4YO9A

Hku4 3clpro unbound structure
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 84
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yo9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yo9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yo9A02
1BRCE 3BTHE 1S84A 3VXEH 1FPCH 1CE5A 3A89A 2ZFFH 2Y81A 2A5KA 4MNWA 1SLWB 1AVGH 2H5CA 1TX6A 4MG3A 2ZHFH 9ESTA 4QT8C 1GJ9B 2FWWA 2ZTXA 5C5NA 4Y71A 1P12E 3UNSA 3TJUA 2BXUH 1AB9B 2R3UA 4CRAA 1J15A 1V2ST 3KGPA 3STJA 2ZF0H 1Z8GA 1UTLM 4K60A 4Q80A 3QLPH 1P2NA 4BTTB 4O3TA 2FS9A 2AGEX 4ZMAH 5C1YA 2BD2A 4MQAA 1BDAA 1S83A 2XTTB 3MU8A 1RD3B 3TGKE 3A83A 2ZCKP 4E05H 4FUCA 1GJCB 2PKAB 4AYVB 2ZG0H 1HFDA 1TBQH 5FX6A 2BVSH 2Y5GA 2QXHA 4K3JA 1E38B 2OC7A 3D23A 3GY4A 4FU7A 1CHOG 1O5DH 1P09A 2F3CE 3E8LA 3RXVA 1UHBB 3KHVA 2RA3A 1EATA 1FJSA 4AORA 3GISB 2BYAX 2UWOA 5IDKA 4A7IB 4E7RG 1ID5H 3QK1A 1OOKB 1TMTH 2A0QB 5FBEA 3HGPA 2BLQA 4YO9A 3S9AA 1Y8TA 1AHTH 5AVDA 2VGCC 3QGNB 1L4ZA 1AWFH 1LKAA 1ZSKA 1BUIA 2ZCLP 1GBHA 5EW2H 2CV3A 1C1SA 1DLEA 3NPSA 4GLYA 1OX1A 2BDYA 2O8UA 2YNAA 4K2YA 4ISNA 1EPTB 3PROA 1C5UA 1ZPCA 1WV7H 1IQNA 1NROH 2C90B 1PFXC 3SJ8A 3PMHB 2QIQA 1EOJA 1QBVH 1Z8RA 2VIVA 1O3NA 2JH0D 3P95A 1SLXB 4YT7H 2QA9E 4CR5A 1H8IH 1SGTA 3MOCA 1LMWB 1LVOA 1CO7E 1QY6A 1P05A 2BD9A 4TY6A 3FP8E 4NIVA 2BD8A 2Y80A 1ETTH 1P2OA 2CXVA 3SUDA 2VIOA 3W94A 4YESB 5DP7A 1ABJH 2GMTB 4INLA 1T8MA 5E0HA 3VB3A 3MNXA 4IBLH 4B2CA 1E37B 2THFB 1ELFA 1O34A 1TNIA 1O2MA 2XNIA 2AEIH 1UTQA 1YC0A 2FM2A 2ZDVH 2VWNA 2XBXA 5TJXA 1TONA 5JDUB 4DGJA 5FBIA 2VGCB 1O3PB 3ZZDA 5T6GA 1O3DA 1H9IE 2ZNKH 1LO6A 1DPOA 3A7ZA 2WPMS 1TRYA 3UWIA 1YPHE 1NS3A 1YF4A 5L2ZH 1O39A 1IOEA 2QN5T 1A0JA 1GCTB 1WSSH 3F9HA 1LVYA 3CS0A 1OWJA 4CRBA 3S9BA 1MTVA 2H6MA 2PSXA 3RXQA 3ZZ9A 1WOFA 1OP0A 3FZDA 2QGRA 3OTJE 2FOBA 1CHOF 1ABIH 1C2IA 2QXGA 1QURH 1K1JA 1HDTH 1BCUH 1AFQB 3GY2A 1S5SA 3EA9A 5FPYA 1GL0E 1DVAH 1O33A 3B9FH 1WUNH 1TGNA 2BLOA 