2SFAA

Serine proteinase from streptomyces fradiae atcc 14544
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
191
structure length
191
Chain Sequence
b'IAGGEAIYAAGGGRCSLGFNVRSSSGATYALTAGHCTEIASTWYTNSGQTSLLGTRAGTSFPGNDYGLIRHSNASAADGRVYLYNGSYRDITGAGNAYVGQTVQRSGSTTGLHSGRVTGLNATVNYGGGDIVSGLIQTNVCAEPGDSGGALFAGSTALGLTSGGSGNCRTGGTTFFQPVTEALSAYGVSIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEINASE
publication title Purification, characterization, primary structure, crystallization and preliminary crystallographic study of a serine proteinase from Streptomyces fradiae ATCC 14544.
pubmed doi rcsb
molecule tags Hydrolase
total genus 49
structure length 191
sequence length 191
ec nomenclature ec 3.4.21.-:
pdb deposition date 1994-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sfaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sfaA01
4YOJA 2R3UA 2ALVA 1O36A 3M37A 2W3KA 4X6PA 4YT6H 1XUKA 3ZZ7A 1O32A 1T7CA 1ETRH 2Z3DA 1O2KA 2WV4A 3GCTG 2AFQB 1UK2A 4Y8XA 5HMAA 3BEUA 4Y0YE 2P95A 3B8JA 4IGDA 2JETB 1TNIA 3A81A 1HBTH 4IC5A 2ZFFH 2EI7A 2ZFPH 4JZ1A 2Q1JA 4JK6A 2OD3B 3T29A 1C1QA 4NA8A 3EE0B 1TQ0B 1ZHMA 4X6NA 1SQOA 1O2SA 4ZHLU 1SBWA 2ZZUH 3RLYH 2B8OH 2BQWB 4ISHH 5GJ4B 5DPAA 1FY4A 2G51A 4Z6AH 5L30H 1MU8B 2F83A 5GIBA 3GDSA 1ZLRA 3QUMP 1LMWB 3ODDA 3TJNA 4AYYB 1C2JA 2HWLB 5C67A 2PKAA 2W3IA 1O2RA 1KXFA 2ANYA 2YNBA 3RXSA 1LCYA 2D2DA 5EQQA 2ULLA 3ZZ4A 4NCYA 1RXPA 2VVVA 4MNVA 1BB0B 3ATKA 2SFAA 3BTTE 1Y5UT 1C1TA 1DICA 3TGJE 2XNIA 1C5XB 2CV3A 3T5FH 1BHXF 4X1SU 1ANEA 1HYLA 1MTNC 3D49H 3BG4B 1KLJH 1BTUA 4MDSA 3LJOA 1OYTH 1O3OA 2FS8A 2ZDLA 3RMLH 1P03A 2OC0A 1SOZA 1C1VH 1IQIA 2ANWA 1SQAA 3E16B 2R0KA 2VVCA 2A2QH 1HLTH 1VGCC 3A8BA 4Y7BA 1W3CA 2G5NA 1V2ST 2BD8A 4ABBA 3QGNB 4XBCA 2VGCC 1W2KH 3EA9A 2ZGBH 1AFQC 1P06A 3A8AA 2VIVA 3CS0A 3RXUA 1UTQA 1EJAA 2P59A 4ZHAA 1Z8RA 4GHTA 1AQ7A 1BMAA 8GCHF 1AY6H 2QXIA 4FUDA 5SGAE 1BIOA 1KXCA 1C5PA 1C1RA 4K8YA 2OXSA 2KAIB 1A0LA 1MTNB 1IQKA 3RXMA 1SGYE 2VWMA 3M3VA 4WXIA 2PTNA 1O5EH 1SPJA 3UR6A 1GJ6A 1DWEH 3KN2A 2ZQ1A 1NY22 2ZECA 3BIUH 2OQ5A 1CHOF 3SU1A 2SGQE 1O2NA 3N7OA 1BDAA 1N6XA 1JMOH 1KSNA 1OOKB 2A31A 1A46H 5DP9A 3ZZBA 4FXGH 4A1VA 5I46H 1OSSA 3HKJB 1OWEA 1O5AB 1TIOA 2C90B 4NGAH 3P92A 1C2MA 1N1LA 2C8YB 4R0IA 2ASUB 1LPGB 3FFGA 1THPB 2GCHG 2TGAA 1K1PA 3TJUA 4Y10E 1FAXA 2Q6DA 4FU9A 3M3SA 1QL8A 1MTVA 1MAXA 4X6MA 2ZG0H 4NZQA 2QAAA 5L2YH 2QGRA 1K1MA 4D7GA 3V3MA 1WBGB 1AUJA 3PLKA 1HXEH 1F0SA 3QZQA 3UNQA 1ELVA 3LDXH 2H1UA 2B0FA 2ZO3H 3K2UA 1NO9H 1YP9A 1GDUA 2GT7A 1UVOA 2BLQA 3HK6B 1UVUH 1KIGH 1YPJH 2PLXA 1TNJA 2ZPSA 5A09A 2BY8X 1NFWA 3G01A 4CBOA 2AGIX 1YC0A 1ETSH 1LVOA 3LU9B 2PUXB 2A45B 3T26A 4DVAU 4FU7A 1C5NH 3I78A 1EAWA 3VB4A 4I32A 2J95A 1OXGA 1N8OC 2CGAA 1SVPA 4NZLA 1GBLA 2ANKH 2BQ6B 4GCHG 4WMEA 2XW9A 5EU8A 1V2NT 3KQEA 4GVUA 1AE8H 2G4UA 4I31A 3E6PH 2FO9A 1FY5A 1XKBC 3L3TA 1O2VA 1QR3E 1GHYH 2TBSA 3PLPA 3U1IB 5JPMH 3LONA 2BDYA 2BM2A 1D6RA 3HK3B 2I6SA 2RA3A 3ATMA 3DT0H 3LJJA 1O37A 1DANH 2ANMH 4IS5A 2PUQH 4WF8A 1QFKH 2BDIA 3MH7A 4K1SA 3E1XB 4WWYA 4GSOA 4RSPA 3VB7A 3ZZ9A 1C9PA 1P57B 3ZVGA 3DFJA 5IDKA 2UWOA 5C5NA 1MZAA 3AVZA 4B74A 1FV9A 1N8OB 4RN6A 2BD2A 3EA7A 2ZDMA 5L2ZH 5FX5A 8ESTE 1GMHF 2FDAA 1GBBA 3K9XB 2UUJB 1GI4A 1C4V2 1HJ8A 1B7XB 2VIDA 3FAOA 3SUDA 1XVMA 4UFFH 5FPYA 5EXLA 1W7GH 1XUJA 1P3CA 4I8HA 2ESTE 2CF8H 4YOGA 2ZWLH 3LC5A 1AWFH 1M9UA 3TITA 1F0TA 4FVBA 5DP5A 4VGCB 3OU0A 2LPRA 1NS3A 4AGJA 1KYNA 1TFXA 1PPFE 1UTPA 5AHGH 2PSXA 1O2LA 1TPAE 1YF4A 4THNH 2HNTC 1GL0E 2GMTB 1EB1H 4NWKA 1PPHE 1GBDA 3RMOH 1FONA 2TIOA 3S7KB 2Z9KA 5HGGA 4AG2A 1AD8H 3BTWE 2H9TH 2OCVB 1PFXC 1HAIH 1Z6EA 3GY3A 2FTLE 3V12A 1WSSH 2ZHDA 1QL7A 1S85A 1ORFA 1QTFA 3F9FA 4ISOA 3SGQE 5EPNA 1TRNA 1T4UH 3QLPH 2ZPQA 1DITH 1DWBH 1U6QA 3PO1C 1PPEE 1HAZB 1EZQA 1BZXE 3A8DA 4OGXA 4B76A 1FMGA 3ENSB 2BDGA 3R3GB 1SG8B 3A7YA 3GY5A 4Z0KA 1XMNB 1TNGA 1CVWH 2G8TA 4XSKU 3BEIB 1UMAH 1HRTH 2HALA 1G3BA 1S6FA 1Q2WA 1SI5H 3SNCA 2BVSH 1BCUH 1C5MD 6CHAC 3TK9A 2NWNA 3PLBA 4A5TS 2PV9B 1LVMA 6GCHG 1ELFA 1DXPA 3URDA 5EW2H 4BAQB 3VXFH 1NFUA 1TABE 1IQJA 2FX6A 3MNXA 4MPXA 1BRCE 2BY6X 4OS4A 5C1XA 3P70B 1BTZA 5LPRA 1A5GH 1ELTA 2PGQB 4H6TA 1CA8B 3OYPA 3AW0A 4D9QA 1FPHH 3PYHA 1A1RA 1QCPA 4AFSA 3LGWA 3SORA 2D26C 1NESE 3S9CA 4ZXYH 4JK5A 1P04A 2CXVA 1IQFA 1TGCA 1GI6A 4ISLA 1ESBA 2Z9JA 3TVJB 3SU3A 1J14A 3PTNA 1SLXB 1V2UT 2QIQA 1E38B 1YPKH 3KHVA 4TPIZ 1DSUA 3A82A 3C27B 2ZNKH 2FYQA 4HFPB 2ZCLP 1YPLH 1GG6C 2AEIH 1BUIA 2UUKB 1GBFA 3E8LA 1GJDB 2GCHF 4MNWA 4ZHMU 3SQHE 4JYVH 3P8NA 1SGTA 1NRRH 5J4QA 1D9IA 1EAXA 3MH6A 5FAHA 1TGSZ 1OWHA 3MH5A 5DKMA 2A32A 1EP6A 2FYRA 3LGTA 1O39A 3DFLA 5F8ZA 4X2YA 1IHSH 2BDAA 2GV7A 3E90B 3CENA 4Q80A 1C4U2 1JIMA 1GBTA 3C1KA 2M5TA 1P2NA 1O3GA 2BB4A 5T6FA 1ESAA 1SLWB 1IQLA 1XM1A 2BVRH 1J16A 1HIAA 9ESTA 1TBRH 1SB1H 1BMNH 3RXPA 1SGFG 1SHHB 1GG6B 1S81A 4ABEA 3UOPA 2AS9A 2ZDNA 1T32A 5E2OA 1GJCB 1BBRH 1CT0E 1GI3A 3SW2B 3VEQB 2A7JA 2ZFRH 1BJUA 1ZMLA 1SMFE 2SNVA 4OS7A 2H6MA 3KEEA 3K6YA 3TH2H 4X8TH 2BX3A 1T8NA 2F3CE 1CGJE 3RXBA 1BBRE 1LTOA 1GMCF 1CBWC 1TMBH 3RM0H 3T25A 1MCTA 3A89A 1KTTB 2JH5D 3RXQA 1MD7A 5FCKA 1UTOA 2OTVA 