2SFAA

Serine proteinase from streptomyces fradiae atcc 14544
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
191
structure length
191
Chain Sequence
IAGGEAIYAAGGGRCSLGFNVRSSSGATYALTAGHCTEIASTWYTNSGQTSLLGTRAGTSFPGNDYGLIRHSNASAADGRVYLYNGSYRDITGAGNAYVGQTVQRSGSTTGLHSGRVTGLNATVNYGGGDIVSGLIQTNVCAEPGDSGGALFAGSTALGLTSGGSGNCRTGGTTFFQPVTEALSAYGVSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Purification, characterization, primary structure, crystallization and preliminary crystallographic study of a serine proteinase from Streptomyces fradiae ATCC 14544.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords SERINE PROTEINASE
total genus 49
structure length 191
sequence length 191
ec nomenclature ec 3.4.21.-:
pdb deposition date 1994-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sfaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sfaA01
4NWKA 3HKIB 4Y7AA 1FY3A 2JH5D 1QB6A 1G3EA 5EOKA 3IWMA 1SOZA 2BB4A 2BD2A 1NC6A 1IQJA 1H9LB 1OKXA 1MUEB 2G4TA 5HM2A 3F6UH 3W95A 2M5TA 2HNTE 2Y81A 2BVRH 1SGIB 3VGCB 3KIDU 3SBKA 4NCYA 2PKAA 3O8CA 4CHAB 2ULLA 2CXVA 4UE7H 2ILNA 4OS1A 2QC2A 1JRSA 1ZPBA 1O32A 2Y6TA 4ISNA 3GY6A 1G32B 5BRRE 1UTMA 1AWHB 1C5SA 2FOAA 1E37B 2BQWB 4GLYA 3TNTA 3FP7E 3RP2A 2WPMS 2F9VA 4YTAA 1GJCB 1AQ7A 1EKBB 2ESTE 4FUCA 1SGTA 1YP9A 1PYTC 1HLTH 1UVOA 1XVMA 4OS5A 4LOYH 4YOIA 2YNBA 2A0QB 2V6NA 1G2LA 3GY8A 1L1NA 3R3GB 3QWCH 4TWYA 4B76A 2BX4A 2WPIS 3A7YA 1F92A 2ZHWH 3SUFA 1D3TB 3QX5H 1JBUH 2VIDA 1K1JA 1O2YA 3S7KB 4ABEA 2ZCLP 5TCCA 3S0NA 1O2XA 1YPJH 1EPTB 1P9UA 1Y3UA 4CRDA 3SNEA 2PR3A 1LO6A 4YESB 3TJVA 1GHAG 1P06A 1AE5A 1CT4E 1EJMA 4LK4A 1TRNA 3ZZAA 2JETC 4Q80A 2ZPSA 1O31A 1GI0A 3A86A 1JXPA 5K7RA 1TMUH 4D9QA 4Z6AH 4GCHF 1TRMA 4IW4E 2RG3A 1O39A 2ZFRH 3VEQB 1YLCA 5GWZA 3GOVB 5ESBA 2B0FA 1AIXH 1TGTA 1CSOE 1W11U 4Y0YE 3SNDA 1FXYA 1ID5H 1GI3A 2Z6BD 3ODDA 2J4IA 4Q7XA 4ABGA 4M7GA 1ANEA 4R0IA 4CH2B 4DVAU 3LGVA 2ZHEH 1TBRH 2NU1E 5CE1A 3EA8A 2A2QH 3VFEA 1FONA 4GAWA 2WYJA 2W3IA 1IQNA 4K3JA 1HIAA 4B2AA 1W10U 4B2CA 1QNJA 2PKAB 1S0QA 1NN6A 2ODPA 1SHHB 1EPTC 4X8TH 4DURA 1WTGH 1NRNH 5GDSH 4J1YA 3TITA 3V0XA 4K8YA 5EQQA 2ZIQH 2P8OC 1ZRKA 1DXWA 2ZO3H 4AZ2B 2VGCB 2HOBA 1E35B 2SNWA 1MQ5A 3RXHA 2TGTA 3UFAA 3RXUA 1ABJH 1P0SH 4ZH8A 1GMCF 2BDBA 3VPKA 1C2HA 3EDXB 2AGEX 4SGAE 1MBMA 1GHVH 3SQHE 2ZU1A 2BVXH 4INHA 1LVYA 1QJ7B 3D23A 1OOKB 2C4FH 1SI5H 4JZFH 1QL9A 4K1SA 3Q77A 2OXSA 3SO3A 4GHTA 3S9CA 5L6NH 4ZHMU 2BY9X 4ISIH 2ZDLA 2Y7XA 1FAXA 1XXDA 1UVUH 4TWWA 4AX9H 2C3SA 4AGJA 1YLDA 1BTZA 1XX9A 5TCAA 4Y8XA 1DFPA 3TJUA 1V2UT 1MTSA 3PLPA 3M7TA 4E06H 1FPHH 2A4RA 3AAUA 5GCHF 3RU4T 1GI4A 5DK1A 3EQ0H 2QV1A 2XTTB 3MOCA 3TPIZ 3PO1C 3A83A 1Q31A 5E2PA 2ZDKA 3VB4A 3B8JA 4CBNA 2A7CA 2ZGXH 1B7XB 1ELCA 1K1IA 1HXEH 4ABBA 2SGDE 4IS5A 2OP9A 3TLOA 2O8LA 1MKXK 2BVSH 2HGTH 3A7XA 2HNTC 1QB1A 2AERH 3M37A 2J95A 1QBOA 2WPLS 2ZNKH 1MAXA 2R2WU 3DUXH 2Z3CA 3LJJA 5DP7A 1O5CB 4XBCA 4FUBA 1BITA 3SORA 4Y10E 1RTLA 1QR3E 5A0CA 5DKMA 1IQIA 1C2LA 2WYGA 1O2ZA 2ZPRA 1H8DH 4IN1A 1WU1A 1O3LA 3B23B 4DW2U 2O8WA 2G8TA 1TNHA 3MU0A 1DXPA 1ZTLA 2CGAA 1UTJA 1RFNA 1HAZB 2BY5X 3LOXA 1QJ6B 1VCWA 1JWTA 4AYVB 4TPIZ 3SI3H 1BTXA 1OWEA 1SQTA 1K1NA 5J4SA 1YBWA 1C5OH 1SLVB 1CQQA 1F0TA 3MU8A 3ZZ7A 2ZDNA 2FTMA 1G2MA 1QA7A 1AB9B 4NZQA 1AD8H 4O9VA 2ZA5A 1SFIA 4DG4A 1KLIH 5LPEA 4YZUA 1CHOF 1EAUA 1O2MA 2IN2A 1G36A 1ZSJA 3LKWA 3OTJE 1D3PB 5JB8S 5AHGH 4AB9A 1TQ0B 3RXPA 3DD2H 4ABDA 2QN5T 2F9UA 5JDUB 1EP5A 4GPGA 1PFXC 4JK5A 2WV4A 1OWJA 2OCVB 1EPTA 7GCHG 5SGAE 1HAGE 3RLWH 4ZKSU 1HAXB 1AKSA 1RIWC 2VH0A 1SGYE 2C93B 1TIOA 1BBRE 1GHXH 1C5RA 2XNIA 1A1RA 1FPCH 3NKKA 1SL3A 3F1SB 3KQCA 4NFFA 2BX3A 1C5XB 3P92A 1UK4A 2Y80A 1XM1A 2G52A 1SGEE 1O38A 2SNVA 1GI8B 2ZGHA 4MQAA 1VGCC 4BAMB 2AIQA 4O97A 4X6OA 1AVGH 1GDUA 3EA7A 1SB1H 4NG9H 1IQGA 4I32A 1HAOH 1FLEE 1C2EA 2A5IA 1CGHA 4DOQA 1FY5A 1KLJH 4OS4A 1JIRA 3SJIA 1AVXA 2ZFFH 1QBNA 5HYOA 6ESTA 1O3PB 3SI4H 1TNJA 3GYMA 1T7CA 5FPYA 4INLA 1O2WA 1VZQH 1W14U 3PMBB 1A3EH 5DPAA 4THNH 1G3CA 3BG4C 3QN7A 2BLOA 4JCNA 1SFQB 3PMJA 2NU0E 2FYRA 1C1NA 4ZHAA 3URDA 1SGCA 1TOCB 1GI2A 1KYNA 2BY8X 5A2MH 1H9HE 1ZSLA 1C1RA 2XWAA 5C20A 3WY8A 1V2MT 4I33A 3ZZ5A 2TIOA 4BOHA 1BRUP 3FANA 3ZVFA 1CO7E 4WXIA 3PMHB 1C2GA 4K2YA 3ZV8A 1HAHH 1EZUC 1RJXB 1GBBA 1D6WA 3V7TA 4UFDH 2ZCKP 2P3FH 1TLDA 3LGIA 1OYTH 4B1TA 4NSYA 2O9QA 1CT2E 1MTVA 3AW1A 1MTNB 1TONA 4H42U 1JRTA 2ZZUH 2P8OB 1K22H 3EA9A 2Z9IA 1O2IA 3TGJE 2ALPA 2FS8A 3E3TA 1IQHA 5EXLA 2CJIA 3HGPA 1P12E 1GBJA 1L0ZA 1S83A 3RXOA 4OS7A 1MBQA 3RXMA 4FU8A 3UY9A 2BYAX 2QXIA 1C5UA 1WOFA 1V2PT 3BEUA 3OSYA 3A7TA 2H1UA 4DT7B 1UJ1A 1C1WH 1BDAA 2CF8H 4NA9H 3UR9A 3RXIA 4K60A 1Y59T 2H9HA 2XXLA 1JMOH 3UWJH 4BAQB 1O33A 1QRZA 1GG6C 1OP2A 2SGFE 4WH8A 1HGTH 1V2WT 3GCHC 1D9IA 1IQLA 4X6PA 1EX3A 1CA0B 2SFAA 2W5EA 3E0NB 1O36A 1V2TT 2AMPA 2FM2A 1PPEE 1GBTA 3VB7A 3FAOA 3P17H 2C8YB 4UFEH 2I6SA 2FEQH 3E6PH 4ZXYH 3KQEA 2ZHDA 4NFEA 2ASUB 2R0KA 1Y5AT 3M5LA 4MTBA 1P2JA 2FODA 1Z8JB 4CRAA 3Q76A 3SOSA 1TX6A 1T8MA 4ABHA 3SV9A 2PKSB 2WPJS 4IMZA 4OGYA 1S0RA 1AUJA 4U32A 4FUFA 4Q2KA 1GMDG 4YOGA 5JPMH 1OWDA 1Z8GA 4D7FA 3LT3A 2BDCA 1QL7A 4JZ1A 1UK2A 3MYWA 