 3RU4D 3S7KB 1A3BH 1RTKA 4IN2A 1IQLA 1C2FA 1YCPK 2HGTH 2BLQA 2BLWA 1EAWA 1K28D 4ABGA 1FZZA 1GCDA 3TH3H 1KY9A 1NRNH 1F0TA 2C8WB 1C2KA 2OC7A 4NG9H 1WQVH 7LPRA 1LHCH 3GY5A 1L1GA 3ATWA 4TY6A 2UUYA 1TMTH 1GBJA 1BTHH 3N7OA 3VXEH 5DGJA 1P9UA 4X6NA 1AKSB 3SU6A 2R3UA 3M3TA 3CENA 3P95A 5GPIB 4GSOA 1UTKA 1MTVA 2PGQB 3LJOA 1UJ1A 1C5YB 3V0XA 4HTCH 1GMCG 4MNWA 4BNRA 3ZZ4A 2DE9A 1SGNE 1EJMA 4DT7B 1YPJH 4B1TA 8GCHF 2Z9KA 4NGAH 2FO9A 2VIQA 1UK4A 2OCVB 3ODDA 3T2NA 1TMBH 2XW9A 1QL7A 2BD4A 2I6QA 3FP7E 1GI9B 3TVJB 2W26A 2A2QH 2ZQ2A 1C5ZB 1SSXA 1TRYA 2HVXA 1MKWK 2V0BA 3UQOA 1DITH 4MG3A 4E05H 1F0RA 3A81A 3AAUA 4GCHG 2BQ6B 1GGDC 1TQ0B 2F9UA 3BTDE 2OQUA 3TGIE 3MWIU 1RIWB 3R0FA 3BEIB 2BQ7B 2BB4A 1NZQH 1FY5A 1Z71A 4OS7A 1UK3A 1EPTA 1K1OA 1GPZA 1RJXB 3F6UH 1BBRH 1GG6C 1NROH 1THPB 2V35A 1QL8A 2BD2A 1RRKA 4X0WU 1OYQA 2HNTF 2CGAA 4FVDA 4Y71A 1DE7H 4OGXA 1SB1H 2BD8A 2QXGA 5EG4A 1FY4A 1KSNA 4YT6H 1RTLA 4WH8A 2BD3A 1S83A 1W7XH 4IN1A 1PYTC 2GVFA 3TH2H 1IQIA 3RMNH 4FU8A 3ATMA 1HAHH 3HKIB 4NIYA 4KGAA 4SGAE 4X6MA 1N1LA 1P2KA 2BD9A 5F03A 5AVDA 3LU9B 3GCHC 4OGYA 2B8OH 1ZR0A 4X6OA 1C5LH 1V6DA 2VJ1A 3EGKH 3I78A 1W11U 1ZSLA 1TIOA 2CHAB 1ELTA 1MAXA 1GI7B 3P6ZB 2NU1E 3PLPA 3TPIZ 1SGQE 3HKJB 1BB0B 2ZWLH 5IDKA 1QCPA 3HK3B 2NU3E 3Q00A 2GT7A 1O3FA 5FPYA 3O8BA 4K3JA 1GBAA 3L3TA 4WMFA 1WYKA 2GT8A 2FTMA 1QJ7B 2FTLE 1BBRK 3IWMA 3LGYA 4UFFH 3C27B 2VWNA 4BXWA 2QXIA 5DP5A 2QC2A 3KN2A 2SFAA 3KNXA 3MO3A 4E06H 1L4ZA 1MQ6A 2FS8A 2ZU1A 5SGAE 1NPMA 1C1WH 5AHGH 1SOTA 3Q3YA 4O97A 1VR1H 2GP9B 3PYHA 7GCHG 1EZQA 1SQOA 2GV7A 1CQQA 1GBFA 1C5OH 1DPOA 1SGFG 4HI3A 4DIHH 1SFIA 1A61H 3M5NA 3PV4A 2GV6A 1AIXH 2EI7A 2W3KA 4LK4A 3O8DA 1GI1A 1C5UA 1BTZA 1YLDA 1A2CH 1HAXB 3RXQA 3UR6A 1XKBC 1Y3WA 3LT3A 2OBQA 3MH4A 1EJNA 4X2WA 3RC5A 2TIOA 1AKSA 2BY9X 1ANDA 1GHWH 2R0KA 1AE8H 3URDA 3RXDA 1CVWH 1GJ7B 1MUEB 2QAAA 3OSYA 3UQVA 2EC9H 1O3BA 3VEQB 1F5KU 3ZVAA 1Y8TA 1TOMH 3ENSB 1DDJA 4AFZA 4FUHA 1A3EH 3QTOH 2EI8A 3LOXA 2DUCA 2D8WA 5A0AE 3RU4E 2XCNA 3TK9A 1LQDB 1IQNA 1THSH 1RGQA 3A84A 4X1QU 4D7GA 3LDXH 1C2JA 2O8MA 1FDPA 1ZHRA 1F0UA 2P59A 1H8DH 1AI8H 1WQSA 3SUFA 2ZHFH 3QGNB 1H9LB 1XXDA 2CXVA 1Y59T 1LVMA 2GZ7A 1AFQB 4NA8A 3E8LA 5T6GA 3V3MA 2QCYA 1AFQC 2J92A 3EE0B 1QIXB 6ESTA 2Z6BD 4ZMAH 2UUJB 3A7WA 1O5EH 2ZKSA 3LGIA 5EQRA 1QB6A 4ABHA 1SGDE 3BTKE 1O2MA 4CREA 2XXLA 1O2WA 1GJDB 5CE1A 4X8VH 1LTOA 1WSSH 3SUDA 1MTNB 4OS5A 1BMNH 3UNSA 1PPZA 4WMEA 1Q2WA 2BLVA 2CN0H 2ZP0H 3GCTG 1P2MA 4X1RU 1SGIB 1SBWA 2D2DA 4JYUH 3ZVFA 3KHVA 4BOHA 3AVZA 3AASA 3EA7A 3HPTB 1SGTA 5G4BA 1JIMA 3T27A 1GI5A 1QY6A 1C4U2 3QLPH 4XSKU 5FAHA 1E35B 2PWXA 2C8XB 3SZNA 5I46H 4WWYA 2JH5D 2ZFPH 2AERH 4MPXA 2A4QA 1XKAC 1CHOG 2XYAA 3VB4A 1DT2A 1HPGA 1W0ZU 3GISB 4D9RA 1KXFA 2WUBA 1E34B 4SGBE 5GWZA 2ZFTA 2GCTB 4F49A 3ZVEA 1O39A 3OX7U 2PSYA 1PPGE 1V2MT 1L0ZA 5E0GA 2OC1A 3ZZ7A 1SC8U 1Z6EA 3M5OA 1O3MA 4NIXA 3A89A 1HAVB 3TNTA 4K1SA 1GWAA 5TCCA 4A7IB 3G01A 1ACBE 2D1JA 4I32A 2OC8A 3MU0A 1OKXA 3QN7A 5LPFA 5EQQA 3LPRA 2QA9E 2UWPA 3SGQE 2BX3A 3PMJA 1BTYA 1P03A 4ASHA 1SLUB 6LPRA 1TFXA 1GJ4H 2OD3B 4K1TA 1DWEH 2OINA 2ZFFH 3ZZ8A 1ETTH 1N8OC 1O2OA 1W12U 1K1MA 3P8OA 3U1JB 5EW1H 4K69A 1ZTKA 1LCYA 1P2QA 1P09A 1AVXA 1HAYB 1LPKB 2FXRA 3ZV8A 1F2SE 1O3JA 4JMYA 2EI6A 1BA8B 1ZLRA 3M5MA 4AX9H 3TU7H 1GHAF 2PUQH 1O37A 1OYTH 2VNTA 3A80A 4Z0KA 1TGBA 2J95A 1O0DH 3UOUA 3ATLA 4H6SB 3SU1A 4Y8YA 3D23A 5DPAA 2R0LA 1P0SH 4Y0ZE 1N6YA 1YCPM 4J2YB 4CRFA 2PFEA 1ZJDA 3MYWA 1A5GH 2O8TA 2WPJS 5C67A 1THRH 1EAIA 3M7QA 1AVWA 2BVSH 4FXGH 4Q2KA 5E0HA 1AWHB 5TJXA 3S7HB 2CF9H 2BDGA 1MZAA 1YC0A 2TGTA 1J15A 3NK8A 1W10U 4DGJA 4BANB 2ZF0H 3CS7A 3TJVA 3BTME 3SN8A 1GI6A 7GCHF 3P92A 4ZXXH 2ZHEH 1G30B 4CRDA 2QF0A 1TRMA 2Z3DA 1D3PB 4X2XA 4Q7XA 2GKVE 3SV2H 1GI8B 3BTEE 2HNTC 1LPZB 5LPEA 1L4DA 2FYQA 2Q1JA 1HIAB 2BZ6H 1YPHC 4ISIH 3ELAH 5TCAA 1AZ8A 1HAVA 2A7HA 1VCQA 1GJ9B 2AMDA 1SLVB 2B5TB 1BCUH 3UNQA 1O2UA 2Y5FA 3BG4C 2XWAA 1HDTH 2C3SA 1LHEH 1HV7A 1LHGH 4Q7YA 3TJOA 5L6NH 5FCKA 1V2NT 1C5QA 1BRAA 4UONA 4KP0A 3SJIA 4NSVA 4YLUA 1YPHE 1ZOMA 1H1BA 3GY2A 1C5NH 1O3EA 3Q76A 1EOJA 1C1TA 3D62A 1FPHH 3F9EA 1YGCH 3GYMA 1ZGVA 1QFKH 1ELGA 1OSSA 3GCNA 1YP9A 4B76A 4B71A 1JWTA 1LKBA 1V2UT 3EDXB 1NFUA 1TNJA 4XOJA 5HM2A 1QTFA 1TGNA 2A7JA 4INHA 1TONA 4B73A 2C4FH 2XBWA 3SU3A 1Y5BT 4ISOA 1DFPA 1UHBA 2PKAA 2ODYB 2Z9GA 5JB8S 2VGCB 8KME2 1CT4E 2FOBA 4X1PU 1BBRE 4IBLH 1GMHG 5A8XA 5FPTA 3KQEA 1C1MA 2Y6TA 1HGTH 1K1LA 4NCYA 1MCTA 1RIWC 3MNSA 5A8YA 2ZI2H 3KF2A 1ZYOA 3MU5A 5A2MH 5LPRA 3PM3A 2FI3E 1T31A 1L1NA 1XXFA 1EUFA 2KAIA 5HYOA 5L2ZH 2AGGX 4BAMB 1TPPA 1GHAG 2Z3EA 2W5EA 1OS8A 1K1JA 5EODA 1SGEE 1TQ7B 2W3IA 1C1PA 3A8DA 3HGNA 1BOQA 3OY6U 4X2YA 1HJ8A 1O32A 3RLYH 2TGDA 2ZC9H 4OS4A 4JZEH 1TBQH 1XUIA 1GVLA 