3ZZ3A 5A8XA 1GHBF 3PWCA 1YPGH 3UIRA 1A7SA 3ZYDA 1LPGB 2FIRH 2TIOA 2ZFQH 3KN2A 1G3CA 1NU9A 1CA0B 3KNXA 1CGJE 2EI8A 1HYLA 1OPHB 2F9VA 1N6YA 3L33A 1FY3A 3GY6A 1HUTH 2BY6X 4OS6A 4JZDH 2VVCA 1O3BA 1ETSH 1O2IA 1O2TA 3SU3A 2AFQB 3HATH 1P3EA 4U30A 2CHAC 3T26A 1AZ8A 1FY8E 4NZLA 2ZGXH 1GI3A 1ARCA 4AGKA 3SNDA 3LJJA 1ZRBA 3SI3H 1LCYA 1C2KA 3A8AA 2Y5HA 4H42U 1MAXA 1JIRA 2VINA 1YPJH 1GHVH 2FESH 1G3BA 4MTBA 1FY1A 2BMGB 3RXHA 3GYLB 5A0CA 4UEHH 2IPHA 1O5BB 1SI5H 3RMNH 2WUBA 1AZZA 2FLRH 4INHA 1UTJA 1IQKA 5CHAB 1O38A 3SO3A 5DKMA 4CRFA 5C20A 4BNRA 5DP3A 1RIWB 1P2QA 3RP2A 7LPRA 2XRCA 2HGTH 1C9PA 1KXDA 4ABFA 3H5CB 1WAYB 1GHBG 2BVXH 1SFIA 1D3PB 5GDSH 3D62A 1CBWC 1C2LA 1NZQH 4K8YA 4DCDA 1G32B 2PUXB 1UTMA 5JB9S 1A5HA 3AW0A 2A2QH 3SUEA 4X8VH 1ZZZA 2RA0A 3MHWU 5L2YH 4AB8A 2IJOB 1KTSB 4NIXA 5JBAS 1O5GH 1OKXA 3URDA 3MO9A 2FI4E 1D3QB 2OBOA 3RMMH 1XXDA 2ZQ1A 1J17T 2FMJA 1O3FA 2OTVA 4I8JA 1EPTA 3UOUA 3FFGA 1F0TA 3Q3YA 3SV7A 7GCHG 5AFZH 3SQHE 4FXGH 1BJVA 3MO3A 1EZSC 1Q31A 3M37A 2YNBA 2G00A 1Y3VA 3LIWA 2OXSA 1GI9B 3C27B 5EW1H 4WH8A 2SNWA 5EU8A 1C1NA 1W0YH 1O2LA 2V6NA 4HZHA 2FOMB 2SGDE 2GDEH 2FI5E 2BLVA 4X6OA 4GUXA 4I33A 2ZU1A 4Q7XA 5I46H 4O97A 4ZXXH 1RTLA 3DT0H 1C1TA 1TMUH 2GVFA 5GIBA 4WMEA 1T8LA 2V3OH 2PUQH 4X8TH 3SNCA 1BTZA 3ZYEA 1YYY1 4MPUA 1EQ9A 1PPZA 4AFUA 3V3MA 1DM4B 5GPIB 1C5LH 1CVWH 5F8XA 1O3JA 5EXLA 3JZ1B 4Y8XA 3PMBB 1MTWA 2ODPA 2Y7ZA 3BEIB 1PQAA 2CF9H 2H9HA 2G4TA 4BAQB 5T6DA 1A3EH 1GJDB 1IQLA 4YLUA 1JRSA 4M7GA 1MZDA 2EEKA 4WJG2 3ENSB 1VCPA 4ZROA 1C5QA 1F0UA 1W8BH 2J38A 1GMCG 1TALA 4YLQH 3S69A 1TMBH 1QB1A 4J2YB 3K6YA 1GJBB 4CREA 4O3UA 1BT7A 5C3NA 1GHZA 2AERH 2K1QA 3URCA 3SJOA 4I31A 5DG6A 2HPPH 1O5FH 3SUGA 1D4PB 2SGAA 4NSYA 4IMQA 1KXFA 1QR3E 3PLKA 1ELDE 1GJ6A 3PB1E 2PTCE 2AS9A 4B76A 3FZZA 2W26A 1P2JA 3FVFB 3U8RH 1BHXF 1OWEA 1DOJA 2ZEBA 3P8NA 1SR5C 2VIPA 2OLGA 1P9SA 4E7NA 2GV7A 3FANA 1TOCB 4TWWA 3RXSA 3RLWH 2GP9B 1A5GH 3KF2A 