2SFAA

Serine proteinase from streptomyces fradiae atcc 14544
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
191
structure length
191
Chain Sequence
IAGGEAIYAAGGGRCSLGFNVRSSSGATYALTAGHCTEIASTWYTNSGQTSLLGTRAGTSFPGNDYGLIRHSNASAADGRVYLYNGSYRDITGAGNAYVGQTVQRSGSTTGLHSGRVTGLNATVNYGGGDIVSGLIQTNVCAEPGDSGGALFAGSTALGLTSGGSGNCRTGGTTFFQPVTEALSAYGVSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SERINE PROTEINASE
publication title Purification, characterization, primary structure, crystallization and preliminary crystallographic study of a serine proteinase from Streptomyces fradiae ATCC 14544.
pubmed doi rcsb
total genus 49
structure length 191
sequence length 191
ec nomenclature ec 3.4.21.-:
pdb deposition date 1994-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sfaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sfaA01
3U8TH 1Z8JB 3F9GA 1UVSH 2IOTA 1HAVB 2VIOA 1KXFA 1TRNA 3TH3H 1NRNH 1NN6A 1E34B 3RLYH 3VB6A 4K1SA 1KLTA 1SGFA 1WQSA 1BHXB 1BRCE 1H9IE 1V3XA 2HNTE 1LCYA 4Y11E 3BTGE 4ZAEA 1FMGA 3K6YA 1HYLA 1YPHE 2FM2A 1T7CA 5GXPA 4DIHH 1KTTB 3ODDA 1SVPA 5PTPA 5F8TA 1SQAA 4ZROA 3EQ0H 1QRZA 2SGFE 1HUTH 1O5EH 4JYUH 3O8RA 5A8YA 5EW2H 1V2QT 1C5TA 1AHTH 3DA9B 1AZ8A 2QY0B 3P8NA 3IG6B 1TNKA 2ZQ1A 1ZRKA 3KL6A 3RXFA 4OS4A 2Z94A 1O3BA 2A5KA 1TPAE 2DE8A 2Y5FA 3NUMA 5DO4H 2VVVA 4MNXA 4ABIA 2O8UA 1C1VH 1NFUA 3Q3YA 4HI3A 2TGDA 5I46H 1FJSA 1YGCH 4JCNA 1O3IA 1OPHB 1DUEA 1SGPE 4ISNA 1CGHA 1NRQH 1BTPA 1ZPCA 2EI6A 2ZP0H 2ZTZA 3HKJB 4I8GA 1SC8U 2D2DA 1C1UH 3TJVA 2F9UA 1W7GH 1X7AC 3BSQA 4DVAU 2KAIA 2ZFTA 1SGFG 1AI8H 2TRMA 3RP2A 6ESTA 2H5DA 3ATMA 2QA9E 1G3DA 3GY5A 2F91A 1YPEH 1EQ9A 3ZVEA 1AE5A 2YOLA 1GHAF 1MMJN 1O2OA 2QV1A 3KQCA 2BQ6B 2BDGA 2FX6A 5FBEA 2BM2A 1GVZA 5HXFA 1GBFA 4X6PA 1SOTA 1A0JA 1NFWA 1T8MA 3Q3XA 3SI3H 1UTJA 2P16A 2ZNKH 1N6XA 3SNCA 2RA0A 1FLEE 2H1UA 1LHGH 2ZO3H 1P9UA 5FXLA 1EOLA 1AB9C 1GHAG 2Y6TA 3O8CA 1KDQA 1ZHMA 3LONA 2G00A 2LNCA 5SGAE 4OS5A 2ZHFH 1AB9B 1DSTA 1F0UA 1OX1A 4BTTB 1RS0A 1JXPA 2ANWA 5T6FA 3SGQE 3QDZB 2SGPE 1MU8B 1C2GA 2ZPRA 1SGYE 1Y5AT 1TIOA 3ESTA 5LH8A 1PPFE 1F0RA 1DUAA 1GJ7B 1O3FA 1S5SA 5EQRA 3OTJE 1QGFA 3SU6A 2Y81A 4X6MA 1WU1A 5HGGA 5C1UA 1HAXB 1OYQA 4I33A 1S6HA 6GCHF 3RXPA 1AFQC 1BMNH 3RXOA 3ZZ9A 3S0NA 2Z9LA 4XOJA 1OXGA 1NY22 2D1JA 5EODA 3FZZA 3MFJA 3RC4A 4TWWA 2P8OC 4UD9H 1DVAH 1XM1A 1Z1IA 4ZXXH 1AFQB 5EPNA 2BZ6H 1ARBA 2ZU5A 4DJZB 2BVSH 2P8OB 1W12U 6GCHG 4Y8ZA 2B8OH 3KGPA 3P8FA 1YP9A 5FX6A 3U9AH 2FO9A 2NU3E 2P59A 1EJMA 1QCPA 4HFPB 1OWEA 2GT7A 2VVUA 3ZVFA 3S9AA 2ALVA 2CV3A 4ABEA 4ABFA 3DT0H 4Y10E 1O3KA 4IBLH 5EQQA 1O3EA 3PTNA 1FPHH 2J4IA 1QL8A 4X2VA 1BTZA 4A6LA 4BOHA 3GY4A 4XBDA 1LHFH 2UUKB 3A7YA 5TCCA 1MKWH 1GBBA 1ELGA 4KGAA 1TMBH 3E0NB 2FI3E 2SGAA 3M3TA 4WJG2 3RU4E 2FS9A 1GDNA 3AW0A 1GHBG 1C5QA 1KY9A 4CRFA 1IQMA 3A83A 4AORA 1AVXA 3FP8E 1TNJA 1GGDC 5GIBA 3ZYEA 5ABWA 1ARCA 4IMQA 1XVOA 2BMGB 3BEUA 4GPGA 1EX3A 4KTCA 2QF3A 1GG6C 3D65E 3MO6A 1GL0E 4X2WA 3VXFH 2C3SA 1GGDB 3VB5A 3I29A 1O2MA 3ENSB 1T31A 2AYWA 3KHVA 2BY5X 4NFFA 1GG6B 3SUFA 1DM4B 1PPHE 2HNTC 1PQ8A 1AWHB 3PMHB 1YPHC 2LPRA 5IDKA 1WUNH 1TGCA 2J94A 3C1KA 4FUIA 3PMJA 4X2XA 1G37A 2VIVA 1G3BA 3F9FA 2XXLA 3RXSA 2PKAB 1V2ST 1P12E 3RXDA 3A8DA 1GJCB 3GYMA 2QXJA 4BANB 5HM9A 3RXQA 1NM6A 2A7JA 3A85A 1GJAB 1ZYOA 3PLBA 3RLWH 3E6PH 1GJDB 2QXGA 2Z9KA 3EA8A 1H9LB 4AGKA 1CU1A 4R0IA 4O9VA 4FUHA 2R2MB 1PPBH 3QTVH 4DGJA 3A80A 3MO9A 2ZPSA 5C1YA 3RXUA 3V7TA 1FUJA 1NROH 1GVLA 1DANH 3QZRA 3V0XA 1CA8B 1HAHH 1ZGIA 5IYTA 2WPKS 1MTNC 2XTTB 2XC0A 2BLVA 5DP5A 1G2MA 2PHBA 2ZKSA 3URCA 1E37B 3T27A 1O5BB 1A5GH 1ZRBA 1MTNB 1P2OA 2BYAX 4PROA 3U98H 1ABIH 3PMAB 5DP4A 3OU0A 3LDXH 1JIMA 2PGQB 1HAYB 2VWLA 1NC6A 1GJ5H 1FN8A 1UTKA 1ETRH 4IGDA 4MG3A 2BD2A 5A09A 4B75A 2PFEA 3BTDE 1C2EA 4Y71A 3DHKH 1DLEA 1TFXA 1S84A 2GMTC 4DIIH 3QZQA 1A7SA 4A92A 2FEQH 1HJ8A 2FZZA 1P8VC 3HATH 1SSXA 3B9FH 4JYTA 3RXMA 4XBBA 3PB1E 2GMTB 1QB1A 3UWJH 2F3CE 4H4FA 1SGCA 1DOJA 1D9IA 1T4VH 4NSVA 1VGCB 2Y82A 1P57B 3E16B 1HJAC 1DXPA 1BQYA 1B0FA 3ZV8A 1V2TT 3QGNB 3SV6A 1SLUB 3G01A 1GI4A 1VCQA 1HJAB 1E35B 4OS7A 2K1QA 2CJIA 3B8JA 1H4WA 3S7HB 1HRTH 2ZGCA 4AFZA 1C1QA 3RXIA 1S0RA 2ZGXH 1IQJA 3MU8A 4UFFH 5J4SA 4NIVA 5A2MH 5L2ZH 3MH5A 3NCLA 3EAJA 3SV7A 3HK6B 2H9HA 3CENA 4F4OC 1HIAA 4Q80A 2AMPA 2BY8X 5C1XA 3GY6A 1DX5M 3V13A 3D62A 3P70B 4BAKB 4RSPA 2V3OH 3MH6A 2OC8A 3SV9A 2ODPA 3UOUA 2ZDKA 3P17H 4BTIB 2A4RA 1IAUA 1D3DB 2ZCKP 4OGXA 1MCVA 3GY8A 2GDDA 2WPIS 5GPIB 4LZ4B 2XBVA 3MMGA 1O2IA 1RIWC 4O3TA 4UDWH 3T2NA 1KXCA 3B23B 1CT4E 1GMDG 1YF4A 1FAKH 5A0AE 2Y7XA 5CHAC 2I6SA 1SLVB 1O3AA 1C5YB 3SJ9A 5BRRE 3AVZA 3FZDA 1F5KU 4HZHA 1SLWB 1C5WB 2J2UA 1THRH 5CHAB 1OWKA 4YESB 1K1OA 1O2XA 3LGVA 2G5NA 5E8EH 3H7OA 5EPYA 3PO1C 4WF8A 1CT0E 2TGPZ 1GI8B 4IC5A 4X1NU 2C90B 2GGVB 3A7XA 6CHAC 1W7XH 2VIWA 3MU0A 4IMZA 3PO1B 1Y3UA 1PFXC 2HALA 3SV8A 1G30B 1HAVA 3LT3A 1MKXK 1S83A 1VR1H 1SB1H 1WQVH 5EOKA 2G81E 2GV6A 1GCDA 2FMJA 3SJKA 2GX4A 6CHAB 1FY8E 2PUXB 1BDAA 1UTQA 3ZVAA 3I77A 4GUXA 1CA0C 2OBQA 1GI0A 2C8YB 1P2QA 4JZEH 2YNBA 1ETTH 4ZXYH 4FU9A 2P3FH 1KIGH 3F1SB 4UFGH 1GI2A 3FANA 1S6FA 5DP8A 1YCPH 2FOMB 2GTBA 2WINI 