1TA2A 3P17H 1GBIA 2NU0E 2ZEBA 1ARCA 1ID5H 1C2LA 1C9PA 4O3UA 4RKOB 2ZDMA 1ESAA 3MMGA 5J4QA 2LNCA 1GCTB 4K5ZA 1DWCH 5E8EH 1LDTT 3NKKA 3RXTA 4H4FA 3QZRA 4J1YA 1ZHPA 2FPZA 3RMLH 1ZSJA 1HAOH 4XDEA 3MHWU 3HGPA 4B75A 1P9SA 3VB3A 4ABFA 4GLYA 2J34A 2NU2E 4ZH8A 2KAIB 5ABWA 2WPMS 1H9HE 3URCA 2Q6FA 3SHCH 2GX4A 2GMTB 3VGCB 1OX1A 1FI8A 2BDBA 1C1RA 2FEQH 3P8GA 3ZV9A 5GCHF 1IQGA 2R9PA 3PB1E 1NY22 3E0NB 3RLWH 1EZSC 2P94A 4BTIB 3UIRA 1MU8B 1XX9A 2A32A 2IOTA 3ATKA 3SU2A 2P3TB 2HWLB 3RXGA 1NRSH 1RTFB 1QBOA 5IYTA 4VGCC 4K8YA 4YLQH 1FONA 2BXUH 1NC6A 1BDAA 1T8NA 3GDSA 2XNIA 5EOKA 4WY3A 2BDYA 2A45B 4JK6A 2C90B 1D3TB 5GIBA 3NWUA 1P3CA 2GDEH 3DA9B 1EXFA 2FDAA 5PTPA 4GUXA 2ZIQH 1TE0A 4F4OC 1V2LT 2J2UA 3U98H 2SGQE 1ZMNA 1UTPA 2OLGA 1J16A 3LONA 3SJOA 5A8ZA 4D76A 2BYAX 3A8AA 4YOJA 1AD8H 3RXAA 1K21H 1GHYH 2ESTE 4ZKOU 2PTCE 2Y82A 4CRAA 4DG4A 3KEEA 1K2I1 1SLXB 1XUJA 2ZHWH 5JPMH 1EP5A 2J94A 2H9TH 1HB0B 3A87A 2QF3A 4X8TH 4CBOA 4NWKA 2PUXB 1O2YA 3AW1A 1UVUH 3S9BA 3GY3A 4TWYA 2P16A 1QQ4A 1ZPZA 1SPJA 3NPSA 4H6TA 4MVNA 1V2ST 3UPEA 2ZPSA 1T8OA 3A82A 1A5IA 3A7ZA 1DSTA 4A1XA 1O2GH 1GBEA 1QQUA 3WY8A 4MNVA 1GI0A 1C5PA 5JBBS 3M35A 2AS9A 1TNHA 2RG3A 2UUKB 1IQHA 2GMTC 4IMZA 2H5DA 4K60A 4Y79A 3VB6A 1ELFA 4YO9A 1V3XA 5C1YA 3ZZBA 2GZ8A 3EA9A 3L33A 2FI4E 1YPKH 1HIAA 2P93A 1O3IA 2RA0A 1ELVA 3DFLA 1W14U 1TBZH 3GOVB 4I33A 1LQEA 2WV4A 2BTCE 1VJ9U 4IW4E 1AB9B 4WJG2 3KGPA 2ZGBH 3UOPA 2PLXA 1SGCA 4O03A 3TLOA 2A31A 3GICB 2JETB 1GBBA 1MMJN 3MI4A 1F92A 2F91A 5AFZH 5F6MA 1IQFA 3K2UA 2VIDA 3FVFB 2NWNA 4PROA 1ESBA 1F5LA 5HXFA 3GY6A 2THFB 1WAYB 1ZPCA 1ZZZA 4NIWA 5DP9A 1FV9A 5DG6A 1Z8IB 3GCOA 5C20A 3RM2H 4ABDA 1ETSH 1O2QA 1TX8A 1D9IA 1O5GH 4UFGH 1GI3A 2ZDVH 1G9IE 1DS2E 1V2KT 2RA3A 3ZYDA 1B7XB 1YM0A 3ZZ9A 1GJCB 3SU0A 2R3YA 1V2JT 3Q3KA 2BY8X 5FCRA 1HAGE 4ABJA 1HAIH 4UEHH 4LOYH 2FOAA 2XWBI 3OU0A 2HRVA 4JZ1A 1ANBA 3M37A 3M36A 3H5CB 3QTVH 3RXCA 1VITG 1GJAB 1UCYH 2C93B 1MU6B 3B8JA 2QYIA 2QXJA 4U01A 4Q7ZA 1O2JA 1GBTA 1D4PB 4AOQA 1NRPH 4XE4A 3MO6A 3NXPA 3BG4B 3CS0A 1EJAA 4DOQA 4XBDA 3MOCA 1GMDF 1WCZA 4DY7B 1O33A 4BAQB 3PO1B 2R2MB 3JZ1B 2V3OH 3MNCA 1TB6H 3BF6H 1PQ7A 1O3NA 1SR5C 1V2TT 1SHYA 1HXEH 2NU4E 2ZHQH 1UVSH 1MD7A 1MTNC 1T4UH 5A09A 1RS0A 1UTLM 1CT0E 3RXBA 3ZZ3A 1BHXF 4YOIA 4ABBA 1MQ5A 1V2PT 3U9AH 3VGCC 2O8LA 4FUDA 1PQ8A 5C1UA 1MKXH 3SI4H 4TPIZ 1O5AB 1Q31A 2XC5A 4ZHLU 2ZDLA 1P2OA 1K1IA 1UTOA 1ZRBA 1UHBB 1NM6A 4X1NU 2LPRA 2Z3CA 1C5VA 1QJ6B 3LH1A 2P8OB 2QN5T 1S6FA 3S9CA 2CMYA 5T6DA 1MD8A 1GI2A 1AFEH 1A0LA 3SJKA 3RXFA 1BITA 3GY4A 3F9HA 1DM4B 1K1PA 3O8CA 1L2EA 1VCPA 2OP9A 1C1VH 1DUAA 2A5IA 1SMFE 1AVGH 3R3GB 4Y76A 2G00A 2ZDAH 1QB1A 4ZKSU 1WV7H 4CH2B 4AYVB 1HUTH 1ZHMA 2XCFA 1U6QA 4K1EA 4NA7A 4QT8C 2QGRA 3RUOA 1YPEH 1O3GA 2BHGA 4DCDA 2XC4A 1ZPBA 4NFFA 3RXKA 2GCTC 1IAUA 1PQ5A 3ESTA 1Y3XA 4GHQA 4OS6A 5F8XA 5ESTE 4AYYB 2ANKH 1O3DA 2A4OA 4K8BA 2C8ZB 3P8NA 5GCHG 2H9EH 3E16B 5FHTA 3W95A 5C5OA 4TY7A 2TBSA 2G51A 2VH6A 3RXPA 2GDDA 1Z1JA 2HLCA 1BHXB 3QGJA 3I77A 1PJPA 1G2LA 4YT7H 1HAPH 1UTQA 4NWLA 4B74A 1CT2E 2AMPA 2ZNKH 1HJAB 7KMEH 2VVVA 2BZAA 1GDNA 1FN6A 3ZZ5A 1YPGH 4JZIA 2FZZA 4UE7H 1N8OB 3AAVA 4Y11E 1JIRA 1RXPA 3MH6A 1XUHA 2TGPZ 3GY8A 5C5NA 2AGEX 1GHBG 4B2BA 1BMAA 1NRRH 4H42U 2C8YB 1DSUA 1NRQH 4AB9A 4MNXA 5EPYA 1A0HB 4A1VA 4CHAB 1CGIE 2A4GA 1S84A 4ABIA 1NO9H 1CU1A 1G3DA 5JBCS 1F0SA 1TPSA 4R8TB 1C2MA 2JKHA 1FN8A 4DW2U 3PROA 1O5FH 4I7YH 1JRTA 3BIVH 5K7RA 3E90B 2ZGJA 3RC6A 1ELBA 3SGAE 1A5HA 1MKXK 1TPOA 2J9NA 3A8BA 3GY7A 2Y81A 4HZHA 3JZ2B 1Z6JH 2AIPA 3T62A 1XM1A 7ESTE 1DVAH 4ZROA 1BTWA 1XUKA 2A1DB 1C2IA 3DUXH 5HMAA 1L1JA 4JZDH 2RDLA 4FUBA 2VGCC 3PTNA 1O36A 2ANWA 5ETXA 1UVPA 2YNBA 1GVKB 1JRSA 1JBUH 1Z8JB 4O9VA 1LVBA 2XBXA 3M7TA 2HPQH 3VPKA 4RSPA 2FOGA 3QDZB 1QL9A 1KLTA 2V3HH 3VB7A 4D9QA 1CGHA 2BY5X 1GI4A 1MCVA 1QBNA 1FLEE 2W7SA 3UNRA 3NZIA 2ZCHP 2F83A 1O31A 1C1OA 1DOJA 4CR5A 2K1QA 3U8RH 1CA0C 1C5RA 1QB9A 1Y3YA 3SUEA 3LGUA 2O8UA 2ZDKA 3ZZCA 2O8WA 1SGYE 1QURH 1GBDA 4Y10E 2SNWA 3E3TA 3FZDA 2VIPA 1LKAA 2D26C 4Y8XA 3SV6A 1T8LA 4OS2A 1EB2A 3QWCH 1GBKA 3A8CA 2ILNA 3RXEA 2CF8H 2BDHA 3ITIA 1P02A 4FUEA 1SOZA 4I31A 5F8ZA 1B0FA 1O2PA 1DY8A 3BIUH 4XBCA 1ETRH 1DLKB 1S81A 2STAE 1KXEA 4YZUA 4I8LA 1ELEE 1BIOA 2WPLS 4WH6A 3PO1C 2BDIA 4XBBA 1Y3UA 4NA9H 5LH8A 3MO9A 3GDVA 4WF8A 3A7XA 2PTNA 4AGKA 1BMMH 3SNCA 2Z94A 1IQJA 2VB0A 1AB9C 1AY6H 1D6WA 1G37A 4ZUHA 3B9FH 1T7CA 3D65E 4DIIH 1DXPA 1GBHA 1AUTC 1LVYA 4ESTE 1K1NA 4ZKRU 2A2XH 4JYVH 3ODFA 5EGMA 2F9PA 1JXPA 2G5NA 1NFYA 1FJSA 3RXIA 3MTYA 1FMGA 4MPVA 1EZXC 3RXHA 6CHAC 3TGJE 1CO7E 1QGFA 2FOMB 6CHAB 2GTBA 2PR3A 4A92A 2UWOA 3SUGA 2PKSB 5BPEA 2Z9IA 2ANYA 5EXLA 1KIGH 4AZ2B 1PPFE 4Y8ZA 3U1IB 3F68H 4MQAA 4NZLA 1OWKA 1W3CA 3NCLA 1UMAH 1QRZA 