1BRAA 1DUAA 2GCHF 3MTYA 1TPOA 3P6ZB 2C4FH 4UE7H 6CHAC 1SB1H 1BTUA 1ZSLA 3SBKA 1V2WT 1DXPA 4NG9H 5T3HA 4X1NU 1GMHF 1K22H 1O3CA 1RGQA 3D49H 1PQ7A 1S0QA 4CRDA 1O2QA 1TAWA 1FI8A 1HAGE 2JKHA 5FPTA 4AN7A 2GZ9A 3C1KA 2ZQ2A 1QBOA 1A3BH 2ZO3H 3HK6B 4LZ1H 3N7OA 1CT0E 4ESTE 3LGWA 3A87A 1TNGA 3SV9A 1VZQH 5GJ4B 2ZFTA 3ZZ5A 1A0HB 4YTAA 3SZNA 3RXCA 5CE1A 4A6LA 5FXLA 1UMAH 1O2HA 4LK4A 5LPFA 3CP7A 4WWYA 4X8SH 5ETXA 3BTWE 3Q76A 2A31A 2DUCA 1V2VT 5GCHF 1BTYA 1E35B 1BZXE 3BTTE 2ANMH 3HGNA 2TPIZ 1V2TT 1AFQC 2P94A 3LGTA 1O0DH 1C1PA 2OINA 1EJAA 3RXLA 4AG1A 5K7RA 1MQ6A 4YT6H 3PLPA 1VGCC 3QWCH 1AKSB 1TGSZ 4DIIH 1DY9A 5EODA 3KEEA 3T2NA 4NSVA 1C2GA 1C5OH 1UTNA 1JIMA 1L1NA 2B8OH 4CH8B 4CRGA 1GBDA 3A8CA 3SU5A 2O9QA 2VIWA 3UQOA 3RXRA 3ZVDA 4Y76A 1UVSH 4NZQA 1HJAC 4UONA 1O2VA 1EUFA 2ASUB 1ELEE 3LU9B 3PO1C 2ZDLA 2PLXA 4BTUB 3TH4H 3DD2H 1ESTA 2P3UB 4FUFA 1P3CA 3BN9A 3JZ2B 4NA9H 4JZ1A 1GJ8B 1GPZA 4K1EA 2RG3A 1MTSA 1WBGB 1QL7A 5JBBS 1LQEA 1W11U 2SGQE 3PLBA 4BAHB 3BTQE 4HFPB 2FXRA 2H1UA 1K1NA 1PQ5A 3KQBA 1B7XB 4AGJA 1YPMH 3TIUA 1T32A 4AFZA 1X7AC 1C2JA 1GBFA 1HRTH 3RLYH 1W3CA 3OSYA 1KIGH 5A09A 1CSOE 2VH6A 1B0FA 1C5ZB 1O3HA 3RXAA 1F5LA 4FVBA 1V2JT 1TNKA 3WY8A 3IWMA 3QGJA 1GJ5H 1AVWA 3RXTA 1A0LA 2BXTH 3TITA 2STBE 2PFEA 3BTDE 3SV6A 3MFJA 1AO5A 1D9IA 4NA7A 1ZHMA 1UK3A 1QRWA 2SGEE 2EI7A 4Y0ZE 4B73A 1O5EH 2GV6A 4ABAA 5LPRA 2A5AA 3U98H 3L3TA 2P8OB 2KAIB 1XKAC 3RXIA 1N1LA 2FEQH 2YOLA 4Q7ZA 1C5WB 1FY4A 4Y10E 3B23B 3F9FA 3S7HB 1ZRKA 2FYQA 4OS5A 3GYMA 5B6OA 4J1YA 1NRQH 4ZKOU 3E0NB 3G01A 5AHGH 2XWBI 1LHDH 3TK6A 1V3XA 3PO1B 2CN0H 1S85A 3Q00A 4ABHA 1AU8A 1C9TA 1KDQB 3NK8A 1EJMA 5J4SA 1HJAB 1A1RA 3MNBA 1UCYE 1GVZA 3U9AH 1RIWC 1LPKB 1ARBA 1D6WA 4D8NA 1F0RA 2UUKB 2TGPZ 3SGBE 2VWLA 5HM2A 1FQ3A 5C1XA 2ZWLH 1OP8A 2VWOA 3ZVGA 1O2SA 3BG8A 2AMQA 5LPEA 1HLTH 2HNTC 1JXPA 4ISOA 2FO9A 2O8MA 1Z1JA 1GI1A 3MMGA 1E36B 1O2PA 1EKBB 2VVUA 1NM6A 3M36A 2ZU4A 1P01A 1YPLH 1QA7A 