5E0HA 1XUFA 1UVTH 1P04A 1FONA 1C1RA 1QL9A 1EP6A 4ISIH 2Z3CA 3HGNA 1MBQA 1MCTA 1QBOA 3SBKA 3MH7A 1NZQH 1GI7B 1DWBH 3T29A 3ZVCA 1TNIA 3KEEA 3JZ1B 3RM0H 1MZDA 1O2JA 5JB8S 4UFDH 3A82A 1AQ7A 4I8JA 1BRUP 1YLCA 1UVUH 1CVWH 5F8XA 1TWXB 4AX9H 4WVPE 1JWTA 1HXEH 5AFZH 2TIOA 1GBJA 2Y5GA 5L2YH 2ZZUH 2ALPA 3SU0A 4K8YA 4NCYA 4ASHA 1ELVA 4CREA 1BMAA 4DY7B 1SL3A 4A7IB 5C5NA 1ZJDA 4MVNA 2QF0A 2H6MA 3VB4A 1A5HA 1QIXB 1BHXF 1ESAA 1J9CH 3LH1A 1AZZA 4D9QA 1MZAA 1TQ7B 3SUEA 4SGBE 2AGIX 4TWYA 1O3DA 1FDPA 3A7VA 1HGTH 3EE0B 1TOCB 4WXIA 1L0ZA 2GZ8A 2BY9X 2WPMS 4X2YA 1P01A 2BDHA 2A2QH 1ESBA 2FLRH 3QUMP 1L4ZA 1K22H 3RMNH 2G8TA 1A2CH 1Z7KA 2I6QA 5BPEA 1L1GA 1LO6A 4X1RU 1UTLM 2PKSC 5LGOA 2PR3A 2ZHWH 4SGAE 3RC6A 2C8WB 1TMTH 2EI8A 4GVUA 2UWLA 1O2NA 1NU9A 8KME2 1LHCH 3IWMA 2Q6FA 4JZ1A 1OP8A 2PKSB 3SI4H 2GVFA 1Z8IB 4MNWA 4X6OA 3NK8A 2D8WA 4WXVA 1HNEE 4K5ZA 5A8XA 3T5FH 5EQSA 2A45B 3NXPA 1F2SE 1O34A 1O35A 1BA8B 1C2LA 1YYY1 2FX4A 3AAVA 3GDVA 3ZZBA 1GI3A 3STJA 4ZMAH 5LPFA 3RXBA 4NIYA 4WH8A 2ZFPH 2JETC 1W10U 1SGDE 3UUZA 3RXJA 1SGNE 2P94A 3FAOA 4LXBH 3NZIA 1GHVH 4TY6A 2A4OA 1OS8A 1F0SA 1P05A 2JETB 1V2WT 1EAWA 3TGIE 3NKKA 2A4QA 1UVOA 1L1NA 2AH4X 3TH2H 4HTCH 4X8VH 5F03A 4WY3A 1UTOA 1SGEE 4NIWA 4CRGA 3GY2A 1W8BH 2VNTA 2QXHA 3H7TA 3U8RH 2P3UB 4IS5A 1FI8A 3LC5A 2HOBA 1PQ5A 4YZUA 3VGCC 1SPJA 1Y3YA 3QO6A 1O3MA 2BD9A 4LK4A 3UY9A 3RMLH 1JRSA 1H1BA 4FXGH 3DUXH 5GDSH 2BVRH 3VGCB 1FY4A 4U32A 1LQEA 2WYJA 1UCYK 3I78A 4K1EA 4DW2U 1A0LA 1HAGE 3ZZ8A 2GD4B 1SBWA 1YM0A 1ZJKA 1C5MD 4NWKA 2FOBA 1NFYA 2P3TB 4OS6A 4B73A 1AO5A 1GI6A 4AG1A 4VGCC 4KKDA 1ZMJA 1K28D 3KF2A 1YCPM 1Y3XA 1C1MA 3M35A 3RXLA 3Q76A 3Q3KA 3A8BA 4OS1A 2AGEX 4AB9A 4AYVB 2J92A 2ZFSA 1RGQA 1DT2A 1UHBB 3P95A 2V3HH 2G4UA 4I8LA 1GVKB 3K9XB 1HB0B 1BTWA 2FLBH 5C5OA 1OYTH 1YCPK 2WPLS 5A8ZA 5EXLA 4OGYA 2FOHA 3M7UA 2A7CA 2YNAA 4D76A 1V2UT 1JMOH 4INHA 4RN6A 1P2IA 1AD8H 4GLYA 3MNBA 3A84A 1AVGH 3ZZAA 1BTHH 3ITIA 3LKWA 1SHHB 3KQEA 1KXEA 5CE1A 1TPOA 1UCYE 2BX3A 4DURA 5JYIA 4FVBA 1C9TA 1F0TA 4IC6A 3KN2A 1K2I1 3VPKA 4FUJA 1ZSKA 1AMHA 3A88A 3GCTF 4Q7ZA 4BXSA 2PKAA 1THSH 1UK2A 1SQTA 4ZUHA 1IQFA 2OD3B 1KXBA 2XW9A 3E91A 1NT1A 2BQWB 2O8LA 3TJUA 3VB3A 2OINA 9LPRA 1BTUA 1J14A 3PWBA 2TBSA 2EI7A 2NU2E 2XBWA 1TRMA 1O2LA 3GCTG 4ESTE 3SU4A 1HXFH 3ZV9A 1GDQA 1QB9A 4I8HA 2XCNA 5DP9A 1C2IA 3P92A 2W5EA 1FAXA 4Y7AA 4ISLA 1H8IH 2J38A 3SUGA 1SOZA 1KXDA 3QN7A 1FPCH 1O2ZA 2A4GA 2UWPA 1BJUA 4IN2A 5FX5A 2OC1A 1IQEA 3QX5H 1FIWA 1SHYA 1S82A 2BD3A 4ABJA 3ATKA 1TBQH 2STAE 4ZHAA 2WV4A 3ZZ5A 2FOFA 1T4UH 1SGTA 1E36B 1ZSJA 2HNTF 3KQBA 1O33A 2FIRH 3ZZDA 3PLPA 1B7XB 1ELBA 4YLQH 3TH4H 2RDLA 1C1OA 1K9OE 3SJ8A 3RXAA 1D3PB 1P2JA 1HAPH 1QRXA 2SGDE 1DSUA 1KLJH 1MTWA 3MNSA 1CQQA 4ZKRU 5FCKA 1XUJA 4NG9H 1BBRH 4ISHH 4TYDA 5FHTA 2BXUH 4K8BA 3S69A 3SU5A 1HAIH 3PLKA 2Q6DA 3A7TA 1TGBA 3ZYDA 5TJXA 2BDYA 2QXIA 3U69H 1YBWA 1Z6JH 3BTFE 3K65B 1GBEA 1O2KA 3ZVGA 1A61H 4GCHF 3SZNA 1MQ5A 1ZTLA 1CGJE 2A5AA 2CF9H 1GMHF 3BTTE 2G52A 1ELFA 1QBVH 4E7RG 1MTSA 1NPMA 1NESE 3EDXB 2ZDAH 3SNEA 4OS2A 1TNLA 1O3NA 2ZCHP 1A1RA 3SHCH 7ESTE 2ZI2H 3D49H 4GCHG 2FDAA 1P11E 3SW2B 1GPZA 1AFEH 1NTPA 7GCHF 1GMHG 2XRCA 1EZSC 3MNCA 2A1DB 4AZ2B 2FTLE 2SNWA 2NU4E 4ZKSU 1O3CA 5GWZA 1O3HA 1HFDA 4O03A 2BD8A 2J9NA 3RU4T 2GDEH 1MAYA 3NPSA 1LHDH 1TALA 5AF9H 1NFXA 1O31A 5CMXH 3MTYA 3VEQB 2AMDA 3FP7E 3TJNA 1D6RA 3FVFB 4NZLA 1JOUB 2GT8A 7GCHG 2ZTYA 1TRYA 4TPYA 1AY6H 1O5CB 4DCDA 1QA7A 3A89A 3LGTA 2FOAA 1GBHA 3RXTA 3MYWA 2OBOA 2UUYA 2F9PA 1K1MA 3L6PA 1TNHA 1WOFA 4B2BA 3GY7A 1ZR0A 1WBGB 4Y8YA 3SJIA 4CRDA 4NGAH 1AKSB 2ESTE 1AWFH 1OKXA 2JKHA 1FIZA 3GDUA 3HPTB 1QR3E 1C1WH 1O5AB 5T6DA 2WPJS 4AFQA 2FESH 3M5OA 1T32A 1AIXH 2BD5A 2DUCA 2ODYB 1RXPA 5A0CA 4MPVA 4AG2A 1CHOF 2XWAA 1C5VA 1QRWA 1J15A 1IHTH 2Z6BD 1XUIA 1SGQE 1T8OA 3TU7H 1J16A 4J2YB 2BY7X 5G4BA 3JZ2B 4MNYA 2FOCA 2TGAA 2P93A 1MTUA 1YPJH 2VWNA 2ZU3A 1LVMA 1A5IA 1C9PA 2OCVB 4CHAC 1CHOG 2FWWA 1RTLA 2WV5A 5DP6A 1OSSA 2VWOA 2ZU1A 2H5CA 2HPPH 2W7UA 1EZQA 1A3EH 3M5MA 4CHAB 2NU1E 2UWOA 5AHGH 1V2JT 3E3TA 2BQ7B 1O5FH 2BXTH 4U30A 4XSKU 1OWJA 1OP2A 3MO3A 3TLOA 1EPTC 5EU8A 3GYLB 1SGRE 1GI1A 1BTXA 4WH6A 1O3PB 2B0FA 1NRPH 2O8TA 1DE7H 3BF6H 1ZTKA 1QQ4A 1YPGH 1ZMLA 2PSYA 1EPTB 1D4PB 1A4WH 1MAXA 2ZDNA 4O3UA 3RXGA 1C2HA 1TE0A 3O8BA 3RXCA 4CRBA 1IQKA 1G32B 1L2EA 3EA9A 1KYNA 1LVYA 5EXNA 5TCAA 5DJ7A 5JBTA 3TIUA 4O97A 2FOGA 4FU8A 1AGJA 3BTME 2ZFFH 1C1NA 2VU8E 3RXKA 7KMEH 1ZTJA 3HGPA 2VH6A 4BXWA 3OX7U 2V0BA 2WUBA 3QGJA 1C2KA 1EATA 2A0QB 2EC9H 2F9BH 3A86A 2HWLB 3LJOA 1BBRK 3OYPA 2SFAA 1HV7A 1MKWK 4K3JA 1MUEB 1O2RA 1BUIA 4M7GA 4X1PU 2PV9B 3VB7A 1RFNA 2F9NA 4KP0A 3F68H 5HMAA 4JK6A 1RIWB 2V6NA 1IQHA 3UNRA 1T8LA 1LPGB 1Z8RA 1QQUA 1FY1A 4FUBA 2CF8H 1C5NH 2Z9GA 1O37A 2ZGHA 3GICB 1GBMA 4K69A 4AB8A 1CE5A 3SU1A 3PMBB 1RRKA 2O8WA 1S81A 5F6MA 3ZZ4A 2A5IA 3UFAA 1A3BH 1V6DA 2TPIZ 2W26A 2QGRA 1C5PA 3M3SA 1BZXE 3FP6E 3R3GB 4E05H 1OWIA 5E0GA 4XBCA 1LTOA 1LKBA 3UTUH 3SQEE 1F92A 3SHAH 2FYRA 3KNXA 2NU0E 2J95A 1DY9A 4KELA 3CS7A 2O8MA 2ZFQH 3RMMH 1DITH 2ANMH 5HYOA 1ANEA 1C4Y2 1CA0B 1BIOA 1EP5A 1GJ9B 3OY5U 4FVDA 4BTUB 1DWDH 1W0YH 1M9UA 1XXFA 1SMFE 1W11U 4RKOB 4K2YA 4MDSA 