4D8NA 1O0DH 1QTFA 5I25A 2GTBA 5A8ZA 1DPOA 4NGAH 1TX8A 3RLYH 1W7GH 2BD5A 1SGPE 2GT7A 2BOKA 4JYVH 3L3TA 2AFQB 2UWPA 1Z8RA 4X6NA 1GBEA 1CGJE 4CHAC 1C2MA 1AZ8A 1AVWA 1GBMA 3MU5A 5A0AE 2UUKB 4E05H 4AFZA 1SVPA 1DVAH 1O3MA 5AVDA 1MZDA 1LVOA 3SJ8A 4WJG2 1Y3WA 4R8TB 1ZRBA 3BIVH 4Y7BA 3UQOA 4A7IB 1NRSH 4AOQA 3M3SA 3V12A 1E0FD 3UQVA 4B73A 1IAUA 1EAIA 3OY5U 5EGMA 1QHRB 1YKTA 2KAIB 2XC5A 3EAJA 2A45B 1F0RA 1ZHMA 3UNQA 1C5TA 4CBOA 5DO4H 4WWYA 3A88A 1K28D 7KMEH 1MD7A 1AZZA 2NU3E 1JOUB 1GI1A 2SGPE 4PROA 4HFPB 4ZXXH 3M3TA 2GGVB 5C1UA 1WAYB 3RXGA 4DY7B 1WQVH 2R3UA 2B7DH 5JBBS 1A46H 1ETTH 3A82A 2GX4A 1S85A 2GCTB 3VXEH 4HGCA 3ZYEA 1HAPH 1GI6A 1BOQA 1OSSA 2BLQA 5GCHG 2XCNA 5L2YH 1ELEE 3SU6A 5JYIA 1ZSKA 2A32A 1OP0A 1EB2A 2CV3A 1AUTC 1O2RA 2TGAA 2WPHS 4AFQA 1C1SA 4I31A 2VIPA 1Y5UT 2G55A 1P3EA 5GXPA 2ZG0H 1OXGA 2Q6DA 3ESTA 1OX1A 3H7TA 4DCDA 5DP4A 3M5NA 3NZIA 1LHDH 1O3OA 4XE4A 3HATH 4D9RA 2SGAA 5EXMA 4I8KA 2FIRH 5JB9S 3TVJB 3ZZDA 3E8LA 3ZVBA 3PYHA 3UNSA 5A09A 4UDWH 4FU9A 4GHQA 1GMDF 2Z9GA 5JBCS 1F2SE 4IC6A 1DWCH 2BHGA 1BHXF 2XW9A 2OC0A 1CU1A 1VITG 1RS0A 2A7HA 3FP8E 3LPRA 3JZ1B 4X8VH 3A7WA 5GPIB 2FP7B 1OP8A 2V35A 2DUCA 3TK5A 1ZGVA 5EPYA 1MTNC 3BTME 5IDKA 4WH6A 1N1LA 1V2OT 3RXLA 3D62A 2J38A 9ESTA 4MG3A 3G01A 4MPUA 1G9IE 1RD3B 1HJAB 1PYTD 1KIGH 4JYTA 3MFJA 3GDUA 1UK3A 1GI9B 5E8EH 2ZTYA 1NTPA 2A5KA 1V2LT 3KN2A 1ESBA 4O03A 1UTOA 1F5KU 1DUAA 1IHSH 3A7VA 3A8AA 3ZVCA 1XUHA 1Z8IB 3SNCA 2FX4A 1AN1E 1TPSA 3GCTG 1S84A 1GHZA 1GBIA 1MTUA 1AFQC 4NWLA 2AGGX 1FIWA 2HPQH 3M7UA 1NRPH 3A84A 1O2TA 1O2VA 3TH2H 2AIPA 4Y0ZE 1GBLA 4ISLA 3U69H 2GT8A 1GJDB 1GBAA 1AKSB 3SNAA 3P8NA 3GDSA 3DT0H 4Z0KA 3F9EA 3ZV9A 1GBDA 1V6DA 1Z1JA 3QUMP 1RTKA 4DIIH 5H4IB 4K69A 1AY6H 3AW0A 3LIWA 2FDAA 4A1VA 1UTLM 2ZU4A 5FCRA 3SJKA 1EZXC 1GDQA 4DGJA 1K21H 4B75A 1BMLA 1LHFH 8KME2 2EI6A 1Z6EA 2BMGB 1SLXB 3D65E 2NWNA 2VGCC 1CBWB 2H2ZA 4X2YA 3SGQE 4HI3A 1MZAA 1QBVH 1UCYK 2CHAB 1LPGB 2RDLA 2FOCA 3T28A 4TPYA 3RM2H 3RXJA 6GCHF 1HAVA 2ALVA 1HRTH 1HFDA 2GKVE 3PTBA 1YC0A 2Y5HA 2BQ7B 1K2I1 2OBQA 1J8AA 4X1SU 1TAWA 4BNRA 5DJ7A 3RMLH 2QCYA 2XC0A 4H4FA 1UCYE 1LKBA 1O3NA 1F5LA 1P05A 3SU4A 4NIYA 5FX6A 3TK9A 2Y82A 3QZQA 3MU4A 2OTVA 1RIWB 1H1BA 2G5VA 2A5AA 1GJ6A 2VIWA 3MU1A 1DWDH 5FPSA 3I77A 1DX5M 1UMAH 2Q1JA 1ZZZA 3STJA 3BN9A 4ABAA 1MKWH 4MNYA 3PV4A 5EQRA 2A4GA 4MVNA 3N7OA 2SGQE 3UOUA 3GY7A 1PPFE 3RMOH 2ZECA 3F68H 2DE9A 2FI3E 4X2XA 1AU8A 1FUJA 3FVFB 4O3TA 1BTYA 2ZQ1A 4MNWA 2UWOA 3MNBA 4DJZB 5FCKA 1GCDA 4XBBA 5GIBA 4LZ1H 3ZVDA 5ETXA 1O2JA 4XFQA 4BAHB 5C67A 1B0FA 1C4V2 1HJ8A 1LHEH 1KDQB 2G5NA 3VB5A 3TH3H 1O2GH 4K5ZA 1TRYA 2F9PA 1E34B 2R0LA 3EGKH 5LH8A 4NIVA 1OWIA 2ZGJA 3URCA 2PWXA 3Q3KA 1BHXB 1EOLA 1GL1A 2GP9B 2OUAA 4Q7YA 2WUBA 1PQ5A 1XMNB 2A7JA 3Q3YA 1FN6A 1V2KT 4NA8A 2QXJA 5AF9H 1V2NT 4X1QU 2BD3A 2ZDMA 1P2IA 7GCHF 5C3NA 3QZRA 1N6YA 1C5NH 9LPRA 2H5DA 1ZMNA 3M5MA 3GCOA 4QT8C 3TU7H 4RSPA 4X1RU 2ZPQA 1BBRH 4CRBA 3P6ZB 5EG4A 2FOGA 3TK6A 2HRVA 5B6OA 3LC3A 3S9AA 1N8OB 1SLWB 1RGQA 3GY5A 2O8UA 3S69A 3T27A 1A2CH 3MO3A 2XWBI 4ZROA 3ZZ3A 5FPTA 1OYQA 1J15A 4LXBH 3SHAH 2EC9H 3BTQE 3AAVA 2ZU5A 1KLTA 1TGBA 2PSYA 3UPEA 1EJNA 4ESTE 1YPEH 3UR6A 2AMDA 3QTOH 1BT7A 2QIQA 4ZMAH 3P95A 1O5BB 3BTTE 2UUYA 1DUEA 1TBQH 1Y8TA 1RRKA 1XKBC 4NSVA 1NU7B 1PPBH 2VNTA 2BD9A 3GDVA 4A92A 4UONA 7LPRA 1BTHH 2G81E 1YCPM 1NRRH 3GICB 1AI8H 1D3QB 3SGBE 4X8UH 1LQEA 2Q6GA 3BEFB 2ZF0H 3SQEE 2P3UB 1PPZA 2VVUA 3DHKH 1HCGA 5F8TA 1ANBA 4ZKOU 2BLVA 1HPGA 3K2UA 1IHTH 3ATMA 1FY1A 1TNKA 1O3IA 3TH4H 1JIMA 2FZZA 3BEIB 4TYDA 1G3DA 2FI5E 4X8SH 1O3CA 1O2KA 1DWEH 1C9PA 1LPKB 1PPGE 4KTUA 1P02A 3MWIU 1K9OE 4CH8B 2VINA 1KSNA 1K1PA 1B5GH 1HDTH 3MH4A 5T6GA 1C5LH 1ZOMA 4Y71A 3LGTA 1YF4A 3MI4A 2FS9A 6GCHG 1HJAC 4IBLH 1GCTC 1FJSA 3O8BA 5FXLA 2PHBA 4XSKU 1C2DA 1BRAA 3SUEA 1MCTA 2V0BA 1SGFA 1P03A 3ZZ9A 4A5TS 3PLBA 1HV7A 4RKOB 1S82A 4XBDA 4KTSA 1T4VH 1FNIA 2GCHF 1XUIA 3BTEE 4WMEA 1TGCA 2FXRA 3ZVEA 7ESTE 1AWFH 1AB9C 1O3HA 2TPIZ 3P8FA 2J34A 1IQMA 3K6YA 5DGJA 2OBOA 2J9NA 4U30A 1ZPZA 1TNLA 2TGPZ 8LPRA 1F0SA 3M35A 1C1UH 2ZU2A 4VGCB 1RXPA 3QGNB 1W13U 3ZZBA 1SHYA 2J92A 2P3TB 3ZYDA 1MH0A 1QB9A 4SGBE 3LH1A 1W3CA 1MD8A 1T8OA 3MHWU 4GSOA 1Z1IA 5E0HA 1P2MA 1C5MD 3E0PB 2GCTC 3GY2A 1GDNA 1DT2A 1H4WA 1LMWB 5FX5A 1GI7B 2TRMA 4A1TA 1BB0B 1HAIH 2VWMA 4A6LA 5J4QA 2HNTF 4KGAA 2OC8A 2PGQB 1K1MA 4JZEH 5EU8A 1M9UA 2A31A 2STAE 1E38B 1PJPA 4WF8A 2ZQ2A 3ODFA 2FLBH 4KKDA 1TA6A 1W12U 1TPOA 1KXDA 1V2ST 1NFWA 4BAKB 3NCLA 5DP9A 2QA9E 1E36B 2PUQH 1TPPA 3SU1A 2W7SA 1ORFA 4AFSA 3UOPA 4X2WA 1BCUH 1C1VH 3T26A 2ZDVH 3B9FH 4ABIA 4X1PU 2Z9JA 2Y5FA 1FDPA 2XBXA 3RXQA 4U01A 1GCTB 4HTCH 1NZQH 2FOEA 1YPKH 1GHAF 2J2UA 3SUGA 2D2DA 1ZHPA 1GL0E 4CRFA 1TALA 2G51A 1O3BA 2GDEH 2VJ1A 2OC1A 1ESTA 3MNSA 3K65B 1L1JA 1O2QA 3TGKE 2QAAA 4AFUA 4KTCA 3ZVAA 1FV9A 1LTOA 1ZMJA 2VVCA 2EI7A 1C5VA 3BG8A 1A5HA 1EUFA 1AO5A 1THPB 4NIWA 1DS2E 1TA2A 5JBTA 1P09A 1EATA 1IQKA 1TPAE 5F8XA 2IOTA 3BTGE 1XUFA 3L6PA 2G4UA 3SV2H 4BTUB 1A61H 1YGCH 1YPHE 4MNVA 4B2BA 3ITIA 4NIXA 2QGRA 8ESTE 2BDGA 2C90B 2F9NA 3ATIA 4VGCC 3MH5A 1LCYA 1HUTH 1ANCA 1ELTA 2Z9LA 4FUHA 3RXDA 3BTHE 1MU8B 5CHAC 1K1LA 2OQ5A 1P04A 1IQFA 2AH4X 2BDIA 