1TNKA 2OXSA 1BRBE 1FAXA 2A4RA 4JYTA 3RXRA 1BTPA 5DP3A 2G55A 3VFEA 4K2YA 1KXDA 5DP6A 2VVCA 3A83A 3KQBA 4AFQA 3STIA 1HLTH 4BTUB 3K65B 1D3DB 2VVUA 3RM0H 3UY9A 1CBWC 1K22H 1C2HA 1DUEA 3A7VA 3SV8A 3T26A 1LHFH 4YM9A 5DK1A 2BXTH 2Q6DA 1H8IH 3LIWA 1A4WH 1TOCB 1YF4A 4BTTB 8ESTE 1EB1H 1S85A 4LZ4B 1O38A 4IC6A 2VIOA 2ZDNA 3LGTA 2ZU2A 2XTTB 1O3AA 1AZZA 2BLOA 3MU8A 3RU4T 2FMJA 1KYNA 1TGCA 3PWCA 1Z7KA 1TNIA 1P2NA 4A6LA 4DJZB 3RXLA 1O3LA 1S82A 1GJBB 4CBNA 4X1SU 4MPWA 4AB8A 5F8TA 4IMQA 1GDUA 3S0NA 1QA7A 3UR9A 2JH0D 3SNEA 4B2AA 1NU7B 1ORFA 3E6PH 3SU4A 1WUNH 2P95A 1SI5H 2FLRH 4YESB 1Q3XA 2QV1A 3TNSA 2RCEA 2AFQB 4GCHF 1NT1A 1V2OT 1XMNB 1W7GH 1HRTH 1Z8GA 1KTSB 5JDUB 2FX6A 1P8VC 2QIQA 3MU1A 3PLKA 1FQ3A 3QX5H 1ZMJA 2GZ9A 1HCGA 2CJIA 2FODA 5JBTA 1A46H 3M3SA 1QRXA 2R2WU 5I25A 1TLDA 1NFWA 1QR3E 2FYRA 3BTQE 4JZFH 3RP2A 3BTWE 3RXMA 2B7DH 2OQ5A 2A0QB 1AQ7A 4NSYA 1X7AC 1ELCA 1C1UH 4DVAU 1GVZA 2Q6GA 1EKBB 4Y7AA 1ABIH 1YLCA 1QBVH 4WVPE 2YNAA 2FP7B 1ZJKA 2SGDE 2IPHA 1OP8A 1O3CA 2ZO3H 2GD4B 1O3OA 3SJ9A 3KQCA 2DE8A 5DO4H 1BQYA 1CA0B 1GHXH 2F9OA 1XVMA 3U69H 1E37B 1SVPA 5AF9H 3HATH 3STJA 1EASA 1O2NA 3SNBA 4E7RG 1ANEA 3UTUH 2ZTYA 1KXAA 2BVRH 1TGSZ 2OC0A 1FAKH 1W2KH 3TH4H 4KKDA 1O5DH 1D6RA 1GL1A 1C2DA 1V2RT 1WTGH 3VXFH 1GCTC 1PPHE 3LGVA 3P8FA 4ZHMU 1ZTLA 2FOEA 2OBOA 5H4IB 1TRNA 1GJ5H 4B2CA 2PW8H 1FPCH 1DWBH 1N6XA 1C4Y2 1PYTD 3MH7A 1M9UA 1O5CB 1VCWA 1O2TA 4FU9A 1O2IA 1DICA 1ELDE 2XC0A 3LC5A 2ZFRH 1CGJE 1HNEE 4YTAA 1LPGB 1KLIH 2B9LA 4KTUA 8GCHG 1CHGA 2FOCA 1GBLA 2F9NA 1GJ6A 2ZA5A 5E2PA 5C3NA 1G2MA 2Z9LA 4RKJB 4ABAA 1EPTC 1GHZA 3SJ8A 4D8NA 1S6HA 1TABE 2BMGB 2G8TA 2ZPQA 1OPHB 3IITA 1D3QB 1SG8B 1V2VT 4ZHAA 5BRRE 3UREA 4I8KA 2FOFA 1GMHF 1NESE 6GCHF 3MNXA 5EXNA 2FLBH 4A1TA 1CSOE 1Z1IA 3GCTF 3K6ZA 3MH5A 3OYPA 4LZ1H 1SHHB 3V12A 3SO3A 1O2VA 2SGEE 3DT0H 1EZUC 2PV9B 1YCPH 4X8UH 3C1KA 1EQ9A 2CV3A 5GXPA 3PMHB 1AGJA 1O2HA 1P11E 1G32B 2F9VA 9ESTA 5HM9A 1FY8E 3ZZ6A 2ZTXA 5CHAC 1FY3A 1EX3A 4Z6AH 1OP0A 1OXGA 1TBRH 4FU7A 2XBVA 1GG6B 2J38A 1MZDA 2QXHA 1C1QA 4U30A 2ZPRA 3T28A 3SQEE 1A1RA 1E36B 3FZZA 5FX6A 3SV9A 2BVXH 2AGIX 4AG1A 5EPNA 3SU5A 2ZQ1A 2B0FA 3PWBA 1SGFA 2UUFB 1H4WA 1AE5A 2ZCKP 2EA3A 2G4UA 3TK6A 5DJ7A 4CH8B 3RMOH 2WPIS 3FFGA 1ZSKA 4Y0YE 4BXSA 1C5MD 3GCHB 4WXVA 5L30H 1IQKA 2IN2A 4ZKNU 1O2LA 1P06A 1OWHA 3RMMH 1BT7A 1J9CH 1S0RA 1UTMA 4I8HA 3AW0A 3SORA 5JYIA 2BX4A 3GDUA 4KELA 2HNTE 3F1SB 4NIVA 1HJ9A 2TPIZ 2OUAA 1VITH 2H5CA 3OY5U 3M3VA 3TJNA 3SI3H 1VGCB 2BDAA 1TYNA 3NUMA 1EAUA 2AEIH 4CHAC 3ATIA 1AMHA 5JB9S 1G36A 4FUJA 5FPSA 3BEUA 2YOLA 5DP8A 3RXJA 1C2EA 3I29A 2FI5E 1MH0A 1DX5M 2PSXA 3UUZA 4HFPB 3UWIA 1UCYK 4FUIA 1EPTB 1LO6A 1HAZB 4GAWA 2ZU5A 1TA6A 1NTPA 3RXSA 1W0YH 5EXMA 1DXWA 1IHTH 3SNAA 1C4V2 1YPLH 2BY7X 1A0JA 2VIWA 3LJJA 3A7TA 1P3EA 2Y7ZA 4FUFA 5GJ4B 1V2WT 1ABJH 1S0QA 3EAJA 1Z8RA 4KTSA 1JMOH 3U8OH 1PQAA 2H9HA 5FXLA 1OWJA 1J14A 1C2GA 1E38B 5C1XA 4D7FA 1FNIA 4ISLA 2Z7FE 4ZXYH 3FAOA 2ASUB 2VU8E 3M7UA 1T4VH 5J4SA 3RDZA 2Y5HA 3UFAA 1GHVH 5FBEA 1ELAA 1DWDH 1O34A 1P12E 2ZG0H 3PLBA 4AG2A 3ZYEA 2ZCLP 1OWDA 2ODQA 2VINA 1UO6A 1BRCE 5L2YH 1SL3A 1FUJA 1BRUP 1UCYE 1CBWB 1QA0A 1B0EA 3U8TH 2G81E 2OTVA 1C5TA 4BAKB 1HJAC 2ALPA 2G5VA 1TMUH 4O3TA 1ARBA 2BY6X 2AH4X 1KDQA 1NU9A 1BTUA 1DANH 1GL0E 1WBGB 2SNVA 4BAOB 1UTJA 4FVBA 4INLA 2QY0B 1TALA 5E0JA 1SGPE 1INCA 2G4TA 2BOHB 1BJUA 2ULLA 2ZU4A 3S69A 4FUCA 1VZQH 1W13U 2FIRH 2HALA 1UTNA 2FWWA 4CR9A 1TPAE 1VGCC 1DLEA 1PPBH 2JH6D 1NN6A 3KCGH 5A0CA 2F3CE 5ESBA 1FXYA 5GDSH 1J17T 1QHRB 2H2ZA 4WXIA 1QRWA 3D49H
chains in the Genus database with same CATH superfamily
2SGFE 5EJ1A 3DD2H 1FIWA 3V7TA 3BSQA 5T3HA 2JETC 5K0HA 1J8AA 6GCHG 5KEDA 4TPYA 4VGCB 4HGCA 3K9XB 2FESH 2H1UA 2PGBB 2ZGXH 1C5XB 4TYDA 3RC4A 3SGBE 5FX5A 1HYLA 3P70B 3E91A 4ACAA 2VWMA 3SV7A 5HGGA 3VB5A 1IHSH 3ZZDA 3TGKE 1MKWH 1P57B 3BTHE 5DP4A 1O2XA 5C0UA 1A7SA 1HBTH 1ESTA 4X8SH 3BV9B 4BAHB 1CA8B 5C17A 1ZRKA 2IJOB 1O2RA 1IQEA 4AFSA 4RN6A 1GGDB 3TK5A 2SGPE 5AFYH 1BZXE 3RXOA 1P2JA 3A88A 3CP7A 2BQWB 2H6MA 3KL6A 3QZQA 1KTTB 2BD5A 1O5BB 4X2VA 4MTBA 3T29A 2WUCA 1YYY1 4M7GA 2GCHG 1KMHB 4AGJA 2BD7A 3FKSD 1OOKB 1W8BH 4KTCA 1P2IA 1LVOA 2ZHDA 1P10A 1PPEE 3EYDA 2AIQA 2FOHA 4MNYA 3KIDU 4OS1A 1E0FD 2J4IA 1ZMLA 3SBKA 1WTHD 2ZFQH 2XRCA 1AN1E 3K6YA 1NBME 1F7ZA 2AMQA 3OEHD 5CMXH 1C5SA 4Q80A 2ZTZA 3PMBB 4U2WA 2P3FH 5CHBA 1H8HD 1NS3A 1OWIA 3PTBA 1YPMH 4ABEA 4INKA 1LMWB 1O3PB 1RFNA 1AUJA 2ANMH 3DHKH 1PPCE 3BTFE 4JCNA 1GMCF 2ZGHA 1GJ8B 1TWXB 3ZVBA 4XRNA 1SQAA 2ZU3A 3SNDA 4AFUA 1K9OE 1O3KA 4AORA 2BDCA 3OTJE 3SOSA 3LC3A 1ZTJA 2TGAA 5F53A 3E1XB 1JOUB 2ZECA 2V6NA 1BUIA 3LH3A 4TSFD 9LPRA 3SYJA 2VH0A 5FBIA 3BTGE 2STBE 1IOEA 2A5KA 3EA8A 1SLWB 5DKMA 1MAYA 3Q77A 1FY1A 1BTXA 1CHOF 