2BOKA 1O2SA 1H8DH 1K1NA 1LMWB 4BAOB 1PPEE 1GJ8B 4UFEH 5GCHF 1ANBA 1BCUH 4X1SU 1Y8TA 4D9RA 4B2AA 1Q2WA 1YPLH 1NS3A 1GHYH 1YPMH 1GHWH 4YM9A 1HAZB 1O30A 2ZDLA 1EAXA 1RTKA 2HVXA 1GBDA 1DXWA 2WYGA 3PV4A 4FU7A 1TA6A 2GCTC 3BG8A 1HPGA 2BLOA 1W2KH 1MD7A 4CH8B 1ZMNA 5HM2A 1SLXB 5GCHG 1GJ6A 4Y7BA 3WY8A 3MU4A 2GCTB 1P09A 2PLXA 3EA7A 3AASA 1TYNA 5FPYA 4MLFB 5B6OA 1P02A 1ELAA 1TNGA 4CRAA 3TVJB 2AERH 1BB0B 3T26A 1Z6EA 2VH0A 2BY6X 4DT7B 2QAAA 4ZHMU 1QFKH 2W3KA 1C5RA 4AYYB 3LGIA 1V2PT 1CBWC 2XWBI 1O0DH 3TNTA 1U6QA 1G3CA 1XVMA 1ZPZA 2J34A 1CBWB 2CMYA 2V35A 3PM3A 3FFGA 1C5OH 1A0HB 1GDUA 3MOCA 5DP7A 2RCEA 1SG8B 1Z8GA 4B76A 5E0JA 1G36A 3KCGH 2CN0H 3A7ZA 2ZF0H 4YT6H 3UIRA 1VJAU 1WYKA 3HK3B 1O38A 3E90B 5C67A 1O32A 4YTAA 3MNXA 5LPEA 1BT7A 2C8ZB 3LGWA 2AFQB 1MTVA 1KXAA 9ESTA 7LPRA 4WMFA 2XBYA 1TAWA 3E8LA 5EG4A 2PTNA 3S7KB 5JBCS 3D23A 3ATIA 2ZC9H 1GWAA 1TBRH 2GP9B 1NO9H 1D6WA 3RMOH 3GDSA 5K0HA 2A32A 1N1LA 2R0KA 2Z9IA 2R3YA 2BHGA 2PUQH 2OQUA 2AIQA 4XFQA 1BRBE 2ZDMA 1N8OC 1AUTC 3EGKH 1O5DH 2XNIA 1ZHPA 4H6SB 2TGTA 3UQVA 1SI5H 3SQHE 2ULLA 2ANYA 4Y8XA 3H5CB 3HKIB 1G9IE 1PQ7A 4ABHA 1O2GH 3LH3A 1N8OB 2XBXA 3GISB 1MU6B 2AMQA 1LHEH 5C2ZA 1ZLRA 1P3CA 1TX7A 1QURH 1ELEE 2FI4E 1TX6A 4Y0YE 2DE9A 5A0BA 2VB0A 4Y6DA 4X6NA 1IQGA 2C8XB 3ATLA 3W95A 1FXYA 1H9HE 2VINA 5C20A 2B7DH 2G5VA 2OP9A 3BEFB 1NU7B 3M36A 1Y3VA 3SUDA 4FUFA 1E38B 1GI9B 2AS9A 3ODFA 3O8DA 3M7TA 1IOEA 4B74A 4BNRA 2NWNA 2CHAC 3M3VA 4NWLA 1DPOA 1WTHD 8GCHF 4K1TA 3A7WA 1PPCE 5JPMH 3N7OA 1QJ6B 1JBUH 2Z9JA 1DWCH 2CHAB 3MI4A 3LU9B 4B1TA 1AVWA 2ZFRH 2G4TA 2B5TB 4BAQB 1O3OA 2AGGX 4H6TA 2A7HA 2O9QA 1TQ0B 1V2NT 1EZXC 4VGCB 4AFUA 4Z6AH 2C93B 1WAYB 1SR5C 1F7ZA 2QC2A 4E06H 1GI5A 1SFIA 3SU3A 3QWCH 2BDBA 1UTPA 8GCHG 1V2KT 1K1PA 2HRVA 4Z0KA 3VXEH 2F9OA 1G3EA 3K2UA 1YKTA 2QN5T 4KTSA 2A2XH 5FCRA 4CRCA 3AAUA 3UPEA 4Y0ZE 1IQLA 2SGEE 1C2DA 1GBIA 2OLGA 1O2QA 2CGAA 3GY3A 4YOJA 1AU8A 1SGIB 2OC0A 1C5ZB 4JMYA 1RJXB 4FUGA 3DD2H 4I7YH 3F9EA 1IQNA 4NA8A 1CSOE 3V3MA 1O3LA 1XUKA 1GBCA 1TPPA 1Z1JA 3RUOA 2W3IA 3MU1A 1D3TB 2OXSA 1ORFA 2ZHQH 1PYTC 1INCA 1PYTD 3UNSA 3S9BA 1GHZA 1G2LA 2R3UA 4ZKNU 1ELDE 2Y5HA 1FY5A 2JH0D 1EB2A 1C1SA 2OC7A 3VFEA 2FI5E 3LGUA 2F83A 1VITF 1C4U2 1GJBB 2HLCA 2RG3A 4Y79A 4HGCA 2Z3EA 5JBAS 1J8AA 1YC0A 2BLQA 4CR9A 1L4DA 3R0FA 4X8UH 4A1VA 3GOVB 3TK6A 3UWIA 2RA3A 2W7SA 1Y5BT 1GJ4H 1QY6A 1EUFA 1ZHRA 1VITG 1HLTH 1P03A 1AKSA 3EYDA 2ZDVH 1UMAH 3BTKE 3TPIZ 1XXDA 3CP7A 3STIA 4WMDA 3TJOA 4A5TS 2Z3DA 1O5GH 4AGJA 1GMCF 1MH0A 5FPTA 3F9HA 5AVDA 3T28A 2SNVA 1HCGA 1TONA 1CHGA 1C5XB 4MPUA 2VIQA 5JBBS 2C4FH 2UUFB 3M37A 3RM2H 1Q3XA 5F8ZA 3LIWA 3M5LA 2ZIQH 1UK4A 2B9LA 4QT8C 1GMCG 4NA9H 4MQAA 1MBMA 4GSOA 1EOJA 3SV2H 1EAIA 1DS2E 1DDJA 3LGYA 1PQAA 3SN8A 1TGTA 2ASUB 2PWXA 2GZ9A 1EJNA 3BN9A 1UO6A 2ZU2A 2VIDA 3M7QA 2ZTXA 4H42U 1LPKB 1C4V2 1ANCA 4AFSA 3BG4C 1GHBF 4X1QU 3SNDA 1IHSH 1JIRA 3BTWE 1P9SA 3BG4B 1DLKB 3SNAA 2KAIB 1L1JA 4Q7YA 3DFLA 1EASA 1UTMA 1TMUH 2Q1JA 1GHXH 3KQDA 1EPTA 3ZZCA 2H9EH 1P10A 4DOQA 1V2VT 2UUJB 2EEKA 4U2WA 1BITA 5DKMA 3QK1A 4BAHB 1O2VA 5FBIA 3T25A 1HAOH 2QIQA 1KLIH 3MHWU 3ZZ3A 1FY3A 1DFPA 4I32A 3TGKE 1HBTH 1ACBE 1TABE 1TPSA 4GHQA 1HJ9A 1GBLA 1BRAA 3TK9A 2ZPQA 1GCTC 1TB6H 4MNVA 1MD8A 5DG6A 5ESTE 2FODA 5DPAA 4B71A 2OUAA 1Q31A 2VWMA 1GCTB 1QJ1B 2GV7A 1C2JA 1TA2A 3UREA 1KSNA 1TGSZ 1TGNA 2BLWA 3RDZA 1KDQB 2BDCA 2BDAA 1ETSH 4FUEA 4B2CA 1QTFA 5DP3A 1MKXH 2IJOB 3LC3A 5GJ4B 1K21H 1QB6A 1LPZB 1W3CA 2ZHEH 1O3GA 3E0PB 1WTGH 4JZIA 2GKVE 4Q7XA 1QA0A 4UEHH 3NWUA 4INKA 4ABGA 5C3NA 1D3QB 3U1JB 1PPZA 4U01A 2Y80A 2FXRA 1ZPBA 1P3EA 1YPKH 1DWEH 3OSYA 1ZOMA 2BVXH 4ABAA 3Q00A 3SO3A 4X0WU 2THFB 4MPXA 4THNH 4FUCA 3ZVBA 5ETXA 1VITH 3SNBA 4I8KA 2R9PA 4WWYA 1OOKB 4MTBA 1E0FD 2GCHF 5I25A 1CT2E 1V2OT 1AN1E 1TX8A 3V12A 1V2MT 1GBAA 2FYQA 2OQ5A 2ZWLH 1VZQH 3Q77A 5LPRA 4A1TA 5K7RA 1BMLA 5EW1H 2A31A 2VVCA 1FNIA 1F5RA 2WUCA 4CBNA 4GHTA 2BD4A 4YLUA 2GCHG 5ESBA 1VJ9U 4X8SH 1FZZA 2JH5D 1EKBB 1FQ3A 1T8NA 4CH2B 2HPQH 2VIPA 3RXVA 1LKAA 2XCFA 2FP7B 1AUJA 2R2WU 5E2PA 1C1TA 2PW8H 1K1LA 2ZGBH 1OWHA 1FN6A 1JRTA 1WV7H 1XX9A 3OY6U 3ATWA 3RXHA 4D7FA 1ABJH 1UTNA 2XC4A 2SGQE 1SQOA 2VGCC 1PPGE 4D8NA 1NRRH 1CO7E 3L33A 1VGCC 1P2MA 2F9VA 4IW4E 4E7NA 2VGCB 2IPHA 2EA3A 3QTOH 4IN1A 3UNQA 2BTCE 1W0ZU 5L6NH 4CR5A 1TOMH 4YT7H 1OP0A 2ZG0H 4TY7A 1LDTT 3UQOA 1O2TA 2BZAA 2ZA5A 2JH6D 4ZKOU 5H4IB 3BIVH 1P06A 3CS0A 5FPSA 1QJ7B 3ZVDA 5EXMA 1BTYA 3P8GA 2ZHDA 1O2PA 5AFYH 2WPHS 1O36A 1ZGVA 2CXVA 1NRSH 1DY8A 3KIDU 1J17T 1O2YA 1K1JA 1Y3WA 3PTBA 4ABBA 4ZHLU 1VCWA 2Z7FE 3RC5A 2QYIA 4NZQA 2PTCE 3M5NA 2H9TH 5L30H 3T62A 1ZZZA 2XYAA 4JYVH 2ZCLP 1ELCA 1SFQB 1XUHA 3E1XB 1MQ6A 4XDEA 5E2OA 3P8OA 1N6YA 2Y7ZA 1IQIA 4Y76A 3RXRA 1GMDF 3BIUH 2BX4A 4INLA 4ZH8A 1ESTA 3BTQE 8LPRA 3SJOA 1XMNB 2STBE 4JK5A 1V2LT 5T3HA 2BOHB 3PROA 2M5TA 1LVBA 1V2RT 1UK3A 4NSYA 4JZDH 3BEIB 4MPWA 1S0QA 2AEIH 1A46H 4WMEA 4NIXA 1O3JA 1W14U 2BD7A 3F6UH 1EB1H 3SU2A 2G51A 4UE7H 3TK5A 5T6GA 1O2WA 5JB9S 1WCZA 4I31A 4R8TB 2BB4A 1EZUC 1Y5UT 1UVPA 3S9CA 2PSXA 2OTVA 3A8CA 1UCYH 1BBRE 3ZZ7A 3MU5A 4YOGA 2FOEA 2ZQ2A 3TITA 3U8OH 1WSSH 3C27B 4F49A 3SOSA 1QNJA 3A8AA 1ZSLA 3ZZ6A 4YO9A 3RU4D 1BOQA 