4B71A 1BRAA 1E37B 3E91A 1OP2A 1QBOA 1T8MA 4O3UA 1HAOH 3L6PA 1EPTA 3RP2A 2HRVA 4UD9H 5CHAC 1EPTC 1GDNA 1LHDH 1E34B 2BD3A 2ZGCA 3UNSA 1ARBA 1HIAB 1QRXA 2ZU5A 5C1UA 1W0ZU 1SGIB 3BTME 1QNJA 4A1TA 1P2JA 1QHRB 2GP9B 3SO3A 2XCNA 1W0YH 3P6ZB 1G3CA 3SV2H 2GGVB 2VWLA 2ZFSA 3MI4A 5FXLA 1Z71A 1DM4B 1GHBF 1O2WA 1C1OA 5FBIA 2XRCA 1PQ7A 1CBWB 3GCHB 4AZ2B 2V6NA 4IBLH 3SNAA 3SNDA 5BPEA 1LQEA 3SV9A 1ZPZA 2GTBA 1B5GH 1TMUH 3PMHB 1NM6A 4DW2U 1FLEE 1L0ZA 4AB9A 2P8OC 2F9BH 3MTYA 5C3NA 1VITH 1LQDB 2TGPZ 4ZKSU 5CHAB 2BOHB 1QB9A 3TGKE 1KTSB 1P2OA 2W5EA 2BHGA 3U69H 1C5VA 1P2IA 1F0RA 2BYAX 2HOBA 1L1GA 2BZ6H 3NWUA 2F91A 3ZZDA 1GL1A 1EZSC 2W7SA 3HKIB 1MKXH 3MNBA 3SV7A 4D9RA 2Y6TA 1QA7A 2BTCE 3UY9A 3OTJE 1AVGH 1XXDA 2HVXA 2V35A 1XUIA 3LGYA 3SV6A 2WPKS 1QY6A 2FIRH 1YM0A 1HAHH 1DFPA 1O3BA 2O8TA 3Q3KA 4XBBA 5B6OA 2AIQA 4H4FA 4CREA 7LPRA 4UDWH 3EYDA 1DVAH 2QXGA 1DY9A 3GICB 3RXRA 4IC6A 2BD5A 3RXCA 4YM9A 4IN1A 3TK5A 2BZAA 1TA2A 3PWCA 2P8OB 3Q00A 2EI6A 2QXJA 1TNLA 2P3TB 1GHZA 1GMHG 3GCOA 3H7TA 4OS2A 4F49A 3SHAH 1K1NA 2OINA 1FIZA 3BTFE 2VJ1A 4ZKRU 3H5CB 2NU4E 1E36B 3L33A 2A2XH 1MQ5A 2FP7B 1GBHA 1AZZA 1WU1A 4AFUA 1ELDE 2Z3EA 1XXFA 1Z8IB 3BG4C 3F9HA 1ZHPA 4TYDA 1D6WA 1O5DH 1AMHA 3SUFA 3ODFA 1O3DA 3DUXH 6GCHF 1C1UH 2QA9E 1DY8A 1GHAF 1QBNA 1LVYA 1K1LA 5EPYA 1A7SA 5IYTA 2FOEA 1NC6A 5A8XA 1K1OA 2FS9A 4X1PU 1D3TB 2ZHQH 5G4BA 1A0HB 2A5KA 3MOCA 1RJXB 1LKAA 2TRMA 2ZFQH 3EA8A 4CR9A 2XBWA 3SHCH 1H8IH 1L1JA 1ZTLA 3NXPA 1TGTA 5E0JA 1O3IA 3NUMA 1H9IE 1TWXB 1GBCA 4AX9H 4ZMAH 4LOYH 3AAUA 1OWJA 1ABJH 1BT7A 3Q77A 1PQ8A 4Q7YA 4KELA 1SLVB 4X8VH 1SR5C 3V7TA 4KTSA 2KAIA 1G37A 4YO9A 5A0AE 5LGOA 4BXSA 1GI9B 5E0HA 2OC1A 4K60A 1C9TA 5JBAS 2FI3E 1A2CH 2O8UA 2AYWA 3F1SB 1MKWK 2VIQA 1ELAA 3IITA 4JZIA 4MQAA 3M5LA 3GDUA 1WYKA 3U9AH 1AIXH 1O31A 4GAWA 4HZHA 4NA7A 3W95A 2ZGHA 5C20A 1GJ8B 1C4Y2 1QURH 3RC6A 7ESTE 3DA9B 1OX1A 1G30B 4BTIB 2ZC9H 1GI5A 1GJ5H 5C5OA 2QF0A 5FBEA 3ZV8A 3MHWU 4Y0ZE 1MUEB 4KKDA 3RXAA 3SUGA 1Y3YA 1AE5A 1GJ4H 1Z1IA 1GMDG 1E0FD 3M36A 4INHA 4JCNA 4OS5A 3LKWA 3ZVFA 4FUHA 4DT7B 1ZHRA 5GPIB 1RFNA 4FVDA 1GPZA 5PTPA 1DLEA 1VR1H 1O5BB 4BOHA 4ABDA 3M5MA 1WTGH 2ZHEH 4I33A 1GI2A 1MZDA 5JB8S 1O2JA 1QA0A 2WINI 4X2VA 2A0QB 2OUAA 2BMGB 4TPYA 4ISNA 1DT2A 1MMJN 2FXRA 2XC5A 4YZUA 4XE4A 2ZIQH 3LIWA 1ABIH 1V2JT 2J92A 2WUBA 3M61U 1BTYA 2BXTH 3ZZ6A 2W7UA 1UTNA 1LKBA 1VITF 4B2AA 1AKSB 1OYQA 1TX7A 1C2DA 2ZCHP 4DOQA 1GWAA 1DLKB 4FU8A 2YOLA 4FUIA 3JZ2B 5DG6A 1FDPA 1FN6A 1O0DH 1P9UA 4BTTB 1G36A 3TPIZ 5GXPA 2FOBA 2IJOB 1O5GH 2DE8A 1MAYA 1D3DB 3ZZAA 1L2EA 1G3DA 4Y11E 5LH8A 2XBXA 3P8OA 1HFDA 1EP5A 2QY0B 5GCHG 3GY6A 4F4OC 4YESB 2GZ7A 1Q3XA 4A92A 4NFFA 1O3LA 1O2UA 5GWZA 1O3EA 2GD4B 4WMFA 3A7TA 5DP3A 1O35A 1RRKA 4DJZB 3SU5A 4YT7H 1O2GH 1KXEA 1Z8GA 4TY7A 2BXUH 2CJIA 4ZXXH 1C5TA 2WUCA 3IWMA 1UHBA 3LH3A 4JZDH 1T8LA 1O3AA 4Q7XA 1ZR0A 3SNBA 3ZZ5A 2EC9H 1A0JA 1UTJA 3SJOA 3ZVBA 1KLTA 3BN9A 3RXOA 1F2SE 2GCTB 1MH0A 1F0UA 3RXHA 1GMCG 3IG6B 5AFZH 1G2LA 4FUJA 3KQCA 2XBVA 1V2VT 1C5SA 2FESH 1DE7H 1QJ6B 1EAUA 4B1TA 5DP4A 1S82A 1ANDA 4BTUB 4VGCC 2R2WU 3GY4A 1ZMNA 2FI5E 1RTKA 3MU0A 4ESTE 1V2TT 4ABIA 4H6SB 1Z7KA 4NFEA 3SU0A 2Z7FE 2SGDE 1O3CA 3M35A 1UHBB 5TCCA 7KMEH 2FOMB 1GHVH 2SNWA 1EQ9A 1K9OE 1ZRBA 1LPZB 1Y3UA 2GMTC 1F92A 3PMJA 3KL6A 1DOJA 1OWKA 1EXFA 3V13A 1ZTJA 7GCHF 1GHBG 1O3FA 2H9EH 1K28D 1P3EA 3R0FA 3ATWA 4Q2KA 4CBNA 3RXDA 1O2HA 4WH8A 4GUXA 2GDDA 1HPGA 1O5CB 1MCVA 1HXFH 4NIXA 1K1IA 2BLWA 3TJVA 5FCRA 1ZPCA 1IQNA 2FPZA 3A8CA 1JBUH 4A6LA 3ZYDA 4XOJA 1ZGIA 1C5ZB 2ZFTA 1KY9A 1AGJA 1IAUA 1N6YA 2CHAC 1UVSH 2ZU1A 1C5UA 2Z94A 3SGBE 1HAPH 1P12E 2ZU2A 2P94A 4UFEH 3ZVDA 3AW1A 1D3QB 3QTVH 3ATLA 3AAVA 3UIRA 4MNYA 1BBRK 2J94A 2B9LA 3FP8E 2I6QA 3KGPA 5ESTE 1AZ8A 4NSVA 3T2NA 2OBOA 4RKJB 2BD9A 3BIVH 1AI8H 3SQEE 2GZ9A 1BTWA 1BRUP 3B9FH 5TCAA 1UK3A 1K22H 4CR5A 4CH8B 5ESBA 4UE7H 3SU2A 2A1DB 2OP9A 2QN5T 2UUFB 4IW4E 1FXYA 1ZZZA 4UFDH 4X1RU 4NG9H 1S6HA 4INKA 2CHAB 3UUZA 1FAKH 1ZYOA 1YYY1 3PWBA 2G4TA 3A7XA 4Y71A 1GMDF 1BMLA 1EX3A 2F9NA 3UOUA 1ZPBA 2C93B 3BTDE 2ZU3A 2HGTH 1O38A 2Z9IA 1P2KA 1O33A 4MPWA 1ZSKA 2ZU4A 2Y81A 3U8TH 2OC8A 4B75A 3D23A 4QT8C 4X2WA 5A0BA 1PYTC 2Z9GA 4SGAE 1GHAG 1V2RT 3RXIA 2A4OA 1TX6A 3GY8A 1D3PB 1YCPH 2DUCA 3VPKA 3F6UH 1O2YA 2BVXH 1BTXA 2H5CA 1H1BA 1UCYH 4DURA 4YLUA 3UWJH 3BF6H 4I8LA 2Y5GA 1AO5A 1UTLM 3HGNA 2PGBB 2QF3A 1AWHB 5AFYH 1W14U 3RUOA 1UCYE 2HNTE 1SHYA 2K1QA 4WMDA 4E7NA 1O2OA 1LHGH 4RKOB 4AN7A 1AVXA 1SC8U 1SGNE 3PM3A 5TJXA 1V2MT 1FN8A 1GBAA 2GV6A 1NRPH 3RLWH 1P2QA 3MH4A 4X1QU 3A7VA 1MKXK 3GYLB 1C2FA 2CN0H 3OX7U 5JDUB 1Y3WA 2RDLA 1PPBH 3ELAH 4X0WU 2ZI2H 3TH3H 2PR3A 4BAMB 5GCHF 2LNCA 2VIWA 1DWCH 2PFEA 3RMNH 1KXAA 1V2PT 3EDXB 1BMMH 1CQQA 5LPFA 1FY1A 1F5KU 4ZKOU 3RXTA 1ARCA 1P11E 3A7WA 3FVFB 2ZGXH 3UPEA 1ZTKA 1HB0B 2WPJS 1C1MA 1CT2E 1DWDH 4ZKNU 1GVLA 1ZMJA 2FTMA 4O03A 5EXNA 1H9LB 4BXWA 1C2HA 3A87A 1G2MA 2VWOA 1SQTA 1C1PA 4OS6A 1LPKB 1O3HA 2GVFA 2O8MA 4JMYA 1NFXA 2A4GA 2J34A 1BHXB 1SGQE 2Z3CA 1D4PB 4DGJA 1GJ9B 5HM2A 1A5HA 3A7ZA 2YNAA 3FANA 4U2WA 4WVPE 4AOQA 1HAXB 2SGPE 1QJ1B 3VB5A 1MBMA 5EW1H 3Q3XA 1QJ7B 4ABAA 3S9BA 1SFIA 4K1EA 4J2YB 2UUYA 5DP7A 2WPHS 1EUFA 3VB3A 1TPOA 