1BMLA 2PHBA 2HPPH 4FUGA 4MDSA 1SGRE 4GVUA 1VITF 4TWWA 4CRBA 1T8MA 3O8RA 1UVOA 1O3HA 1SQTA 3SQHE 3N99A 1WOFA 2ZZUH 4CRCA 3M61U 2G52A 2EEKA 2ZFSA 2A7CA 4NFEA 1FIZA 3QO6A 2RFKC 1RD3B 1OWEA 1MBQA 3RXVA 1XVOA 1GMDG 2WV5A 5EQSA 4A5TS 4WMDA 1KXBA 3A7YA 3M5LA 3ZVCA 4UFDH 3QK1A 4IGDA 3H7OA 1AO5A 3A85A 1KDQB 1GHBF 4DURA 2WYGA 1G3EA 1GBCA 5T6FA 2VWLA 3UWJH 3ZVGA 4UDWH 4THNH 3GYLB 1HXFH 1VJAU 1TNLA 4I8GA 2F43B 2A5AA 4ZAEA 1P04A 1EAXA 1MBMA 3T25A 1F5RA 2BM2A 1UVTH 4X6PA 4XFQA 3W94A 1C1SA 2WPKS 1YKTA 3MNBA 1V2QT 5GNDA 1EATA 5FL7D 5EW2H 1TNGA 4LXBH 2FM2A 2ODPA 1BJVA 1NFXA 2ALVA 1WDIA 1DY9A 1CE5A 1MTSA 1QJ1B 3IG6B 1EOLA 1TAWA 3HK6B 1G3BA 5LGOA 3BG8A 2GCHF 3F9FA 4MPUA 1O30A 2AYWA 4Y6DA 1C9TA 4P02A 2KZ4A 1KXCA 3RXUA 3ZZAA 3MU4A 3BN9A 1TX6A 1QZ8A 2GGVB 1Y5UT 2HOBA 1YWUA 5EU8A 1EP6A 1TX7A 1MTUA 2CHAC 2I6SA 8LPRA 1QNJA 1AHTH 1GBMA 3V13A 3FP6E 2P3UB 2W7UA 3T5FH 3ZVDA 3MFJA 3LKWA 1G3CA 1S5SA 1T32A 4RT1A 4NZQA 1Y5AT 2PKAB 1YBWA 4MLFB 1GDQA 1O2SA 3KQDA 1P05A 3H7TA 3S9AA 3SW2B 3B23B 4Y7BA 1P01A 1KLJH 3LGWA 5DP7A 1XUGA 2F9BH 1AU8A 2FX4A 3TITA 3FANA 2P8OC 1ANCA 2VWOA 3TIUA 4YOGA 3FP8E 2WINI 3PMAB 3E0PB 2SGAA 1MTWA 3Q3XA 1IQMA 1C1NA 2KCAA 4AN7A 1HFDA 4I8JA 1O2KA 4IC5A 5C2ZA 1OP2A 4IS5A 4GPGA 3QUMP 2M5TA 3BTTE 3L6PA 1B5GH 4ISHH 5B6OA 3A86A 3DFJA 2KM0A 2WYJA 4CRGA 2UWLA 2VIVA 2WPHS 2Z9JA 5A0BA 1O35A 4GHTA 5JBAS 2XBYA 2Y80A 3EQ0H 4E7NA 3BEFB 1ZGIA 4R0IA 2Y5GA 4ISNA 4UD9H 4UFEH 2ZGCA 1AWFH 1LHDH 1H9IE 2EQNA 2Y7XA 2FS9A 2BOKA 2O9QA 1UK2A 1SFQB 3SHAH 1C5WB 4JK5A 1Y3VA 2PKSC 3TJUA 1XUFA 4U32A 2TRMA 1PFXC 1WU1A 5CHAB 5E2OA 3F9GA 2WZQA 1O2ZA 1TGTA 3RU4D 3S7KB 1A3BH 1RTKA 3KYGA 4IN2A 1IQLA 1C2FA 1YCPK 2HGTH 2BLQA 2BLWA 1EAWA 1K28D 1SQRA 4ABGA 1FZZA 1GCDA 3TH3H 1KY9A 2J97A 3F3BA 1NRNH 1F0TA 2C8WB 1C2KA 2OC7A 4NG9H 1WQVH 7LPRA 1LHCH 3GY5A 1L1GA 3ATWA 4TY6A 2UUYA 1TMTH 1GBJA 1BTHH 3N7OA 3VXEH 5DGJA 1P9UA 4X6NA 1AKSB 3SU6A 2R3UA 3M3TA 3CENA 3P95A 5GPIB 4GSOA 1UTKA 1MTVA 2PGQB 3WW7A 3LJOA 1UJ1A 1C5YB 3V0XA 4HTCH 1YY3A 3F2GA 1GMCG 4MNWA 4BNRA 3ZZ4A 2DE9A 1SGNE 1EJMA 4DT7B 1YPJH 5EJLA 4B1TA 8GCHF 2IJD1 2Z9KA 4NGAH 2FO9A 2VIQA 1UK4A 2OCVB 3ODDA 3T2NA 1TMBH 2XW9A 4Q4LA 3F2FA 1QL7A 2BD4A 2I6QA 3FP7E 1GI9B 3TVJB 3W1EA 2W26A 2A2QH 2ZQ2A 1C5ZB 1SSXA 1TRYA 2HVXA 1MKWK 2WHXA 4XD7D 2V0BA 3UQOA 1DITH 4MG3A 2YMSD 4E05H 1F0RA 3A81A 3AAUA 3FOAA 2BQ6B 4GCHG 1GGDC 1TQ0B 2F9UA 3BTDE 2OQUA 3TGIE 3MWIU 1RIWB 3R0FA 3BEIB 2BQ7B 2BB4A 1NZQH 1FY5A 2KFWA 1Z71A 4OS7A 1UK3A 1EPTA 2LP6A 1K1OA 1GPZA 1RJXB 3F6UH 4RT0A 1BBRH 1GG6C 1NROH 1THPB 2V35A 1QL8A 3H09A 2BD2A 1RRKA 4X0WU 4ASUD 1OYQA 2HNTF 2CGAA 4FVDA 4Y71A 1DE7H 4OGXA 1SB1H 2BD8A 2QXGA 5EG4A 1FY4A 1KSNA 4YT6H 1RTLA 4WH8A 5DN6D 3FN8A 2BD3A 1S83A 1W7XH 4IN1A 3MQKC 1PYTC 2GVFA 3TH2H 1IQIA 3RMNH 4FU8A 3ATMA 1HAHH 3DCLA 3HKIB 4NIYA 4KGAA 4SGAE 4X6MA 1N1LA 1P2KA 2BD9A 5F03A 5AVDA 3LU9B 3GCHC 4OGYA 2B8OH 1ZR0A 4X6OA 1C5LH 1V6DA 2VJ1A 3EGKH 1COWD 3I78A 1W11U 1ZSLA 1TIOA 2CHAB 1ELTA 1MAXA 1GI7B 3P6ZB 2NU1E 3PLPA 2QE7D 1SGQE 3HKJB 3TPIZ 1BB0B 2ZWLH 5IDKA 1QCPA 3HK3B 2NU3E 3Q00A 2GT7A 1O3FA 1VKYA 5FPYA 3O8BA 4K3JA 1GBAA 3L3TA 4WMFA 1WYKA 2GT8A 2FTMA 1QJ7B 2FTLE 1BBRK 3IWMA 3LGYA 4I86A 3C27B 4UFFH 2VWNA 4BXWA 2QXIA 5DP5A 2QC2A 2XNDD 3KN2A 2SFAA 3KNXA 3MO3A 4E06H 1L4ZA 1MQ6A 2FS8A 2ZU1A 5SGAE 1NPMA 1C1WH 5AHGH 1SOTA 3Q3YA 4O97A 1VR1H 2GP9B 3PYHA 7GCHG 3UAIC 1EZQA 1SQOA 2GV7A 1CQQA 1GBFA 1C5OH 1DPOA 1SGFG 4HI3A 4DIHH 1SFIA 1A61H 3M5NA 3PV4A 2GV6A 1AIXH 2EI7A 2W3KA 4LK4A 3O8DA 1GI1A 1C5UA 1BTZA 1YLDA 1A2CH 1HAXB 3RXQA 3UR6A 1XKBC 1Y3WA 3LT3A 2OBQA 4P00A 3MH4A 1EJNA 4X2WA 3RC5A 2TIOA 1AKSA 2BY9X 1ANDA 1GHWH 2R0KA 1AE8H 3URDA 3RXDA 1CVWH 1GJ7B 1MUEB 2QAAA 3OSYA 3UQVA 2EC9H 1O3BA 3VEQB 1F5KU 4F55A 3ZVAA 1Y8TA 1TOMH 3ENSB 1DDJA 4AFZA 4FUHA 1A3EH 3QTOH 2EI8A 3LOXA 2DUCA 2D8WA 2F4LA 5A0AE 3RU4E 2XCNA 3TK9A 1LQDB 1IQNA 1THSH 1RGQA 3A84A 4X1QU 4D7GA 3LDXH 1C2JA 2O8MA 1FDPA 1ZHRA 1F0UA 2P59A 1H8DH 1AI8H 1WQSA 3SUFA 2ZHFH 3QGNB 1H9LB 1XXDA 2CXVA 1Y59T 1LVMA 2GZ7A 1AFQB 4NA8A 3E8LA 5T6GA 3V3MA 2QCYA 4DT4A 1AFQC 2J92A 3EE0B 1QIXB 6ESTA 2Z6BD 4ZMAH 2UUJB 3A7WA 1O5EH 2ZKSA 3LGIA 5EQRA 1QB6A 4ABHA 1SGDE 3BTKE 1O2MA 4CREA 2XXLA 1O2WA 1GJDB 5CE1A 4X8VH 1LTOA 1WSSH 3SUDA 1MTNB 4OS5A 1BMNH 3UNSA 1PPZA 4WMEA 1Q2WA 2BLVA 2CN0H 2ZP0H 3GCTG 1P2MA 4X1RU 1SGIB 1SBWA 2D2DA 4JYUH 3ZVFA 3KHVA 4BOHA 3AVZA 3AASA 3EA7A 3HPTB 1SGTA 5G4BA 4TT3D 1JIMA 3T27A 1GI5A 1QY6A 1C4U2 3QLPH 4XSKU 5FAHA 1E35B 2PWXA 2C8XB 3SZNA 5I46H 4WWYA 2JH5D 2ZFPH 2AERH 4MPXA 2A4QA 1XKAC 1CHOG 2XYAA 3VB4A 1DT2A 1HPGA 1W0ZU 3GISB 4D9RA 1KXFA 2WUBA 1E34B 4SGBE 5GWZA 2ZFTA 2GCTB 4F49A 3ZVEA 1O39A 3OX7U 2PSYA 1PPGE 1V2MT 1L0ZA 5E0GA 2OC1A 3ZZ7A 1SC8U 1Z6EA 1W0JD 3M5OA 