2G55A 3A87A 1UJ1A 4Q2KA 1EAUA 1TLDA 1GBTA 3TGJE 1QHRB 1P2NA 3SGAE 1W13U 4NA7A 1RTFB 1S85A 5EGMA 1Y59T 1P0SH 1DICA 1EXFA 1B0EA 4TPIZ 2FPZA 1ELTA 1QBNA 3M61U 5JDUB 2VJ1A 5DK1A 4D7GA 1GBKA 4LZ1H 1Z71A 1C5UA 4AN7A 1ID5H 2D26C 1THPB 3RXEA 1C5LH 3A81A 1CGIE 3GCOA 5DGJA 4ISOA 4LOYH 4XE4A 1BJVA 2ODQA 2ZEBA 2ANKH 2QCYA 3SGBE 1RD3B 1B5GH 8ESTE 2FTMA 2ZU4A 3GCNA 1P2KA 3LOXA 3BTEE 3K6ZA 4X8TH 1K1IA 1PJPA 2ZECA 3PYHA 6LPRA 3UR9A 1C1PA 1O2UA 4J1YA 1FV9A 3TNSA 3ELAH 1LQDB 4KTUA 1UHBA 2XC5A 2IN2A 4K60A 3BTHE 4A1XA 1HIAB 3BV9B 4ABDA 2GZ7A 1TBZH 1EJAA 3LPRA 3DFJA 2R0LA 3SORA 1VCPA 2H2ZA 4NFEA 3UOPA 2P95A 1XKBC 4FUDA 1O39A 3P6ZB 2AIPA 3PWCA 1XUGA 4BAMB 2ILNA 4JZFH 4RKJB 3URDA 1O2HA 3MH4A 3MWIU 2HGTH 3QLPH 1C5SA 1GL1A 3UR6A 3LJJA 1BMMH 2BDIA 1HDTH 2PGBB 1F5LA 5J4QA 1KTSB 4DG4A 3IITA 1YLDA 1OWDA 4AOQA 3L3TA 3GCHC 1ANDA 1C2FA 2FS8A 1XKAC 2ZGJA 4UONA 3AW1A 4YOIA 1LVOA 1C2MA 4GAWA 3U1IB 5FAHA 1AE8H 3W94A 1QL7A 2Q6GA 3GCHB 4CBOA
chains in the Genus database with same CATH superfamily
3U8TH 1Z8JB 3F9GA 1UVSH 2IOTA 1HAVB 2VIOA 1KXFA 1TRNA 3TH3H 1NRNH 1NN6A 1E34B 3RLYH 3VB6A 4K1SA 1KLTA 1SGFA 1WQSA 1BHXB 1BRCE 1H9IE 1V3XA 2HNTE 1LCYA 4Y11E 3BTGE 4ZAEA 1FMGA 3K6YA 1HYLA 1W0KD 1YPHE 2FM2A 1T7CA 5GXPA 4DIHH 1KTTB 3ODDA 1SVPA 5PTPA 5F8TA 1SQAA 4ZROA 3EQ0H 1QRZA 2SGFE 1HUTH 1O5EH 4JYUH 3O8RA 5A8YA 5EW2H 1V2QT 1C5TA 1AHTH 3DA9B 1AZ8A 2QY0B 3P8NA 3IG6B 1TNKA 2ZQ1A 1ZRKA 3KL6A 3RXFA 4OS4A 2Z94A 1O3BA 2A5KA 1TPAE 2DE8A 1YWUA 2Y5FA 3NUMA 5DO4H 5C0TA 2VVVA 4MNXA 4ABIA 2O8UA 1C1VH 1NFUA 3Q3YA 4HI3A 2TGDA 5I46H 1FJSA 1YGCH 4JCNA 1O3IA 2AHME 1OPHB 1DUEA 1SGPE 4ISNA 1CGHA 1NRQH 1BTPA 1ZPCA 2EI6A 2ZP0H 2ZTZA 3HKJB 4I8GA 1SC8U 1FX0B 2D2DA 1C1UH 3TJVA 3F2GA 2F9UA 3KYGA 1W7GH 1X7AC 3BSQA 4DVAU 2KAIA 2ZFTA 1SGFG 1AI8H 2TRMA 3RP2A 6ESTA 2H5DA 3ATMA 2QA9E 1G3DA 3GY5A 2F91A 1YPEH 1EQ9A 3ZVEA 1AE5A 2YOLA 1GHAF 1MMJN 1O2OA 2QV1A 3KQCA 2BQ6B 2BDGA 2FX6A 5FBEA 2BM2A 1BMFD 1GVZA 5HXFA 1GBFA 4X6PA 1SOTA 1A0JA 1NFWA 1T8MA 3Q3XA 3SI3H 1UTJA 2P16A 5HKKD 2ZNKH 1N6XA 3SNCA 2RA0A 1FLEE 2H1UA 1LHGH 2ZO3H 1P9UA 5FXLA 1EOLA 1AB9C 1GHAG 1EFRD 2Y6TA 3O8CA 1KDQA 1ZHMA 1KMHB 2G00A 3LONA 4RT0A 2LNCA 5SGAE 4Q63A 4OS5A 2ZHFH 1AB9B 1DSTA 1F0UA 1OX1A 4BTTB 1RS0A 1JXPA 2ANWA 5T6FA 3SGQE 3QDZB 2SGPE 1MU8B 1C2GA 2ZPRA 1SGYE 1Y5AT 1TIOA 3ESTA 5LH8A 1PPFE 1F0RA 1DUAA 1GJ7B 1O3FA 1S5SA 5EQRA 3OTJE 1QGFA 3SU6A 2Y81A 5KGOA 4X6MA 1WU1A 3OEED 5HGGA 1HAXB 5C1UA 1OYQA 4I33A 1S6HA 6GCHF 3RXPA 1AFQC 1BMNH 3RXOA 3ZZ9A 3S0NA 3U28C 2Z9LA 4XOJA 1OXGA 1NY22 2D1JA 3OAAD 3FZZA 3MFJA 5EODA 3RC4A 4TWWA 2P8OC 4UD9H 1DVAH 1XM1A 1Z1IA 4ZXXH 1AFQB 5EPNA 2QF4A 2BZ6H 1ARBA 2ZU5A 4DJZB 2BVSH 2P8OB 1W12U 6GCHG 4Y8ZA 2B8OH 3KGPA 3P8FA 1YP9A 5FX6A 3U9AH 2FO9A 2NU3E 2P59A 1EJMA 1QCPA 4HFPB 1OWEA 2GT7A 2VVUA 3ZVFA 3S9AA 2ALVA 2CV3A 4ABEA 4ABFA 3DT0H 4Y10E 4AC9A 1O3KA 4ASUD 4IBLH 1SKYE 5EQQA 1O3EA 3PTNA 1FPHH 2J4IA 1QL8A 4X2VA 1BTZA 4A6LA 4BOHA 3GY4A 4XBDA 1LHFH 2UUKB 3A7YA 5TCCA 1MKWH 1GBBA 1ELGA 4KGAA 1TMBH 3E0NB 2FI3E 2SGAA 3M3TA 4WJG2 3RU4E 2FS9A 1GDNA 3AW0A 1GHBG 1C5QA 1KY9A 4CRFA 1IQMA 3A83A 4AORA 1AVXA 3FP8E 1TNJA 1GGDC 5GIBA 3ZYEA 5ABWA 1ARCA 4IMQA 1XVOA 2BMGB 3BEUA 4GPGA 1EX3A 4KTCA 2QF3A 1GG6C 3D65E 3MO6A 1GL0E 4X2WA 3VXFH 2C3SA 1GGDB 3VB5A 3I29A 1O2MA 3ENSB 1T31A 2AYWA 3KHVA 2BY5X 4NFFA 1GG6B 3SUFA 1DM4B 1PPHE 2HNTC 1PQ8A 1AWHB 3PMHB 1YPHC 2LPRA 5IDKA 1WUNH 1TGCA 2J94A 3C1KA 5F53A 4FUIA 3PMJA 4X2XA 1G37A 2VIVA 1G3BA 3F9FA 2XXLA 3RXSA 2PKAB 3H09A 1V2ST 4F48B 1P12E 3RXDA 3A8DA 1GJCB 3GYMA 2QXJA 4BANB 5HM9A 3RXQA 1NM6A 2A7JA 3A85A 1GJAB 1ZYOA 3PLBA 3RLWH 3E6PH 1GJDB 2QXGA 3N7DA 2Z9KA 3EA8A 1H9LB 4AGKA 1CU1A 4R0IA 2KCAA 4O9VA 2GJGA 4FUHA 2R2MB 1PPBH 3QTVH 4DGJA 3A80A 3MO9A 2ZPSA 5C1YA 3RXUA 3V7TA 1FUJA 1NROH 1GVLA 2V3MA 1DANH 3QZRA 3V0XA 1CA8B 1HAHH 1ZGIA 5IYTA 2WPKS 1MTNC 2XTTB 2XC0A 2BLVA 5DP5A 1G2MA 2PHBA 2ZKSA 3URCA 1E37B 3MQKC 3T27A 1O5BB 1A5GH 1ZRBA 2JJ1D 1MTNB 1P2OA 2KR7A 2BYAX 4I86A 4PROA 3U98H 1ABIH 3PMAB 5DP4A 3OU0A 3LDXH 1JIMA 2PGQB 1HAYB 2VWLA 1NC6A 1GJ5H 1FN8A 1UTKA 1ETRH 4IGDA 4MG3A 2BD2A 5A09A 4B75A 2PFEA 3BTDE 1C2EA 4Y71A 3DHKH 1DLEA 1TFXA 3FOAA 1S84A 2GMTC 4DIIH 3QZQA 1A7SA 4A92A 2FEQH 1HJ8A 2FZZA 1P8VC 3HATH 1SSXA 3B9FH 4JYTA 3RXMA 4XBBA 3PB1E 2GMTB 1QB1A 4ZCNA 3UWJH 2F3CE 1W0JD 4H4FA 1SGCA 1DOJA 1D9IA 1T4VH 4NSVA 1VGCB 2Y82A 1P57B 3E16B 3SYJA 1HJAC 1DXPA 1BQYA 1B0FA 3ZV8A 1V2TT 1SQRA 3QGNB 3SV6A 1SLUB 3G01A 1GI4A 1VCQA 1HJAB 1E35B 4OS7A 2K1QA 2CJIA 3B8JA 1H4WA 3S7HB 1HRTH 2ZGCA 4AFZA 1C1QA 3RXIA 1S0RA 2ZGXH 1IQJA 3MU8A 4UFFH 5J4SA 4NIVA 5A2MH 5L2ZH 3MH5A 3NCLA 3EAJA 3SV7A 3HK6B 2JDID 2H9HA 2L74A 3CENA 4F4OC 1HIAA 4Q80A 2AMPA 2BY8X 5C1XA 5HIYA 1E1QD 3GY6A 1DX5M 3V13A 3D62A 3P70B 4BAKB 4RSPA 2V3OH 3MH6A 2OC8A 3SV9A 2ODPA 3UOUA 2ZDKA 3P17H 3GS9A 4B6EA 4BTIB 2A4RA 1IAUA 1D3DB 2ZCKP 4OGXA 5HIZA 1MCVA 3GY8A 2GDDA 2WPIS 5GPIB 4LZ4B 2XBVA 3MMGA 1O2IA 1RIWC 4O3TA 4UDWH 3T2NA 1KXCA 3B23B 1CT4E 1GMDG 1YF4A 1FAKH 5A0AE 2Y7XA 5CHAC 2I6SA 1SLVB 1O3AA 1C5YB 3SJ9A 3OE7D 5BRRE 3AVZA 3FZDA 1F5KU 4HZHA 1SLWB 1C5WB 1YLNA 2J2UA 1THRH 5CHAB 1OWKA 4YESB 1K1OA 1O2XA 3LGVA 2G5NA 