1VITG 3GCHC 3P17H 3GCNA 1RD3B 2BX4A 3I77A 4X2XA 2A7CA 2FMJA 2V3OH 2ZTZA 5JBBS 3TNTA 3DD2H 4MPUA 2P16A 1INCA 2BLVA 3GY7A 1AU8A 2ZKSA 3GDVA 5K0HA 1HJ9A 1W7XH 1W10U 1YCPM 1QB6A 2BDHA 5T6GA 2BD4A 2H9HA 2ZGJA 1RS0A 1VCPA 1THSH 1Z6JH 3MWIU 4CHAC 2G81E 1J9CH 4UONA 1CGHA 4WJG2 3PROA 1QQ4A 1BJVA 1DUAA 3M3TA 3MNSA 2BD7A 5BRRE 1PQ5A 3M5OA 5C1YA 3ATIA 1V3XA 4OGYA 1O3KA 1S84A 1V2LT 1QRZA 4X8SH 2ZTXA 1WOFA 1O2QA 2Y7XA 1GHWH 4D7FA 5JBCS 4CRGA 3UNRA 4LZ4B 1PPCE 1OS8A 3FZZA 2VVUA 2C8ZB 3RU4E 4Y8ZA 2ZTYA 1GI8B 3TNSA 1GI1A 5DK1A 2Y82A 1HAVA 2G00A 3K65B 4E06H 1Y5BT 3Q76A 4X8UH 1ELCA 1XUHA 3ITIA 4BAKB 1ANCA 4K3JA 3H7OA 1TA6A 3ZYEA 2GX4A 3HPTB 4CHAB 2NU3E 3EAJA 3OY5U 1YKTA 1C2EA 1Y3XA 1C2LA 1DUEA 1IQMA 1GCTC 1CE5A 1BA8B 1NFYA 3FP6E 4I7YH 1GVKB 4OS1A 2J38A 5T3HA 2HNTF 4H42U 1EOLA 2FLRH 3BSQA 5CMXH 4MG3A 3QGJA 2A4QA 1L1NA 1XVOA 3SU6A 1ZOMA 2BLOA 3LOXA 1V2WT 1O3PB 3WY8A 2JH0D 3SJ9A 2Y7ZA 2DE9A 1P05A 1IQEA 4PROA 1OKXA 3RC4A 1V2QT 2V0BA 5I25A 3P95A 5E2PA 4DIHH 1SGRE 4ZROA 1OP0A 4AGKA 1F5LA 4AYVB 1ANBA 3I29A 1AB9C 1HJAC 1HDTH 3EQ0H 1HAVB 5E8EH 1MQ6A 3OY6U 1Y5AT 3A85A 4UEHH 2GKVE 1A3BH 3KCGH 1J15A 1OPHB 3KQDA 4X6OA 7GCHG 3RU4T 1SFQB 1FY8E 2F9OA 2HPPH 2NU1E 3ZV9A 1GCTB 3RXVA 2VU8E 3A84A 3ZVEA 1SGDE 1YPMH 3VGCC 1C1SA 3ZZ8A 3HATH 3RC5A 2IN2A 3NZIA 1NROH 2VIOA 2RCEA 2XXLA 1CO7E 3VB6A 1GI0A 4UFGH 2P3UB 3TH4H 4B2BA 4GPGA 2JKHA 1LO6A 3RMMH 1LDTT 3OSYA 3O8RA 1S5SA 4IN2A 1CA0B 2XC4A 5FPTA 1ZJDA 1KDQA 2FOAA 1AB9B 1HJAB 2ODQA 2Y5FA 2GZ8A 2NU2E 4B2CA 1EASA 4XDEA 1YGCH 1KXDA 3QZRA 4J1YA 3QTOH 5F03A 1JIRA 3U98H 3M7UA 3NKKA 1TMTH 2BDBA 4O97A 2FOHA 5L6NH 2OC7A 2O9QA 4MTBA 5C2ZA 1YPHC 1GBKA 1Q31A 4NA9H 1V2KT 3QK1A 3VGCB 1SOTA 2FWWA 1ELBA 2O8WA 4TWWA 1WUNH 1NTPA 1TOMH 4I8KA 3TU7H 1AKSA 2WV5A 2AGGX 1A4WH 2Y5HA 2ZHFH 3QWCH 1IHTH 3NPSA 3RXFA 3W94A 3MO9A 3O8CA 1EOJA 2G52A 4HGCA 1YLDA 1NU7B 1NT1A 2RG3A 4AFQA 3Q3YA 1TPSA 2C3SA 1KDQB 1JXPA 1L4ZA 3JZ1B 1CU1A 3TLOA 2OBQA 3D62A 4NSYA 2Z6BD 3RXKA 2XC0A 2C8WB 4YLQH 4AFZA 6ESTA 1YLCA 1DPOA 3ESTA 1A5IA 2PHBA 1E35B 1V2OT 1ELEE 4CRFA 2PKAB 1LHEH 2RA0A 3UREA 2H5DA 4JZEH 2VINA 1PPZA 1TQ7B 2Y80A 3LPRA 4A7IB 3F9GA 2O8LA 2A5AA 2V3HH 2ZCKP 3PMAB 3SI3H 1BRBE 2PWXA 1AVWA 1G9IE 1RGQA 1K21H 4TWYA 1DX5M 1TOCB 2BY7X 3STJA 3A83A 3U1JB 4CRCA 1DS2E 1FY3A 4HTCH 3ZZ3A 1GI7B 4KGAA 2TGDA 1HCGA 1VGCB 2JH6D 4CRAA 3T27A 2W26A 1TALA 1ELGA 4Y79A 1F5RA 1FJSA 2ZDAH 3F68H 1EAIA 3KF2A 4U01A 2VGCB 4Q7ZA 5DGJA 1W13U 4Y6DA 3M7QA 2PSYA 1YPHE 1AFQB 1O30A 2GCTC 4B73A 1H4WA 1HNEE 4R8TB 2ILNA 1G32B 4DY7B 1B0EA 2BOKA 1GVZA 1O3NA 3V0XA 1ACBE 1SGEE 3RM2H 3MO3A 3E3TA 4SGBE 2CF9H 1MTSA 1XUGA 1P9SA 3QN7A 2AH4X 1ZSLA 2Q6FA 1SGCA 4Y8YA 2TPIZ 4JZFH 1QRWA 1TAWA 1PYTD 1TNHA 1UVTH 1GGDC 2P93A 2XCFA 1FZZA 5DP8A 4M7GA 4MPVA 1C2GA 1C5WB 3PMBB 1EATA 2ZHWH 3RDZA 1MTWA 5A0CA 1FIWA 1TRMA 2ZDVH 1BQYA 3RXEA 1MBQA 3RXJA 1FUJA 3UQVA 1MU6B 3UWIA 1YCPK 2XYAA 1O2IA 1XKAC 4WXVA 3P8GA 1L4DA 2WYJA 2BDCA 5F8XA 5T6DA 1UCYK 2A4RA 1QQUA 2QC2A 4KTUA 1TB6H 2A7HA 5EXMA 2SGFE 1O3MA 3SOSA 1ZSJA 1S0RA 2F9PA 1TBZH 3PV4A 1WTHD 3UFAA 1A61H 1MKWH 4KTCA 2R0LA 1GGDB 1O2XA 3BV9B 2PW8H 1RTLA 4FUBA 4LK4A 2STBE 3DHKH 1LVBA 1OWDA 1KXBA 4K5ZA 1V6DA 4NWLA 1JWTA 4D8NA 4ZAEA 4CRDA 1J8AA 3GYMA 1WAYB 1XUFA 3SGAE 3SJ8A 3GCTF 1K1JA 1GCDA 3BTHE 2J2UA 3GY2A 2QV1A 5EG4A 1GBIA 5JYIA 3SUEA 1HGTH 1OWIA 3BG8A 5EQRA 3CP7A 3M7TA 4O3TA 4K8BA 1PQAA 3RU4D 5DP6A 3ZVAA 4FUFA 1HAYB 2WPLS 4TY6A 2UWPA 1VCWA 2FI4E 1P09A 1UTKA 4ZH8A 2ZPRA 2C8XB 2PTCE 2ZDKA 4ABGA 3S9AA 2VB0A 6LPRA 1T4VH 1THRH 4NIWA 2R9PA 3A80A 2A5IA 5EODA 2QXHA 1RIWC 4DG4A 4E7RG 4HI3A 3MNCA 5EQSA 2AGEX 1AUTC 2EA3A 5K7RA 4Y76A 4CRBA 2VIPA 1Y8TA 4CH2B 1EJNA 1S0QA 1GJ7B 1W11U 1C5RA 1TONA 1AHTH 2Z9LA 1Y3VA 5FX6A 3PB1E 4BANB 1VJAU 5F8TA 3LC3A 1GDQA 2F9VA 2ZEBA 5HYOA 1TX8A 3VXEH 4I8JA 2AMPA 2HPQH 2P3FH 5DO4H 3BTQE 5E0GA 2G5VA 4FUCA 1JRTA 1ZJKA 1GBEA 2BQ7B 2R3YA 1FQ3A 2ODYB 1NRSH 2BY9X 4LXBH 1QB1A 4MLFB 1DDJA 4XBDA 1RIWB 1KLIH 2WYGA 3SU4A 3LGIA 4ASHA 1VZQH 1JOUB 3LT3A 1K2I1 4ISIH 3P8FA 2OQUA 1AFEH 5FHTA 3MU5A 3ZZCA 1TBQH 2AERH 1Z8JB 4LZ1H 4Y7AA 3LGUA 2SGEE 5J4SA 2G55A 1GBJA 2AIPA 4MVNA 2XWBI 3STIA 4ABJA 1SLUB 3QO6A 4MNXA 2H2ZA 2XBYA 5JBTA 3F9EA 2XWAA 1LHFH 3SV8A 5A8ZA 3MYWA 1BTPA 2D1JA 1O2ZA 3MMGA 5HM9A 1GJAB 1ESTA 1UTMA 2FLBH 3KQBA 3T28A 5A8YA 1P01A 2Q6GA 1B0FA 2FX4A 3S69A 1ETTH 1WV7H 1F7ZA 3BTGE 4JYUH 1IQHA 3AASA 1NU9A 1P0SH 1C1NA 1VJ9U 4BAHB 1JRSA 1P10A 2VH6A 3MU1A 1NPMA 2B5TB 1SSXA 2WPIS 3PO1B 1EJMA 2UWLA 8KME2 1DXWA 1MTUA 1EZUC 5H4IB 3NK8A 1CSOE 3KNXA 3VFEA 1YPEH 3SZNA 2WPMS 1X7AC 2STAE 3U8RH 1A3EH 3FZDA 1WQVH 1C5LH 2AMQA 4XFQA 4BNRA 1TYNA 1UK4A 1FI8A 3TJOA 3FP7E 1SL3A 1TGNA 2FOCA 1PJPA 3GOVB 1UJ1A 1PPGE 3TGIE 1VCQA 1O3JA 2VWNA 1EZXC 4O9VA 3D65E 1TPPA 1NRNH 3NCLA 4YOIA 6CHAB 1ID5H 2IOTA 1QIXB 1RTFB 5GDSH 3QX5H 3O8DA 2AMDA 2ODPA 2J9NA 4NIVA 1TRYA 2FOFA 1TNKA 2B7DH 3URCA 3U8OH 4AG1A 4D76A 1YPGH 4NIYA 3UQOA 5F6MA 1C5QA 1SGPE 1SGFA 1UVPA 2TGTA 3GISB 3K6ZA 5ABWA 5FPSA 2PKSC 3MU4A 1O2PA 3RXGA 3EGKH 1CHGA 1BOQA 1O5FH 3S7HB 1HV7A 1GBMA 2ZP0H 4ZUHA 4WH6A 1NN6A 8GCHG 3SJKA 5EGMA 1EB2A 5HXFA 9LPRA 4IMZA 3E0PB 1LHCH 1W8BH 3RXLA 2FODA 2IPHA 