1HJ9A 3BTDE 2ZDAH 3U8TH 3KQBA 2GV7A 2VH6A 1YPLH 1SGRE 1W7XH 1C4U2 1D6RA 1TX7A 4F4OC 1CVWH 1INCA 4AGKA 1ACBE 1ETRH 4YOJA 1ZMLA 4UFFH 1GJ4H 4WMDA 2ZFSA 3STIA 3OU0A 4OS2A 1ELAA 1C4Y2 3O8DA 4CRGA 2SGEE 1YYY1 5F03A 1T8LA 1HAVB 1GJBB 2D1JA 1O2NA 3M61U 3C27B 1ARBA 2D26C 1DY8A 4Y6DA 5PTPA 3MH6A 1NFUA 1BTWA 2WPKS 3RXFA 1O30A 1P2NA 3T62A 1ELDE 3S7HB 4Y8ZA 1QQ4A 1ZJKA 4UEHH 5CHAB 5T3HA 1NT1A 3ATKA 3ENSB 3MMGA 1A0HB 1IQEA 3NXPA 3JZ2B 1ELFA 4MDSA 1O2SA 1DE7H 2FOFA 3A8BA 4YT6H 5F8ZA 1UVSH 1P2QA 3MTYA 2FOBA 1N6XA 1BJVA 2F9BH 4KP0A 3EE0B 1CHGA 1BIOA 2Z9KA 2H6MA 1AGJA 4F49A 1GJ7B 1X7AC 3BTWE 4AG2A 2VU8E 1UO6A 3MO6A 1FI8A 3UIRA 3PB1E 3KL6A 4GVUA 1A5GH 1XVOA 1H9IE 1P01A 1O3EA 4TY7A 3NPSA 1Y5BT 2XRCA 6CHAC 2QF0A 1A7SA 1S6FA 2B9LA 2BZ6H 3NWUA 1O2LA 2BY7X 3KHVA 5HM9A 1TYNA 3T2NA 1V3XA 4CR5A 3TIUA 4CR9A 5E0GA 2OQUA 1FIZA 1NRQH 4D7GA 5CMXH 4Y11E 1DLKB 1A3BH 2W26A 3LGWA 1P3CA 2ZFPH 1SPJA 2BD7A 4A1XA 2OC7A 1ELVA 3RXEA 1LHGH 1OS8A 1ZLRA 2NU2E 4FVDA 1QFKH 3SN8A 2P95A 3Q00A 1TMTH 4HZHA 1HAYB 1VJ9U 1NY22 1XXFA 3RMMH 1BTPA 1FY8E 1BRBE 1NFXA 2R2MB 2BTCE 3RXSA 5FBIA 3H7OA 5LGOA 2J94A 1BMNH 4BAOB 1EJAA 3O8RA 1UCYH 3RU4D 3PMAB 3F9HA 1LPZB 1NPMA 1B0EA 3BF6H 2BY6X 1QL8A 2V3HH 1SG8B 3SUDA 3QTVH 2BQ6B 2I6QA 3I78A 4BXSA 1RTFB 1GWAA 4IGDA 1C1MA 2CHAC 2D8WA 2P16A 4FUJA 4YLQH 1GBCA 5EODA 1J9CH 2F9OA 3M36A 2WV5A 1TABE 2GDDA 1SMFE 2PFEA 3P70B 4OS6A 1DSTA 1WYKA 2BD8A 2FMJA 2ODQA 3RUOA 1C1OA 1MAYA 1C5ZB 3PROA 1VITF 1P2OA 1GGDB 2GMTC 2BDHA 2FO9A 2FWWA 1Q2WA 1KXAA 1SGFG 1TB6H 1C5QA 4UFGH 3MO9A 5EQSA 1CE5A 4KELA 1UTQA 2GVFA 1Z6JH 3KNXA 1TGNA 1SQOA 3PTNA 4Y79A 3U8RH 3LGYA 2FPZA 3T25A 1K1OA 4H6TA 4O3UA 3LC5A 1A5IA 1PQAA 5C1YA 2H9EH 4ISOA 3RXKA 4K8BA 3OX7U 3E91A 3GCHB 1ARCA 3RC6A 2ZCHP 3SU3A 1O5GH 1O3DA 3NUMA 3U8OH 4U2WA 1O3FA 4RKJB 1S81A 1KXCA 4AG1A 3GY4A 1NU9A 1QJ1B 3M7QA 2ZTZA 2A4QA 3ATWA 4WMFA 3NK8A 1EAWA 3PWCA 4ZAEA 1P9SA 1D3DB 1SBWA 1NO9H 1DICA 4X1NU 3FZZA 3MNXA 3SV7A 1TMBH 2RA3A 2LNCA 3SV8A 3AVZA 2CN0H 1BRCE 1O3GA 1AFEH 1EZQA 4E7NA 1FAKH 3K6ZA 1WTHD 2GZ9A 3A8CA 2FI4E 4I8JA 3ZZ8A 5T6FA 1HB0B 2F83A 1THRH 3A80A 5F6MA 1DANH 1VGCB 2THFB 2ZGBH 4FUGA 2JETB 2PSXA 3ZZ4A 2GV6A 2TGDA 1UTNA 4H6SB 1WQSA 3CENA 1YPGH 4FVBA 1V2JT 3H5CB 4MNXA 2EA3A 1SGNE 1FMGA 2FLRH 4RN6A 1KY9A 1WSSH 4FU7A 2HPPH 1MTWA 3D49H 5GJ4B 1Y3YA 1IOEA 1O3AA 3I29A 3LGUA 5JBAS 1NM6A 2Z94A 2ZC9H 2VVVA 1EQ9A 1QQUA 1UTPA 4NZLA 2BD4A 1J16A 1CHOG 1QURH 2ANYA 1F5RA 1DSUA 3PO1B 1GVLA 2O8TA 3HPTB 3M3VA 4K1EA 4AORA 1OWKA 2BLWA 2QYIA 3SZNA 3TJNA 3V3MA 1C1TA 1ABIH 2VB0A 3HK3B 3V13A 3LH3A 3ZZCA 3IITA 3PM3A 3LDXH 3A81A 3RM0H 2VIVA 5TJXA 1W0ZU 2H9TH 2PUXB 3MNCA 4ISHH 5FAHA 2UUFB 4I8GA 2ZTXA 2QXHA 1GVZA 1T31A 1MMJN 2ZKSA 3RMNH 1YPHC 4Q7ZA 3VXFH 1HNEE 5C2ZA 1C1QA 2IPHA 2IJOB 3UNRA 2GCHG 1Y3VA 1T32A 2H5CA 3BSQA 3P8OA 2ZP0H 2XC4A 4FUIA 3OYPA 5EXNA 2FYQA 2XCFA 1EXFA 1KXEA 1EZSC 2UUJB 4AB8A 1J14A 5ESTE 1UHBA 2Z7FE 4AN7A 3HKJB 2O8MA 1BBRK 2GZ7A 1TOMH 5LPFA 2ZU3A 3RXCA 1D4PB 3E1XB 3UREA 1O2PA 1O2HA 3HGNA 1ZYOA 3VB6A 1DM4B 3KCGH 2GZ8A 2ZEBA 4FXGH 1C2IA 1VITH 1VR1H 1NFYA 3CS7A 1L1GA 1DOJA 1Z71A 5HXFA 1GVKB 1GBKA 1O5DH 2AGIX 2CF9H 2OINA 4MPXA 4YT7H 1SC8U 1UHBB 1DY9A 1SGQE 1PQ7A 4K1TA 1LVBA 3W94A 1O2UA 3A87A 1S5SA 2CMYA 1BZXE 2FESH 3KGPA 1YCPK 1QIXB 1KDQA 2V3OH 1ELGA 2XYAA 1W2KH 4CREA 3QLPH 1GPZA 2NU4E 1GBFA 2PGBB 4DIHH 1GMHG 1EB1H 1T8NA 3F9GA 3HK6B 4WXVA 2FOMB 2ODYB 1QA0A 2XBVA 1V2QT 4WVPE 3L33A 2OD3B 3PLKA 1TBZH 5K0HA 2C8WB 1C2FA 2DE8A 3UTUH 2FOHA 5ABWA 2A1DB 5T6DA 1O5AB 3SGAE 4B74A 3A89A 4J2YB 3VGCC 2BM2A 2Y7ZA 1GMCG 1UVTH 3Q3XA 3RXBA 1C5PA 1CBWC 3FP6E 3ZZ6A 3RC4A 1GJAB 5DG6A 4ZKRU 4JZDH 4B71A 1QCPA 1VJAU 1GHYH 1T4UH 2ZHQH 1MCVA 1P11E 4NA7A 2ANMH 1YM0A 1FZZA 3QK1A 2LPRA 1VCPA 5C5OA 2BZAA 3A8DA 3BIUH 5A8XA 1ELBA 3EYDA 1N8OC 5C1XA 1YPMH 1KTSB 4BXWA 1PQ8A 1WBGB 5DP3A 1LDTT 3UWIA 4JMYA 8GCHF 1LHCH 1AFQB 1FY4A 2PTNA 4TY6A 2HVXA 6LPRA 1P10A 5LPRA 1PPHE 2VWNA 1NROH 3KEEA 4ASHA 2WUCA 5A0BA 3ATLA 2GD4B 3A85A 3C1KA 4UD9H 2R9PA 3TGIE 1O5EH 1TE0A 1GHBF 3U1JB 3SW2B 3ZVGA 4IC5A 1W0YH 2B8OH 5I46H 3CP7A 3RXAA 4BTIB 3UUZA 1EAXA 5E0JA 4GUXA 1O5FH 1NESE 1GHBG 2BDAA 2OLGA 3SHCH 2AMQA 3MH7A 4D76A 3DA9B 2A4OA 1ZHRA 2WINI 2ZI2H 1C5YB 1V2VT 2JH0D 2KAIA 3VB3A 2EI8A 4OGXA 1DWBH 1O37A 3LJOA 5DP8A 1G37A 1THSH 2PW8H 1BA8B 1CA0C 3QDZB 1TQ7B 3E16B 8GCHG 2ZHFH 1XUGA 1DDJA 1L4ZA 2PTCE 2Y5GA 2ZFQH 4XDEA 3QO6A 4LZ4B 1HXFH 3BTKE 1BMAA 3GCNA 1OPHB 1P57B 1C5WB 2Z3EA 1EOJA 4MPWA 1GGDC 3T5FH 3SU0A 1DLEA 2ZGCA 5EW1H 2HLCA 3KQDA 1LKAA 1SLUB 4Y8YA 1BQYA 1UVPA 4I8LA 1UTKA 3U9AH 4FUDA 3IG6B 4JZIA 4IMQA 3LONA 3BG4B 1NS3A 3RXTA 1KXFA 3SJOA 5AFZH 1J17T 2BOHB 3TJOA 1AE8H 2BXTH 2HALA 5G4BA 4ZUHA 1VCQA 3RU4E 3KF2A 4YLUA 3OY6U 1DITH 1GHWH 1ZTKA 1C2JA 1QY6A 1GJ8B 2F3CE 3LU9B 1CGIE 4BTTB 1C9TA 2FTLE 1GMHF 1YCPH 1GG6B 2QXGA 2RCEA 1AMHA 1TFXA 4JK6A 2W3KA 1MKXH 5EW2H 2GMTB 2B5TB 2R3YA 2VIQA 3QGJA 1GJ5H 2BDYA 1GI5A 2PLXA 1EP6A 3AASA 1BTUA 2QY0B 5DP5A 2ANKH 4Y76A 2VWLA 3U1IB 3DFLA 4I8HA 2Q6FA 5EPNA 1GJ9B 1AHTH 1GBHA 1W8BH 4ABFA 2PKSC 5E2OA 1SSXA 2C8XB 5FHTA 1Y3XA 6CHAB 2AEIH 3GCTF 2AS9A 3FZDA 3DFJA 1SGDE 4X2VA 3RXVA 5AFYH 1XKAC 2VIOA 1HIAB 5L2ZH 