5E8EH 3H7OA 5EPYA 3PO1C 4WF8A 1CT0E 2TGPZ 1GI8B 4IC5A 4X1NU 2C90B 2GGVB 3A7XA 6CHAC 1W7XH 2VIWA 3MU0A 4IMZA 2WV9A 1Y3UA 1PFXC 2HALA 3PO1B 3SV8A 1G30B 1HAVA 3LT3A 1MKXK 1S83A 1VR1H 1SB1H 1WQVH 5EOKA 2G81E 2GV6A 1GCDA 2FMJA 3SJKA 2GX4A 6CHAB 1FY8E 2PUXB 1BDAA 1UTQA 2YMSC 2YMSD 3ZVAA 3I77A 4GUXA 1CA0C 2OBQA 1GI0A 2C8YB 1P2QA 4JZEH 2YNBA 1ETTH 4ZXYH 2YMSB 4FU9A 2P3FH 1KIGH 2W6ID 3F1SB 4UFGH 1GI2A 3FANA 1S6FA 5DP8A 1YCPH 2FOMB 2GTBA 2WINI 5E0HA 1XUFA 1UVTH 1P04A 1FONA 1C1RA 1QL9A 1EP6A 4ISIH 2Z3CA 3HGNA 1MBQA 1MCTA 1QBOA 3SBKA 3MH7A 1NZQH 1GI7B 1DWBH 3T29A 3FKSD 3ZVCA 1TNIA 3KEEA 3JZ1B 3RM0H 1MZDA 1O2JA 5JB8S 4UFDH 3A82A 1AQ7A 4I8JA 1BRUP 1YLCA 1UVUH 1CVWH 5F8XA 1TWXB 4AX9H 4WVPE 1JWTA 1HXEH 5AFZH 2TIOA 1GBJA 2Y5GA 5L2YH 2ZZUH 2ALPA 3SU0A 4K8YA 4NCYA 4ASHA 1ELVA 4CREA 1BMAA 4DY7B 1SL3A 4A7IB 5C5NA 1ZJDA 4MVNA 2QF0A 2H6MA 3VB4A 1A5HA 1QIXB 1BHXF 1ESAA 1J9CH 3LH1A 1AZZA 4D9QA 1MZAA 1TQ7B 3SUEA 4SGBE 2AGIX 4TWYA 1O3DA 1FDPA 3A7VA 1HGTH 3EE0B 1TOCB 4WXIA 1L0ZA 2GZ8A 2KCYA 2BY9X 2WPMS 4X2YA 1P01A 2BDHA 2A2QH 1ESBA 2FLRH 3QUMP 1L4ZA 1K22H 3RMNH 2G8TA 1A2CH 1Z7KA 2I6QA 5BPEA 1L1GA 1LO6A 4X1RU 1UTLM 5KECA 2PKSC 5LGOA 2PR3A 2ZHWH 5CDFE 3CNRA 4SGAE 3RC6A 1E1RD 2C8WB 1TMTH 2EI8A 4GVUA 2UWLA 1O2NA 1NU9A 8KME2 1LHCH 3IWMA 2Q6FA 4JZ1A 1OP8A 2PKSB 3SI4H 2GVFA 1Z8IB 4MNWA 2WPDD 4X6OA 3NK8A 2D8WA 4WXVA 1HNEE 4K5ZA 5A8XA 3T5FH 5EQSA 2A45B 3NXPA 1F2SE 1O34A 1O35A 1BA8B 1C2LA 1YYY1 5DSFA 2FX4A 3AAVA 3GDVA 3ZZBA 1GI3A 3STJA 4ZMAH 5LPFA 3WW7A 3RXBA 4NIYA 4WH8A 2ZFPH 2JETC 1W10U 1SGDE 3UUZA 3RXJA 1SGNE 2P94A 3FAOA 4LXBH 3NZIA 1GHVH 4TY6A 2A4OA 1OS8A 1F0SA 1P05A 2JETB 1V2WT 1EAWA 3TGIE 3NKKA 2A4QA 1UVOA 1L1NA 2AH4X 3TH2H 4HTCH 4X8VH 5F03A 4WY3A 1UTOA 1SGEE 4XD7D 4NIWA 4CRGA 3GY2A 1W8BH 4OM9A 2VNTA 2QXHA 3H7TA 3U8RH 2P3UB 4IS5A 1FI8A 3LC5A 2HOBA 1PQ5A 4YZUA 3VGCC 1SPJA 1Y3YA 3QO6A 1O3MA 2BD9A 4LK4A 3UY9A 3RMLH 1JRSA 1H1BA 4FXGH 3DUXH 5GDSH 2BVRH 3VGCB 1FY4A 4U32A 1LQEA 2WYJA 2EQNA 1UCYK 3I78A 4Q4LA 4K1EA 4DW2U 1A0LA 1HAGE 2F4LA 3ZZ8A 2GD4B 1SBWA 1YM0A 1ZJKA 1C5MD 4NWKA 2FOBA 1NFYA 2P3TB 4OS6A 4B73A 3NRLA 1AO5A 1GI6A 4AG1A 4VGCC 4KKDA 1ZMJA 1K28D 3KF2A 1YCPM 1Y3XA 1C1MA 3M35A 2KZ4A 3RXLA 3Q76A 3Q3KA 3A8BA 4OS1A 2AGEX 3UAIC 4AB9A 4AYVB 2J92A 2ZFSA 1RGQA 3UB0A 1DT2A 1UHBB 3P95A 2V3HH 2G4UA 4I8LA 3FN8A 1K0HA 1GVKB 3K9XB 1HB0B 2J97A 1BTWA 2FLBH 5C5OA 1OYTH 1YCPK 2WPLS 5A8ZA 5EXLA 4OGYA 2FOHA 3M7UA 2A7CA 2YNAA 4D76A 1V2UT 1JMOH 4INHA 4RN6A 1P2IA 1AD8H 4GLYA 3MNBA 3A84A 1AVGH 3ZZAA 1BTHH 3ITIA 2WZQA 3LKWA 1SHHB 3KQEA 1KXEA 5CE1A 1TPOA 1UCYE 2BX3A 4DURA 5JYIA 4FVBA 1C9TA 1F0TA 4IC6A 3KQ5A 3KN2A 1K2I1 3VPKA 4FUJA 1ZSKA 1AMHA 3A88A 3GCTF 4Q7ZA 4BXSA 2PKAA 1THSH 1UK2A 1SQTA 3OEHD 4ZUHA 1IQFA 2OD3B 1KXBA 2VBCA 2XW9A 3E91A 1NT1A 2BQWB 2O8LA 3TJUA 3VB3A 2OINA 9LPRA 1BTUA 1J14A 3PWBA 2TBSA 2EI7A 2NU2E 2XBWA 1TRMA 2JJ2D 1O2LA 3GCTG 4ESTE 3SU4A 1HXFH 3ZV9A 1GDQA 1QB9A 4I8HA 3AK5A 2XCNA 5DP9A 1C2IA 3P92A 2W5EA 1FAXA 4Y7AA 4ISLA 1H8IH 2J38A 3SUGA 1SOZA 1KXDA 3QN7A 1FPCH 1O2ZA 2A4GA 3PRDA 2QE7D 2UWPA 1BJUA 4IN2A 5FX5A 2OC1A 1IQEA 3QX5H 1FIWA 1SHYA 1S82A 2BD3A 4ABJA 3ATKA 1TBQH 2STAE 4ZHAA 2WV4A 3ZZ5A 2FOFA 1T4UH 1SGTA 1E36B 1ZSJA 2HNTF 3KQBA 1O33A 2FIRH 3ZZDA 3PLPA 1B7XB 1ELBA 4YLQH 3TH4H 2RDLA 1C1OA 1K9OE 3SJ8A 3RXAA 1D3PB 1P2JA 1HAPH 1QRXA 2SGDE 1DSUA 1NBME 1KLJH 1MTWA 3MNSA 1CQQA 4ZKRU 5FCKA 1XUJA 4NG9H 1BBRH 4ISHH 4TYDA 5FHTA 2BXUH 4K8BA 3S69A 3SU5A 1HAIH 3PLKA 2Q6DA 3A7TA 4F55A 1TGBA 3ZYDA 5TJXA 2BDYA 2QXIA 3U69H 1YBWA 1Z6JH 3BTFE 3K65B 1GBEA 1O2KA 3ZVGA 1A61H 4GCHF 3SZNA 1MQ5A 1ZTLA 1CGJE 2J5UA 2A5AA 2CF9H 1GMHF 3BTTE 2G52A 1ELFA 1QBVH 4E7RG 1MTSA 1NPMA 1NESE 3EDXB 2ZDAH 3SNEA 4OS2A 1TNLA 1O3NA 2ZCHP 4DT4A 1A1RA 3SHCH 7ESTE 2KX4A 2ZI2H 3D49H 4GCHG 2FDAA 1P11E 3SW2B 1GPZA 1AFEH 1NTPA 7GCHF 1GMHG 2XRCA 1EZSC 3MNCA 2A1DB 4AZ2B 2FTLE 1WXRA 2SNWA 2NU4E 4ZKSU 1O3CA 5GWZA 1O3HA 1HFDA 4XRNA 2KM0A 4O03A 2BD8A 2J9NA 3RU4T 2GDEH 1MAYA 3NPSA 1LHDH 1TALA 5AF9H 1NFXA 1O31A 5CMXH 3MTYA 3VEQB 2AMDA 3FP7E 1E79D 3TJNA 1D6RA 3FVFB 4NZLA 1JOUB 2GT8A 7GCHG 2ZTYA 1TRYA 4TPYA 1AY6H 1O5CB 4DCDA 1QA7A 3A89A 3LGTA 2FOAA 1GBHA 3RXTA 3MYWA 2OBOA 2UUYA 2F9PA 1K1MA 3L6PA 2XOKD 1TNHA 1WOFA 4B2BA 3GY7A 1ZR0A 1WBGB 4Y8YA 3SJIA 4CRDA 4NGAH 1AKSB 2ESTE 1AWFH 1OKXA 2JKHA 1FIZA 3GDUA 3HPTB 1QR3E 1C1WH 1O5AB 5T6DA 2WPJS 4AFQA 2FESH 3M5OA 1T32A 1AIXH 2BD5A 2DUCA 2ODYB 1RXPA 5A0CA 4MPVA 3F2HA 4AG2A 1CHOF 2LELA 2XWAA 1C5VA 1QRWA 1J15A 1IHTH 2Z6BD 1XUIA 1SGQE 1T8OA 3TU7H 1J16A 4J2YB 2BY7X 5G4BA 3JZ2B 4MNYA 2FOCA 4FETA 2TGAA 2P93A 1MTUA 1YPJH 2VWNA 2ZU3A 1LVMA 1A5IA 1C9PA 2OCVB 4B6FA 4CHAC 1CHOG 2FWWA 1RTLA 2WV5A 4FOUC 1OSSA 2VWOA 2ZU1A 5DP6A 1QZ8A 2H5CA 2HPPH 2W7UA 1EZQA 1A3EH 3M5MA 4CHAB 2NU1E 2UWOA 5AHGH 1V2JT 3E3TA 2BQ7B 1O5FH 2BXTH 2K8IA 4U30A 4XSKU 1OWJA 1OP2A 3MO3A 3TLOA 1EPTC 5EU8A 3GYLB 1SGRE 1GI1A 1BTXA 4WH6A 1O3PB 2B0FA 1NRPH 2O8TA 1DE7H 3BF6H 1ZTKA 1QQ4A 1YPGH 1ZMLA 2PSYA 1EPTB 1D4PB 1A4WH 1MAXA 2ZDNA 4O3UA 3RXGA 1C2HA 1TE0A 3O8BA 3RXCA 4CRBA 1IQKA 1G32B 1L2EA 3EA9A 1KYNA 1LVYA 5EXNA 5TCAA 5DJ7A 5JBTA 5C17A 3TIUA 4O97A 2FOGA 4FU8A 1AGJA 3BTME 