1NZQH 2HLCA 4JYTA 1CGIE 8LPRA 3SI4H 2FZZA 2R2MB 2EEKA 4K69A 2NU0E 2ALPA 1Y59T 4I8GA 5EOKA 4KP0A 1ZGVA 1S83A 1NRQH 3TIUA 4INLA 3MU8A 4GCHF 1HAGE 4YTAA 1CHOG 4GLYA 1O2TA 2VNTA 1CT4E 4FUGA 1OP8A 2ZF0H 2VH0A 1H8DH 4ABHA 1W12U 4K2YA 2XTTB 3A86A 1YBWA 3HGPA 2PKSB 3A88A 1GHXH 1O2MA 1MD8A 1XX9A 5AF9H 1C2IA 3TK6A 5ETXA 3SBKA 3SNEA 4A1XA 2D8WA 5LPEA 1QL9A 4BAOB 3O8BA 1J17T 2EI8A 2QCYA 2CMYA 3BEFB 4GHQA 3SJIA 1WQSA 1C1WH 3UTUH 2FOGA 2SGAA 1IQGA 2FEQH 1G3EA 1P2MA 4DCDA 1C2KA 1QBVH 4AB8A 5CE1A 5JB9S 3SN8A 3T62A 2OLGA 1DSTA 4AORA 3M5NA 5A2MH 1AN1E 1BITA 1H9HE 5AVDA 1HUTH 1BTHH 1QGFA 2BY5X 3KIDU 1IOEA 3BTEE 1EKBB 3PTBA 4IMQA 3S0NA 3LH1A 1FPCH 4U32A 3BTKE 1ZRKA 1T31A 2JETC 2GT8A 3CS7A 1C5OH 1GJBB 3B23B 1EPTB 2ZA5A 4U30A 2F9UA 2J4IA 4X1NU 3LGVA 2ZQ2A 3E0NB 1UO6A 2QYIA 1T8OA 1C5YB 1P8VC 4FUEA 1TE0A 3UR9A 2FM2A 1TGBA 4WY3A 2THFB 4ABFA 1Z1JA 4E05H 4DIIH 1TLDA 1FNIA 2C4FH 3QDZB 4K1TA 1P02A 3ZVCA 1WCZA 5DJ7A 1CA0C 1O34A 3MO6A 3MFJA 2GDEH
chains in the Genus database with same CATH superfamily
4YOJA 2R3UA 2ALVA 2V3MA 2XNDD 1O36A 3M37A 2W3KA 4X6PA 4YT6H 1XUKA 3ZZ7A 1O32A 1T7CA 1ETRH 2Z3DA 1O2KA 2YMSD 2WV4A 3GCTG 2AFQB 3VG8A 1UK2A 4Y8XA 5HMAA 3BEUA 4Y0YE 2P95A 3B8JA 4IGDA 2JETB 1TNIA 3A81A 1HBTH 4IC5A 2ZFFH 2EI7A 2ZFPH 4JZ1A 2Q1JA 4JK6A 2OD3B 3T29A 2LELA 1C1QA 4NA8A 3EE0B 1TQ0B 1ZHMA 4X6NA 1SQOA 1O2SA 4ZHLU 1SBWA 2ZZUH 3RLYH 2B8OH 2BQWB 4RT0A 4ISHH 5GJ4B 5DPAA 1FY4A 2G51A 4Z6AH 5L30H 1MU8B 2F83A 5GIBA 3GDSA 1ZLRA 3QUMP 1LMWB 3ODDA 3TJNA 4AYYB 1C2JA 2HWLB 5C67A 2PKAA 2W3IA 1O2RA 1KXFA 2ANYA 2YNBA 3RXSA 1LCYA 2D2DA 5EQQA 2ULLA 3ZZ4A 4NCYA 1RXPA 2VVVA 4MNVA 1BB0B 3ATKA 2SFAA 3BTTE 1Y5UT 1C1TA 1DICA 3TGJE 2XNIA 1C5XB 2CV3A 4RT1A 3T5FH 1BHXF 4X1SU 1ANEA 1HYLA 1MTNC 3D49H 3BG4B 1KLJH 1BTUA 4MDSA 3LJOA 1OYTH 1O3OA 2FS8A 2ZDLA 3RMLH 1P03A 2OC0A 1SOZA 1C1VH 1IQIA 2ANWA 1SQAA 3E16B 2EQNA 2R0KA 2VVCA 2A2QH 1HLTH 1VGCC 2RDEA 3A8BA 4Y7BA 1W3CA 2G5NA 1V2ST 2BD8A 4ABBA 5B6LA 3QGNB 4XBCA 2VGCC 1W2KH 3EA9A 2ZGBH 1AFQC 1P06A 3A8AA 2VIVA 3CS0A 3RXUA 1UTQA 1EJAA 2P59A 4ZHAA 1Z8RA 4GHTA 3DSGA 1AQ7A 1BMAA 8GCHF 1AY6H 2QXIA 4FUDA 5SGAE 3OEHD 1BIOA 1KXCA 1C5PA 1C1RA 4K8YA 2OXSA 2KAIB 1A0LA 1MTNB 1IQKA 3RXMA 1SGYE 2VWMA 3M3VA 3SYJA 4WXIA 2PTNA 1H8ED 1O5EH 1SPJA 3UR6A 4M9FA 1GJ6A 1DWEH 3KN2A 2ZQ1A 1NY22 3PRDA 2ZECA 3BIUH 2OQ5A 1CHOF 3SU1A 2SGQE 1O2NA 3N7OA 1BDAA 1N6XA 1JMOH 1KSNA 1OOKB 2A31A 1A46H 5DP9A 3ZZBA 4FXGH 5HIZA 4A1VA 5I46H 1OSSA 3HKJB 1OWEA 1O5AB 1TIOA 2C90B 2KX4A 4NGAH 3P92A 1C2MA 1N1LA 2C8YB 4R0IA 2ASUB 1LPGB 3FFGA 1THPB 2GCHG 2TGAA 1K1PA 3TJUA 4Y10E 1FAXA 2Q6DA 4FU9A 3M3SA 1QL8A 1MTVA 1MAXA 4X6MA 2ZG0H 4NZQA 3OE7D 2QAAA 5L2YH 2QGRA 1K1MA 4D7GA 3V3MA 1WBGB 1AUJA 3PLKA 1OHHD 1HXEH 1F0SA 3QZQA 3UNQA 1ELVA 3LDXH 2H1UA 2B0FA 2ZO3H 3K2UA 1NO9H 1YP9A 1GDUA 2GT7A 1UVOA 2BLQA 3HK6B 1UVUH 1KIGH 1YPJH 2W6ID 2PLXA 1TNJA 2ZPSA 5A09A 2BY8X 1NFWA 3G01A 4CBOA 2AGIX 2WSSD 1YC0A 1ETSH 1LVOA 3LU9B 2PUXB 2A45B 3T26A 4DVAU 4FU7A 1C5NH 3I78A 1EAWA 4OM9A 3VB4A 4I32A 2J95A 1OXGA 1N8OC 2CGAA 1SVPA 4NZLA 1GBLA 2ANKH 2BQ6B 4GCHG 4WMEA 2XW9A 5EU8A 1V2NT 3KQEA 4GVUA 1AE8H 2G4UA 2HVYB 4I86A 4I31A 3E6PH 2FO9A 3NRLA 1FY5A 1XKBC 3L3TA 1O2VA 1QR3E 1GHYH 2TBSA 3PLPA 3U1IB 5JPMH 3LONA 2BDYA 2BM2A 1D6RA 3HK3B 2I6SA 2RA3A 3ATMA 3DT0H 3LJJA 1O37A 1DANH 2ANMH 4IS5A 2PUQH 4WF8A 1QFKH 2BDIA 3MH7A 5C94A 5DSFA 4K1SA 3E1XB 4WWYA 4GSOA 4RSPA 3VB7A 3ZZ9A 1C9PA 1P57B 3ZVGA 3DFJA 5IDKA 2UWOA 5C5NA 1MZAA 3AVZA 3N99A 4B74A 1FV9A 1N8OB 4RN6A 2BD2A 3EA7A 2ZDMA 5L2ZH 5FX5A 3W1EA 1GMHF 8ESTE 2FDAA 1GBBA 3K9XB 2UUJB 1GI4A 1C4V2 1HJ8A 1B7XB 2VIDA 4B6FA 3FAOA 3SUDA 1W0KD 1XVMA 4UFFH 5FPYA 5EXLA 1W7GH 1XUJA 1P3CA 4I8HA 2ESTE 2CF8H 4YOGA 2ZWLH 3LC5A 1AWFH 1M9UA 3TITA 1F0TA 4FVBA 5DP5A 4VGCB 3OU0A 2LPRA 1NS3A 4AGJA 1KYNA 1TFXA 1PPFE 1UTPA 5AHGH 2PSXA 1O2LA 1TPAE 1YF4A 4THNH 3OAAD 2HNTC 1GL0E 2J97A 4FOUC 2GMTB 4RI0A 1EB1H 4NWKA 1PPHE 1GBDA 3RMOH 1FONA 2TIOA 3S7KB 2Z9KA 5HGGA 4AG2A 1AD8H 3BTWE 2H9TH 1PFXC 1HAIH 2OCVB 5GNDA 1Z6EA 3GY3A 2FTLE 3V12A 1WSSH 2ZHDA 1QL7A 1S85A 1ORFA 1QTFA 2KZ4A 3F9FA 3F0OA 4ISOA 3SGQE 5EPNA 1TRNA 1T4UH 3QLPH 2ZPQA 1E79D 1DITH 1DWBH 1U6QA 3PO1C 1PPEE 1HAZB 1EZQA 1BZXE 3A8DA 4OGXA 4B76A 1FMGA 3ENSB 2BDGA 3R3GB 1SG8B 3A7YA 3GY5A 2OK5A 4Z0KA 1XMNB 1TNGA 1CVWH 2G8TA 4XSKU 3BEIB 1UMAH 1HRTH 2HALA 1G3BA 1S6FA 1Q2WA 1SI5H 3SNCA 2BVSH 1BCUH 1C5MD 6CHAC 3TK9A 2NWNA 2VBCA 3PLBA 4A5TS 2PV9B 1LVMA 6GCHG 1ELFA 1DXPA 1S6LA 3URDA 5EW2H 4BAQB 3VXFH 1NFUA 1TABE 1IQJA 2FX6A 3MNXA 4MPXA 1BRCE 2BY6X 4OS4A 5T1VA 5C1XA 3P70B 1BTZA 5LPRA 1A5GH 1ELTA 2PGQB 4H6TA 1CA8B 3OYPA 3AW0A 4D9QA 1FPHH 3PYHA 1A1RA 1QCPA 4AFSA 3LGWA 3SORA 2D26C 1NESE 3S9CA 4ZXYH 4JK5A 1P04A 2CXVA 1IQFA 1TGCA 1GI6A 4ISLA 1ESBA 2Z9JA 3TVJB 3SU3A 1J14A 3PTNA 1SLXB 3KQ5A 1V2UT 2QIQA 1E38B 1YPKH 3KHVA 4TPIZ 1DSUA 3A82A 3C27B 2ZNKH 2FYQA 4HFPB 2ZCLP 1YPLH 1GG6C 2AEIH 1BUIA 2UUKB 1GBFA 3E8LA 1GJDB 2GCHF 4MNWA 4ZHMU 3SQHE 3WWBA 4JYVH 3P8NA 1SGTA 2QF5A 1NRRH 5J4QA 1D9IA 1EAXA 3MH6A 5FAHA 1TGSZ 1OWHA 3MH5A 5DKMA 2A32A 1EP6A 2FYRA 3LGTA 1O39A 3DFLA 5F8ZA 4X2YA 1IHSH 2BDAA 2GV7A 3E90B 3CENA 4Q80A 2L74A 1C4U2 1JIMA 