1O3MA 4NIXA 3A89A 1HAVB 3TNTA 4K1SA 1GWAA 5TCCA 4A7IB 3G01A 1ACBE 2D1JA 4I32A 2OC8A 3MU0A 1OKXA 3QN7A 5LPFA 5EQQA 3LPRA 2QA9E 2UWPA 3SGQE 2BX3A 3PMJA 1BTYA 1P03A 4ASHA 1SLUB 6LPRA 1TFXA 1GJ4H 4HG6A 2OD3B 4K1TA 1DWEH 2OINA 2ZFFH 3ZZ8A 1ETTH 1N8OC 1O2OA 1W12U 1K1MA 3P8OA 3U1JB 3F0PA 5EW1H 4K69A 1ZTKA 1LCYA 1P2QA 1P09A 1AVXA 1HAYB 1LPKB 2FXRA 3ZV8A 1F2SE 1O3JA 4JMYA 2EI6A 3OEED 1BA8B 1ZLRA 3M5MA 4AX9H 3TU7H 5DSFA 1GHAF 2PUQH 1O37A 1OYTH 2VNTA 3A80A 2J5UA 4Z0KA 1TGBA 2J95A 1O0DH 3UOUA 3ATLA 4H6SB 3SU1A 4Y8YA 3D23A 5DPAA 2R0LA 1P0SH 1K0HA 4OM9A 3PRBA 4Y0ZE 1N6YA 1YCPM 4J2YB 4CRFA 2PFEA 4B6FA 1ZJDA 2EY4C 3MYWA 1A5GH 5IK2D 2O8TA 2WPJS 5C67A 1THRH 1EAIA 3M7QA 2GJGA 1AVWA 2BVSH 4FXGH 4Q2KA 5E0HA 1AWHB 5TJXA 3S7HB 2CF9H 2BDGA 1MZAA 1YC0A 3N7EA 2TGTA 1J15A 3NK8A 1W10U 4DGJA 4BANB 2ZF0H 3CS7A 3TJVA 3BTME 3SN8A 1GI6A 7GCHF 3P92A 1H8ED 4ZXXH 2ZHEH 1G30B 4CRDA 2QF0A 1TRMA 2Z3DA 1D3PB 4X2XA 4Q7XA 2GKVE 3SV2H 1GI8B 3BTEE 2HNTC 1LPZB 5LPEA 1L4DA 2FYQA 2Q1JA 1HIAB 2BZ6H 3KQ5A 1YPHC 4ISIH 3ZIAD 2KR7A 5KGOA 3ELAH 5TCAA 1AZ8A 1HAVA 2JJ1D 2A7HA 1VCQA 1GJ9B 2AMDA 1SLVB 2B5TB 1BMFD 1BCUH 3UNQA 1O2UA 2Y5FA 3BG4C 2XWAA 1HDTH 2C3SA 1LHEH 1HV7A 1LHGH 4Q7YA 3TJOA 5L6NH 2JIZD 5FCKA 1MABB 1V2NT 1C5QA 1BRAA 4UONA 4KP0A 3SJIA 4NSVA 4YLUA 1YPHE 1ZOMA 1H1BA 3GY2A 1C5NH 1O3EA 3Q76A 1EOJA 1C1TA 1YLNA 3D62A 1FPHH 3F9EA 1YGCH 3GYMA 1ZGVA 2YMSC 1QFKH 1ELGA 1OSSA 3GCNA 1YP9A 4B76A 4B71A 1JWTA 1LKBA 1V2UT 3EDXB 1NFUA 1TNJA 4XOJA 5HM2A 3GS9A 1QTFA 1TGNA 2A7JA 4INHA 1TONA 4B73A 2C4FH 2XBWA 3SU3A 1Y5BT 4ISOA 1DFPA 1UHBA 2PKAA 2ODYB 2Z9GA 5JB8S 2VGCB 8KME2 1CT4E 2FOBA 4X1PU 1BBRE 4IBLH 1GMHG 2KX4A 5A8XA 5FPTA 3KQEA 1C1MA 2Y6TA 1HGTH 2W6ID 1K1LA 4NCYA 1MCTA 1RIWC 3MNSA 5A8YA 2ZI2H 3KF2A 1ZYOA 3MU5A 5A2MH 5LPRA 2PP6A 3PM3A 2FI3E 1E1RD 1T31A 1L1NA 1XXFA 1EUFA 2KAIA 5HYOA 5L2ZH 2AGGX 4BAMB 1TPPA 1GHAG 2Z3EA 2W5EA 1OS8A 1K1JA 5EODA 1SGEE 1TQ7B 2W3IA 1C1PA 3A8DA 3HGNA 1BOQA 2HLDD 3OY6U 4X2YA 1HJ8A 1O32A 3RLYH 2TGDA 2ZC9H 4OS4A 4JZEH 1TBQH 1XUIA 1GVLA 4Q63A 1TA2A 3P17H 1GBIA 2NU0E 2ZEBA 1ARCA 1ID5H 1C2LA 1C9PA 4O3UA 4RKOB 2ZDMA 1ESAA 3MMGA 5J4QA 2LNCA 1GCTB 4K5ZA 1DWCH 5E8EH 1LDTT 3NKKA 3RXTA 4H4FA 3QZRA 4J1YA 1ZHPA 2FPZA 3RMLH 1ZSJA 1HAOH 4XDEA 3MHWU 3HGPA 4B75A 1P9SA 3VB3A 4ABFA 4GLYA 2J34A 2NU2E 4ZH8A 2KAIB 5ABWA 2WPMS 2W6JD 1H9HE 3URCA 2Q6FA 3SHCH 2GX4A 2GMTB 3VGCB 1OX1A 1FI8A 2BDBA 1C1RA 2FEQH 3P8GA 3ZV9A 5GCHF 1IQGA 2R9PA 3PB1E 1NY22 3E0NB 3RLWH 1EZSC 2P94A 4BTIB 3UIRA 1MU8B 1XX9A 2A32A 2IOTA 3ATKA 3SU2A 2P3TB 3PRDA 2HWLB 3RXGA 1NRSH 1RTFB 1QBOA 2IPQX 5IYTA 4VGCC 4K8YA 4YLQH 1FONA 2BXUH 1NC6A 1BDAA 1T8NA 3GDSA 1E79D 2XNIA 5EOKA 4WY3A 2BDYA 2A45B 4JK6A 2C90B 1D3TB 2WV9A 5GIBA 3NWUA 1P3CA 2GDEH 3DA9B 5HIYA 1EXFA 2FDAA 5PTPA 4B6EA 4GUXA 2ZIQH 1TE0A 4F4OC 1V2LT 2J2UA 3U98H 2SGQE 1ZMNA 1UTPA 2OLGA 3F0OA 1J16A 3LONA 3SJOA 5A8ZA 4D76A 2BYAX 3OFND 3A8AA 4YOJA 1AD8H 3RXAA 1K21H 1GHYH 2ESTE 4ZKOU 2PTCE 2Y82A 3EE7A 4CRAA 4DG4A 3KEEA 1K2I1 1SLXB 1XUJA 2ZHWH 5JPMH 1EP5A 2J94A 2H9TH 1HB0B 2M2AA 1FX0B 3A87A 2QF3A 4X8TH 4CBOA 4NWKA 2PUXB 1O2YA 3AW1A 1UVUH 3S9BA 3GY3A 4TWYA 2J98A 2P16A 1QQ4A 1ZPZA 1SPJA 3NPSA 4H6TA 4MVNA 1V2ST 3UPEA 2ZPSA 1T8OA 3A82A 1A5IA 3A7ZA 1DSTA 4A1XA 1O2GH 1GBEA 1QQUA 3WY8A 4MNVA 1GI0A 1C5PA 5JBBS 3M35A 2AS9A 1TNHA 2RG3A 2UUKB 1IQHA 2GMTC 5C0TA 4IMZA 2H5DA 4K60A 4Y79A 2L74A 3VB6A 1ELFA 4YO9A 1V3XA 5C1YA 3ZZBA 2GZ8A 3EA9A 4M9FA 3L33A 2J98B 2FI4E 1YPKH 1HIAA 2P93A 1O3IA 2RA0A 1ELVA 3DFLA 1W14U 1TBZH 1NBMD 3GOVB 5CDFE 4I33A 1LQEA 2WV4A 2BTCE 1VJ9U 4IW4E 1AB9B 4WJG2 3KGPA 2ZGBH 3UOPA 2PLXA 1SGCA 4O03A 3TLOA 2A31A 3GICB 2JETB 1GBBA 4Z1MD 1MMJN 3MI4A 1F92A 2F91A 5AFZH 5F6MA 1IQFA 3K2UA 2VIDA 3FVFB 2NWNA 2QF5A 4PROA 1ESBA 1F5LA 5HXFA 3GY6A 2THFB 1WAYB 1ZPCA 1ZZZA 4NIWA 5DP9A 1FV9A 5DG6A 1Z8IB 3GCOA 5C20A 2KCPA 3RM2H 4ABDA 1ETSH 1O2QA 1TX8A 1D9IA 1O5GH 4UFGH 1GI3A 2ZDVH 1G9IE 1DS2E 1V2KT 2RA3A 3ZYDA 1B7XB 1YM0A 3ZZ9A 1GJCB 3SU0A 2R3YA 1V2JT 3Q3KA 2BY8X 5FCRA 1HAGE 4ABJA 1HAIH 4UEHH 2OK5A 4LOYH 2FOAA 2XWBI 3OU0A 3NRLA 2HRVA 4JZ1A 1ANBA 3M37A 3M36A 2V3MA 3H5CB 3QTVH 3RXCA 1VITG 1GJAB 1UCYH 2C93B 1MU6B 3B8JA 5B6LA 2QYIA 2QXJA 4U01A 4Q7ZA 1O2JA 1GBTA 1D4PB 4AOQA 1NRPH 1UW7A 4XE4A 3MO6A 3NXPA 3BG4B 3CS0A 1EJAA 4DOQA 4XBDA 3MOCA 1GMDF 1WCZA 4DY7B 1O33A 4BAQB 3PO1B 2R2MB 3JZ1B 2V3OH 3MNCA 1TB6H 3BF6H 1PQ7A 1O3NA 1SR5C 1V2TT 1SHYA 1HXEH 2NU4E 2ZHQH 1UVSH 2KCYA 1MD7A 1MTNC 1T4UH 2XOKD 5A09A 1RS0A 1UTLM 1CT0E 3RXBA 3ZZ3A 1BHXF 4YOIA 3PV5A 4ABBA 1MQ5A 1V2PT 4FETA 3U9AH 3VGCC 2O8LA 4FUDA 1PQ8A 5C1UA 1MKXH 3SI4H 4TPIZ 1O5AB 1Q31A 2XC5A 4ZHLU 2ZDLA 1P2OA 1K1IA 1UTOA 1ZRBA 1UHBB 1NM6A 4X1NU 2LPRA 2Z3CA 1C5VA 1QJ6B 3PV2A 3LH1A 2P8OB 