2ZFFH 1C1NA 2VU8E 3RXKA 7KMEH 1ZTJA 3HGPA 2VH6A 4BXWA 3OX7U 2V0BA 1VKYA 2WUBA 3QGJA 1C2KA 1EATA 2A0QB 2EC9H 2F9BH 3A86A 2HWLB 3DSGA 3LJOA 1BBRK 3OYPA 2SFAA 1HV7A 1MKWK 4K3JA 1MUEB 1O2RA 1BUIA 4M7GA 4X1PU 2PV9B 3VB7A 1RFNA 2F9NA 4KP0A 3F68H 5HMAA 3F2FA 4JK6A 1RIWB 5GNDA 2V6NA 1IQHA 3UNRA 1T8LA 1LPGB 1Z8RA 1QQUA 1FY1A 4FUBA 2CF8H 3EE7A 1C5NH 2Z9GA 1O37A 2KFWA 1NBMD 2ZGHA 3GICB 1GBMA 4K69A 4AB8A 1CE5A 3SU1A 3PMBB 1RRKA 2O8WA 1S81A 5F6MA 3ZZ4A 3F3BA 2A5IA 3UFAA 1A3BH 1V6DA 2TPIZ 2W26A 3WWFA 2QGRA 1C5PA 3M3SA 1BZXE 3FP6E 3R3GB 4E05H 1OWIA 5E0GA 4XBCA 1LTOA 1LKBA 2RDEA 3UTUH 3SQEE 1F92A 3SHAH 2FYRA 3KNXA 2NU0E 2J95A 1DY9A 2OK5A 4KELA 3CS7A 2O8MA 2ZFQH 3RMMH 1DITH 2ANMH 5HYOA 1ANEA 1C4Y2 1CA0B 1BIOA 1EP5A 1GJ9B 3OY5U 4FVDA 4BTUB 1DWDH 1W0YH 1M9UA 1XXFA 1SMFE 1W11U 4RKOB 4K2YA 4MDSA 2BOKA 1O2SA 1H8DH 1K1NA 1LMWB 4BAOB 1PPEE 1GJ8B 4UFEH 5GCHF 1ANBA 1BCUH 4X1SU 1Y8TA 2PP6A 4D9RA 4RI0A 4B2AA 1Q2WA 1YPLH 1NS3A 1GHYH 2K0QA 1YPMH 1GHWH 4YM9A 1HAZB 2L6OA 1O30A 2ZDLA 1EAXA 1RTKA 2HVXA 1GBDA 1DXWA 2WYGA 3PV4A 4FU7A 1TA6A 2GCTC 3BG8A 1HPGA 2BLOA 1W2KH 1MD7A 4CH8B 1ZMNA 5HM2A 1SLXB 5GCHG 1GJ6A 4Y7BA 3WY8A 3MU4A 2GCTB 1P09A 2PLXA 3N7EA 3EA7A 3AASA 1TYNA 5FPYA 4MLFB 5B6OA 1P02A 1ELAA 1TNGA 3DSOA 4CRAA 3TVJB 2AERH 2LP6A 1BB0B 3T26A 1Z6EA 2VH0A 1S6LA 2BY6X 4DT7B 2QAAA 4ZHMU 1QFKH 2W3KA 1C5RA 4AYYB 3LGIA 1V2PT 1CBWC 2XWBI 1O0DH 3TNTA 1U6QA 3WWBA 1G3CA 1XVMA 1ZPZA 2J34A 1CBWB 2CMYA 2V35A 3PM3A 3FFGA 1C5OH 1A0HB 1GDUA 3MOCA 5DP7A 2RCEA 1SG8B 1Z8GA 4P00A 4B76A 5E0JA 1G36A 3KCGH 2CN0H 3A7ZA 2ZF0H 4YT6H 3UIRA 1VJAU 1WYKA 3HK3B 1O38A 3E90B 5C67A 1O32A 4YTAA 3MNXA 5LPEA 1BT7A 2C8ZB 3LGWA 2AFQB 1MTVA 1KXAA 9ESTA 7LPRA 4WMFA 2XBYA 1TAWA 3E8LA 5EG4A 2PTNA 3S7KB 5JBCS 3D23A 3ATIA 2ZC9H 1GWAA 1TBRH 2GP9B 1NO9H 1D6WA 3RMOH 3GDSA 2JIZD 5K0HA 2A32A 1N1LA 2R0KA 2Z9IA 2R3YA 2BHGA 2PUQH 2OQUA 2AIQA 4XFQA 1BRBE 2ZDMA 1N8OC 1AUTC 3EGKH 1O5DH 2XNIA 1ZHPA 4H6SB 2TGTA 3UQVA 1SI5H 3SQHE 2ULLA 2ANYA 4Y8XA 3H5CB 3HKIB 1G9IE 1PQ7A 4ABHA 1O2GH 3LH3A 1N8OB 2XBXA 3GISB 1MU6B 2AMQA 1LHEH 5C2ZA 2F43B 1ZLRA 1P3CA 1TX7A 1QURH 1ELEE 5CHBA 2FI4E 1TX6A 4Y0YE 2DE9A 5A0BA 2VB0A 4Y6DA 2WSSD 4X6NA 1IQGA 2C8XB 3ATLA 3W95A 1FXYA 1H9HE 2VINA 4M9FA 5C20A 2B7DH 2G5VA 2OP9A 3BEFB 1NU7B 3M36A 1Y3VA 3SUDA 4FUFA 1E38B 1GI9B 2AS9A 3ODFA 3O8DA 3M7TA 1IOEA 4B74A 4BNRA 2NWNA 5EJZA 2CHAC 3M3VA 4NWLA 1DPOA 1WTHD 8GCHF 4K1TA 3A7WA 1PPCE 5JPMH 3N7OA 1QJ6B 1JBUH 2Z9JA 1DWCH 2CHAB 3MI4A 3LU9B 4B1TA 1AVWA 2ZFRH 2G4TA 2B5TB 4BAQB 1O3OA 2AGGX 4RT1A 4H6TA 2A7HA 2O9QA 1TQ0B 1V2NT 1EZXC 4VGCB 4AFUA 4Z6AH 2C93B 1WAYB 1SR5C 1F7ZA 2QC2A 4E06H 1GI5A 1SFIA 3SU3A 3QWCH 2BDBA 1UTPA 8GCHG 1V2KT 1K1PA 2HRVA 4Z0KA 3VXEH 2F9OA 1G3EA 3K2UA 1YKTA 2QN5T 4KTSA 2J98B 2A2XH 5FCRA 4CRCA 3AAUA 3UPEA 4Y0ZE 1IQLA 2SGEE 1C2DA 1GBIA 2OLGA 3FO8D 1O2QA 2CGAA 3GY3A 4YOJA 1AU8A 1H8ED 2HVYB 1SGIB 2OC0A 1C5ZB 4JMYA 1RJXB 4FUGA 3DD2H 4I7YH 3F9EA 1IQNA 4NA8A 1CSOE 3V3MA 1O3LA 1XUKA 1GBCA 1TPPA 1Z1JA 3RUOA 4YXWD 2W3IA 3MU1A 1D3TB 2OXSA 1ORFA 2ZHQH 1PYTC 1INCA 1PYTD 3UNSA 3S9BA 1GHZA 2QF5A 1G2LA 2R3UA 4ZKNU 1ELDE 2Y5HA 1FY5A 2JH0D 1EB2A 1C1SA 2OC7A 2HLDD 3VFEA 2FI5E 3LGUA 2F83A 1VITF 1C4U2 1GJBB 2HLCA 2RG3A 4Y79A 4HGCA 2Z3EA 5JBAS 1J8AA 1YC0A 2BLQA 4CR9A 1L4DA 3R0FA 5C0UA 4X8UH 4A1VA 3PRBA 3GOVB 3TK6A 3UWIA 2RA3A 5FL7D 2W7SA 1Y5BT 1GJ4H 2WHXA 1QY6A 1EUFA 1ZHRA 1VITG 1HLTH 1P03A 4ACBA 1AKSA 3EYDA 3W1EA 2ZDVH 1UMAH 3BTKE 3TPIZ 1XXDA 3CP7A 3STIA 4WMDA 3TJOA 4A5TS 2Z3DA 1O5GH 4AGJA 1GMCF 1MH0A 5FPTA 3F9HA 1YY3A 5AVDA 3N99A 3T28A 2SNVA 1HCGA 1TONA 1CHGA 1C5XB 4MPUA 2VIQA 5JBBS 2C4FH 2UUFB 1WDIA 3M37A 3OFND 3RM2H 1Q3XA 5F8ZA 3LIWA 3M5LA 2ZIQH 1UK4A 2B9LA 3OTPA 4QT8C 1GMCG 4NA9H 4MQAA 1MBMA 4GSOA 1EOJA 3SV2H 1EAIA 1DS2E 1DDJA 3LGYA 1PQAA 3SN8A 1TGTA 2ASUB 2PWXA 2GZ9A 1EJNA 3BN9A 1UO6A 2ZU2A 2VIDA 3M7QA 2ZTXA 4H42U 1LPKB 1C4V2 1ANCA 4AFSA 3BG4C 1GHBF 4X1QU 3SNDA 1IHSH 1JIRA 3BTWE 1P9SA 3BG4B 1DLKB 3SNAA 1H8HD 2KAIB 1L1JA 4Q7YA 3DFLA 1EASA 1UTMA 3F0PA 1TMUH 2Q1JA 1GHXH 3KQDA 1EPTA 3ZZCA 2H9EH 1P10A 4DOQA 1V2VT 2UUJB 2V7QD 2EEKA 4U2WA 1BITA 5DKMA 3QK1A 4BAHB 1O2VA 5FBIA 3T25A 1HAOH 2QIQA 1KLIH 3MHWU 3ZZ3A 1FY3A 1DFPA 4I32A 3TGKE 1HBTH 1ACBE 1TABE 1TPSA 4GHQA 1HJ9A 1GBLA 1BRAA 3TK9A 3SZEA 2ZPQA 1GCTC 1TB6H 4MNVA 1MD8A 5DG6A 5ESTE 2FODA 5DPAA 4B71A 2OUAA 1Q31A 2VWMA 1GCTB 1QJ1B 2GV7A 1C2JA 1TA2A 3UREA 1KSNA 1TGSZ 1TGNA 2BLWA 3RDZA 1KDQB 2BDCA 2BDAA 1ETSH 4FUEA 4B2CA 1QTFA 3DSPA 5DP3A 2CK3D 1MKXH 2IJOB 5EJ1A 3LC3A 5GJ4B 1K21H 1QB6A 1LPZB 1W3CA 2ZHEH 1O3GA 3DCLA 3E0PB 1WTGH 4JZIA 2GKVE 4Q7XA 2IJD1 1QA0A 4UEHH 3NWUA 4INKA 4ABGA 5C3NA 1D3QB 3U1JB 1PPZA 4U01A 2Y80A 2FXRA 1ZPBA 1P3EA 1YPKH 1DWEH 3OSYA 1ZOMA 2BVXH 4ABAA 3Q00A 3SO3A 4X0WU 2THFB 4MPXA 1OHHD 4THNH 4FUCA 3ZVBA 5ETXA 1VITH 3SNBA 4I8KA 2R9PA 4WWYA 3KYFA 1OOKB 4MTBA 1E0FD 2GCHF 5I25A 1CT2E 1V2OT 1AN1E 1TX8A 3F0OA 3V12A 1V2MT 1GBAA 2FYQA 2OQ5A 2ZWLH 1VZQH 3Q77A 5LPRA 4A1TA 5K7RA 1BMLA 5EW1H 2A31A 2VVCA 1F5RA 1FNIA 2WUCA 5T1VA 4CBNA 4GHTA 2BD4A 4YLUA 2GCHG 5ESBA 4HG6A 1VJ9U 4X8SH 1FZZA 2JH5D 1EKBB 1FQ3A 3ZIAD 1T8NA 4CH2B 2HPQH 2VIPA 3RXVA 1LKAA 2XCFA 