1GBTA 3C1KA 2M5TA 1P2NA 1O3GA 2BB4A 5T6FA 1ESAA 1SLWB 1IQLA 1XM1A 2BVRH 1J16A 1HIAA 9ESTA 1TBRH 1SB1H 1BMNH 3RXPA 1SGFG 1SHHB 1GG6B 1S81A 4ABEA 3UOPA 2AS9A 2ZDNA 1T32A 5E2OA 1GJCB 1BBRH 1CT0E 1GI3A 2QE7D 3SW2B 3VEQB 2IJD1 2A7JA 2ZFRH 1BJUA 1ZMLA 1SMFE 2SNVA 4OS7A 2H6MA 3KEEA 3K6YA 3TH2H 4X8TH 2BX3A 1T8NA 2F3CE 1CGJE 3RXBA 1BBRE 1LTOA 1GMCF 1CBWC 1TMBH 3RM0H 3T25A 1MCTA 3A89A 1KTTB 2JH5D 3RXQA 1MD7A 5FCKA 1UTOA 2OTVA 4B71A 1BRAA 1E37B 3E91A 1OP2A 1QBOA 1T8MA 4O3UA 1HAOH 3L6PA 1EPTA 3RP2A 2HRVA 4UD9H 5CHAC 1EPTC 1GDNA 3H09A 1LHDH 1E34B 2BD3A 2ZGCA 3UNSA 1ARBA 1HIAB 1QRXA 2ZU5A 5C1UA 1W0ZU 1SGIB 3BTME 1QNJA 4A1TA 1P2JA 1QHRB 2GP9B 3SO3A 2XCNA 1W0YH 3P6ZB 1G3CA 3SV2H 2GGVB 2VWLA 2ZFSA 3MI4A 2WHXA 5FXLA 1Z71A 1DM4B 1GHBF 1O2WA 1C1OA 5FBIA 2XRCA 1PQ7A 1CBWB 3GCHB 4AZ2B 2V6NA 4IBLH 3SNAA 1W0JD 4P00A 3SNDA 5BPEA 1LQEA 3SV9A 1ZPZA 2GTBA 1B5GH 1TMUH 3PMHB 2JJ2D 1NM6A 3F0PA 1FLEE 4DW2U 1L0ZA 4AB9A 2P8OC 2F9BH 3MTYA 5C3NA 1VITH 1LQDB 2TGPZ 4ZKSU 5CHAB 2BOHB 1QB9A 3TGKE 1KTSB 1P2OA 2W5EA 2BHGA 3U69H 1C5VA 4YXWD 1P2IA 1F0RA 2BYAX 1FX0B 2HOBA 1L1GA 2BZ6H 3NWUA 2F91A 3ZZDA 1GL1A 1EZSC 2W7SA 3HKIB 1MKXH 3MNBA 3SV7A 4D9RA 2Y6TA 1QA7A 2BTCE 3UY9A 3OTJE 1AVGH 1XXDA 2HVXA 2V35A 1XUIA 3LGYA 3SV6A 2WPKS 1QY6A 2FIRH 1NBME 1YM0A 1E1RD 1HAHH 1DFPA 1BMFD 1O3BA 2O8TA 3Q3KA 4XBBA 5B6OA 2AIQA 4H4FA 4CREA 7LPRA 4UDWH 3EYDA 1DVAH 2QXGA 1DY9A 3GICB 3RXRA 4IC6A 2BD5A 3RXCA 4YM9A 4IN1A 3PV2A 3TK5A 2BZAA 1TA2A 3PWCA 2P8OB 3Q00A 1YY3A 2EI6A 2QXJA 1TNLA 2P3TB 1GHZA 1GMHG 3GCOA 3H7TA 3KYFA 4OS2A 4F49A 3SHAH 1K1NA 2OINA 1FIZA 2F43B 3BTFE 2VJ1A 4ZKRU 3H5CB 2NU4E 4DT4A 1E36B 3L33A 2A2XH 1MQ5A 2FP7B 1GBHA 1AZZA 1WU1A 4AFUA 1ELDE 2Z3EA 1XXFA 1Z8IB 3BG4C 3F9HA 1ZHPA 4TYDA 1D6WA 1O5DH 1AMHA 3SUFA 3ODFA 1O3DA 3DUXH 4P02A 6GCHF 1C1UH 2QA9E 1DY8A 1GHAF 1QBNA 1LVYA 1K1LA 5EPYA 4F48B 1A7SA 5IYTA 2FOEA 1NC6A 5A8XA 1K1OA 2FS9A 4X1PU 1D3TB 2ZHQH 5G4BA 1A0HB 2A5KA 3MOCA 1RJXB 1LKAA 2TRMA 2ZFQH 3EA8A 4CR9A 2XBWA 3SHCH 1H8IH 5C17A 1L1JA 1ZTLA 3NXPA 1TGTA 5E0JA 1O3IA 3NUMA 1H9IE 1TWXB 1E1QD 1GBCA 2JDID 4AX9H 4LOYH 4ZMAH 3AAUA 1OWJA 1ABJH 1BT7A 3Q77A 1PQ8A 4Q7YA 4KELA 1SLVB 4X8VH 1SR5C 3V7TA 4KTSA 2KAIA 1G37A 4YO9A 5A0AE 5LGOA 4BXSA 1GI9B 5E0HA 2OC1A 4K60A 1C9TA 5JBAS 2FI3E 1A2CH 2O8UA 2AYWA 3F1SB 1MKWK 2VIQA 3OTPA 1ELAA 1COWD 3IITA 4JZIA 4MQAA 3M5LA 3GDUA 1WYKA 3U9AH 1AIXH 1O31A 4GAWA 4HZHA 4NA7A 3W95A 2ZGHA 5C20A 1GJ8B 1C4Y2 1QURH 3RC6A 7ESTE 3DA9B 1OX1A 1G30B 4BTIB 2ZC9H 1GI5A 1GJ5H 1YWUA 5C5OA 4B6EA 1K0HA 2QF0A 5FBEA 3ZV8A 3MHWU 4Y0ZE 1MUEB 4KKDA 3RXAA 3SUGA 1Y3YA 1AE5A 1GJ4H 1Z1IA 1GMDG 1E0FD 3M36A 4INHA 4JCNA 4OS5A 3LKWA 3ZVFA 4FUHA 4ACBA 4DT7B 1ZHRA 5GPIB 1RFNA 3N7DA 4FVDA 1GPZA 5PTPA 3KYGA 1DLEA 1VR1H 1O5BB 4BOHA 4ABDA 3M5MA 1WTGH 2ZHEH 4I33A 1GI2A 1MZDA 5JB8S 1O2JA 1QA0A 2WINI 4X2VA 2A0QB 2OUAA 2BMGB 4TPYA 3FOAA 4ISNA 1DT2A 1MMJN 2FXRA 2XC5A 4YZUA 4XE4A 1KMHB 5KECA 2ZIQH 3LIWA 1ABIH 1V2JT 2J92A 2WUBA 3M61U 1BTYA 2BXTH 3ZZ6A 2W7UA 1UTNA 1LKBA 1VITF 4B2AA 1AKSB 1OYQA 1TX7A 1C2DA 2ZCHP 4DOQA 1GWAA 1DLKB 4FU8A 2YOLA 4FUIA 3JZ2B 5DG6A 1FDPA 1FN6A 1O0DH 1P9UA 4BTTB 1G36A 3TPIZ 5GXPA 2FOBA 4Q4LA 2IJOB 1O5GH 2WPDD 3DSPA 2DE8A 2KM0A 2K0QA 1MAYA 2RFKC 1D3DB 3ZZAA 1L2EA 1G3DA 4Y11E 5LH8A 2XBXA 3PRBA 3P8OA 1HFDA 1EP5A 2QY0B 5GCHG 3GY6A 4F4OC 4YESB 2GZ7A 1Q3XA 4A92A 4NFFA 1O3LA 1O2UA 5GWZA 1O3EA 2GD4B 4WMFA 4Z1MD 3A7TA 5DP3A 1O35A 1RRKA 4DJZB 3SU5A 4YT7H 1O2GH 1KXEA 1Z8GA 4TY7A 2BXUH 2CJIA 4ZXXH 1C5TA 2WUCA 3IWMA 1UHBA 3LH3A 4JZDH 4ZCNA 1T8LA 1O3AA 4Q7XA 1ZR0A 3SNBA 3ZZ5A 2EC9H 1A0JA 2IPQX 1UTJA 3SJOA 3WWFA 3ZVBA 1KLTA 2KCAA 3BN9A 3RXOA 1F2SE 5IK2D 2GCTB 1MH0A 1F0UA 3RXHA 1GMCG 3IG6B 5AFZH 4TT3D 4AC9A 2YMSB 1G2LA 4FUJA 3KQCA 2XBVA 1V2VT 1C5SA 2FESH 1DE7H 1QJ6B 1EAUA 4B1TA 5DP4A 1S82A 1ANDA 4BTUB 4VGCC 2R2WU 3GY4A 1ZMNA 2FI5E 1RTKA 3MU0A 4ESTE 1V2TT 4ABIA 4H6SB 1Z7KA 4NFEA 3SU0A 2Z7FE 2SGDE 1O3CA 3M35A 1UHBB 5TCCA 7KMEH 2FOMB 1GHVH 2SNWA 1EQ9A 1K9OE 1ZRBA 3MQKC 1LPZB 1Y3UA 2GMTC 1F92A 3PMJA 3KL6A 5C0UA 1DOJA 1OWKA 1EXFA 3V13A 1ZTJA 7GCHF 1GHBG 1O3FA 2H9EH 1K28D 3F2FA 1P3EA 3R0FA 3ATWA 4Q2KA 4CBNA 3RXDA 1O2HA 1SQRA 5FL7D 4WH8A 5EJLA 4GUXA 2GDDA 1HPGA 1O5CB 1MCVA 1HXFH 4NIXA 1K1IA 2BLWA 3TJVA 5FCRA 1ZPCA 1IQNA 2FPZA 3A8CA 1JBUH 4A6LA 3ZYDA 4XOJA 1ZGIA 1C5ZB 2ZFTA 3U28C 1KY9A 1AGJA 1IAUA 1N6YA 2CHAC 1UVSH 2ZU1A 1C5UA 2Z94A 3SGBE 1HAPH 1P12E 2ZU2A 2P94A 4UFEH 3ZVDA 3AW1A 1D3QB 3QTVH 3ATLA 3AAVA 3UIRA 4MNYA 1BBRK 2J94A 2B9LA 2KCPA 3FP8E 2I6QA 3KGPA 1NBMD 5ESTE 1AZ8A 4NSVA 3T2NA 2OBOA 4RKJB 2BD9A 3CNRA 3BIVH 1AI8H 3SQEE 2GZ9A 1BTWA 1BRUP 3B9FH 5TCAA 1UK3A 1K22H 4CR5A 4CH8B 5ESBA 4UE7H 3SU2A 2A1DB 2OP9A 2QN5T 2UUFB 4IW4E 5DN6D 1FXYA 1ZZZA 4UFDH 4X1RU 4NG9H 5HIYA 1S6HA 4INKA 2CHAB 3UUZA 1FAKH 1ZYOA 1YYY1 3PWBA 2G4TA 3A7XA 4Y71A 1GMDF 1BMLA 1EX3A 2F9NA 3UOUA 1ZPBA 2C93B 3BTDE 2ZU3A 2HGTH 1O38A 2Z9IA 1P2KA 1O33A 4MPWA 1ZSKA 2ZU4A 2Y81A 4FETA 3U8TH 2OC8A 4B75A 3D23A 4QT8C 4X2WA 5A0BA 1PYTC 2Z9GA 4SGAE 1GHAG 1V2RT 2XOKD 3RXIA 2A4OA 1TX6A 3GY8A 1D3PB 1YCPH 2DUCA 3F3BA 3F6UH 3VPKA 1O2YA 2WV9A 2BVXH 1BTXA 2H5CA 4HG6A 1H1BA 1UCYH 4DURA 4YLUA 3UWJH 