2QN5T 1S6FA 3S9CA 4ACBA 2CMYA 5T6DA 1MD8A 1GI2A 1AFEH 1A0LA 3SJKA 3RXFA 1BITA 3GY4A 3F9HA 1DM4B 1K1PA 1EFRD 3O8CA 1L2EA 1VCPA 2OP9A 1C1VH 1DUAA 2A5IA 1SMFE 1AVGH 5EJZA 3R3GB 4Y76A 2G00A 2ZDAH 1QB1A 4ZKSU 1WV7H 4CH2B 4AYVB 1HUTH 1ZHMA 2XCFA 1U6QA 4K1EA 4NA7A 4QT8C 2QGRA 3RUOA 1YPEH 1O3GA 2BHGA 4DCDA 2XC4A 1ZPBA 4NFFA 3RXKA 2GCTC 1IAUA 1PQ5A 3ESTA 1Y3XA 4GHQA 4OS6A 5F8XA 5ESTE 4AYYB 2ANKH 1O3DA 2A4OA 4K8BA 2C8ZB 3P8NA 5GCHG 2H9EH 3E16B 5FHTA 3W95A 5C5OA 4TY7A 2TBSA 2G51A 2VH6A 3RXPA 2GDDA 1Z1JA 2HLCA 1BHXB 3QGJA 3I77A 1PJPA 1G2LA 4YT7H 1HAPH 1UTQA 4NWLA 4B74A 1CT2E 2AMPA 2ZNKH 1HJAB 7KMEH 2VVVA 2BZAA 1GDNA 5C94A 1FN6A 3ZZ5A 1YPGH 4JZIA 5T1VA 2FZZA 4UE7H 1N8OB 3AAVA 4Y11E 1JIRA 1RXPA 3MH6A 1XUHA 2TGPZ 3GY8A 5C5NA 2AGEX 1GHBG 4B2BA 1BMAA 1NRRH 4H42U 2C8YB 1DSUA 1NRQH 4AB9A 4MNXA 5EPYA 1A0HB 3VG8A 4A1VA 4CHAB 1CGIE 2A4GA 1S84A 4ZCNA 4ABIA 1NO9H 1CU1A 1G3DA 5JBCS 1F0SA 1TPSA 4R8TB 1C2MA 2JKHA 2KCOA 1FN8A 4DW2U 3PROA 5EIYA 1O5FH 4I7YH 1JRTA 3BIVH 5K7RA 3E90B 2ZGJA 3RC6A 1ELBA 3SGAE 1A5HA 2YMSB 1MKXK 1TPOA 2J9NA 3A8BA 3GY7A 2Y81A 4HZHA 3JZ2B 1Z6JH 2AIPA 3T62A 1XM1A 7ESTE 1DVAH 4ZROA 4YXWD 1BTWA 1XUKA 2A1DB 1C2IA 3DUXH 5HMAA 1L1JA 4JZDH 2RDLA 4FUBA 2VGCC 3PTNA 1O36A 2ANWA 1WXRA 5ETXA 1UVPA 2YNBA 1GVKB 1JRSA 1JBUH 1Z8JB 4O9VA 1LVBA 2XBXA 3M7TA 2HPQH 3VPKA 3WWFA 4RSPA 2FOGA 3QDZB 1QL9A 1KLTA 2V3HH 3VB7A 4D9QA 1CGHA 2BY5X 1GI4A 1MCVA 1QBNA 1FLEE 2W7SA 3UNRA 3NZIA 2ZCHP 2F83A 1O31A 1C1OA 1DOJA 4CR5A 2K1QA 3U8RH 1CA0C 1C5RA 1QB9A 1Y3YA 3SUEA 3LGUA 2O8UA 2ZDKA 3ZZCA 2O8WA 1SGYE 1QURH 1GBDA 4Y10E 2SNWA 3E3TA 3FZDA 2VIPA 1LKAA 2D26C 4Y8XA 3SV6A 1T8LA 4OS2A 1EB2A 3QWCH 1GBKA 3A8CA 2ILNA 3RXEA 2CF8H 2BDHA 3ITIA 1P02A 4FUEA 1SOZA 4I31A 5F8ZA 1B0FA 4F48B 1O2PA 1DY8A 3BIUH 4XBCA 1ETRH 1DLKB 1S81A 2STAE 1KXEA 4YZUA 4I8LA 1ELEE 1BIOA 2WPLS 4WH6A 3PO1C 2BDIA 4XBBA 1Y3UA 4NA9H 5LH8A 3MO9A 3GDVA 4WF8A 3A7XA 2PTNA 4AGKA 1BMMH 3SNCA 2Z94A 1IQJA 2VB0A 1AB9C 1AY6H 1D6WA 1G37A 4ZUHA 3B9FH 1T7CA 3WWBA 3D65E 4DIIH 3DSOA 1DXPA 1GBHA 2VBCA 1AUTC 1LVYA 4ESTE 1K1NA 4ZKRU 2A2XH 4JYVH 3ODFA 5EGMA 2F9PA 1JXPA 2G5NA 1NFYA 1FJSA 3RXIA 3MTYA 1FMGA 4MPVA 1EZXC 3RXHA 6CHAC 3TGJE 1CO7E 1QGFA 2FOMB 3OTPA 6CHAB 2GTBA 2PR3A 4A92A 2UWOA 3SUGA 2PKSB 5BPEA 2Z9IA 2ANYA 5EXLA 1KIGH 2QF4A 4AZ2B 1PPFE 4Y8ZA 3DSGA 3U1IB 3F68H 4MQAA 4NZLA 1OWKA 1W3CA 3NCLA 1UMAH 1QRZA 1TNKA 2OXSA 4AC9A 1BRBE 1FAXA 2A4RA 1SKYE 3F2HA 4JYTA 3RXRA 1BTPA 5DP3A 2G55A 1S6LA 3VFEA 4K2YA 1KXDA 5DP6A 2VVCA 3A83A 3KQBA 4AFQA 3STIA 1HLTH 4BTUB 3K65B 1D3DB 2VVUA 3RM0H 3UY9A 1CBWC 1K22H 2JDID 1C2HA 1DUEA 3A7VA 3SV8A 3T26A 1LHFH 4YM9A 5DK1A 2BXTH 2Q6DA 1H8IH 3LIWA 1A4WH 1TOCB 1YF4A 4BTTB 8ESTE 1EB1H 1S85A 4LZ4B 1O38A 5HIZA 4IC6A 2VIOA 3SZEA 2ZDNA 3LGTA 2ZU2A 2XTTB 1O3AA 1AZZA 2BLOA 3MU8A 3RU4T 2FMJA 1KYNA 1TGCA 3PWCA 1Z7KA 1TNIA 1P2NA 4A6LA 4DJZB 3RXLA 1O3LA 1S82A 1GJBB 4CBNA 4X1SU 4MPWA 4AB8A 5F8TA 4IMQA 1GDUA 3S0NA 1QA7A 3UR9A 2JH0D 3SNEA 4B2AA 1NU7B 1ORFA 3E6PH 3SU4A 1WUNH 2P95A 1SI5H 2FLRH 4YESB 1Q3XA 2QV1A 3TNSA 2RCEA 2AFQB 4GCHF 1NT1A 1V2OT 1XMNB 1W7GH 1HRTH 1Z8GA 1KTSB 5JDUB 2FX6A 1P8VC 2QIQA 3MU1A 3PLKA 1FQ3A 3QX5H 1ZMJA 2GZ9A 2AHME 1HCGA 2CJIA 2FODA 5JBTA 1A46H 3M3SA 1QRXA 2R2WU 5I25A 1TLDA 3OAAD 1NFWA 1QR3E 2FYRA 3BTQE 4JZFH 3RP2A 3BTWE 3RXMA 2B7DH 2OQ5A 2A0QB 1AQ7A 4NSYA 1X7AC 1E1QD 1ELCA 1C1UH 4DVAU 1GVZA 2Q6GA 1EKBB 4Y7AA 1ABIH 1YLCA 1OHHD 1QBVH 4WVPE 2YNAA 2FP7B 1ZJKA 2SGDE 2IPHA 1OP8A 1O3CA 2ZO3H 2GD4B 1O3OA 3SJ9A 3KQCA 5HKKD 2DE8A 5DO4H 1BQYA 1CA0B 1GHXH 2F9OA 1XVMA 3U69H 1E37B 1SVPA 5AF9H 3HATH 3STJA 1EASA 1O2NA 3SNBA 4E7RG 1ANEA 3UTUH 2ZTYA 1KXAA 2BVRH 1TGSZ 2OC0A 1FAKH 1W2KH 3TH4H 4KKDA 1O5DH 1D6RA 1GL1A 1C2DA 1V2RT 1WTGH 3VXFH 1GCTC 1PPHE 3LGVA 3P8FA 2K8IA 4ZHMU 1ZTLA 2FOEA 2OBOA 5H4IB 1TRNA 1GJ5H 4B2CA 2PW8H 1FPCH 1DWBH 1N6XA 1C4Y2 1W0KD 1PYTD 3MH7A 1M9UA 1O5CB 1VCWA 1O2TA 4FU9A 1O2IA 5KECA 1DICA 1ELDE 3FO8D 2XC0A 3LC5A 2ZFRH 1CGJE 1HNEE 4YTAA 1LPGB 1KLIH 2B9LA 4KTUA 8GCHG 1CHGA 2FOCA 1GBLA 2F9NA 1GJ6A 2ZA5A 5E2PA 5C3NA 1G2MA 2Z9LA 4RKJB 4ABAA 1EPTC 1GHZA 3SJ8A 4D8NA 1S6HA 1TABE 2BMGB 2G8TA 2ZPQA 1OPHB 3IITA 1D3QB 1SG8B 1V2VT 4ZHAA 5BRRE 3UREA 4I8KA 2FOFA 1GMHF 1NESE 6GCHF 3MNXA 5EXNA 2FLBH 4A1TA 1CSOE 1Z1IA 3GCTF 3K6ZA 3MH5A 3OYPA 4LZ1H 1SHHB 3V12A 2WSSD 3SO3A 1O2VA 2SGEE 3DT0H 1EZUC 2PV9B 1YCPH 4X8UH 3C1KA 1EQ9A 2CV3A 5GXPA 3PMHB 1AGJA 1O2HA 4FOUC 1P11E 1G32B 2F9VA 9ESTA 5HM9A 1FY8E 3ZZ6A 2ZTXA 5CHAC 1FY3A 1EX3A 4Z6AH 1OP0A 1OXGA 1TBRH 4FU7A 2XBVA 1GG6B 2J38A 1MZDA 2QXHA 1C1QA 4U30A 2ZPRA 3T28A 3SQEE 1A1RA 1E36B 3FZZA 5FX6A 3SV9A 2BVXH 2AGIX 4AG1A 5EPNA 3SU5A 2ZQ1A 2B0FA 3PWBA 1SGFA 2UUFB 1H4WA 1AE5A 2ZCKP 2EA3A 2G4UA 3TK6A 5DJ7A 4CH8B 