2FP7B 5DN6D 1AUJA 2R2WU 5E2PA 1C1TA 2PW8H 1K1LA 2ZGBH 1OWHA 1FN6A 1JRTA 1WV7H 1XX9A 3OY6U 3ATWA 3RXHA 4D7FA 1ABJH 1UTNA 2XC4A 2SGQE 1SQOA 2VGCC 1PPGE 4D8NA 1NRRH 1CO7E 3L33A 1VGCC 1P2MA 2F9VA 4IW4E 4E7NA 2VGCB 2IPHA 2EA3A 3QTOH 4IN1A 3UNQA 2BTCE 1W0ZU 5L6NH 1MABB 4CR5A 1TOMH 4YT7H 1OP0A 2ZG0H 4TY7A 1LDTT 3UQOA 4TT3D 1O2TA 2BZAA 2ZA5A 2JH6D 4ZKOU 5H4IB 3BIVH 1P06A 3CS0A 5FPSA 1QJ7B 3ZVDA 5EXMA 1BTYA 3P8GA 2ZHDA 1O2PA 5AFYH 2WPHS 1O36A 1ZGVA 2CXVA 1NRSH 1DY8A 3KIDU 1J17T 1O2YA 1K1JA 1Y3WA 3PTBA 4ABBA 4ZHLU 3PV2A 1VCWA 2Z7FE 4TSFD 3RC5A 2QYIA 4NZQA 2PTCE 3M5NA 2H9TH 2IPQX 5L30H 3T62A 1ZZZA 2XYAA 4JYVH 2ZCLP 1ELCA 1SFQB 1XUHA 3E1XB 1MQ6A 4XDEA 5E2OA 3P8OA 1N6YA 2Y7ZA 1IQIA 4Y76A 3RXRA 1GMDF 3BIUH 2BX4A 4INLA 4ZH8A 1ESTA 3BTQE 8LPRA 3SJOA 1XMNB 2STBE 4JK5A 1V2LT 5T3HA 2BOHB 3PROA 2M5TA 1LVBA 1V2RT 1UK3A 4NSYA 4JZDH 3BEIB 5KEDA 4MPWA 1S0QA 2AEIH 1A46H 4WMEA 4NIXA 1O3JA 1W14U 2BD7A 3F6UH 1EB1H 3SU2A 2G51A 4UE7H 3TK5A 5T6GA 1O2WA 5JB9S 1WCZA 4I31A 4R8TB 2BB4A 1EZUC 1Y5UT 1UVPA 3S9CA 2PSXA 2OTVA 3A8CA 1UCYH 1BBRE 3ZZ7A 3MU5A 4YOGA 2FOEA 2ZQ2A 3TITA 3U8OH 1WSSH 3C27B 4F49A 3SOSA 1QNJA 3A8AA 1ZSLA 3ZZ6A 5B6LA 4YO9A 3RU4D 1BOQA 2G55A 3A87A 1UJ1A 4Q2KA 1EAUA 1TLDA 4ACAA 1GBTA 3TGJE 1QHRB 2KCPA 1P2NA 3SGAE 1W13U 4NA7A 5C94A 1RTFB 1S85A 5EGMA 1Y59T 1P0SH 1DICA 1EXFA 1B0EA 4TPIZ 2FPZA 1ELTA 1QBNA 3M61U 5JDUB 2VJ1A 5DK1A 4D7GA 1COWD 1GBKA 4LZ1H 1Z71A 1C5UA 4AN7A 1ID5H 2D26C 1THPB 3RXEA 1C5LH 3A81A 1CGIE 3GCOA 5DGJA 4ISOA 4LOYH 4XE4A 1BJVA 2ODQA 2ZEBA 2ANKH 2EY4C 2QCYA 3PV5A 3SGBE 1RD3B 1B5GH 8ESTE 2FTMA 2ZU4A 3GCNA 1P2KA 3LOXA 3BTEE 3K6ZA 4X8TH 1K1IA 1PJPA 2ZECA 3PYHA 5EJLA 6LPRA 3UR9A 1C1PA 1O2UA 4J1YA 5IK2D 1FV9A 3TNSA 3ELAH 1LQDB 4KTUA 1UHBA 1UW7A 2XC5A 2XNDD 2IN2A 4K60A 3BTHE 4A1XA 1HIAB 3BV9B 3VG8A 4ABDA 2W6JD 2GZ7A 2J98A 1TBZH 1EJAA 2KCOA 3LPRA 3DFJA 2R0LA 3SORA 1VCPA 2H2ZA 4NFEA 3UOPA 2P95A 1XKBC 4FUDA 1O39A 3P6ZB 4Z1MD 2AIPA 3PWCA 1XUGA 4BAMB 2ILNA 4JZFH 4P02A 4RKJB 3URDA 1O2HA 3MH4A 3MWIU 2HGTH 3QLPH 1C5SA 1GL1A 3UR6A 3LJJA 1BMMH 2BDIA 1HDTH 2PGBB 1F5LA 5J4QA 5EIYA 1KTSB 4DG4A 3IITA 1YLDA 1OWDA 4AOQA 3L3TA 3GCHC 1ANDA 1C2FA 2FS8A 1XKAC 2ZGJA 4UONA 3AW1A 4YOIA 1LVOA 1C2MA 4GAWA 3U1IB 5FAHA 1AE8H 2RFKC 3W94A 1QL7A 2M2AA 2Q6GA 3GCHB 4CBOA
chains in the Genus database with same CATH topology
3U8TH 1Z8JB 3F9GA 1UVSH 2IOTA 1HAVB 2VIOA 1KXFA 1TRNA 3TH3H 1NRNH 1NN6A 1E34B 3RLYH 3VB6A 4K1SA 1KLTA 1SGFA 1WQSA 1BHXB 1BRCE 1H9IE 1V3XA 2HNTE 1LCYA 4Y11E 3BTGE 4ZAEA 1FMGA 3K6YA 1HYLA 1YPHE 2FM2A 1T7CA 5GXPA 4DIHH 1KTTB 3ODDA 1SVPA 5PTPA 5F8TA 1SQAA 4ZROA 3EQ0H 1QRZA 2SGFE 1HUTH 1O5EH 4JYUH 3O8RA 5A8YA 5EW2H 1V2QT 1C5TA 1AHTH 3DA9B 1AZ8A 2QY0B 3P8NA 3IG6B 1TNKA 2ZQ1A 1ZRKA 3KL6A 3RXFA 4OS4A 2Z94A 1O3BA 2A5KA 1TPAE 2DE8A 2Y5FA 3NUMA 5DO4H 2VVVA 4MNXA 4ABIA 2O8UA 1C1VH 1NFUA 3Q3YA 4HI3A 2TGDA 5I46H 1FJSA 1YGCH 4JCNA 1O3IA 1OPHB 1DUEA 1SGPE 4ISNA 1CGHA 1NRQH 1BTPA 1ZPCA 2EI6A 2ZP0H 2ZTZA 3HKJB 4I8GA 1SC8U 2D2DA 1C1UH 3TJVA 2F9UA 1W7GH 1X7AC 3BSQA 4DVAU 2KAIA 2ZFTA 1SGFG 1AI8H 2TRMA 3RP2A 6ESTA 2H5DA 3ATMA 2QA9E 1G3DA 3GY5A 2F91A 1YPEH 1EQ9A 3ZVEA 1AE5A 2YOLA 1GHAF 1MMJN 1O2OA 2QV1A 3KQCA 2BQ6B 2BDGA 2FX6A 5FBEA 2BM2A 1GVZA 5HXFA 1GBFA 4X6PA 1SOTA 1A0JA 1NFWA 1T8MA 3Q3XA 3SI3H 1UTJA 2P16A 2ZNKH 1N6XA 3SNCA 2RA0A 1FLEE 2H1UA 1LHGH 2ZO3H 1P9UA 5FXLA 1EOLA 1AB9C 1GHAG 2Y6TA 3O8CA 1KDQA 1ZHMA 3LONA 2G00A 2LNCA 5SGAE 4OS5A 2ZHFH 1AB9B 1DSTA 1F0UA 1OX1A 4BTTB 1RS0A 1JXPA 2ANWA 5T6FA 3SGQE 3QDZB 2SGPE 1MU8B 1C2GA 2ZPRA 1SGYE 1Y5AT 1TIOA 3ESTA 5LH8A 1PPFE 1F0RA 1DUAA 1GJ7B 1O3FA 1S5SA 5EQRA 3OTJE 1QGFA 3SU6A 2Y81A 4X6MA 1WU1A 5HGGA 5C1UA 1HAXB 1OYQA 4I33A 1S6HA 6GCHF 3RXPA 1AFQC 1BMNH 3RXOA 3ZZ9A 3S0NA 2Z9LA 4XOJA 1OXGA 1NY22 2D1JA 5EODA 3FZZA 3MFJA 3RC4A 4TWWA 2P8OC 4UD9H 1DVAH 1XM1A 1Z1IA 4ZXXH 1AFQB 5EPNA 2BZ6H 1ARBA 2ZU5A 4DJZB 2BVSH 2P8OB 1W12U 6GCHG 4Y8ZA 2B8OH 3KGPA 3P8FA 1YP9A 5FX6A 3U9AH 2FO9A 2NU3E 2P59A 1EJMA 1QCPA 4HFPB 1OWEA 2GT7A 2VVUA 3ZVFA 3S9AA 2ALVA 2CV3A 4ABEA 4ABFA 3DT0H 4Y10E 1O3KA 4IBLH 5EQQA 1O3EA 3PTNA 1FPHH 2J4IA 1QL8A 4X2VA 1BTZA 4A6LA 4BOHA 3GY4A 4XBDA 1LHFH 2UUKB 3A7YA 5TCCA 1MKWH 1GBBA 1ELGA 4KGAA 1TMBH 3E0NB 2FI3E 2SGAA 3M3TA 4WJG2 3RU4E 2FS9A 1GDNA 3AW0A 1GHBG 1C5QA 1KY9A 4CRFA 1IQMA 3A83A 4AORA 1AVXA 3FP8E 1TNJA 1GGDC 5GIBA 3ZYEA 5ABWA 1ARCA 4IMQA 1XVOA 2BMGB 3BEUA 4GPGA 1EX3A 4KTCA 2QF3A 1GG6C 3D65E 3MO6A 1GL0E 4X2WA 3VXFH 2C3SA 1GGDB 3VB5A 3I29A 1O2MA 3ENSB 1T31A 2AYWA 3KHVA 2BY5X 4NFFA 1GG6B 3SUFA 1DM4B 1PPHE 2HNTC 1PQ8A 1AWHB 3PMHB 1YPHC 2LPRA 5IDKA 1WUNH 1TGCA 2J94A 3C1KA 4FUIA 3PMJA 4X2XA 1G37A 2VIVA 1G3BA 3F9FA 2XXLA 3RXSA 2PKAB 1V2ST 1P12E 3RXDA 3A8DA 1GJCB 3GYMA 2QXJA 4BANB 5HM9A 3RXQA 1NM6A 2A7JA 3A85A 1GJAB 1ZYOA 3PLBA 3RLWH 3E6PH 1GJDB 2QXGA 2Z9KA 3EA8A 1H9LB 4AGKA 1CU1A 4R0IA 4O9VA 4FUHA 2R2MB 1PPBH 3QTVH 4DGJA 3A80A 3MO9A 2ZPSA 5C1YA 3RXUA 3V7TA 1FUJA 1NROH 1GVLA 1DANH 3QZRA 3V0XA 1CA8B 1HAHH 1ZGIA 5IYTA 2WPKS 1MTNC 2XTTB 2XC0A 2BLVA 5DP5A 1G2MA 2PHBA 2ZKSA 3URCA 1E37B 3T27A 1O5BB 1A5GH 1ZRBA 1MTNB 1P2OA 2BYAX 4PROA 3U98H 1ABIH 3PMAB 5DP4A 3OU0A 3LDXH 1JIMA 2PGQB 