1VCQA 5GXPA 2FI3E 2GX4A 5JBTA 2GKVE 1W0ZU 1O2GH 1XUKA 4X1QU 4X6NA 1F7ZA 5JBCS 1HAVA 3V12A 3DFJA 1PPCE 4JZEH 1P2KA 3OYPA 2GD4B 1J16A 8GCHF 3TGJE 1G9IE 3F1SB 1C4V2 3BTFE 2ZHWH 4R0IA 1K1PA 3OX7U 1O2RA 4OS1A 3TJVA 3T28A 4DJZB 3UWJH 3SU0A 1ZTKA 1LTOA 1ZJDA 4WMFA 2XBYA 2OBQA 2Z9JA 2FX4A 1XM1A 3A86A 4MVNA 1FDPA 3ZVCA 1MCTA 1THRH 1C1OA 1YM0A 1OP2A 4I8HA 2WPLS 4H4FA 3BEUA 4Y7BA 3BG4C 3MH6A 3UREA 1VGCB 4LOYH 1WCZA 3MO6A 4NGAH 3SNAA 3E90B 1JRTA 2ZU2A 1VITG 2O8TA 3MWIU 4IW4E 3SW2B 4WY3A 3RM0H 3TNSA 7KMEH 1BTWA 4NIWA 2FX6A 1IHSH 1GI4A 3AVZA 3DHKH 3UY9A 1BMNH 3EYDA 1AY6H 5A0BA 1EB2A 4CHAB 1AB9C 1ZHRA 3SOSA 4UFGH 3I29A 1ELGA 2ZFRH 3GICB 4CH2B 1CGHA 1UTOA 2QCYA 5A2MH 4WXIA 1QHRB 1EZQA 5DO4H 1HCGA 1FZZA 1DFPA 5A0AE 3RUOA 4F4OC 2OP9A 1SGQE 2OC0A 2ZHDA 1SGFG 2R0LA 5PTPA 4XSKU 2AIPA 5K0HA 2R9PA 2CGAA 1C2HA 2SNVA 1ANCA 1YGCH 1SGCA 5FX5A 3ZVFA 3SUFA 4UDWH 2R3YA 3NWUA 3SNEA 1MU6B 3O8BA 1XUFA 1G30B 2BDCA 2SGFE 4XBBA 2NU2E 4Q2KA 1Q2WA 2SFAA 1MKWH 4KTCA 2P3TB 3EE0B 1T7CA 8ESTE 3MNSA 1GMCF 1BITA 4KTSA 1QTFA 4FUDA 1PQ8A 3LC5A 1FV9A 3KQEA 1DXWA 2W3KA 4A1XA 1QJ6B 1C5TA 3EQ0H 1EB1H 1XUIA 4DW2U 2A32A 1KXBA 2VH0A 1AIXH 2ZU5A 2G52A 1XMNB 2BX4A 3I77A 2FOCA 1QFKH 1HAOH 3MU0A 4Y0YE 4ABGA 2R2MB 1C1WH 4AX9H 1BTPA 3R3GB 6GCHG 3LGYA 1FXYA 2A7CA 3BEFB 3BTME 1P11E 2Z9IA 1TE0A 3P8FA 2BX3A 4Y8ZA 5DK1A 1L1GA 1D3TB 2VWMA 4RSPA 1YCPM 2F9PA 3A7XA 2J94A 1F92A 1PPFE 1YP9A 2WINI 2QYIA 3H7TA 1JWTA 3OU0A 4THNH 1GI7B 1FAXA 1RXPA 1AI8H 1KXAA 2PHBA 4GAWA 4TPYA 1AWHB 1H9HE 2PTNA 1O2UA 1YKTA 1YBWA 1XUGA 5LH8A 1OXGA 1FNIA 2WPIS 2FPZA 1NRNH 4PROA 1NTPA 4ABDA 2VJ1A 4FUGA 4K8BA 1ANBA 1C5PA 3RXUA 2BQWB 1V2RT 1C5SA 4TY7A 1LHFH 2A7JA 3UUZA 3RC6A 1V2MT 1TIOA 3M35A 2D1JA 2FODA 2AMDA 2VIQA 3F68H 1MZAA 2F9UA 4CBNA 2Q1JA 2ZGCA 1HAIH 1TRNA 1S0RA 1SGPE 1YCPK 1ZPZA 3LOXA 1TGBA 5I25A 1LVBA 1P57B 2ZDNA 3GCHB 2ZGBH 2FDAA 4WH6A 5ESTE 2ZC9H 6ESTA 1W14U 5DP5A 1ESAA 1GCDA 1UVOA 