1O3JA 5L30H 4IN2A 1O3KA 2F91A 1P2KA 2ANWA 2JH6D 1XUKA 1TNIA 2Z3DA 4ZHLU 1A0LA 5A8YA 4BANB 4CRCA 4JYUH 2A2XH 1FN8A 3P8GA 1HYLA 2ZWLH 3SU2A 3TNSA 2P93A 1XUJA 1H8IH 5HGGA 1ANDA 1BMMH 2G00A 1A0JA 4MLFB 1EASA 2EEKA 1CT0E 2PV9B 1QRXA 3RC5A 3T29A 4X0WU 5HMAA 1ESAA 1SQAA 1O2OA 3A7ZA 4ZKNU 5BPEA 4WY3A 4I7YH 1F7ZA 3SNBA 1LVMA 1QRWA 1ZR0A 4GCHG 4INKA 3RDZA 5IYTA 3U98H 2C8ZB 1FQ3A 2UWLA 1KXBA 2QF3A 1A4WH 2W7UA 4AYYB 2FX6A 1ZPCA 4ABJA 1BJUA 3SU5A 1SR5C 1Z7KA 2P94A 3SJ9A 3BV9B 4YM9A 1G30B 1SOTA 3GY3A 1F0UA 3M5OA 1OWHA 1TGSZ 1TNGA 3GYLB 3E90B 3RXRA 2P59A 1PPCE 1U6QA 1O34A 1WV7H 1V2RT 3ELAH 4E7RG 1WCZA 3FFGA 2STBE 2RA0A 1O35A 1L2EA 4X6MA 4XOJA 1MU6B 3S9BA 1CA8B 2YOLA 1MKWK 2ZFTA 2XBYA 1P8VC 2K1QA 3SV6A 4FUEA 1MQ6A 5DP6A 1QGFA 1LQDB 2YNAA 1C1PA 1ETSH 1WUNH 2HWLB 3BTFE 1HBTH 4YO9A 1L4DA 1TWXB 2VWOA 1G3BA 3R0FA 3K9XB 2XBWA 1S6HA 2AYWA 3PWBA 5FBEA 1ZTJA 1BUIA 1C2KA 3GISB 2BXUH 5C5NA 1Q3XA 4MPVA 3F9FA 1KTTB 3CS0A 2TBSA 1ZJDA 1ZGIA 2JKHA
chains in the Genus database with same CATH superfamily
4NWKA 3HKIB 3KQ5A 4Y7AA 1FY3A 2JH5D 1QB6A 1G3EA 5EOKA 3IWMA 1SOZA 2BB4A 2BD2A 1NC6A 1IQJA 1H9LB 1OKXA 1MUEB 2G4TA 5HM2A 3F6UH 3W95A 2M5TA 2HNTE 3U28C 3WW7A 2Y81A 2BVRH 1SGIB 3VGCB 3KIDU 3SBKA 4NCYA 2PKAA 3O8CA 4CHAB 2ULLA 2CXVA 4UE7H 2ILNA 2KCAA 4OS1A 2QC2A 1JRSA 1ZPBA 1O32A 2Y6TA 4ISNA 3GY6A 1G32B 5BRRE 1UTMA 1AWHB 1C5SA 2FOAA 1E37B 2BQWB 4GLYA 3TNTA 3FP7E 3RP2A 2WPMS 2F9VA 4YTAA 1GJCB 1AQ7A 1EKBB 2ESTE 4FUCA 1SGTA 1YP9A 1PYTC 1HLTH 1UVOA 1XVMA 4OS5A 4LOYH 4YOIA 2YNBA 2A0QB 2V6NA 1G2LA 3GY8A 1L1NA 3R3GB 3QWCH 4TWYA 4B76A 3PV5A 2BX4A 2WPIS 3OE7D 4M9FA 3A7YA 1F92A 2ZHWH 3SUFA 1D3TB 3QX5H 1JBUH 2VIDA 1K1JA 1O2YA 3S7KB 4ABEA 2ZCLP 5TCCA 3S0NA 2F4LA 1O2XA 1YPJH 1EPTB 1P9UA 1Y3UA 4CRDA 3SNEA 2PR3A 1LO6A 4YESB 3TJVA 1GHAG 1P06A 1AE5A 1CT4E 1EJMA 4LK4A 1TRNA 3ZZAA 2JETC 4Q80A 4ASUD 2ZPSA 1O31A 1GI0A 3A86A 1JXPA 5C17A 5K7RA 1TMUH 4D9QA 4Z6AH 2QE7D 4GCHF 1TRMA 4IW4E 2RG3A 1O39A 2ZFRH 3VEQB 1YLCA 5GWZA 3CNRA 3GOVB 5ESBA 2B0FA 1AIXH 1TGTA 1CSOE 1W11U 4Y0YE 3SNDA 1FXYA 1ID5H 1GI3A 2Z6BD 3ODDA 2J4IA 4Q7XA 4ABGA 4M7GA 1ANEA 4R0IA 4CH2B 4DVAU 3LGVA 2ZHEH 1TBRH 2NU1E 5CE1A 3EA8A 2A2QH 3VFEA 1FONA 4GAWA 2WYJA 2W3IA 1IQNA 4K3JA 1HIAA 4B2AA 1W10U 4B2CA 1QNJA 2PKAB 1S0QA 1NN6A 2ODPA 1SHHB 1EPTC 4X8TH 4DURA 1YWUA 1WTGH 1NRNH 5GDSH 3VG8A 4J1YA 3TITA 3V0XA 4K8YA 5EQQA 2ZIQH 2P8OC 1ZRKA 1DXWA 2ZO3H 4AZ2B 4I86A 2VGCB 2HOBA 1E35B 2SNWA 1MQ5A 3RXHA 2TGTA 3UFAA 3RXUA 1ABJH 1P0SH 4ZH8A 1GMCF 2BDBA 3VPKA 1C2HA 3EDXB 2AGEX 4SGAE 1MBMA 1GHVH 3SQHE 2ZU1A 2BVXH 4INHA 1LVYA 1QJ7B 3D23A 1OOKB 2C4FH 1SI5H 4JZFH 1QL9A 4K1SA 3Q77A 2OXSA 3SO3A 4GHTA 3S9CA 5L6NH 4ZHMU 2BY9X 4ISIH 2ZDLA 2Y7XA 1FAXA 1XXDA 1UVUH 4TWWA 4AX9H 2C3SA 4AGJA 1YLDA 1BTZA 1XX9A 5TCAA 4Y8XA 1DFPA 3TJUA 1V2UT 1MTSA 3PLPA 3M7TA 4E06H 1FPHH 2A4RA 3AAUA 5GCHF 3RU4T 1GI4A 5DK1A 3EQ0H 2QV1A 2XTTB 3MOCA 3TPIZ 3PO1C 3A83A 1Q31A 5E2PA 4B6FA 2ZDKA 3VB4A 3B8JA 4CBNA 3W1EA 4FOUC 2A7CA 2ZGXH 1B7XB 1ELCA 1K1IA 1HXEH 4ABBA 2SGDE 4IS5A 2OP9A 3TLOA 2O8LA 1MKXK 2BVSH 3F0PA 2HGTH 3A7XA 3N99A 2HNTC 1QB1A 2AERH 3M37A 2J95A 1QBOA 2WPLS 2ZNKH 1MAXA 2R2WU 3DUXH 2Z3CA 3LJJA 5DP7A 1O5CB 4XBCA 4FUBA 1BITA 3SORA 4Y10E 3PRDA 1RTLA 1QR3E 5A0CA 5DKMA 1IQIA 1C2LA 2WYGA 1O2ZA 2ZPRA 1H8DH 4IN1A 1WU1A 1O3LA 3B23B 4DW2U 2O8WA 2G8TA 1TNHA 3MU0A 1DXPA 1ZTLA 2CGAA 1UTJA 1RFNA 1HAZB 2BY5X 3LOXA 1QJ6B 1VCWA 1JWTA 4AYVB 4TPIZ 3SI3H 1BTXA 1OWEA 5KGOA 1SQTA 1K1NA 5J4SA 1YBWA 1C5OH 1SLVB 1CQQA 1F0TA 3MU8A 3ZZ7A 2ZDNA 2FTMA 1G2MA 1QA7A 2KFWA 1AB9B 4NZQA 1AD8H 4O9VA 2ZA5A 1SFIA 4DG4A 1KLIH 5LPEA 4YZUA 1CHOF 1EAUA 3FOAA 1O2MA 2IN2A 1G36A 1ZSJA 3LKWA 3OTJE 4X8VH 1D3PB 5JB8S 5AHGH 4AB9A 1TQ0B 3RXPA 3DD2H 4ABDA 2QN5T 2F9UA 5JDUB 1EP5A 4GPGA 1PFXC 4JK5A 2WV4A 1OWJA 2OCVB 1EPTA 7GCHG 5SGAE 1HAGE 3RLWH 4ZKSU 1HAXB 1AKSA 1RIWC 2VH0A 1SGYE 2C93B 1TIOA 1BBRE 1GHXH 1C5RA 2XNIA 1A1RA 1FPCH 3NKKA 1SL3A 3F1SB 3KQCA 4NFFA 2RDEA 2BX3A 1C5XB 3P92A 1UK4A 2Y80A 1XM1A 3DSGA 2G52A 1SGEE 1O38A 2SNVA 1GI8B 2ZGHA 4MQAA 1VGCC 4BAMB 2AIQA 4O97A 4X6OA 1AVGH 1GDUA 3EA7A 1SB1H 4NG9H 1IQGA 4I32A 1HAOH 1FLEE 1C2EA 2A5IA 1CGHA 4DOQA 1FY5A 1KLJH 4OS4A 1JIRA 3SJIA 1AVXA 2ZFFH 1QBNA 5HYOA 4RI0A 6ESTA 1O3PB 3SI4H 2OK5A 1TNJA 3GYMA 1T7CA 5FPYA 4INLA 1O2WA 1VZQH 1W14U 3PMBB 1A3EH 2W6ID 4THNH 5DPAA 1G3CA 3BG4C 3F3BA 3QN7A 2BLOA 4JCNA 1SFQB 3PMJA 2EY4C 2NU0E 2FYRA 1C1NA 4ZHAA 3URDA 1SGCA 1TOCB 1GI2A 1KYNA 2BY8X 5A2MH 1H9HE 1ZSLA 1C1RA 2XWAA 5HKKD 5C20A 2KM0A 3F2GA 3WY8A 1V2MT 4I33A 3ZZ5A 2TIOA 4BOHA 1BRUP 3FANA 3ZVFA 1CO7E 4WXIA 1WDIA 3PMHB 1C2GA 4K2YA 3ZV8A 1HAHH 1EZUC 1RJXB 1GBBA 1D6WA 3V7TA 4UFDH 2ZCKP 2P3FH 1TLDA 3LGIA 1OYTH 4B1TA 4NSYA 2O9QA 1CT2E 1MTVA 3AW1A 1MTNB 1TONA 4H42U 1JRTA 2ZZUH 4ZCNA 2P8OB 1K22H 3EA9A 2Z9IA 1O2IA 3TGJE 4DT4A 2ALPA 2FS8A 3E3TA 1IQHA 5EXLA 2CJIA 3HGPA 1P12E 1GBJA 1L0ZA 1S83A 3RXOA 4OS7A 1MBQA 3RXMA 4FU8A 3UY9A 2BYAX 2QXIA 1C5UA 1WOFA 1V2PT 3BEUA 3OSYA 3A7TA 2H1UA 4DT7B 1UJ1A 1C1WH 1BDAA 2CF8H 4NA9H 3UR9A 3RXIA 4K60A 1Y59T 2H9HA 2XXLA 1JMOH 3UWJH 4BAQB 1O33A 1QRZA 1GG6C 1OP2A 2SGFE 4WH8A 1HGTH 1V2WT 3GCHC 1D9IA 1IQLA 4X6PA 1EX3A 