3BF6H 4I8LA 3F2HA 2Y5GA 1AO5A 1UTLM 3HGNA 2PGBB 2QF3A 1AWHB 5AFYH 5C0TA 1W14U 3RUOA 1UCYE 2HNTE 1SHYA 4XD7D 2K1QA 4WMDA 4E7NA 1O2OA 1LHGH 4RKOB 4AN7A 1AVXA 1SC8U 1SGNE 3PM3A 5TJXA 1V2MT 1FN8A 1GBAA 2GV6A 1NRPH 3RLWH 1P2QA 3MH4A 4X1QU 3A7VA 1MKXK 3GYLB 1C2FA 2CN0H 3OX7U 5JDUB 1Y3WA 2RDLA 1PPBH 3ELAH 4X0WU 2W6JD 2ZI2H 3TH3H 2PR3A 4BAMB 5GCHF 2LNCA 2VIWA 1DWCH 2PFEA 3RMNH 1KXAA 1V2PT 3EDXB 1BMMH 1CQQA 5LPFA 1FY1A 1F5KU 4ZKOU 3RXTA 1ARCA 1P11E 3A7WA 3FVFB 2ZGXH 3UPEA 1ZTKA 1HB0B 2WPJS 1C1MA 1CT2E 1DWDH 4ZKNU 1GVLA 1ZMJA 2FTMA 4O03A 5EXNA 1H9LB 4BXWA 1C2HA 3A87A 1G2MA 5HKKD 2VWOA 1SQTA 1C1PA 4OS6A 1LPKB 1O3HA 2GVFA 2O8MA 4JMYA 1NFXA 2A4GA 2J34A 1BHXB 1SGQE 2Z3CA 1D4PB 4DGJA 1GJ9B 5HM2A 1A5HA 3A7ZA 2YNAA 3FANA 4U2WA 4WVPE 4AOQA 1HAXB 2SGPE 1QJ1B 3VB5A 1MBMA 2EY4C 5EW1H 3Q3XA 2KR7A 1QJ7B 4ABAA 3S9BA 1SFIA 2HLDD 4K1EA 4J2YB 3UB0A 2UUYA 5DP7A 2WPHS 1EUFA 3VB3A 1TPOA 1VITG 3GCHC 3P17H 3GCNA 1RD3B 2BX4A 3I77A 4X2XA 2A7CA 2FMJA 3F2GA 2V3OH 2ZTZA 5JBBS 3TNTA 3DD2H 4MPUA 2P16A 1INCA 2BLVA 3GY7A 1AU8A 2ZKSA 3GDVA 5K0HA 1HJ9A 1W7XH 1W10U 1YCPM 1QB6A 2BDHA 5T6GA 2BD4A 2H9HA 2ZGJA 1RS0A 1VCPA 1THSH 1Z6JH 3MWIU 4CHAC 2G81E 1J9CH 4UONA 1CGHA 4WJG2 3PROA 1QQ4A 1BJVA 1DUAA 3M3TA 3MNSA 2BD7A 5BRRE 1PQ5A 3M5OA 5C1YA 3ATIA 1V3XA 4OGYA 1O3KA 1S84A 4F55A 1V2LT 1QRZA 2J98A 4X8SH 2ZTXA 1WOFA 1O2QA 2Y7XA 1GHWH 4D7FA 5JBCS 4CRGA 3UNRA 4LZ4B 1PPCE 1OS8A 3GS9A 3FZZA 2VVUA 2C8ZB 3RU4E 4Y8ZA 2ZTYA 3EE7A 1GI8B 3TNSA 1GI1A 5DK1A 2Y82A 1HAVA 2G00A 3K65B 4E06H 1Y5BT 3Q76A 4X8UH 1ELCA 1XUHA 3ITIA 4BAKB 5EIYA 1ANCA 4K3JA 3H7OA 1TA6A 3ZYEA 2F4LA 2GX4A 3HPTB 4CHAB 2NU3E 3EAJA 3OY5U 1YKTA 1C2EA 1Y3XA 1C2LA 1DUEA 3OEED 1IQMA 1GCTC 1CE5A 1BA8B 2KFWA 1NFYA 3FP6E 4I7YH 1GVKB 4OS1A 2J38A 2JIZD 5T3HA 2HNTF 5KEDA 4H42U 2M2AA 1EOLA 2FLRH 3BSQA 5CMXH 4MG3A 3QGJA 2J98B 2A4QA 1L1NA 1XVOA 3SU6A 1ZOMA 2BLOA 3LOXA 1V2WT 1O3PB 3WY8A 2JH0D 3SJ9A 2Y7ZA 2DE9A 1P05A 1IQEA 4PROA 1OKXA 3RC4A 1V2QT 2V0BA 5I25A 3P95A 5E2PA 4DIHH 1SGRE 4ZROA 1OP0A 1YLNA 4AGKA 1F5LA 4AYVB 1ANBA 3I29A 1AB9C 1HJAC 1HDTH 3EQ0H 1HAVB 5E8EH 1MQ6A 3OY6U 1Y5AT 3A85A 4UEHH 2GKVE 1A3BH 3KCGH 4ACAA 1J15A 1OPHB 3KQDA 4X6OA 7GCHG 3RU4T 1SFQB 1FY8E 2F9OA 2HPPH 2NU1E 3ZV9A 1GCTB 3RXVA 2WZQA 2VU8E 3A84A 3ZVEA 1SGDE 1YPMH 3VGCC 1C1SA 3ZZ8A 3HATH 3RC5A 2IN2A 3NZIA 1NROH 2VIOA 2RCEA 2XXLA 1CO7E 3VB6A 1GI0A 4UFGH 2P3UB 3TH4H 4B2BA 3FN8A 2JKHA 4GPGA 1LO6A 3RMMH 1LDTT 3OSYA 3O8RA 1S5SA 2AHME 4IN2A 1CA0B 2XC4A 5FPTA 1ZJDA 1KDQA 2FOAA 1AB9B 1HJAB 2ODQA 2Y5FA 2V7QD 2GZ8A 2NU2E 4B2CA 1EASA 4XDEA 1YGCH 1KXDA 3QZRA 4J1YA 3QTOH 5F03A 1JIRA 3U98H 3M7UA 3NKKA 1TMTH 2BDBA 4O97A 2FOHA 5L6NH 2OC7A 2O9QA 4MTBA 5C2ZA 1YPHC 1GBKA 1Q31A 4NA9H 1V2KT 3QK1A 3VGCB 1SOTA 2FWWA 1ELBA 2O8WA 4TWWA 1WUNH 1NTPA 1TOMH 4I8KA 3TU7H 1AKSA 2CK3D 2WV5A 2AGGX 1A4WH 2Y5HA 2ZHFH 3QWCH 1IHTH 3NPSA 3RXFA 3W94A 3MO9A 3O8CA 3UAIC 1EOJA 2G52A 4HGCA 5EJZA 1YLDA 1NU7B 1NT1A 2RG3A 4AFQA 3Q3YA 1TPSA 3WW7A 2C3SA 1KDQB 1JXPA 1L4ZA 1SKYE 3JZ1B 1CU1A 3TLOA 2OBQA 3D62A 4NSYA 2Z6BD 3RXKA 2XC0A 2C8WB 4YLQH 4AFZA 6ESTA 1YLCA 1DPOA 3ESTA 1A5IA 2PHBA 1E35B 1V2OT 1ELEE 2LP6A 4CRFA 2PKAB 1LHEH 2RA0A 3UREA 2H5DA 4JZEH 2VINA 1PPZA 1TQ7B 2Y80A 3LPRA 4A7IB 3F9GA 2O8LA 2A5AA 2V3HH 2ZCKP 3PMAB 3SI3H 1BRBE 2PWXA 1AVWA 1G9IE 1RGQA 2K8IA 1K21H 4TWYA 1DX5M 1TOCB 2BY7X 3STJA 3A83A 3U1JB 4CRCA 1DS2E 1FY3A 4HTCH 3ZZ3A 1GI7B 4KGAA 2TGDA 1HCGA 1VGCB 2JH6D 4CRAA 3T27A 2W26A 1TALA 1ELGA 4Y79A 1F5RA 1FJSA 2ZDAH 3F68H 1EAIA 3KF2A 4U01A 2VGCB 4Q7ZA 1EFRD 5DGJA 1W13U 3FO8D 4Y6DA 3M7QA 2PSYA 1YPHE 1AFQB 1O30A 2GCTC 3N7EA 4B73A 1H4WA 1HNEE 4R8TB 2ILNA 1G32B 4DY7B 2YMSC 1B0EA 2BOKA 1GVZA 1O3NA 3V0XA 1ACBE 1SGEE 3RM2H 3MO3A 3E3TA 4SGBE 2CF9H 1MTSA 1XUGA 1P9SA 3QN7A 2AH4X 1ZSLA 2Q6FA 1SGCA 4Y8YA 2TPIZ 4JZFH 1QRWA 1TAWA 1PYTD 1TNHA 1UVTH 1GGDC 2P93A 2XCFA 1FZZA 5DP8A 4M7GA 4MPVA 1C2GA 1C5WB 3PMBB 1EATA 2ZHWH 3RDZA 1MTWA 5A0CA 1FIWA 1TRMA 2ZDVH 1BQYA 3RXEA 1MBQA 3RXJA 1FUJA 3UQVA 1MU6B 3UWIA 1YCPK 2XYAA 1O2IA 1XKAC 4WXVA 3P8GA 1L4DA 2WYJA 2BDCA 2J5UA 5F8XA 5T6DA 1UCYK 2A4RA 1QQUA 2QC2A 4KTUA 1TB6H 2A7HA 5EXMA 2SGFE 1O3MA 3SOSA 1ZSJA 1S0RA 2F9PA 1TBZH 3PV4A 1WTHD 3UFAA 1A61H 1MKWH 4KTCA 2R0LA 1GGDB 1O2XA 3BV9B 2PW8H 1RTLA 4FUBA 4LK4A 2STBE 3DHKH 1LVBA 1OWDA 1KXBA 4K5ZA 1V6DA 4NWLA 1JWTA 4D8NA 4ZAEA 4CRDA 1J8AA 3GYMA 1WAYB 1XUFA 3SGAE 3SJ8A 3GCTF 1K1JA 1GCDA 3DCLA 3BTHE 2J2UA 3GY2A 2QV1A 5EG4A 1GBIA 5JYIA 3SUEA 1HGTH 1OWIA 3BG8A 5EQRA 3CP7A 1H8HD 4TSFD 3M7TA 4O3TA 4K8BA 1PQAA 3RU4D 5DP6A 3ZVAA 1WXRA 4FUFA 1HAYB 2WPLS 4TY6A 2UWPA 1VCWA 2FI4E 1P09A 1UTKA 4ZH8A 2ZPRA 2C8XB 2PTCE 2ZDKA 4ABGA 3S9AA 2VB0A 6LPRA 1T4VH 1THRH 4NIWA 2R9PA 3A80A 2A5IA 5CHBA 2QXHA 1RIWC 5EODA 4DG4A 4E7RG 4HI3A 3FKSD 3MNCA 5EQSA 2AGEX 1AUTC 2EA3A 5K7RA 3OFND 4Y76A 4CRBA 2VIPA 1Y8TA 4CH2B 1EJNA 1QZ8A 1S0QA 1GJ7B 1W11U 1C5RA 1TONA 1AHTH 2Z9LA 1Y3VA 1MABB 5FX6A 3PB1E 4BANB 1VJAU 5F8TA 1UW7A 3LC3A 1GDQA 2F9VA 2ZEBA 5HYOA 1TX8A 3VXEH 4I8JA 2AMPA 2HPQH 2P3FH 5DO4H 3BTQE 5E0GA 2G5VA 4FUCA 1JRTA 1ZJKA 1GBEA 2BQ7B 2R3YA 1FQ3A 2ODYB 3SZEA 1NRSH 2BY9X 4LXBH 1QB1A 4MLFB 1DDJA 4XBDA 1RIWB 2QF4A 1KLIH 2WYGA 