3RMOH 2WPIS 3FFGA 1ZSKA 4Y0YE 4BXSA 1C5MD 3GCHB 4WXVA 5L30H 1IQKA 2IN2A 4ZKNU 1O2LA 1P06A 1OWHA 3RMMH 1BT7A 1J9CH 1S0RA 1UTMA 4I8HA 3AW0A 3SORA 5JYIA 2BX4A 3GDUA 4KELA 2HNTE 3F1SB 4NIVA 1HJ9A 2TPIZ 2OUAA 3N7DA 1VITH 2H5CA 3OY5U 3M3VA 3TJNA 3SI3H 1VGCB 2BDAA 1TYNA 3NUMA 1EAUA 2CK3D 2AEIH 4CHAC 2HVYB 3ATIA 1AMHA 3U28C 5JB9S 1G36A 2JJ2D 4FUJA 5FPSA 3BEUA 2YOLA 5DP8A 3RXJA 1C2EA 3I29A 2FI5E 1MH0A 1DX5M 2PSXA 3UUZA 4HFPB 3UWIA 2WPDD 1UCYK 4FUIA 1EPTB 3UB0A 1LO6A 1HAZB 4GAWA 2ZU5A 1TA6A 1NTPA 3RXSA 1W0YH 5EXMA 1DXWA 1IHTH 3SNAA 1C4V2 1YPLH 2BY7X 1A0JA 2VIWA 3LJJA 3A7TA 1P3EA 2Y7ZA 4FUFA 5GJ4B 1V2WT 1ABJH 1S0QA 3EAJA 3AK5A 1Z8RA 4KTSA 1JMOH 3U8OH 1PQAA 2H9HA 5FXLA 1OWJA 1J14A 1C2GA 1E38B 3DSPA 5C1XA 4D7FA 1FNIA 4ISLA 2Z7FE 4ZXYH 3FAOA 2ASUB 2VU8E 3M7UA 3CNRA 1T4VH 5J4SA 3RDZA 2Y5HA 3UFAA 1GHVH 5FBEA 1ELAA 1DWDH 1O34A 2LELA 1P12E 3KYFA 2ZG0H 3PLBA 4AG2A 3ZYEA 2ZCLP 1OWDA 2ODQA 2VINA 1UO6A 1BRCE 5L2YH 1SL3A 1FUJA 1BRUP 1UCYE 2V7QD 1CBWB 1QA0A 1B0EA 3U8TH 2G81E 2L6OA 2OTVA 4RI0A 1C5TA 4BAKB 1HJAC 2ALPA 2G5VA 1TMUH 4O3TA 1ARBA 2BY6X 2AH4X 1KDQA 1NU9A 1BTUA 1DANH 1GL0E 1WBGB 2SNVA 4BAOB 1UTJA 4FVBA 4INLA 2QY0B 1TALA 5E0JA 1SGPE 1INCA 2G4TA 2BOHB 1BJUA 2ULLA 2ZU4A 3OE7D 3S69A 4FUCA 1VZQH 1W13U 2FIRH 2HALA 1UTNA 2FWWA 4CR9A 2K0QA 1TPAE 1VGCC 1DLEA 1PPBH 2JH6D 1NN6A 3KCGH 5A0CA 2F3CE 5ESBA 1FXYA 2RDEA 5GDSH 1J17T 1QHRB 2H2ZA 4WXIA 1QRWA 3D49H
chains in the Genus database with same CATH topology
2SGFE 3DD2H 1FIWA 3V7TA 3BSQA 5T3HA 2JETC 5K0HA 1J8AA 6GCHG 4TPYA 4VGCB 4HGCA 3K9XB 2FESH 2H1UA 2PGBB 2ZGXH 1C5XB 4TYDA 3RC4A 3SGBE 5FX5A 1HYLA 3P70B 3E91A 2VWMA 3SV7A 5HGGA 3VB5A 1IHSH 3ZZDA 3TGKE 1MKWH 1P57B 3BTHE 5DP4A 1O2XA 1A7SA 1HBTH 1ESTA 4X8SH 3BV9B 4BAHB 1CA8B 1ZRKA 2IJOB 1O2RA 1IQEA 4AFSA 4RN6A 1GGDB 3TK5A 2SGPE 5AFYH 1BZXE 3RXOA 1P2JA 3A88A 3CP7A 2BQWB 2H6MA 3KL6A 3QZQA 1KTTB 2BD5A 1O5BB 4X2VA 4MTBA 3T29A 2WUCA 1YYY1 4M7GA 2GCHG 4AGJA 2BD7A 1OOKB 1W8BH 4KTCA 1P2IA 1LVOA 2ZHDA 1P10A 1PPEE 3EYDA 2AIQA 2FOHA 4MNYA 3KIDU 4OS1A 1E0FD 2J4IA 1ZMLA 3SBKA 1WTHD 2ZFQH 2XRCA 1AN1E 3K6YA 1F7ZA 2AMQA 5CMXH 1C5SA 4Q80A 2ZTZA 3PMBB 4U2WA 2P3FH 1NS3A 1OWIA 3PTBA 1YPMH 4ABEA 4INKA 1LMWB 1O3PB 1RFNA 1AUJA 2ANMH 3DHKH 1PPCE 3BTFE 4JCNA 1GMCF 2ZGHA 1GJ8B 1TWXB 3ZVBA 1SQAA 2ZU3A 3SNDA 4AFUA 1K9OE 1O3KA 4AORA 2BDCA 3OTJE 3SOSA 3LC3A 1ZTJA 2TGAA 3E1XB 1JOUB 2ZECA 2V6NA 1BUIA 3LH3A 9LPRA 2VH0A 5FBIA 3BTGE 2STBE 1IOEA 2A5KA 3EA8A 1SLWB 5DKMA 1MAYA 3Q77A 1FY1A 1BTXA 1CHOF 1BMLA 2PHBA 2HPPH 4FUGA 4MDSA 1SGRE 4GVUA 1VITF 4TWWA 4CRBA 1T8MA 3O8RA 1UVOA 1O3HA 1SQTA 3SQHE 4CRCA 1WOFA 2ZZUH 3M61U 2G52A 2EEKA 2ZFSA 2A7CA 4NFEA 1FIZA 3QO6A 1RD3B 1OWEA 1MBQA 3RXVA 1XVOA 1GMDG 2WV5A 5EQSA 4A5TS 4WMDA 1KXBA 3A7YA 3M5LA 3ZVCA 4UFDH 3QK1A 4IGDA 3H7OA 1AO5A 3A85A 1KDQB 1GHBF 4DURA 2WYGA 1G3EA 1GBCA 5T6FA 2VWLA 3UWJH 3ZVGA 4UDWH 4THNH 3GYLB 1HXFH 1VJAU 1TNLA 4I8GA 2A5AA 4ZAEA 1P04A 1EAXA 1MBMA 3T25A 1F5RA 2BM2A 1UVTH 4X6PA 4XFQA 3W94A 1C1SA 2WPKS 1YKTA 3MNBA 1V2QT 1EATA 5EW2H 1TNGA 4LXBH 2FM2A 2ODPA 1BJVA 1NFXA 2ALVA 1DY9A 1CE5A 1MTSA 1QJ1B 3IG6B 1EOLA 1TAWA 3HK6B 1G3BA 5LGOA 3BG8A 2GCHF 3F9FA 4MPUA 1O30A 2AYWA 4Y6DA 1C9TA 1KXCA 3RXUA 3ZZAA 3MU4A 3BN9A 1TX6A 2GGVB 1Y5UT 2HOBA 5EU8A 1EP6A 1TX7A 1MTUA 2CHAC 2I6SA 8LPRA 1QNJA 1AHTH 1GBMA 3V13A 3FP6E 2P3UB 2W7UA 3T5FH 3ZVDA 3MFJA 3LKWA 1G3CA 1S5SA 1T32A 4NZQA 1Y5AT 2PKAB 1YBWA 4MLFB 1GDQA 1O2SA 3KQDA 1P05A 3H7TA 3S9AA 3SW2B 3B23B 4Y7BA 1P01A 1KLJH 3LGWA 5DP7A 1XUGA 2F9BH 1AU8A 2FX4A 3TITA 3FANA 2P8OC 1ANCA 2VWOA 3TIUA 4YOGA 3FP8E 2WINI 3PMAB 3E0PB 2SGAA 1MTWA 3Q3XA 1IQMA 1C1NA 4AN7A 1HFDA 4I8JA 1O2KA 4IC5A 5C2ZA 1OP2A 4IS5A 4GPGA 3QUMP 2M5TA 3BTTE 3L6PA 1B5GH 4ISHH 5B6OA 3A86A 3DFJA 2WYJA 4CRGA 2UWLA 2VIVA 2WPHS 2Z9JA 5A0BA 1O35A 4GHTA 5JBAS 2XBYA 2Y80A 3EQ0H 4E7NA 3BEFB 1ZGIA 4R0IA 2Y5GA 4ISNA 4UD9H 4UFEH 2ZGCA 1AWFH 1LHDH 1H9IE 2Y7XA 2FS9A 2BOKA 2O9QA 1UK2A 1SFQB 3SHAH 1C5WB 4JK5A 1Y3VA 2PKSC 3TJUA 1XUFA 4U32A 2TRMA 1PFXC 1WU1A 5CHAB 5E2OA 3F9GA 1O2ZA 1TGTA 3RU4D 3S7KB 1A3BH 1RTKA 4IN2A 1IQLA 1C2FA 1YCPK 2HGTH 2BLQA 2BLWA 1EAWA 1K28D 4ABGA 1FZZA 1GCDA 3TH3H 1KY9A 1NRNH 1F0TA 2C8WB 1C2KA 2OC7A 4NG9H 1WQVH 7LPRA 1LHCH 3GY5A 1L1GA 3ATWA 4TY6A 2UUYA 1TMTH 1GBJA 1BTHH 3N7OA 3VXEH 5DGJA 1P9UA 4X6NA 1AKSB 3SU6A 2R3UA 3M3TA 3CENA 3P95A 5GPIB 4GSOA 1UTKA 1MTVA 2PGQB 3LJOA 1UJ1A 1C5YB 3V0XA 4HTCH 1GMCG 4MNWA 4BNRA 3ZZ4A 2DE9A 1SGNE 1EJMA 4DT7B 1YPJH 4B1TA 8GCHF 2Z9KA 4NGAH 2FO9A 2VIQA 1UK4A 2OCVB 3ODDA 3T2NA 1TMBH 2XW9A 1QL7A 2BD4A 2I6QA 3FP7E 1GI9B 3TVJB 2W26A 2A2QH 2ZQ2A 1C5ZB 1SSXA 1TRYA 2HVXA 1MKWK 2V0BA 3UQOA 1DITH 4MG3A 4E05H 1F0RA 3A81A 3AAUA 4GCHG 2BQ6B 1GGDC 1TQ0B 2F9UA 3BTDE 2OQUA 