4IGDA 1G3DA 1AKSA 4FVDA 3RXKA 1Y3WA 5AFYH 3GCTF 1FIZA 1QL8A 1Y5UT 3AAUA 2ZDMA 1V2OT 1RRKA 4ABBA 1NESE 1W7GH 4NIYA 1GHWH 1TBZH 2Y5FA 3T29A 3O8RA 1HXFH 3VB4A 4B2BA 3PV4A 2Z94A 2GTBA 4YOGA 4Z0KA 1DS2E 5ESBA 5FPSA 1YPEH 3NZIA 5TCAA 1F2SE 4OS2A 4AB9A 1O36A 2RCEA 2FOFA 1K1IA 5C2ZA 3TJOA 2F83A 1LPZB 1EOLA 1JOUB 2JH5D 4LXBH 1HIAB 1K1OA 2AIQA 2FOGA 1MTNC 2A1DB 3A84A 5CMXH 2ANWA 4IS5A 1Z1IA 3ZZ8A 2JETC 2Q6DA 2QC2A 3HKJB 4MNYA 1WU1A 3K9XB 3TU7H 2FZZA 2XCNA 1OWHA 1SLUB 4I32A 1VJAU 1L2EA 2OQUA 2J95A 1ZTLA 1ACBE 2TRMA 3P92A 4DURA 2VNTA 2ZA5A 2A4QA 1PPGE 4O9VA 1O2WA 5CHAC 1MAYA 4YOIA 3ZZBA 1GBTA 1FN6A 4HTCH 4I8GA 4WMDA 3GDUA 3KIDU 4AYYB 2GZ8A 1K21H 5C1UA 1MD8A 3F9GA 1UCYH 2ZECA 4MNVA 3VXFH 4BAOB 1Z8JB 1HAPH 1C4Y2 2SGPE 2ZGHA 1C1VH 2Z3CA 1BBRK 2BLWA 2XC5A 2A5IA 1QBNA 1A46H 4OGXA 3S7KB 4D7FA 1U6QA 2BDAA 1BA8B 1DWCH 2ZGJA 4ZH8A 2IOTA 8KME2 1PPBH 4KTUA 8LPRA 3F6UH 4O03A 4UFDH 3U1IB 2RDLA 3U8TH 3SN8A 2Z3DA 2AH4X 1SGYE 1SHHB 1T8NA 1UHBA 8GCHG 1SVPA 3MH5A 5DP8A 3D65E 2ZFSA 1IHTH 4CHAC 1O3AA 1AD8H 3STIA 3BTEE 3V13A 2UWPA 4ABEA 3DUXH 2A45B 2XXLA 1PPEE 1O32A 2F91A 3MU4A 3BV9B 4RKJB 1G2MA 1SFQB 2HWLB 1TOMH 2CMYA 1SGIB 2BQ6B 2W3IA 1CHGA 2WPKS 1O30A 1EAXA 3SV8A 1WTHD 2BTCE 1DE7H 1P2IA 1V2UT 2BQ7B 2FLBH 1JMOH 4AZ2B 1GMDF 1J9CH 1V2KT 3A8BA 1TFXA 2ZPRA 2V0BA 1ZGVA 4KELA 6LPRA 2HNTF 1Y59T 3MYWA 1TPSA 2GCTB 1DICA 1IQEA 1KLIH 3EAJA 1V2LT 1EP5A 1KLJH 5F03A 1P2MA 2LNCA 1A5IA 1GBJA 1C5NH 2EI6A 1LDTT 2FTLE 4RKOB 4NWLA 1ZMJA 3VFEA 1HAHH 1O3EA 2B7DH 3E3TA 3LGIA 5IYTA 2OUAA 1VJ9U 2AGGX 3SQEE 1E34B 1BJUA 3IITA 1VITH 2W7SA 1F5KU 3SU2A 2QY0B 3TNTA 3TH2H 1AVXA 2PGBB 1P02A 2G5NA 3LDXH 3SV2H 3S9CA 1D3DB 2W5EA 3RU4D 3RXPA 5FAHA 4MDSA 1ANEA 1BMLA 3W95A 1TNLA 4FUEA 3S0NA 1HPGA 4KKDA 1MU8B 1ZPBA 1FMGA 2TGTA 1P04A 5E8EH 2ANKH 5EPYA 3NXPA 2OC8A 1SQAA 2F9BH 4B2AA 3GCOA 1W7XH 2FS8A 1ELCA 4ZKNU 4Y6DA 1NFYA 2OC1A 3A7YA 5HM9A 4X6PA 3NCLA 2Z7FE 2C8XB 2BD5A 3ATWA 