1HAYB 2VWLA 1NC6A 1GJ5H 1FN8A 1UTKA 1ETRH 4IGDA 4MG3A 2BD2A 5A09A 4B75A 2PFEA 3BTDE 1C2EA 4Y71A 3DHKH 1DLEA 1TFXA 1S84A 2GMTC 4DIIH 3QZQA 1A7SA 4A92A 2FEQH 1HJ8A 2FZZA 1P8VC 3HATH 1SSXA 3B9FH 4JYTA 3RXMA 4XBBA 3PB1E 2GMTB 1QB1A 3UWJH 2F3CE 4H4FA 1SGCA 1DOJA 1D9IA 1T4VH 4NSVA 1VGCB 2Y82A 1P57B 3E16B 1HJAC 1DXPA 1BQYA 1B0FA 3ZV8A 1V2TT 3QGNB 3SV6A 1SLUB 3G01A 1GI4A 1VCQA 1HJAB 1E35B 4OS7A 2K1QA 2CJIA 3B8JA 1H4WA 3S7HB 1HRTH 2ZGCA 4AFZA 1C1QA 3RXIA 1S0RA 2ZGXH 1IQJA 3MU8A 4UFFH 5J4SA 4NIVA 5A2MH 5L2ZH 3MH5A 3NCLA 3EAJA 3SV7A 3HK6B 2H9HA 3CENA 4F4OC 1HIAA 4Q80A 2AMPA 2BY8X 5C1XA 3GY6A 1DX5M 3V13A 3D62A 3P70B 4BAKB 4RSPA 2V3OH 3MH6A 2OC8A 3SV9A 2ODPA 3UOUA 2ZDKA 3P17H 4BTIB 2A4RA 1IAUA 1D3DB 2ZCKP 4OGXA 1MCVA 3GY8A 2GDDA 2WPIS 5GPIB 4LZ4B 2XBVA 3MMGA 1O2IA 1RIWC 4O3TA 4UDWH 3T2NA 1KXCA 3B23B 1CT4E 1GMDG 1YF4A 1FAKH 5A0AE 2Y7XA 5CHAC 2I6SA 1SLVB 1O3AA 1C5YB 3SJ9A 5BRRE 3AVZA 3FZDA 1F5KU 4HZHA 1SLWB 1C5WB 2J2UA 1THRH 5CHAB 1OWKA 4YESB 1K1OA 1O2XA 3LGVA 2G5NA 5E8EH 3H7OA 5EPYA 3PO1C 4WF8A 1CT0E 2TGPZ 1GI8B 4IC5A 4X1NU 2C90B 2GGVB 3A7XA 6CHAC 1W7XH 2VIWA 3MU0A 4IMZA 3PO1B 1Y3UA 1PFXC 2HALA 3SV8A 1G30B 1HAVA 3LT3A 1MKXK 1S83A 1VR1H 1SB1H 1WQVH 5EOKA 2G81E 2GV6A 1GCDA 2FMJA 3SJKA 2GX4A 6CHAB 1FY8E 2PUXB 1BDAA 1UTQA 3ZVAA 3I77A 4GUXA 1CA0C 2OBQA 1GI0A 2C8YB 1P2QA 4JZEH 2YNBA 1ETTH 4ZXYH 4FU9A 2P3FH 1KIGH 3F1SB 4UFGH 1GI2A 3FANA 1S6FA 5DP8A 1YCPH 2FOMB 2GTBA 2WINI 5E0HA 1XUFA 1UVTH 1P04A 1FONA 1C1RA 1QL9A 1EP6A 4ISIH 2Z3CA 3HGNA 1MBQA 1MCTA 1QBOA 3SBKA 3MH7A 1NZQH 1GI7B 1DWBH 3T29A 3ZVCA 1TNIA 3KEEA 3JZ1B 3RM0H 1MZDA 1O2JA 5JB8S 4UFDH 3A82A 1AQ7A 4I8JA 1BRUP 1YLCA 1UVUH 1CVWH 5F8XA 1TWXB 4AX9H 4WVPE 1JWTA 1HXEH 5AFZH 2TIOA 1GBJA 2Y5GA 5L2YH 2ZZUH 2ALPA 3SU0A 4K8YA 4NCYA 4ASHA 1ELVA 4CREA 1BMAA 4DY7B 1SL3A 4A7IB 5C5NA 1ZJDA 4MVNA 2QF0A 2H6MA 3VB4A 1A5HA 1QIXB 1BHXF 1ESAA 1J9CH 3LH1A 1AZZA 4D9QA 1MZAA 1TQ7B 3SUEA 4SGBE 2AGIX 4TWYA 1O3DA 1FDPA 3A7VA 1HGTH 3EE0B 1TOCB 4WXIA 1L0ZA 2GZ8A 2BY9X 2WPMS 4X2YA 1P01A 2BDHA 2A2QH 1ESBA 2FLRH 3QUMP 1L4ZA 1K22H 3RMNH 2G8TA 1A2CH 1Z7KA 2I6QA 5BPEA 1L1GA 1LO6A 4X1RU 1UTLM 2PKSC 5LGOA 2PR3A 2ZHWH 4SGAE 3RC6A 2C8WB 1TMTH 2EI8A 4GVUA 2UWLA 1O2NA 1NU9A 8KME2 1LHCH 3IWMA 2Q6FA 4JZ1A 1OP8A 2PKSB 3SI4H 2GVFA 1Z8IB 4MNWA 4X6OA 3NK8A 2D8WA 4WXVA 1HNEE 4K5ZA 5A8XA 3T5FH 5EQSA 2A45B 3NXPA 1F2SE 1O34A 1O35A 1BA8B 1C2LA 1YYY1 2FX4A 3AAVA 3GDVA 3ZZBA 1GI3A 3STJA 4ZMAH 5LPFA 3RXBA 4NIYA 4WH8A 2ZFPH 2JETC 1W10U 1SGDE 3UUZA 3RXJA 1SGNE 2P94A 3FAOA 4LXBH 3NZIA 1GHVH 4TY6A 2A4OA 1OS8A 1F0SA 1P05A 2JETB 1V2WT 1EAWA 3TGIE 3NKKA 2A4QA 1UVOA 1L1NA 2AH4X 3TH2H 4HTCH 4X8VH 5F03A 4WY3A 1UTOA 1SGEE 4NIWA 4CRGA 3GY2A 1W8BH 2VNTA 2QXHA 3H7TA 3U8RH 2P3UB 4IS5A 1FI8A 3LC5A 2HOBA 1PQ5A 4YZUA 3VGCC 1SPJA 1Y3YA 3QO6A 1O3MA 2BD9A 4LK4A 3UY9A 3RMLH 1JRSA 1H1BA 4FXGH 3DUXH 5GDSH 2BVRH 3VGCB 1FY4A 4U32A 1LQEA 2WYJA 1UCYK 3I78A 4K1EA 4DW2U 1A0LA 1HAGE 3ZZ8A 2GD4B 1SBWA 1YM0A 1ZJKA 1C5MD 4NWKA 2FOBA 1NFYA 2P3TB 4OS6A 4B73A 1AO5A 1GI6A 4AG1A 4VGCC 4KKDA 1ZMJA 1K28D 3KF2A 1YCPM 1Y3XA 1C1MA 3M35A 3RXLA 3Q76A 3Q3KA 3A8BA 4OS1A 2AGEX 4AB9A 4AYVB 2J92A 2ZFSA 1RGQA 1DT2A 1UHBB 3P95A 2V3HH 2G4UA 4I8LA 1GVKB 3K9XB 1HB0B 1BTWA 2FLBH 5C5OA 1OYTH 1YCPK 2WPLS 5A8ZA 5EXLA 4OGYA 2FOHA 3M7UA 2A7CA 2YNAA 4D76A 1V2UT 1JMOH 4INHA 4RN6A 1P2IA 1AD8H 4GLYA 3MNBA 3A84A 1AVGH 3ZZAA 1BTHH 3ITIA 3LKWA 1SHHB 3KQEA 1KXEA 5CE1A 1TPOA 1UCYE 2BX3A 4DURA 5JYIA 4FVBA 1C9TA 1F0TA 4IC6A 3KN2A 1K2I1 3VPKA 4FUJA 1ZSKA 1AMHA 3A88A 3GCTF 4Q7ZA 4BXSA 2PKAA 1THSH 1UK2A 1SQTA 4ZUHA 1IQFA 2OD3B 1KXBA 2XW9A 3E91A 1NT1A 2BQWB 2O8LA 3TJUA 3VB3A 2OINA 9LPRA 1BTUA 1J14A 3PWBA 2TBSA 2EI7A 2NU2E 2XBWA 1TRMA 1O2LA 3GCTG 4ESTE 3SU4A 1HXFH 3ZV9A 1GDQA 1QB9A 4I8HA 2XCNA 5DP9A 1C2IA 3P92A 2W5EA 1FAXA 4Y7AA 4ISLA 1H8IH 2J38A 3SUGA 1SOZA 1KXDA 3QN7A 1FPCH 1O2ZA 2A4GA 2UWPA 1BJUA 4IN2A 5FX5A 2OC1A 1IQEA 3QX5H 1FIWA 1SHYA 1S82A 2BD3A 4ABJA 3ATKA 1TBQH 2STAE 4ZHAA 2WV4A 3ZZ5A 2FOFA 1T4UH 1SGTA 1E36B 1ZSJA 2HNTF 3KQBA 1O33A 2FIRH 3ZZDA 3PLPA 1B7XB 1ELBA 4YLQH 3TH4H 2RDLA 1C1OA 1K9OE 3SJ8A 3RXAA 1D3PB 1P2JA 1HAPH 1QRXA 2SGDE 1DSUA 1KLJH 1MTWA 3MNSA 1CQQA 4ZKRU 5FCKA 1XUJA 4NG9H 1BBRH 4ISHH 4TYDA 5FHTA 2BXUH 4K8BA 3S69A 3SU5A 1HAIH 3PLKA 2Q6DA 3A7TA 1TGBA 3ZYDA 5TJXA 2BDYA 2QXIA 3U69H 1YBWA 1Z6JH 3BTFE 3K65B 1GBEA 1O2KA 3ZVGA 1A61H 4GCHF 3SZNA 1MQ5A 1ZTLA 1CGJE 2A5AA 2CF9H 1GMHF 3BTTE 2G52A 1ELFA 1QBVH 4E7RG 1MTSA 1NPMA 1NESE 3EDXB 2ZDAH 3SNEA 4OS2A 1TNLA 1O3NA 2ZCHP 1A1RA 3SHCH 7ESTE 2ZI2H 3D49H 4GCHG 2FDAA 1P11E 3SW2B 1GPZA 1AFEH 1NTPA 7GCHF 1GMHG 2XRCA 1EZSC 3MNCA 2A1DB 4AZ2B 2FTLE 2SNWA 2NU4E 4ZKSU 1O3CA 5GWZA 1O3HA 1HFDA 4O03A 2BD8A 2J9NA 3RU4T 2GDEH 1MAYA 3NPSA 1LHDH 1TALA 5AF9H 1NFXA 1O31A 5CMXH 3MTYA 3VEQB 2AMDA 3FP7E 3TJNA 1D6RA 3FVFB 4NZLA 1JOUB 2GT8A 7GCHG 2ZTYA 1TRYA 4TPYA 1AY6H 1O5CB 4DCDA 1QA7A 3A89A 3LGTA 2FOAA 1GBHA 3RXTA 3MYWA 2OBOA 2UUYA 2F9PA 1K1MA 3L6PA 1TNHA 1WOFA 4B2BA 3GY7A 1ZR0A 1WBGB 4Y8YA 3SJIA 4CRDA 4NGAH 1AKSB 2ESTE 1AWFH 1OKXA 2JKHA 1FIZA 3GDUA 3HPTB 1QR3E 1C1WH 1O5AB 5T6DA 2WPJS 4AFQA 2FESH 3M5OA 1T32A 1AIXH 2BD5A 2DUCA