1CA0B 2SFAA 2W5EA 3E0NB 1O36A 1V2TT 2AMPA 2FM2A 1PPEE 1GBTA 3VB7A 3FAOA 3P17H 2C8YB 4UFEH 2I6SA 2FEQH 3E6PH 4ZXYH 3KQEA 2ZHDA 4NFEA 2ASUB 2R0KA 1Y5AT 3M5LA 4MTBA 1P2JA 2FODA 1Z8JB 4CRAA 3Q76A 3SOSA 1TX6A 1T8MA 4ABHA 3SV9A 2PKSB 2WPJS 4IMZA 4OGYA 1S0RA 1AUJA 4U32A 4FUFA 4Q2KA 1GMDG 4YOGA 5JPMH 1OWDA 1Z8GA 3EE7A 4D7FA 3LT3A 2BDCA 4RT1A 1QL7A 1QZ8A 4JZ1A 1UK2A 3MYWA 3DSOA 4D8NA 1O0DH 1QTFA 5I25A 2KCPA 2GTBA 5A8ZA 1DPOA 4NGAH 1TX8A 3RLYH 1W7GH 3OTPA 2BD5A 1SGPE 2GT7A 2BOKA 2QF5A 4JYVH 3L3TA 2AFQB 2UWPA 1Z8RA 4X6NA 1GBEA 1CGJE 4CHAC 1C2MA 1AZ8A 1AVWA 1GBMA 3MU5A 5A0AE 2UUKB 4E05H 4AFZA 1SVPA 1DVAH 1O3MA 5AVDA 1MZDA 1LVOA 3SJ8A 4WJG2 1Y3WA 4R8TB 1ZRBA 3BIVH 4Y7BA 3UQOA 4A7IB 1E79D 1NRSH 4AOQA 3M3SA 3V12A 1E0FD 3UQVA 4B73A 1IAUA 1EAIA 3OY5U 5EGMA 1QHRB 5GNDA 1YKTA 2KAIB 2XC5A 3EAJA 5C94A 2A45B 1F0RA 1ZHMA 3UNQA 1C5TA 4CBOA 5DO4H 4WWYA 3A88A 1K28D 7KMEH 1MD7A 1AZZA 2NU3E 1JOUB 1GI1A 2SGPE 4PROA 4HFPB 1UW7A 4ZXXH 3M3TA 2GGVB 5C1UA 1WAYB 5KEDA 3RXGA 4DY7B 1WQVH 2R3UA 2B7DH 5JBBS 1A46H 1ETTH 3A82A 2GX4A 2XNDD 1S85A 2GCTB 3VXEH 3DCLA 4HGCA 3ZYEA 1HAPH 1GI6A 1BOQA 1OSSA 2BLQA 5GCHG 2XCNA 5L2YH 1ELEE 3SU6A 5JYIA 2V3MA 1ZSKA 2A32A 1OP0A 1EB2A 2CV3A 1AUTC 1O2RA 2TGAA 2WPHS 5CHBA 4AFQA 1C1SA 4I31A 2VIPA 1Y5UT 2G55A 1P3EA 5GXPA 3SZEA 2ZG0H 1OXGA 2Q6DA 3ESTA 1OX1A 3H7TA 4DCDA 5DP4A 3M5NA 3NZIA 1LHDH 1O3OA 4XE4A 3HATH 4D9RA 2SGAA 5EXMA 4I8KA 3UAIC 2FIRH 5JB9S 3TVJB 3ZZDA 3E8LA 3ZVBA 3PYHA 3UNSA 5A09A 4UDWH 4FU9A 4GHQA 1GMDF 2Z9GA 5JBCS 1F2SE 4IC6A 1DWCH 4Q63A 2BHGA 1BHXF 2OC0A 1CU1A 1VITG 2XW9A 1RS0A 2A7HA 3FP8E 3LPRA 3JZ1B 3OEHD 3A7WA 5GPIB 2FP7B 1OP8A 2V35A 2DUCA 3TK5A 1ZGVA 5EPYA 1MTNC 3BTME 5IDKA 4WH6A 1N1LA 1V2OT 3RXLA 3D62A 2J38A 9ESTA 4MG3A 3G01A 4MPUA 1G9IE 1RD3B 2F43B 1HJAB 1PYTD 1KIGH 4JYTA 3MFJA 3GDUA 1UK3A 1GI9B 5E8EH 2ZTYA 1NTPA 2A5KA 1V2LT 3KN2A 1ESBA 4O03A 1UTOA 1F5KU 1DUAA 1IHSH 3A7VA 3A8AA 3ZVCA 1XUHA 1Z8IB 3SNCA 2FX4A 1AN1E 1TPSA 3GCTG 1S84A 1GHZA 1GBIA 1MTUA 1AFQC 4NWLA 5C0UA 2AGGX 1FIWA 2HPQH 3M7UA 1NRPH 3A84A 1O2TA 2PP6A 1O2VA 3TH2H 2AIPA 4Y0ZE 1GBLA 4ISLA 3U69H 2GT8A 1GJDB 1GBAA 1AKSB 3SNAA 3P8NA 3GDSA 3DT0H 4Z0KA 3F9EA 3ZV9A 1E1QD 1GBDA 1V6DA 1Z1JA 1EFRD 3QUMP 1RTKA 4DIIH 1OHHD 5H4IB 4K69A 1AY6H 3AW0A 3LIWA 2FDAA 1W0KD 4A1VA 1UTLM 2ZU4A 5FCRA 2YMSC 1EZXC 1GDQA 3SJKA 4DGJA 1K21H 4B75A 1BMLA 1LHFH 8KME2 2EI6A 1Z6EA 2BMGB 1SLXB 3D65E 2NWNA 2VGCC 1CBWB 2H2ZA 4X2YA 3SGQE 4HI3A 1MZAA 1QBVH 1UCYK 2CHAB 1LPGB 2RDLA 2FOCA 3T28A 4TPYA 3RM2H 3RXJA 6GCHF 1HAVA 2ALVA 3FO8D 1HRTH 1HFDA 2GKVE 3PTBA 1W0JD 1YC0A 2Y5HA 5DN6D 2BQ7B 1K2I1 2OBQA 1J8AA 4X1SU 1TAWA 4BNRA 5DJ7A 3RMLH 2QCYA 2XC0A 4H4FA 1UCYE 1LKBA 1O3NA 1F5LA 1P05A 3SU4A 4NIYA 5FX6A 3TK9A 2Y82A 3QZQA 3MU4A 2OTVA 1RIWB 1H1BA 2G5VA 2A5AA 1GJ6A 2VIWA 3MU1A 1DWDH 5FPSA 3I77A 1DX5M 1UMAH 2Q1JA 1ZZZA 3STJA 3BN9A 4ABAA 1MKWH 4MNYA 3PV4A 5EQRA 2A4GA 4MVNA 3N7OA 2SGQE 3UOUA 1H8HD 3GY7A 1PPFE 5T1VA 2ZECA 3RMOH 3F68H 5EIYA 2DE9A 2FI3E 4X2XA 1AU8A 1FUJA 3FVFB 4O3TA 4TT3D 1BTYA 2ZQ1A 4MNWA 2UWOA 3MNBA 4DJZB 5FCKA 1GCDA 4XBBA 5GIBA 4LZ1H 3ZVDA 5ETXA 1O2JA 4XFQA 4BAHB 1K0HA 3OEED 1B0FA 1C4V2 1HJ8A 1LHEH 5C67A 1KDQB 2G5NA 3VB5A 3TH3H 5KECA 1O2GH 4K5ZA 1TRYA 2F9PA 1E34B 2R0LA 3EGKH 5LH8A 4NIVA 1OWIA 2ZGJA 3URCA 2PWXA 3Q3KA 1BHXB 1EOLA 1GL1A 2GP9B 2L74A 2OUAA 4Q7YA 2WUBA 1PQ5A 1XMNB 2A7JA 3Q3YA 1FN6A 5HIYA 1V2KT 2J97A 4NA8A 1YLNA 2QXJA 5AF9H 1V2NT 4X1QU 2BD3A 2ZDMA 3ZIAD 1P2IA 7GCHF 5C3NA 3QZRA 1N6YA 1C5NH 9LPRA 2H5DA 1ZMNA 3M5MA 3GCOA 4QT8C 3TU7H 4RSPA 1KMHB 3N7DA 4X1RU 2ZPQA 1BBRH 4CRBA 3P6ZB 5EG4A 2FOGA 3TK6A 2HRVA 5B6OA 3LC3A 3S9AA 1N8OB 1SLWB 1RGQA 3GY5A 2O8UA 3S69A 3T27A 1A2CH 3MO3A 1SKYE 2XWBI 4ZROA 3ZZ3A 5FPTA 1OYQA 1J15A 4LXBH 3SHAH 2EC9H 3BTQE 3AAVA 2ZU5A 2YMSD 1KLTA 1TGBA 2PSYA 3UPEA 1EJNA 4ESTE 1YPEH 3UR6A 2AMDA 3QTOH 1BT7A 2QIQA 4ZMAH 3P95A 1O5BB 3BTTE 2UUYA 1DUEA 1TBQH 1Y8TA 1RRKA 1XKBC 4NSVA 1NU7B 1PPBH 2VNTA 2BD9A 2L6OA 3GDVA 4A92A 4UONA 7LPRA 1BTHH 2G81E 1YCPM 1NRRH 3GICB 1AI8H 1D3QB 3PRBA 3SGBE 4X8UH 1LQEA 2Q6GA 2K0QA 3BEFB 2ZF0H 3SQEE 2P3UB 1PPZA 2VVUA 5EJLA 3DHKH 1HCGA 5F8TA 1ANBA 1VKYA 4ZKOU 2BLVA 1HPGA 3K2UA 1IHTH 3ATMA 1FY1A 1TNKA 1O3IA 3TH4H 1JIMA 2FZZA 3BEIB 4TYDA 1G3DA 2FI5E 4X8SH 1O3CA 1O2KA 1DWEH 1C9PA 1LPKB 1PPGE 4KTUA 1P02A 3MWIU 1K9OE 4CH8B 2VINA 5CDFE 1KSNA 1K1PA 1B5GH 1HDTH 3MH4A 5T6GA 1C5LH 1ZOMA 4Y71A 3LGTA 1YF4A 3MI4A 2FS9A 6GCHG 1HJAC 4IBLH 1GCTC 1FJSA 3O8BA 5FXLA 2PHBA 4XSKU 1C2DA 1BRAA 3SUEA 1MCTA 2V7QD 2V0BA 1SGFA 1P03A 3ZZ9A 4A5TS 3PLBA 1HV7A 4RKOB 1S82A 4XBDA 4KTSA 1T4VH 2WSSD 1FNIA 3NRLA 2KCOA 2GCHF 1XUIA 3BTEE 4WMEA 1TGCA 2FXRA 3ZVEA 7ESTE 1AWFH 1AB9C 1O3HA 2TPIZ 3P8FA 2J34A 1IQMA 3K6YA 5DGJA 2OBOA 2J9NA 4U30A 1ZPZA 4F48B 1TNLA 2TGPZ 2VBCA 8LPRA 1F0SA 3M35A 1C1UH 2ZU2A 4VGCB 1RXPA 3QGNB 1W13U 3ZZBA 1SHYA 2J92A 2P3TB 3ZYDA 1MH0A 1QB9A 4SGBE 3LH1A 1W3CA 1MD8A 1T8OA 3MHWU 4GSOA 3KYGA 1Z1IA 5E0HA 1P2MA 1C5MD 3E0PB 2GCTC 3GY2A 1GDNA 1DT2A 3WWFA 1H4WA 1LMWB 4Q4LA 5FX5A 1GI7B 2TRMA 4A1TA 1BB0B 1HAIH 2VWMA 4A6LA 5J4QA 2HNTF 4KGAA 2OC8A 1FX0B 2PGQB 1K1MA 4JZEH 5EU8A 1M9UA 2A31A 2STAE 1E38B 1PJPA 4WF8A 2ZQ2A 3ODFA 