3SU4A 3LGIA 4ASHA 1VZQH 1JOUB 3LT3A 1K2I1 4ISIH 3P8FA 2OQUA 1AFEH 5FHTA 3MU5A 3ZZCA 1TBQH 2AERH 1Z8JB 4LZ1H 4Y7AA 3LGUA 2SGEE 5J4SA 2G55A 1GBJA 2AIPA 4MVNA 1WDIA 2XWBI 3STIA 4ABJA 1SLUB 3QO6A 4MNXA 2H2ZA 2XBYA 5JBTA 3F9EA 2XWAA 5EJ1A 1LHFH 3SV8A 5A8ZA 3MYWA 1BTPA 2D1JA 1O2ZA 3MMGA 5HM9A 1GJAB 1VKYA 1ESTA 1UTMA 2FLBH 2KCYA 3KQBA 3T28A 3AK5A 5A8YA 1P01A 5F53A 2Q6GA 1B0FA 2FX4A 3S69A 1ETTH 1WV7H 1F7ZA 3BTGE 4Q63A 4JYUH 1IQHA 3AASA 1NU9A 1P0SH 1C1NA 1VJ9U 4BAHB 1JRSA 1P10A 2VH6A 3MU1A 1NPMA 2B5TB 1SSXA 2WPIS 3PO1B 1EJMA 2UWLA 8KME2 1DXWA 1MTUA 1EZUC 5H4IB 3NK8A 1CSOE 3KNXA 2JJ1D 3VFEA 1YPEH 3SZNA 2WPMS 1X7AC 2STAE 3U8RH 1A3EH 3FZDA 1WQVH 1C5LH 2AMQA 4XFQA 4BNRA 1TYNA 1UK4A 1FI8A 2KCOA 3TJOA 3FP7E 1SL3A 1TGNA 2FOCA 1PJPA 3GOVB 1UJ1A 1PPGE 3TGIE 1VCQA 1O3JA 2PP6A 4XRNA 2VWNA 1EZXC 4O9VA 3D65E 1TPPA 1NRNH 3NCLA 4YOIA 6CHAB 1ID5H 2IOTA 1QIXB 1RTFB 5GDSH 3QX5H 3O8DA 2AMDA 2ODPA 2J9NA 4NIVA 1TRYA 2FOFA 1TNKA 2B7DH 3URCA 3U8OH 4AG1A 4D76A 1YPGH 4NIYA 3UQOA 5F6MA 1C5QA 1SGPE 1SGFA 1UVPA 2TGTA 3GISB 3K6ZA 5ABWA 5FPSA 2PKSC 3MU4A 1O2PA 3RXGA 3EGKH 1CHGA 1BOQA 1O5FH 3S7HB 1HV7A 1GBMA 2ZP0H 4ZUHA 4WH6A 1NN6A 8GCHG 3SJKA 5EGMA 1EB2A 5HXFA 9LPRA 4IMZA 3E0PB 1LHCH 1W8BH 3RXLA 2FODA 2IPHA 1NZQH 2HLCA 4JYTA 1CGIE 8LPRA 3SI4H 2FZZA 2R2MB 2EEKA 4K69A 2NU0E 2ALPA 1Y59T 4I8GA 5EOKA 4KP0A 1ZGVA 1S83A 1NRQH 3TIUA 4INLA 3MU8A 4GCHF 1HAGE 4YTAA 1CHOG 4GLYA 1O2TA 2VNTA 5CDFE 1CT4E 4FUGA 3ZIAD 1OP8A 4ASUD 2ZF0H 2VH0A 1H8DH 4ABHA 1W12U 4K2YA 2XTTB 3A86A 1YBWA 3HGPA 2PKSB 3A88A 1GHXH 1O2MA 1MD8A 1XX9A 5AF9H 1C2IA 3TK6A 5ETXA 3SBKA 3SNEA 4A1XA 2D8WA 5LPEA 1QL9A 4BAOB 3O8BA 1J17T 2EI8A 2QCYA 2CMYA 3BEFB 4GHQA 3SJIA 1WQSA 1C1WH 3UTUH 2FOGA 2SGAA 1IQGA 2FEQH 1G3EA 1P2MA 4DCDA 1C2KA 1QBVH 4AB8A 5CE1A 5JB9S 3SN8A 3T62A 2OLGA 1DSTA 4AORA 3M5NA 3PV5A 5A2MH 1AN1E 1BITA 1H9HE 2GJGA 5AVDA 1HUTH 1BTHH 1QGFA 2BY5X 3KIDU 1IOEA 3BTEE 2L6OA 1EKBB 3PTBA 4IMQA 3DSOA 3S0NA 3LH1A 1FPCH 4U32A 3BTKE 1ZRKA 1T31A 2JETC 2GT8A 3CS7A 1C5OH 1GJBB 3B23B 1EPTB 2ZA5A 4U30A 2F9UA 2J4IA 4X1NU 3LGVA 2ZQ2A 3E0NB 1UO6A 2QYIA 1T8OA 1C5YB 1P8VC 4FUEA 1TE0A 3UR9A 2FM2A 1TGBA 4WY3A 2THFB 4ABFA 1Z1JA 4E05H 5KGOA 4DIIH 1TLDA 1FNIA 2C4FH 3QDZB 4K1TA 1P02A 3ZVCA 1WCZA 5DJ7A 1CA0C 1O34A 3MO6A 3MFJA 2GDEH
chains in the Genus database with same CATH topology
4YOJA 2R3UA 2ALVA 1O36A 3M37A 2W3KA 4X6PA 4YT6H 1XUKA 3ZZ7A 1O32A 1T7CA 1ETRH 2Z3DA 1O2KA 2WV4A 3GCTG 2AFQB 1UK2A 4Y8XA 5HMAA 3BEUA 4Y0YE 2P95A 3B8JA 4IGDA 2JETB 1TNIA 3A81A 1HBTH 4IC5A 2ZFFH 2EI7A 2ZFPH 4JZ1A 2Q1JA 4JK6A 2OD3B 3T29A 1C1QA 4NA8A 3EE0B 1TQ0B 1ZHMA 4X6NA 1SQOA 1O2SA 4ZHLU 1SBWA 2ZZUH 3RLYH 2B8OH 2BQWB 4ISHH 5GJ4B 5DPAA 1FY4A 2G51A 4Z6AH 5L30H 1MU8B 2F83A 5GIBA 3GDSA 1ZLRA 3QUMP 1LMWB 3ODDA 3TJNA 4AYYB 1C2JA 2HWLB 5C67A 2PKAA 2W3IA 1O2RA 1KXFA 2ANYA 2YNBA 3RXSA 1LCYA 2D2DA 5EQQA 2ULLA 3ZZ4A 4NCYA 1RXPA 2VVVA 4MNVA 1BB0B 3ATKA 2SFAA 3BTTE 1Y5UT 1C1TA 1DICA 3TGJE 2XNIA 1C5XB 2CV3A 3T5FH 1BHXF 4X1SU 1ANEA 1HYLA 1MTNC 3D49H 3BG4B 1KLJH 1BTUA 4MDSA 3LJOA 1OYTH 1O3OA 2FS8A 2ZDLA 3RMLH 1P03A 2OC0A 1SOZA 1C1VH 1IQIA 2ANWA 1SQAA 3E16B 2R0KA 2VVCA 2A2QH 1HLTH 1VGCC 3A8BA 4Y7BA 1W3CA 2G5NA 1V2ST 2BD8A 4ABBA 3QGNB 4XBCA 2VGCC 1W2KH 3EA9A 2ZGBH 1AFQC 1P06A 3A8AA 2VIVA 3CS0A 3RXUA 1UTQA 1EJAA 2P59A 4ZHAA 1Z8RA 4GHTA 1AQ7A 1BMAA 8GCHF 1AY6H 2QXIA 4FUDA 5SGAE 1BIOA 1KXCA 1C5PA 1C1RA 4K8YA 2OXSA 2KAIB 1A0LA 1MTNB 1IQKA 3RXMA 1SGYE 2VWMA 3M3VA 4WXIA 2PTNA 1O5EH 1SPJA 3UR6A 1GJ6A 1DWEH 3KN2A 2ZQ1A 1NY22 2ZECA 3BIUH 2OQ5A 1CHOF 3SU1A 2SGQE 1O2NA 3N7OA 1BDAA 1N6XA 1JMOH 1KSNA 1OOKB 2A31A 1A46H 5DP9A 3ZZBA 4FXGH 4A1VA 5I46H 1OSSA 3HKJB 1OWEA 1O5AB 1TIOA 2C90B 4NGAH 3P92A 1C2MA 1N1LA 2C8YB 4R0IA 2ASUB 1LPGB 3FFGA 1THPB 2GCHG 2TGAA 1K1PA 3TJUA 4Y10E 1FAXA 2Q6DA 4FU9A 3M3SA 1QL8A 1MTVA 1MAXA 4X6MA 2ZG0H 4NZQA 2QAAA 5L2YH 2QGRA 1K1MA 4D7GA 3V3MA 1WBGB 1AUJA 3PLKA 1HXEH 1F0SA 3QZQA 3UNQA 1ELVA 3LDXH 2H1UA 2B0FA 2ZO3H 3K2UA 1NO9H 1YP9A 1GDUA 2GT7A 1UVOA 2BLQA 3HK6B 1UVUH 1KIGH 1YPJH 2PLXA 1TNJA 2ZPSA 5A09A 2BY8X 1NFWA 3G01A 4CBOA 2AGIX 1YC0A 1ETSH 1LVOA 3LU9B 2PUXB 2A45B 3T26A 4DVAU 4FU7A 1C5NH 3I78A 1EAWA 3VB4A 4I32A 2J95A 1OXGA 1N8OC 2CGAA 1SVPA 4NZLA 1GBLA 2ANKH 2BQ6B 4GCHG 4WMEA 2XW9A 5EU8A 1V2NT 3KQEA 4GVUA 1AE8H 2G4UA 4I31A 3E6PH 2FO9A 1FY5A 1XKBC 3L3TA 1O2VA 1QR3E 1GHYH 2TBSA 3PLPA 3U1IB 5JPMH 3LONA 2BDYA 2BM2A 1D6RA 3HK3B 2I6SA 2RA3A 3ATMA 3DT0H 3LJJA 1O37A 1DANH 2ANMH 4IS5A 2PUQH 4WF8A 1QFKH 2BDIA 3MH7A 4K1SA 3E1XB 4WWYA 4GSOA 4RSPA 3VB7A 3ZZ9A 1C9PA 1P57B 3ZVGA 3DFJA 5IDKA 2UWOA 5C5NA 1MZAA 3AVZA 4B74A 1FV9A 1N8OB 4RN6A 2BD2A 3EA7A 2ZDMA 5L2ZH 5FX5A 8ESTE 1GMHF 2FDAA 1GBBA 3K9XB 2UUJB 1GI4A 1C4V2 1HJ8A 1B7XB 2VIDA 3FAOA 3SUDA 1XVMA 4UFFH 5FPYA 5EXLA 1W7GH 1XUJA 1P3CA 4I8HA 2ESTE 2CF8H 4YOGA 2ZWLH 3LC5A 1AWFH 1M9UA 3TITA 1F0TA 4FVBA 5DP5A 4VGCB 3OU0A 2LPRA 1NS3A 4AGJA 1KYNA 1TFXA 1PPFE 1UTPA 5AHGH 2PSXA 1O2LA 1TPAE 1YF4A 4THNH 2HNTC 1GL0E 2GMTB 1EB1H 4NWKA 1PPHE 1GBDA 3RMOH 1FONA 2TIOA 3S7KB 2Z9KA 5HGGA 4AG2A 1AD8H 3BTWE 2H9TH 2OCVB 1PFXC 1HAIH 1Z6EA 3GY3A 2FTLE 3V12A 1WSSH 2ZHDA 1QL7A 1S85A 1ORFA 