5HMAA 4MPWA 3SI4H 3KQDA 1C2DA 3QUMP 1MBQA 1GBMA 1O2KA 3ATLA 5EPNA 2V35A 1GI0A 3VPKA 3CENA 4OS4A 1HV7A 1L4DA 1V2QT 2XBWA 1G3EA 1P10A 3ATKA 1C5MD 2JETB 2ESTE 3TLOA 4BAKB 1C5VA 4D9QA 1EJNA 4JK5A 1EPTC 2XW9A 1JBUH 1Z6EA 2GDDA 3RM2H 1ZTJA 2VIDA 1O3MA 2ZDKA 3A81A 4JYVH 2ULLA 3RXMA 1KYNA 3SJKA 3P70B 4JYTA 1QIXB 1S6FA 1NRRH 2QF0A 4FU9A 4Y11E 5F6MA 1AQ7A 3RXDA 1GG6C 1GJAB 1HIAA 2BDIA 1O31A 4WXVA 4JCNA 3QDZB 1BHXB 2G4UA 1H1BA 4I7YH 1C2EA 1KLTA 2PW8H 1NRSH 3LH3A 3FP7E 1PYTC 1GI8B 3RC4A 1FAKH 1OWDA 3PTBA 3SNBA 1OYTH 2XC4A 5FCRA 1BTHH 1CT2E 1P06A 1ZMLA 1Z71A 1SC8U 1UVTH 1NY22 2ZHEH 5EXMA 1NFWA 1B5GH 4GSOA 3GCHC 3U69H 4D7GA 4ZAEA 2BDHA 2HPQH 4A92A 1Y3XA 2UWLA 1TNJA 1SOZA 1O3LA 3UNQA 5BPEA 1XUHA 2OCVB 3K2UA 1ZR0A 2PSYA 1EP6A 1T4VH 3BIVH 4AOQA 4ZKRU 1NC6A 3KQCA 4IC6A 3T27A 1O3OA 1G37A 2G81E 1QB9A 3A80A 1K1LA 1QCPA 3HK3B 1CQQA 1QJ7B 5JPMH 2WV4A 1NU7B 4JYUH 1AN1E 2NU1E 1S6HA 1WYKA 1AE8H 3TPIZ 1F5RA 1GHAF 4XFQA 3NUMA 4DY7B 2TGDA 6CHAB 1NFXA 2K7XA 5H4IB 4H6TA 1KXEA 1Z6JH 4B1TA 1O3GA 1HAYB 3MH7A 4X2XA 1O3KA 1TPAE 2WV5A 4AG2A 1Y3UA 5G4BA 2A7HA 5TCCA 1TB6H 3PMJA 4Q7YA 4DVAU 1AUTC 2F9NA 1TGTA 1H8DH 2G8TA 1ANDA 2ZKSA 3MU5A 5EQRA 1SLVB 5DP9A 1KSNA 2J9NA 1VR1H 1T8OA 3GCTG 4VGCB 1BRBE 4XOJA 2A4RA 2Z9KA 4MPXA 4FUJA 1GGDC 1C1QA 3RDZA 2PV9B 5T6FA 1FUJA 2XC0A 3EA7A 3GCNA 5JYIA 1UO6A 2ZHQH 3I78A 1EAUA 6GCHF 1QB6A 1BB0B 2C8WB 4NWKA 2I6QA 3QTOH 5DPAA 1T4UH 4X8UH 4X6MA 3TGIE 3ODFA 1NRPH 2CHAB 1GBAA 1CA8B 4TPIZ 1FIWA 2F9OA 1XXFA 2BM2A 2H2ZA 4ZXYH 2PGQB 5JB8S 3Q3XA 1TA6A 3GY7A 1DUEA 1WTGH 2FTMA 3M5LA 1SQOA 4I8LA 1BTXA 1LKBA 2FP7B 1FLEE 2OD3B 1XKBC 4X0WU 3O8CA 5HYOA 2ZCHP 1YPKH 4BAMB 2R0KA 3HPTB 4VGCC 2Y7XA 4ISLA 3M3SA 1HXEH 2O8WA 1XVMA 3EGKH 3LJOA 3UR9A 2Z3EA 2EA3A 4ZHAA 3E0PB 1FONA 4F49A 1LHCH 1INCA 3L6PA 1A4WH 3NKKA 3M3TA 1PPHE 3SJ9A 1W2KH 2H9EH 2O8LA 1L1JA 3MI4A 1D6RA 3SHAH 1MBMA 2BD3A 5A8YA 1C2MA 1K2I1 3M7QA 3RXGA 5ABWA 1SGRE 4ZUHA 