2FLBH 4KKDA 3DSPA 1COWD 1TA6A 1W12U 1TPOA 1KXDA 1V2ST 1NFWA 4BAKB 3NCLA 5DP9A 2QA9E 1E36B 2PUQH 1TPPA 3SU1A 2W7SA 1ORFA 4AFSA 3UOPA 4X2WA 1BCUH 1C1VH 3T26A 2ZDVH 3B9FH 4ABIA 2J98B 4X1PU 2Z9JA 3F0OA 2Y5FA 1FDPA 2XBXA 3RXQA 4U01A 1GCTB 4HTCH 1NZQH 2FOEA 1YPKH 1GHAF 2J2UA 3SUGA 2D2DA 1ZHPA 1GL0E 4CRFA 1TALA 2G51A 1O3BA 2GDEH 2VJ1A 3F2FA 2OC1A 1ESTA 3MNSA 3K65B 1L1JA 1O2QA 3TGKE 2QAAA 4AFUA 4KTCA 3ZVAA 1FV9A 1LTOA 1ZMJA 2VVCA 2EI7A 1C5VA 3BG8A 1A5HA 1EUFA 1AO5A 1THPB 4NIWA 1DS2E 1TA2A 5JBTA 3AK5A 1P09A 1EATA 1IQKA 1TPAE 5F8XA 2IOTA 3BTGE 1XUFA 3L6PA 2G4UA 2QF4A 3SV2H 4BTUB 1A61H 1YGCH 4F55A 1YPHE 2W6JD 4MNVA 4B2BA 3ITIA 4NIXA 2QGRA 8ESTE 2BDGA 3WWBA 2C90B 2F9NA 3ATIA 4VGCC 3MH5A 1LCYA 1HUTH 1ANCA 1ELTA 2Z9LA 4FUHA 3RXDA 3BTHE 1MU8B 5CHAC 1K1LA 2OQ5A 1P04A 1IQFA 2AH4X 2BDIA 4XRNA 1HJ9A 3BTDE 2ZDAH 3U8TH 3KQBA 2GV7A 2VH6A 2JJ1D 1YPLH 1SGRE 1W7XH 1C4U2 1D6RA 1TX7A 4F4OC 1CVWH 1INCA 4AGKA 2YMSB 1ACBE 1ETRH 4YOJA 1ZMLA 4UFFH 1GJ4H 4WMDA 2ZFSA 3STIA 3OU0A 4OS2A 1ELAA 1C4Y2 3O8DA 4CRGA 2SGEE 1YYY1 5F03A 1T8LA 1HAVB 1GJBB 2D1JA 1O2NA 3M61U 3C27B 1ARBA 2D26C 1DY8A 4Y6DA 5PTPA 3MH6A 1NFUA 1BTWA 2WPKS 3RXFA 1O30A 1P2NA 3T62A 1ELDE 3S7HB 4Y8ZA 1QQ4A 1ZJKA 4UEHH 5CHAB 5T3HA 1NT1A 3ATKA 3ENSB 3MMGA 1A0HB 1IQEA 3NXPA 3JZ2B 1ELFA 4MDSA 1O2SA 1DE7H 2FOFA 3A8BA 3N7EA 4YT6H 1UVSH 5F8ZA 1E1RD 1P2QA 3MTYA 2FOBA 1N6XA 1BJVA 2F9BH 4KP0A 3EE0B 1CHGA 1BIOA 2Z9KA 4HG6A 2H6MA 1AGJA 4F49A 1GJ7B 1X7AC 3BTWE 4AG2A 2VU8E 1UO6A 3MO6A 1FI8A 3UIRA 3PB1E 3KL6A 4GVUA 1A5GH 1XVOA 1H9IE 1P01A 1O3EA 4TY7A 3NPSA 1Y5BT 2XRCA 6CHAC 2QF0A 1A7SA 1S6FA 2B9LA 2BZ6H 3NWUA 1O2LA 2BY7X 3KHVA 5HM9A 2LP6A 1TYNA 3T2NA 1V3XA 4CR5A 3TIUA 2GJGA 4CR9A 5E0GA 2OQUA 1FIZA 1NRQH 4D7GA 5CMXH 3F2HA 4Y11E 1DLKB 1A3BH 2W26A 3LGWA 1P3CA 2ZFPH 1SPJA 2BD7A 4A1XA 5FL7D 2OC7A 1ELVA 2CK3D 3RXEA 1LHGH 1OS8A 1ZLRA 2NU2E 4FVDA 1QFKH 3SN8A 2P95A 3Q00A 1TMTH 4HZHA 1HAYB 1VJ9U 1NY22 1XXFA 2KX4A 3RMMH 1BTPA 1FY8E 1BRBE 1NFXA 2R2MB 2BTCE 3RXSA 5FBIA 3H7OA 5LGOA 2J94A 1BMNH 4BAOB 1EJAA 3O8RA 1UCYH 3RU4D 3PMAB 3F9HA 1LPZB 1NPMA 1B0EA 3BF6H 2BY6X 1QL8A 2V3HH 3H09A 1SG8B 3SUDA 3QTVH 2BQ6B 2I6QA 3I78A 4BXSA 1RTFB 1GWAA 4IGDA 1C1MA 5B6LA 2CHAC 2D8WA 2P16A 4FUJA 4YLQH 1GBCA 2JIZD 5EODA 1J9CH 2F9OA 3M36A 2WV5A 1TABE 2KCYA 2GDDA 1SMFE 2KR7A 2PFEA 3P70B 1DSTA 4OS6A 1WYKA 2BD8A 2FMJA 2ODQA 3RUOA 1C1OA 1MAYA 1C5ZB 3OAAD 3PROA 1VITF 2EQNA 1P2OA 1GGDB 2GMTC 2BDHA 2FO9A 2FWWA 1Q2WA 1KXAA 1SGFG 1H8ED 1TB6H 1C5QA 4UFGH 3MO9A 2M2AA 5EQSA 3MQKC 1CE5A 4KELA 1UTQA 2GVFA 1Z6JH 3KNXA 1TGNA 1SQOA 3PTNA 4Y79A 1S6LA 3U8RH 3LGYA 5F53A 2FPZA 3T25A 1K1OA 4H6TA 4O3UA 3LC5A 1A5IA 1PQAA 5C1YA 2H9EH 4ISOA 3RXKA 4K8BA 2JJ2D 3OX7U 3E91A 3GCHB 1ARCA 3RC6A 2ZCHP 3SU3A 1O5GH 1O3DA 3NUMA 3U8OH 4U2WA 1O3FA 4RKJB 5HIZA 1S81A 1KXCA 4FETA 4AG1A 3GY4A 1NU9A 1QJ1B 3M7QA 2ZTZA 2A4QA 3ATWA 4WMFA 3NK8A 1EAWA 3PWCA 4ZAEA 1P9SA 1D3DB 1SBWA 1NO9H 4ACAA 1DICA 4X1NU 3FZZA 3MNXA 3SV7A 1TMBH 2RA3A 2LNCA 3SV8A 3AVZA 2CN0H 2J5UA 2KZ4A 1BRCE 1O3GA 1AFEH 1EZQA 4E7NA 1FAKH 3K6ZA 1WTHD 2GZ9A 3A8CA 2FI4E 4I8JA 3ZZ8A 5T6FA 1HB0B 2F83A 1THRH 3A80A 5F6MA 1DANH 1VGCB 2THFB 2ZGBH 4FUGA 2JETB 2PSXA 3ZZ4A 2GV6A 2TGDA 1UTNA 4H6SB 1WQSA 3CENA 1YPGH 4FVBA 1V2JT 3H5CB 4MNXA 2EA3A 1SGNE 1FMGA 2FLRH 4RN6A 5EJZA 1KY9A 1WSSH 4FU7A 2HPPH 1MTWA 3D49H 5GJ4B 1Y3YA 1IOEA 1O3AA 3I29A 3LGUA 5JBAS 1NM6A 2Z94A 2RFKC 2ZC9H 2VVVA 1EQ9A 1QQUA 3KYFA 1UTPA 4NZLA 2BD4A 1J16A 1CHOG 1QURH 3PV2A 2ANYA 1F5RA 1DSUA 3PO1B 1GVLA 2O8TA 3HPTB 3M3VA 4K1EA 4AORA 1OWKA 2BLWA 2QYIA 3SZNA 3TJNA 3V3MA 1C1TA 1ABIH 2VB0A 3HK3B 3V13A 3LH3A 3ZZCA 3IITA 3PM3A 3LDXH 3A81A 3RM0H 2VIVA 5TJXA 1W0ZU 2H9TH 2PUXB 3MNCA 4ISHH 5FAHA 2UUFB 4I8GA 2ZTXA 2QXHA 1GVZA 1T31A 1MMJN 2ZKSA 3RMNH 1YPHC 4Q7ZA 3VXFH 1HNEE 5C2ZA 1C1QA 2IPHA 2IJOB 3UNRA 2GCHG 1Y3VA 2IPQX 1T32A 2H5CA 3BSQA 3P8OA 2ZP0H 2XC4A 4FUIA 3OYPA 5EXNA 2FYQA 2XCFA 1EXFA 1KXEA 1EZSC 2UUJB 4AB8A 1J14A 5ESTE 1UHBA 2WPDD 2Z7FE 4AN7A 3HKJB 2O8MA 1BBRK 2GZ7A 1TOMH 5LPFA 2ZU3A 3RXCA 1D4PB 4XD7D 3E1XB 3UREA 1NBME 1O2PA 1O2HA 3HGNA 1ZYOA 3VB6A 1DM4B 3KCGH 2GZ8A 2ZEBA 4FXGH 1C2IA 1VITH 1VR1H 1NFYA 2XOKD 4TSFD 3CS7A 1L1GA 1DOJA 1Z71A 5HXFA 1GVKB 1GBKA 1O5DH 2AGIX 2CF9H 3FKSD 1MABB 2OINA 4MPXA 4YT7H 1SC8U 1UHBB 1DY9A 1SGQE 1PQ7A 4K1TA 2J98A 1LVBA 3W94A 1O2UA 3A87A 1S5SA 2CMYA 1BZXE 2FESH 3KGPA 1YCPK 1QIXB 1KDQA 2V3OH 1ELGA 2XYAA 1W2KH 4CREA 3QLPH 1GPZA 2NU4E 1GBFA 2PGBB 4DIHH 1GMHG 1EB1H 1T8NA 3F9GA 3HK6B 4WXVA 2FOMB 2ODYB 1QA0A 2XBVA 2HLDD 1V2QT 4WVPE 3L33A 2OD3B 3PLKA 1TBZH 5K0HA 2C8WB 1C2FA 2DE8A 3UTUH 2FOHA 5ABWA 2A1DB 5T6DA 1O5AB 3SGAE 4B74A 3A89A 4J2YB 3VGCC 2BM2A 2Y7ZA 1GMCG 1UVTH 4B6EA 3Q3XA 3RXBA 1C5PA 1CBWC 3FP6E 3ZZ6A 3RC4A 1GJAB 5DG6A 4ZKRU 4JZDH 4B71A 1QCPA 1VJAU 1GHYH 1T4UH 2ZHQH 1BMFD 1MCVA 1P11E 4NA7A 2ANMH 1YM0A 1FZZA 3QK1A 5EJ1A 2LPRA 1VCPA 5C5OA 2BZAA 3A8DA 4OM9A 3BIUH 5A8XA 1ELBA 3EYDA 1N8OC 5C1XA 1YPMH 1KTSB 4BXWA 1PQ8A 1WBGB 3UB0A 5DP3A 1LDTT 3UWIA 4JMYA 8GCHF 1LHCH 1AFQB 1FY4A 2PTNA 1WXRA 4TY6A 2HVXA 6LPRA 1P10A 5LPRA 1PPHE 2VWNA 1NROH 3KEEA 4ASHA 2WUCA 5A0BA 3ATLA 2GD4B 3A85A 3C1KA 4UD9H 2R9PA 3TGIE 