3TGIE 3MWIU 1RIWB 3R0FA 3BEIB 2BQ7B 2BB4A 1NZQH 1FY5A 1Z71A 4OS7A 1UK3A 1EPTA 1K1OA 1GPZA 1RJXB 3F6UH 1BBRH 1GG6C 1NROH 1THPB 2V35A 1QL8A 2BD2A 1RRKA 4X0WU 1OYQA 2HNTF 2CGAA 4FVDA 4Y71A 1DE7H 4OGXA 1SB1H 2BD8A 2QXGA 5EG4A 1FY4A 1KSNA 4YT6H 1RTLA 4WH8A 2BD3A 1S83A 1W7XH 4IN1A 1PYTC 2GVFA 3TH2H 1IQIA 3RMNH 4FU8A 3ATMA 1HAHH 3HKIB 4NIYA 4KGAA 4SGAE 4X6MA 1N1LA 1P2KA 2BD9A 5F03A 5AVDA 3LU9B 3GCHC 4OGYA 2B8OH 1ZR0A 4X6OA 1C5LH 1V6DA 2VJ1A 3EGKH 3I78A 1W11U 1ZSLA 1TIOA 2CHAB 1ELTA 1MAXA 1GI7B 3P6ZB 2NU1E 3PLPA 3TPIZ 1SGQE 3HKJB 1BB0B 2ZWLH 5IDKA 1QCPA 3HK3B 2NU3E 3Q00A 2GT7A 1O3FA 5FPYA 3O8BA 4K3JA 1GBAA 3L3TA 4WMFA 1WYKA 2GT8A 2FTMA 1QJ7B 2FTLE 1BBRK 3IWMA 3LGYA 4UFFH 3C27B 2VWNA 4BXWA 2QXIA 5DP5A 2QC2A 3KN2A 2SFAA 3KNXA 3MO3A 4E06H 1L4ZA 1MQ6A 2FS8A 2ZU1A 5SGAE 1NPMA 1C1WH 5AHGH 1SOTA 3Q3YA 4O97A 1VR1H 2GP9B 3PYHA 7GCHG 1EZQA 1SQOA 2GV7A 1CQQA 1GBFA 1C5OH 1DPOA 1SGFG 4HI3A 4DIHH 1SFIA 1A61H 3M5NA 3PV4A 2GV6A 1AIXH 2EI7A 2W3KA 4LK4A 3O8DA 1GI1A 1C5UA 1BTZA 1YLDA 1A2CH 1HAXB 3RXQA 3UR6A 1XKBC 1Y3WA 3LT3A 2OBQA 3MH4A 1EJNA 4X2WA 3RC5A 2TIOA 1AKSA 2BY9X 1ANDA 1GHWH 2R0KA 1AE8H 3URDA 3RXDA 1CVWH 1GJ7B 1MUEB 2QAAA 3OSYA 3UQVA 2EC9H 1O3BA 3VEQB 1F5KU 3ZVAA 1Y8TA 1TOMH 3ENSB 1DDJA 4AFZA 4FUHA 1A3EH 3QTOH 2EI8A 3LOXA 2DUCA 2D8WA 5A0AE 3RU4E 2XCNA 3TK9A 1LQDB 1IQNA 1THSH 1RGQA 3A84A 4X1QU 4D7GA 3LDXH 1C2JA 2O8MA 1FDPA 1ZHRA 1F0UA 2P59A 1H8DH 1AI8H 1WQSA 3SUFA 2ZHFH 3QGNB 1H9LB 1XXDA 2CXVA 1Y59T 1LVMA 2GZ7A 1AFQB 4NA8A 3E8LA 5T6GA 3V3MA 2QCYA 1AFQC 2J92A 3EE0B 1QIXB 6ESTA 2Z6BD 4ZMAH 2UUJB 3A7WA 1O5EH 2ZKSA 3LGIA 5EQRA 1QB6A 4ABHA 1SGDE 3BTKE 1O2MA 4CREA 2XXLA 1O2WA 1GJDB 5CE1A 4X8VH 1LTOA 1WSSH 3SUDA 1MTNB 4OS5A 1BMNH 3UNSA 1PPZA 4WMEA 1Q2WA 2BLVA 2CN0H 2ZP0H 3GCTG 1P2MA 4X1RU 1SGIB 1SBWA 2D2DA 4JYUH 3ZVFA 3KHVA 4BOHA 3AVZA 3AASA 3EA7A 3HPTB 1SGTA 5G4BA 1JIMA 3T27A 1GI5A 1QY6A 1C4U2 3QLPH 4XSKU 5FAHA 1E35B 2PWXA 2C8XB 3SZNA 5I46H 4WWYA 2JH5D 2ZFPH 2AERH 4MPXA 2A4QA 1XKAC 1CHOG 2XYAA 3VB4A 1DT2A 1HPGA 1W0ZU 3GISB 4D9RA 1KXFA 2WUBA 1E34B 4SGBE 5GWZA 2ZFTA 2GCTB 4F49A 3ZVEA 1O39A 3OX7U 2PSYA 1PPGE 1V2MT 1L0ZA 5E0GA 2OC1A 3ZZ7A 1SC8U 1Z6EA 3M5OA 1O3MA 4NIXA 3A89A 1HAVB 3TNTA 4K1SA 1GWAA 5TCCA 4A7IB 3G01A 1ACBE 2D1JA 4I32A 2OC8A 3MU0A 1OKXA 3QN7A 5LPFA 5EQQA 3LPRA 2QA9E 2UWPA 3SGQE 2BX3A 3PMJA 1BTYA 1P03A 4ASHA 1SLUB 6LPRA 1TFXA 1GJ4H 2OD3B 4K1TA 1DWEH 2OINA 2ZFFH 3ZZ8A 1ETTH 1N8OC 1O2OA 1W12U 1K1MA 3P8OA 3U1JB 5EW1H 4K69A 1ZTKA 1LCYA 1P2QA 1P09A 1AVXA 1HAYB 1LPKB 2FXRA 3ZV8A 1F2SE 1O3JA 4JMYA 2EI6A 1BA8B 1ZLRA 3M5MA 4AX9H 3TU7H 1GHAF 2PUQH 1O37A 1OYTH 2VNTA 3A80A 4Z0KA 1TGBA 2J95A 1O0DH 3UOUA 3ATLA 4H6SB 3SU1A 4Y8YA 3D23A 5DPAA 2R0LA 1P0SH 4Y0ZE 1N6YA 1YCPM 4J2YB 4CRFA 2PFEA 1ZJDA 3MYWA 1A5GH 2O8TA 2WPJS 5C67A 1THRH 1EAIA 3M7QA 1AVWA 2BVSH 4FXGH 4Q2KA 5E0HA 1AWHB 5TJXA 3S7HB 2CF9H 2BDGA 1MZAA 1YC0A 2TGTA 1J15A 3NK8A 1W10U 4DGJA 4BANB 2ZF0H 3CS7A 3TJVA 3BTME 3SN8A 1GI6A 7GCHF 3P92A 4ZXXH 2ZHEH 1G30B 4CRDA 2QF0A 1TRMA 2Z3DA 1D3PB 4X2XA 4Q7XA 2GKVE 3SV2H 1GI8B 3BTEE 2HNTC 1LPZB 5LPEA 1L4DA 2FYQA 2Q1JA 1HIAB 2BZ6H 1YPHC 4ISIH 3ELAH 5TCAA 1AZ8A 1HAVA 2A7HA 1VCQA 1GJ9B 2AMDA 1SLVB 2B5TB 1BCUH 3UNQA 1O2UA 2Y5FA 3BG4C 2XWAA 1HDTH 2C3SA 1LHEH 1HV7A 1LHGH 4Q7YA 3TJOA 5L6NH 5FCKA 1V2NT 1C5QA 1BRAA 4UONA 4KP0A 3SJIA 4NSVA 4YLUA 1YPHE 1ZOMA 1H1BA 3GY2A 1C5NH 1O3EA 3Q76A 1EOJA 1C1TA 3D62A 1FPHH 3F9EA 1YGCH 3GYMA 1ZGVA 1QFKH 1ELGA 1OSSA 3GCNA 1YP9A 4B76A 4B71A 1JWTA 1LKBA 1V2UT 3EDXB 1NFUA 1TNJA 4XOJA 5HM2A 1QTFA 1TGNA 2A7JA 4INHA 1TONA 4B73A 2C4FH 2XBWA 3SU3A 1Y5BT 4ISOA 1DFPA 1UHBA 2PKAA 2ODYB 2Z9GA 5JB8S 2VGCB 8KME2 1CT4E 2FOBA 4X1PU 1BBRE 4IBLH 1GMHG 5A8XA 5FPTA 3KQEA 1C1MA 2Y6TA 1HGTH 1K1LA 4NCYA 1MCTA 1RIWC 3MNSA 5A8YA 2ZI2H 3KF2A 1ZYOA 3MU5A 5A2MH 5LPRA 3PM3A 2FI3E 1T31A 1L1NA 1XXFA 1EUFA 2KAIA 5HYOA 5L2ZH 2AGGX 4BAMB 1TPPA 1GHAG 2Z3EA 2W5EA 1OS8A 1K1JA 5EODA 1SGEE 1TQ7B 2W3IA 1C1PA 3A8DA 3HGNA 1BOQA 3OY6U 4X2YA 1HJ8A 1O32A 3RLYH 2TGDA 2ZC9H 4OS4A 4JZEH 1TBQH 1XUIA 1GVLA 1TA2A 3P17H 1GBIA 2NU0E 2ZEBA 1ARCA 1ID5H 1C2LA 1C9PA 4O3UA 4RKOB 2ZDMA 1ESAA 3MMGA 5J4QA 2LNCA 1GCTB 4K5ZA 1DWCH 5E8EH 1LDTT 3NKKA 3RXTA 4H4FA 3QZRA 4J1YA 1ZHPA 2FPZA 3RMLH 1ZSJA 1HAOH 4XDEA 3MHWU 3HGPA 4B75A 1P9SA 3VB3A 4ABFA 4GLYA 2J34A 2NU2E 4ZH8A 2KAIB 5ABWA 2WPMS 1H9HE 3URCA 2Q6FA 3SHCH 2GX4A 2GMTB 3VGCB 1OX1A 1FI8A 2BDBA 1C1RA 2FEQH 3P8GA 3ZV9A 5GCHF 1IQGA 2R9PA 3PB1E 1NY22 3E0NB 3RLWH 1EZSC 2P94A 4BTIB 3UIRA 1MU8B 1XX9A 2A32A 2IOTA 3ATKA 3SU2A 2P3TB 2HWLB 3RXGA 1NRSH 1RTFB 1QBOA 5IYTA 4VGCC 4K8YA 4YLQH 1FONA 2BXUH 1NC6A 1BDAA 1T8NA 3GDSA 2XNIA 5EOKA 4WY3A 2BDYA 2A45B 4JK6A 2C90B 1D3TB 5GIBA 3NWUA 1P3CA 2GDEH 3DA9B 1EXFA