1QQUA 2VU8E 4ZKSU 1YLCA 2BY9X 1DITH 3BTKE 1TQ7B 3RU4T 1C5RA 4ISIH 2Z9GA 2ZTYA 4GHQA 2VB0A 1GJ4H 1GHAG 3VGCC 4BOHA 2ZP0H 3A85A 3CS7A 3OY5U 4DOQA 1B0EA 1BBRH 1DSTA 1C4U2 1W12U 1DSUA 2CJIA 3ODDA 1ZSJA 3VB6A 4OS7A 3RXOA 4A5TS 1GG6B 1HJ8A 1GI2A 1GVLA 2VVVA 1SGDE 1V2NT 3TJNA 3P17H 1P0SH 5E2PA 1CU1A 4UFFH 1V2PT 3A7WA 1SGEE 2NU3E 2BB4A 1GDUA 4IMZA 1O2NA 4LZ4B 1GHXH 4GHTA 5A8ZA 4ABIA 4CBOA 5F8ZA 1O5AB 1ZYOA 3TH3H 1J8AA 1GBBA 1TQ0B 1RS0A 4NFEA 2EC9H 1K1MA 5L30H 2GGVB 1N8OB 3TVJB 1GBLA 1BQYA 1DANH 1QRZA 3R0FA 4FU8A 1ORFA 3LT3A 3ITIA 3UPEA 1IQMA 1HAXB 2B0FA 1IQIA 2UUYA 1IQHA 1UTKA 1HB0B 2FOHA 1OS8A 2ALVA 4FUIA 1GDQA 2Y82A 3MH4A 1TX8A 1UVUH 4GVUA 1QGFA 1DWBH 4NCYA 2WYGA 3IG6B 2C3SA 3AASA 2QV1A 5DP4A 3SU6A 5BRRE 1DY8A 1OYQA 2BOHB 1TNHA 1WQSA 1A61H 2OQ5A 4NFFA 5GCHG 1ELAA 2B9LA 1LHGH 2C8ZB 2QXJA 3KCGH 1UCYK 4Y7AA 5EQSA 1L0ZA 2BZAA 4TWYA 2ZIQH 3RMOH 1IQGA 4OGYA 5LGOA 1QJ1B 4ISHH 1MKWK 4KGAA 1C1MA 1RTKA 2Q6FA 3TK5A 1OSSA 2BDBA 2P59A 3RXBA 5F8TA 4X2YA 3ZV8A 1DWEH 3ZZAA 1SL3A 4K1TA 1HAZB 1P9UA 3ESTA 1CA0C 3QO6A 1GGDB 3UR6A 1SQTA 3M7TA 4X2WA 5DP6A 4AFQA 2PKSB 2ILNA 2J4IA 2HVXA 3PYHA 1SOTA 1BMMH 1HNEE 1O3IA 3SU4A 4HI3A 1ZGIA 5SGAE 1O2ZA 1GVKB 2GCHG 3HKIB 1H4WA 2J92A 4UD9H 2NWNA 3LONA 2Z9LA 3Q3KA 1V6DA 2TGAA 3SORA 1EASA 1MKXH 3ZZCA 1SHYA 3H7OA 4X1RU 1KTTB 1THPB 2J2UA 3VEQB 2G5VA 2HALA 4ABJA 1NT1A 1ELBA 1XUJA 1ZMNA 1F0SA 1AGJA 1TGCA 4HGCA 7GCHF 1RJXB 2PKAA 4YM9A 4TYDA 1Q3XA 2A2XH 2WPHS 3GY3A 3M5MA 1S81A 1TA2A 1VCWA 1GBIA 1SBWA 1UJ1A 1UK2A 3E6PH 3SJIA 1O2JA 1SG8B 2DE9A 4FUHA 1ZOMA 5EOKA 4IC5A 4FUBA 3SU1A 1DX5M 3PMAB 1MMJN 1KDQA 2Y6TA 1KY9A 3B8JA 2GCTC 1QL9A 2PR3A 3M5NA 2FYRA 4B71A 1BIOA 1Z8IB 4B74A 4IN2A 3VB5A 1UVPA 1GHYH 2C93B 4JK6A 4DT7B 1C1RA 4YZUA 3LH1A 1TABE 3BIUH 1NFUA 1S82A 1XVOA 1Y5BT 1NN6A 1RFNA 2Z6BD 2QF3A 2D2DA 1ELTA 1C1UH 3ATMA 3SGAE 3GDSA 1EAIA 2GT8A 5EQQA 1W13U 1MD7A 1ZHPA 3UQVA 1Y5AT 2FOAA 4K5ZA 4ZHLU 3LGUA 