1O5EH 1TE0A 1GHBF 3U1JB 3SW2B 3ZVGA 4IC5A 1W0YH 2B8OH 4Z1MD 5I46H 3CP7A 3RXAA 4BTIB 2K8IA 3UUZA 1EAXA 5E0JA 4GUXA 2WZQA 1O5FH 2WHXA 1NESE 1GHBG 2BDAA 2OLGA 3SHCH 2AMQA 3MH7A 4D76A 3DA9B 2A4OA 1ZHRA 2WINI 2ZI2H 1C5YB 1V2VT 2JH0D 2KAIA 3OFND 3VB3A 2EI8A 4OGXA 1DWBH 2JDID 1O37A 3LJOA 5DP8A 1G37A 1THSH 2PW8H 2AHME 1BA8B 1CA0C 3QDZB 1TQ7B 3E16B 8GCHG 2ZHFH 1XUGA 1DDJA 1L4ZA 2PTCE 2Y5GA 2ZFQH 4RT0A 4XDEA 3QO6A 4LZ4B 1HXFH 3BTKE 1BMAA 3GCNA 1OPHB 4P00A 1P57B 1C5WB 2Z3EA 1EOJA 4MPWA 1GGDC 3T5FH 3SU0A 1DLEA 2ZGCA 5EW1H 2HLCA 3KQDA 1LKAA 1SLUB 4Y8YA 1BQYA 1UVPA 4I8LA 1UTKA 3U9AH 4FUDA 3IG6B 4JZIA 4IMQA 3LONA 3BG4B 1NS3A 3RXTA 1KXFA 3SJOA 5AFZH 1J17T 2BOHB 3TJOA 1AE8H 2BXTH 3GS9A 2HALA 5G4BA 4ZUHA 1VCQA 3RU4E 3KF2A 4YLUA 3OY6U 1DITH 1GHWH 1ZTKA 1C2JA 1QY6A 1NBMD 1GJ8B 2F3CE 3LU9B 1CGIE 4BTTB 1C9TA 2FTLE 1GMHF 1YCPH 1GG6B 2QXGA 2RCEA 1AMHA 1TFXA 4JK6A 2W3KA 1MKXH 5EW2H 2GMTB 2B5TB 2R3YA 2VIQA 3QGJA 1GJ5H 2BDYA 1GI5A 2PLXA 1EP6A 3AASA 1BTUA 2QY0B 5DP5A 2ANKH 4Y76A 2VWLA 5DSFA 3U1IB 3DFLA 4I8HA 2Q6FA 5EPNA 1GJ9B 1AHTH 1GBHA 1W8BH 4ABFA 2PKSC 5E2OA 1SSXA 2C8XB 5FHTA 5C0TA 1Y3XA 6CHAB 2AEIH 3GCTF 2AS9A 3FZDA 3DFJA 1SGDE 4X2VA 3RXVA 5AFYH 1XKAC 2VIOA 1HIAB 5L2ZH 1O3JA 5L30H 4IN2A 1O3KA 2F91A 1P2KA 2ANWA 2JH6D 1XUKA 1TNIA 2Z3DA 4ZHLU 1A0LA 5A8YA 4BANB 4CRCA 4JYUH 2HVYB 1SQRA 2A2XH 1FN8A 4AC9A 3P8GA 1HYLA 2ZWLH 3SU2A 3TNSA 2P93A 1XUJA 1H8IH 5HGGA 1ANDA 1BMMH 2IJD1 2G00A 1A0JA 4MLFB 1EASA 2EEKA 1CT0E 2PV9B 1QRXA 2WV9A 3RC5A 3T29A 4X0WU 5HMAA 1ESAA 1SQAA 1O2OA 3A7ZA 4ZKNU 5BPEA 4WY3A 4I7YH 1F7ZA 3SNBA 1LVMA 1QRWA 1ZR0A 4GCHG 4INKA 3RDZA 5IYTA 3U98H 2C8ZB 1FQ3A 4ACBA 2UWLA 1KXBA 2QF3A 1A4WH 2W7UA 4AYYB 2FX6A 4P02A 1ZPCA 4ABJA 1BJUA 3SU5A 1SR5C 1Z7KA 2P94A 3SJ9A 3BV9B 4YM9A 1YY3A 1G30B 1SOTA 5IK2D 3GY3A 1F0UA 3M5OA 1OWHA 1TGSZ 1TNGA 3GYLB 3E90B 3RXRA 2P59A 1PPCE 1U6QA 1O34A 1WV7H 1V2RT 2LELA 3ELAH 4E7RG 1WCZA 3FFGA 2STBE 2RA0A 1O35A 1L2EA 4X6MA 4XOJA 1MU6B 3S9BA 1CA8B 2YOLA 3SYJA 1MKWK 2ZFTA 2XBYA 1P8VC 2K1QA 3SV6A 4FUEA 1MQ6A 5DP6A 1QGFA 1LQDB 2YNAA 1C1PA 1ETSH 1WUNH 2HWLB 3BTFE 1HBTH 4YO9A 1L4DA 1TWXB 2VWOA 1G3BA 3R0FA 3K9XB 2XBWA 1S6HA 2AYWA 3FN8A 4YXWD 3PWBA 5FBEA 1ZTJA 1BUIA 1C2KA 3GISB 2BXUH 5C5NA 1Q3XA 4MPVA 3F9FA 1KTTB 3CS0A 2TBSA 1ZJDA 1ZGIA 2JKHA
chains in the Genus database with same CATH topology
4NWKA 3HKIB 4Y7AA 1FY3A 2JH5D 1QB6A 1G3EA 5EOKA 3IWMA 1SOZA 2BB4A 2BD2A 1NC6A 1IQJA 1H9LB 1OKXA 1MUEB 2G4TA 5HM2A 3F6UH 3W95A 2M5TA 2HNTE 2Y81A 2BVRH 1SGIB 3VGCB 3KIDU 3SBKA 4NCYA 2PKAA 3O8CA 4CHAB 2ULLA 2CXVA 4UE7H 2ILNA 4OS1A 2QC2A 1JRSA 1ZPBA 1O32A 2Y6TA 4ISNA 3GY6A 1G32B 5BRRE 1UTMA 1AWHB 1C5SA 2FOAA 1E37B 2BQWB 4GLYA 3TNTA 3FP7E 3RP2A 2WPMS 2F9VA 4YTAA 1GJCB 1AQ7A 1EKBB 2ESTE 4FUCA 1SGTA 1YP9A 1PYTC 1HLTH 1UVOA 1XVMA 4OS5A 4LOYH 4YOIA 2YNBA 2A0QB 2V6NA 1G2LA 3GY8A 1L1NA 3R3GB 3QWCH 4TWYA 4B76A 2BX4A 2WPIS 3A7YA 1F92A 2ZHWH 3SUFA 1D3TB 3QX5H 1JBUH 2VIDA 1K1JA 1O2YA 3S7KB 4ABEA 2ZCLP 5TCCA 3S0NA 1O2XA 1YPJH 1EPTB 1P9UA 1Y3UA 4CRDA 3SNEA 2PR3A 1LO6A 4YESB 3TJVA 1GHAG 1P06A 1AE5A 1CT4E 1EJMA 4LK4A 1TRNA 3ZZAA 2JETC 4Q80A 2ZPSA 1O31A 1GI0A 3A86A 1JXPA 5K7RA 1TMUH 4D9QA 4Z6AH 4GCHF 1TRMA 4IW4E 2RG3A 1O39A 2ZFRH 3VEQB 1YLCA 5GWZA 3GOVB 5ESBA 2B0FA 1AIXH 1TGTA 1CSOE 1W11U 4Y0YE 3SNDA 1FXYA 1ID5H 1GI3A 2Z6BD 3ODDA 2J4IA 4Q7XA 4ABGA 4M7GA 1ANEA 4R0IA 4CH2B 4DVAU 3LGVA 2ZHEH 1TBRH 2NU1E 5CE1A 3EA8A 2A2QH 3VFEA 1FONA 4GAWA 2WYJA 2W3IA 1IQNA 4K3JA 1HIAA 4B2AA 1W10U 4B2CA 1QNJA 2PKAB 1S0QA 1NN6A 2ODPA 1SHHB 1EPTC 4X8TH 4DURA 1WTGH 1NRNH 5GDSH 4J1YA 3TITA 3V0XA 4K8YA 5EQQA 2ZIQH 2P8OC 1ZRKA 1DXWA 2ZO3H 4AZ2B 2VGCB 2HOBA 1E35B 2SNWA 1MQ5A 3RXHA 2TGTA 3UFAA 3RXUA 1ABJH 1P0SH 4ZH8A 1GMCF 2BDBA 3VPKA 1C2HA 3EDXB 2AGEX 4SGAE 1MBMA 1GHVH 3SQHE 2ZU1A 2BVXH 4INHA 1LVYA 1QJ7B 3D23A 1OOKB 2C4FH 1SI5H 4JZFH 1QL9A 4K1SA 3Q77A 2OXSA 3SO3A 4GHTA 3S9CA 5L6NH 4ZHMU 2BY9X 4ISIH 2ZDLA 2Y7XA 1FAXA 1XXDA 1UVUH 4TWWA 4AX9H 2C3SA 4AGJA 1YLDA 1BTZA 1XX9A 5TCAA 4Y8XA 1DFPA 3TJUA 1V2UT 1MTSA 3PLPA 3M7TA 4E06H 1FPHH 2A4RA 3AAUA 5GCHF 3RU4T 1GI4A 5DK1A 3EQ0H 2QV1A 2XTTB 3MOCA 3TPIZ 3PO1C 3A83A 1Q31A 5E2PA 2ZDKA 3VB4A 3B8JA 4CBNA 2A7CA 2ZGXH 1B7XB 1ELCA 1K1IA 1HXEH 4ABBA 2SGDE 4IS5A 2OP9A 3TLOA 2O8LA 1MKXK 2BVSH 2HGTH 3A7XA 2HNTC 1QB1A 2AERH 3M37A 2J95A 1QBOA 2WPLS 2ZNKH 1MAXA 2R2WU 3DUXH 2Z3CA 3LJJA 5DP7A 1O5CB 4XBCA 4FUBA 1BITA 3SORA 4Y10E 1RTLA 1QR3E 5A0CA 5DKMA 1IQIA 1C2LA 2WYGA 1O2ZA 2ZPRA 1H8DH 4IN1A 1WU1A 1O3LA 3B23B 4DW2U 2O8WA 2G8TA 1TNHA 3MU0A 1DXPA 1ZTLA 2CGAA 1UTJA 1RFNA 1HAZB 2BY5X 3LOXA 1QJ6B 1VCWA 1JWTA 4AYVB 4TPIZ 3SI3H 1BTXA 1OWEA 1SQTA 1K1NA 5J4SA 1YBWA 1C5OH 1SLVB 1CQQA 1F0TA 3MU8A 3ZZ7A 2ZDNA 2FTMA 1G2MA 1QA7A 1AB9B 4NZQA 1AD8H 4O9VA 2ZA5A 1SFIA 4DG4A 1KLIH 5LPEA 4YZUA 1CHOF 1EAUA 1O2MA 2IN2A 1G36A 1ZSJA 3LKWA 3OTJE 1D3PB 5JB8S 5AHGH 4AB9A 1TQ0B 3RXPA 3DD2H 4ABDA 2QN5T 2F9UA 5JDUB 1EP5A 4GPGA 1PFXC 4JK5A 2WV4A 1OWJA 2OCVB 1EPTA 7GCHG 5SGAE 1HAGE 3RLWH 4ZKSU 1HAXB 1AKSA 1RIWC 2VH0A 1SGYE 2C93B 1TIOA 1BBRE 1GHXH 1C5RA 2XNIA 1A1RA 1FPCH 3NKKA 1SL3A 3F1SB 3KQCA 4NFFA 2BX3A 1C5XB 3P92A 1UK4A 2Y80A 1XM1A 2G52A 1SGEE 