1QTFA 3F9FA 4ISOA 3SGQE 5EPNA 1TRNA 1T4UH 3QLPH 2ZPQA 1DITH 1DWBH 1U6QA 3PO1C 1PPEE 1HAZB 1EZQA 1BZXE 3A8DA 4OGXA 4B76A 1FMGA 3ENSB 2BDGA 3R3GB 1SG8B 3A7YA 3GY5A 4Z0KA 1XMNB 1TNGA 1CVWH 2G8TA 4XSKU 3BEIB 1UMAH 1HRTH 2HALA 1G3BA 1S6FA 1Q2WA 1SI5H 3SNCA 2BVSH 1BCUH 1C5MD 6CHAC 3TK9A 2NWNA 3PLBA 4A5TS 2PV9B 1LVMA 6GCHG 1ELFA 1DXPA 3URDA 5EW2H 4BAQB 3VXFH 1NFUA 1TABE 1IQJA 2FX6A 3MNXA 4MPXA 1BRCE 2BY6X 4OS4A 5C1XA 3P70B 1BTZA 5LPRA 1A5GH 1ELTA 2PGQB 4H6TA 1CA8B 3OYPA 3AW0A 4D9QA 1FPHH 3PYHA 1A1RA 1QCPA 4AFSA 3LGWA 3SORA 2D26C 1NESE 3S9CA 4ZXYH 4JK5A 1P04A 2CXVA 1IQFA 1TGCA 1GI6A 4ISLA 1ESBA 2Z9JA 3TVJB 3SU3A 1J14A 3PTNA 1SLXB 1V2UT 2QIQA 1E38B 1YPKH 3KHVA 4TPIZ 1DSUA 3A82A 3C27B 2ZNKH 2FYQA 4HFPB 2ZCLP 1YPLH 1GG6C 2AEIH 1BUIA 2UUKB 1GBFA 3E8LA 1GJDB 2GCHF 4MNWA 4ZHMU 3SQHE 4JYVH 3P8NA 1SGTA 1NRRH 5J4QA 1D9IA 1EAXA 3MH6A 5FAHA 1TGSZ 1OWHA 3MH5A 5DKMA 2A32A 1EP6A 2FYRA 3LGTA 1O39A 3DFLA 5F8ZA 4X2YA 1IHSH 2BDAA 2GV7A 3E90B 3CENA 4Q80A 1C4U2 1JIMA 1GBTA 3C1KA 2M5TA 1P2NA 1O3GA 2BB4A 5T6FA 1ESAA 1SLWB 1IQLA 1XM1A 2BVRH 1J16A 1HIAA 9ESTA 1TBRH 1SB1H 1BMNH 3RXPA 1SGFG 1SHHB 1GG6B 1S81A 4ABEA 3UOPA 2AS9A 2ZDNA 1T32A 5E2OA 1GJCB 1BBRH 1CT0E 1GI3A 3SW2B 3VEQB 2A7JA 2ZFRH 1BJUA 1ZMLA 1SMFE 2SNVA 4OS7A 2H6MA 3KEEA 3K6YA 3TH2H 4X8TH 2BX3A 1T8NA 2F3CE 1CGJE 3RXBA 1BBRE 1LTOA 1GMCF 1CBWC 1TMBH 3RM0H 3T25A 1MCTA 3A89A 1KTTB 2JH5D 3RXQA 1MD7A 5FCKA 1UTOA 2OTVA 4B71A 1BRAA 1E37B 3E91A 1OP2A 1QBOA 1T8MA 4O3UA 1HAOH 3L6PA 1EPTA 3RP2A 2HRVA 4UD9H 5CHAC 1EPTC 1GDNA 1LHDH 1E34B 2BD3A 2ZGCA 3UNSA 1ARBA 1HIAB 1QRXA 2ZU5A 5C1UA 1W0ZU 1SGIB 3BTME 1QNJA 4A1TA 1P2JA 1QHRB 2GP9B 3SO3A 2XCNA 1W0YH 3P6ZB 1G3CA 3SV2H 2GGVB 2VWLA 2ZFSA 3MI4A 5FXLA 1Z71A 1DM4B 1GHBF 1O2WA 1C1OA 5FBIA 2XRCA 1PQ7A 1CBWB 3GCHB 4AZ2B 2V6NA 4IBLH 3SNAA 3SNDA 5BPEA 1LQEA 3SV9A 1ZPZA 2GTBA 1B5GH 1TMUH 3PMHB 1NM6A 4DW2U 1FLEE 1L0ZA 4AB9A 2P8OC 2F9BH 3MTYA 5C3NA 1VITH 1LQDB 2TGPZ 4ZKSU 5CHAB 2BOHB 1QB9A 3TGKE 1KTSB 1P2OA 2W5EA 2BHGA 3U69H 1C5VA 1P2IA 1F0RA 2BYAX 2HOBA 1L1GA 2BZ6H 3NWUA 2F91A 3ZZDA 1GL1A 1EZSC 2W7SA 3HKIB 1MKXH 3MNBA 3SV7A 4D9RA 2Y6TA 1QA7A 2BTCE 3UY9A 3OTJE 1AVGH 1XXDA 2HVXA 2V35A 1XUIA 3LGYA 3SV6A 2WPKS 1QY6A 2FIRH 1YM0A 1HAHH 1DFPA 1O3BA 2O8TA 3Q3KA 4XBBA 5B6OA 2AIQA 4H4FA 4CREA 7LPRA 4UDWH 3EYDA 1DVAH 2QXGA 1DY9A 3GICB 3RXRA 4IC6A 2BD5A 3RXCA 4YM9A 4IN1A 3TK5A 2BZAA 1TA2A 3PWCA 2P8OB 3Q00A 2EI6A 2QXJA 1TNLA 2P3TB 1GHZA 1GMHG 3GCOA 3H7TA 4OS2A 4F49A 3SHAH 1K1NA 2OINA 1FIZA 3BTFE 2VJ1A 4ZKRU 3H5CB 2NU4E 1E36B 3L33A 2A2XH 1MQ5A 2FP7B 1GBHA 1AZZA 1WU1A 4AFUA 1ELDE 2Z3EA 1XXFA 1Z8IB 3BG4C 3F9HA 1ZHPA 4TYDA 1D6WA 1O5DH 1AMHA 3SUFA 3ODFA 1O3DA 3DUXH 6GCHF 1C1UH 2QA9E 1DY8A 1GHAF 1QBNA 1LVYA 1K1LA 5EPYA 1A7SA 5IYTA 2FOEA 1NC6A 5A8XA 1K1OA 2FS9A 4X1PU 1D3TB 2ZHQH 5G4BA 1A0HB 2A5KA 3MOCA 1RJXB 1LKAA 2TRMA 2ZFQH 3EA8A 4CR9A 2XBWA 3SHCH 1H8IH 1L1JA 1ZTLA 3NXPA 1TGTA 5E0JA 1O3IA 3NUMA 1H9IE 1TWXB 1GBCA 4AX9H 4ZMAH 4LOYH 3AAUA 1OWJA 1ABJH 1BT7A 3Q77A 1PQ8A 4Q7YA 4KELA 1SLVB 4X8VH 1SR5C 3V7TA 4KTSA 2KAIA 1G37A 4YO9A 5A0AE 5LGOA 4BXSA 1GI9B 5E0HA 2OC1A 4K60A 1C9TA 5JBAS 2FI3E 1A2CH 2O8UA 2AYWA 3F1SB 1MKWK 2VIQA 1ELAA 3IITA 4JZIA 4MQAA 3M5LA 3GDUA 1WYKA 3U9AH 1AIXH 1O31A 4GAWA 4HZHA 4NA7A 3W95A 2ZGHA 5C20A 1GJ8B 1C4Y2 1QURH 3RC6A 7ESTE 3DA9B 1OX1A 1G30B 4BTIB 2ZC9H 1GI5A 1GJ5H 5C5OA 2QF0A 5FBEA 3ZV8A 3MHWU 4Y0ZE 1MUEB 4KKDA 3RXAA 3SUGA 1Y3YA 1AE5A 1GJ4H 1Z1IA 1GMDG 1E0FD 3M36A 4INHA 4JCNA 4OS5A 3LKWA 3ZVFA 4FUHA 4DT7B 1ZHRA 5GPIB 1RFNA 4FVDA 1GPZA 5PTPA 1DLEA 1VR1H 1O5BB 4BOHA 4ABDA 3M5MA 1WTGH 2ZHEH 4I33A 1GI2A 1MZDA 5JB8S 1O2JA 1QA0A 2WINI 4X2VA 2A0QB 2OUAA 2BMGB 4TPYA 4ISNA 1DT2A 1MMJN 2FXRA 2XC5A 4YZUA 4XE4A 2ZIQH 3LIWA 1ABIH 1V2JT 2J92A 2WUBA 3M61U 1BTYA 2BXTH 3ZZ6A 2W7UA 1UTNA 1LKBA 1VITF 4B2AA 1AKSB 1OYQA 1TX7A 1C2DA 2ZCHP 4DOQA 1GWAA 1DLKB 4FU8A 2YOLA 4FUIA 3JZ2B 5DG6A 1FDPA 1FN6A 1O0DH 1P9UA 4BTTB 1G36A 3TPIZ 5GXPA 2FOBA 2IJOB 1O5GH 2DE8A 1MAYA 1D3DB 3ZZAA 1L2EA 1G3DA 4Y11E 5LH8A 2XBXA 3P8OA 1HFDA 1EP5A 2QY0B 5GCHG 3GY6A 4F4OC 4YESB 2GZ7A 1Q3XA 4A92A 4NFFA 1O3LA 1O2UA 5GWZA 1O3EA 2GD4B 4WMFA 3A7TA 5DP3A 1O35A 1RRKA 4DJZB 3SU5A 4YT7H 1O2GH 1KXEA 1Z8GA 4TY7A 2BXUH 2CJIA 4ZXXH 1C5TA 2WUCA 3IWMA 1UHBA 3LH3A 4JZDH 1T8LA 1O3AA 4Q7XA 1ZR0A 3SNBA 3ZZ5A 2EC9H 1A0JA 1UTJA 3SJOA 3ZVBA 1KLTA 3BN9A 3RXOA 1F2SE 2GCTB 1MH0A 1F0UA 3RXHA 1GMCG 3IG6B 5AFZH 1G2LA 4FUJA 3KQCA 2XBVA 1V2VT 1C5SA 2FESH 1DE7H 1QJ6B 1EAUA 4B1TA 5DP4A 1S82A 1ANDA 4BTUB 4VGCC 2R2WU 3GY4A 1ZMNA 2FI5E 1RTKA 3MU0A 4ESTE 1V2TT 4ABIA 4H6SB 1Z7KA 4NFEA 3SU0A 2Z7FE 2SGDE 1O3CA 3M35A 1UHBB 5TCCA 7KMEH 2FOMB 1GHVH 2SNWA 1EQ9A 1K9OE 1ZRBA 1LPZB 1Y3UA 2GMTC 1F92A 3PMJA 3KL6A 1DOJA 1OWKA 1EXFA 3V13A 1ZTJA 7GCHF 1GHBG 1O3FA 2H9EH 1K28D 1P3EA 3R0FA 3ATWA 4Q2KA 4CBNA 3RXDA 1O2HA 4WH8A 4GUXA 2GDDA 1HPGA 1O5CB 1MCVA 1HXFH 4NIXA 1K1IA 2BLWA 3TJVA 5FCRA 1ZPCA 1IQNA 2FPZA 3A8CA 1JBUH 4A6LA 3ZYDA 4XOJA 1ZGIA 1C5ZB 2ZFTA 1KY9A 1AGJA 1IAUA 1N6YA 2CHAC 1UVSH 2ZU1A 1C5UA 2Z94A 3SGBE 1HAPH 1P12E 2ZU2A 2P94A 4UFEH 3ZVDA 3AW1A 1D3QB 3QTVH 3ATLA 3AAVA 3UIRA 4MNYA 1BBRK 2J94A 2B9LA 3FP8E 2I6QA 3KGPA