1O38A 2SNVA 1GI8B 2ZGHA 4MQAA 1VGCC 4BAMB 2AIQA 4O97A 4X6OA 1AVGH 1GDUA 3EA7A 1SB1H 4NG9H 1IQGA 4I32A 1HAOH 1FLEE 1C2EA 2A5IA 1CGHA 4DOQA 1FY5A 1KLJH 4OS4A 1JIRA 3SJIA 1AVXA 2ZFFH 1QBNA 5HYOA 6ESTA 1O3PB 3SI4H 1TNJA 3GYMA 1T7CA 5FPYA 4INLA 1O2WA 1VZQH 1W14U 3PMBB 1A3EH 5DPAA 4THNH 1G3CA 3BG4C 3QN7A 2BLOA 4JCNA 1SFQB 3PMJA 2NU0E 2FYRA 1C1NA 4ZHAA 3URDA 1SGCA 1TOCB 1GI2A 1KYNA 2BY8X 5A2MH 1H9HE 1ZSLA 1C1RA 2XWAA 5C20A 3WY8A 1V2MT 4I33A 3ZZ5A 2TIOA 4BOHA 1BRUP 3FANA 3ZVFA 1CO7E 4WXIA 3PMHB 1C2GA 4K2YA 3ZV8A 1HAHH 1EZUC 1RJXB 1GBBA 1D6WA 3V7TA 4UFDH 2ZCKP 2P3FH 1TLDA 3LGIA 1OYTH 4B1TA 4NSYA 2O9QA 1CT2E 1MTVA 3AW1A 1MTNB 1TONA 4H42U 1JRTA 2ZZUH 2P8OB 1K22H 3EA9A 2Z9IA 1O2IA 3TGJE 2ALPA 2FS8A 3E3TA 1IQHA 5EXLA 2CJIA 3HGPA 1P12E 1GBJA 1L0ZA 1S83A 3RXOA 4OS7A 1MBQA 3RXMA 4FU8A 3UY9A 2BYAX 2QXIA 1C5UA 1WOFA 1V2PT 3BEUA 3OSYA 3A7TA 2H1UA 4DT7B 1UJ1A 1C1WH 1BDAA 2CF8H 4NA9H 3UR9A 3RXIA 4K60A 1Y59T 2H9HA 2XXLA 1JMOH 3UWJH 4BAQB 1O33A 1QRZA 1GG6C 1OP2A 2SGFE 4WH8A 1HGTH 1V2WT 3GCHC 1D9IA 1IQLA 4X6PA 1EX3A 1CA0B 2SFAA 2W5EA 3E0NB 1O36A 1V2TT 2AMPA 2FM2A 1PPEE 1GBTA 3VB7A 3FAOA 3P17H 2C8YB 4UFEH 2I6SA 2FEQH 3E6PH 4ZXYH 3KQEA 2ZHDA 4NFEA 2ASUB 2R0KA 1Y5AT 3M5LA 4MTBA 1P2JA 2FODA 1Z8JB 4CRAA 3Q76A 3SOSA 1TX6A 1T8MA 4ABHA 3SV9A 2PKSB 2WPJS 4IMZA 4OGYA 1S0RA 1AUJA 4U32A 4FUFA 4Q2KA 1GMDG 4YOGA 5JPMH 1OWDA 1Z8GA 4D7FA 3LT3A 2BDCA 1QL7A 4JZ1A 1UK2A 3MYWA 4D8NA 1O0DH 1QTFA 5I25A 2GTBA 5A8ZA 1DPOA 4NGAH 1TX8A 3RLYH 1W7GH 2BD5A 1SGPE 2GT7A 2BOKA 4JYVH 3L3TA 2AFQB 2UWPA 1Z8RA 4X6NA 1GBEA 1CGJE 4CHAC 1C2MA 1AZ8A 1AVWA 1GBMA 3MU5A 5A0AE 2UUKB 4E05H 4AFZA 1SVPA 1DVAH 1O3MA 5AVDA 1MZDA 1LVOA 3SJ8A 4WJG2 1Y3WA 4R8TB 1ZRBA 3BIVH 4Y7BA 3UQOA 4A7IB 1NRSH 4AOQA 3M3SA 3V12A 1E0FD 3UQVA 4B73A 1IAUA 1EAIA 3OY5U 5EGMA 1QHRB 1YKTA 2KAIB 2XC5A 3EAJA 2A45B 1F0RA 1ZHMA 3UNQA 1C5TA 4CBOA 5DO4H 4WWYA 3A88A 1K28D 7KMEH 1MD7A 1AZZA 2NU3E 1JOUB 1GI1A 2SGPE 4PROA 4HFPB 4ZXXH 3M3TA 2GGVB 5C1UA 1WAYB 3RXGA 4DY7B 1WQVH 2R3UA 2B7DH 5JBBS 1A46H 1ETTH 3A82A 2GX4A 1S85A 2GCTB 3VXEH 4HGCA 3ZYEA 1HAPH 1GI6A 1BOQA 1OSSA 2BLQA 5GCHG 2XCNA 5L2YH 1ELEE 3SU6A 5JYIA 1ZSKA 2A32A 1OP0A 1EB2A 2CV3A 1AUTC 1O2RA 2TGAA 2WPHS 4AFQA 1C1SA 4I31A 2VIPA 1Y5UT 2G55A 1P3EA 5GXPA 2ZG0H 1OXGA 2Q6DA 3ESTA 1OX1A 3H7TA 4DCDA 5DP4A 3M5NA 3NZIA 1LHDH 1O3OA 4XE4A 3HATH 4D9RA 2SGAA 5EXMA 4I8KA 2FIRH 5JB9S 3TVJB 3ZZDA 3E8LA 3ZVBA 3PYHA 3UNSA 5A09A 4UDWH 4FU9A 4GHQA 1GMDF 2Z9GA 5JBCS 1F2SE 4IC6A 1DWCH 2BHGA 1BHXF 2XW9A 2OC0A 1CU1A 1VITG 1RS0A 2A7HA 3FP8E 3LPRA 3JZ1B 4X8VH 3A7WA 5GPIB 2FP7B 1OP8A 2V35A 2DUCA 3TK5A 1ZGVA 5EPYA 1MTNC 3BTME 5IDKA 4WH6A 1N1LA 1V2OT 3RXLA 3D62A 2J38A 9ESTA 4MG3A 3G01A 4MPUA 1G9IE 1RD3B 1HJAB 1PYTD 1KIGH 4JYTA 3MFJA 3GDUA 1UK3A 1GI9B 5E8EH 2ZTYA 1NTPA 2A5KA 1V2LT 3KN2A 1ESBA 4O03A 1UTOA 1F5KU 1DUAA 1IHSH 3A7VA 3A8AA 3ZVCA 1XUHA 1Z8IB 3SNCA 2FX4A 1AN1E 1TPSA 3GCTG 1S84A 1GHZA 1GBIA 1MTUA 1AFQC 4NWLA 2AGGX 1FIWA 2HPQH 3M7UA 1NRPH 3A84A 1O2TA 1O2VA 3TH2H 2AIPA 4Y0ZE 1GBLA 4ISLA 3U69H 2GT8A 1GJDB 1GBAA 1AKSB 3SNAA 3P8NA 3GDSA 3DT0H 4Z0KA 3F9EA 3ZV9A 1GBDA 1V6DA 1Z1JA 3QUMP 1RTKA 4DIIH 5H4IB 4K69A 1AY6H 3AW0A 3LIWA 2FDAA 4A1VA 1UTLM 2ZU4A 5FCRA 3SJKA 1EZXC 1GDQA 4DGJA 1K21H 4B75A 1BMLA 1LHFH 8KME2 2EI6A 1Z6EA 2BMGB 1SLXB 3D65E 2NWNA 2VGCC 1CBWB 2H2ZA 4X2YA 3SGQE 4HI3A 1MZAA 1QBVH 1UCYK 2CHAB 1LPGB 2RDLA 2FOCA 3T28A 4TPYA 3RM2H 3RXJA 6GCHF 1HAVA 2ALVA 1HRTH 1HFDA 2GKVE 3PTBA 1YC0A 2Y5HA 2BQ7B 1K2I1 2OBQA 1J8AA 4X1SU 1TAWA 4BNRA 5DJ7A 3RMLH 2QCYA 2XC0A 4H4FA 1UCYE 1LKBA 1O3NA 1F5LA 1P05A 3SU4A 4NIYA 5FX6A 3TK9A 2Y82A 3QZQA 3MU4A 2OTVA 1RIWB 1H1BA 2G5VA 2A5AA 1GJ6A 2VIWA 3MU1A 1DWDH 5FPSA 3I77A 1DX5M 1UMAH 2Q1JA 1ZZZA 3STJA 3BN9A 4ABAA 1MKWH 4MNYA 3PV4A 5EQRA 2A4GA 4MVNA 3N7OA 2SGQE 3UOUA 3GY7A 1PPFE 3RMOH 2ZECA 3F68H 2DE9A 2FI3E 4X2XA 1AU8A 1FUJA 3FVFB 4O3TA 1BTYA 2ZQ1A 4MNWA 2UWOA 3MNBA 4DJZB 5FCKA 1GCDA 4XBBA 5GIBA 4LZ1H 3ZVDA 5ETXA 1O2JA 4XFQA 4BAHB 5C67A 1B0FA 1C4V2 1HJ8A 1LHEH 1KDQB 2G5NA 3VB5A 3TH3H 1O2GH 4K5ZA 1TRYA 2F9PA 1E34B 2R0LA 3EGKH 5LH8A 4NIVA 1OWIA 2ZGJA 3URCA 2PWXA 3Q3KA 1BHXB 1EOLA 1GL1A 2GP9B 2OUAA 4Q7YA 2WUBA 1PQ5A 1XMNB 2A7JA 3Q3YA 1FN6A 1V2KT 4NA8A 2QXJA 5AF9H 1V2NT 4X1QU 2BD3A 2ZDMA 1P2IA 7GCHF 5C3NA 3QZRA 1N6YA 1C5NH 9LPRA 2H5DA 1ZMNA 3M5MA 3GCOA 4QT8C 3TU7H 4RSPA 4X1RU 2ZPQA 1BBRH 4CRBA 3P6ZB 5EG4A 2FOGA 3TK6A 2HRVA 5B6OA 3LC3A 3S9AA 1N8OB 1SLWB 1RGQA 3GY5A 2O8UA 3S69A 3T27A 1A2CH 3MO3A 2XWBI 4ZROA 3ZZ3A 5FPTA 1OYQA 1J15A 4LXBH 3SHAH 2EC9H 3BTQE 3AAVA 2ZU5A 1KLTA 1TGBA 2PSYA 3UPEA 1EJNA 4ESTE 1YPEH 3UR6A 2AMDA 3QTOH 1BT7A 2QIQA 4ZMAH 3P95A 1O5BB 3BTTE 2UUYA 1DUEA 1TBQH 1Y8TA 1RRKA 1XKBC 4NSVA 1NU7B 1PPBH 2VNTA 2BD9A 3GDVA 4A92A 4UONA 7LPRA 1BTHH 2G81E 1YCPM 1NRRH 3GICB 1AI8H 1D3QB 3SGBE 4X8UH 1LQEA 2Q6GA 3BEFB 2ZF0H 3SQEE 2P3UB 1PPZA 2VVUA 3DHKH 1HCGA 5F8TA 1ANBA 4ZKOU 2BLVA 1HPGA 3K2UA 1IHTH 3ATMA 1FY1A 1TNKA 1O3IA 3TH4H 1JIMA 2FZZA 3BEIB 4TYDA 1G3DA 2FI5E 4X8SH 1O3CA 1O2KA 1DWEH 1C9PA 1LPKB 1PPGE 4KTUA 1P02A 3MWIU 1K9OE 4CH8B 2VINA 1KSNA 1K1PA 1B5GH 1HDTH 3MH4A 5T6GA 1C5LH 1ZOMA 4Y71A 3LGTA 1YF4A 3MI4A 2FS9A 6GCHG