2PKSC 1GCTC 2Q6GA 4X1PU 3ZVBA 1C5XB 1GBKA 4JZFH 3BG4B 1P03A 1QQ4A 1RTFB 3A8DA 1MQ5A 1HAVB 1GI6A 4XBDA 1SGNE 2P95A 2P93A 1T31A 3ZZ7A 2DE8A 4JZIA 4BXSA 3ATIA 1C5YB 4K69A 4CRCA 3BTGE 2H5DA 2ZFPH 1XX9A 4BANB 2G51A 1MH0A 1EX3A 3QZQA 3UNRA 1PJPA 1O37A 1VITF 2P8OC 1MTNB 2UUJB 2ZDAH 4NA8A 1BRUP 1THSH 3MNCA 1EZUC 1FN8A 2ZPSA 5GWZA 2D26C 3DA9B 2HNTE 2ANYA 3E16B 3LC3A 1AFEH 3SHCH 1GDNA 3M61U 5E2OA 4DIHH 3VGCB 2GMTC 1OWIA 3BSQA 2J34A 2XBVA 1SGFA 4R8TB 3E91A 3DFLA 3PTNA 5DGJA 3MU1A 1SSXA 1WQVH 2QAAA 1N8OC 3O8DA 3QX5H 4SGBE 1GMHG 3K6ZA 3M3VA 2R2WU 2GT7A 3RC5A 3E1XB 3PM3A 1E0FD 1A2CH 1DWDH 4WVPE 3RMLH 4Z6AH 3UTUH 1CGIE 1TLDA 5DJ7A 2NU0E 4GPGA 2BY8X 3A82A 2CF8H 2P3FH 3M5OA 4X2VA 4ASHA 1W10U 1IQFA 4I8KA 4WF8A 1CT4E 1Y3YA 2ODYB 3T25A 1ESBA 4BXWA 1YLDA 3QTVH 1IQJA 2HOBA 4GCHF 5EG4A 3V0XA 1GJ7B 1QNJA 4H6SB 1BBRE 5EXNA 3K65B 1MCVA 1O2OA 2KAIA 3RXEA 5HGGA 1TWXB 1TRMA 4U01A 3KL6A 3RXFA 4MNXA 1P8VC 2XYAA 2B5TB 4DG4A 1G36A 3ZV9A 1FY5A 2AGIX 3UFAA 1YPHC 2ALPA 1OWKA 5C5OA 2BOKA 2TBSA 4IN1A 1TX7A 3EDXB 4U32A 4Y8YA 2NU4E 1MKXK 1SPJA 5C67A 3TK9A 1DLKB 2ZZUH 3F9EA 2IN2A 1G2LA 3LGVA 4MLFB 1YCPH 1DDJA 3BF6H 1UK4A 4RN6A 2BY7X 2BD4A 2ZU3A 3A7TA 1ZJKA 2BZ6H 3FAOA 2XCFA 2UUFB 1HBTH 5EGMA 2HRVA 1MUEB 1HGTH 4XE4A 4X1SU 4B75A 2XWAA 4D9RA 3LKWA 3UOPA 5HXFA 9LPRA 1GMDG 3M7UA 2V3HH 1UTPA 2BHGA 4XDEA 3RU4E 3SGQE 1TBRH 3QZRA 3AW1A 1AMHA 4YOJA 3T5FH 1GL1A 1O2YA 1PYTD 2G55A 4UFEH 4K1SA 5J4QA 7ESTE 1TPPA 1HJ9A 1ETRH 1GWAA 1K28D 1LVMA 1M9UA 3ZZ6A 3VB7A 1AUJA 2BDGA 2I6SA 2LIZA 1EZXC 4E06H 4BTIB 1FPHH 4GCHG 2BD7A 3GOVB 2P16A 1LHEH 5E0GA 1KXCA 2ZPQA 3AAVA 4JMYA 1CBWB 3OY6U 3A88A 1IAUA 4AFSA 2A4OA 1DT2A 4MPVA 2HLCA 1O2XA 1SMFE 1BMAA 2H9TH 2ODQA 2BVRH 3P8OA 5FCKA 4Y79A 1C2FA 3ZVAA 1ELVA 1QRXA 1K9OE 1EAWA 2JH6D 2LPRA 2M5TA 5FHTA 4A1VA 4KP0A 3A7VA 1MTUA 1TYNA 3ELAH 1LQDB 2FOEA 1NPMA 1QA0A 1Z7KA 5E0JA 1GI5A 1GBCA 2GZ7A 1J14A 3GY8A 1EXFA 3LPRA 3U1JB 3RXJA 2QXIA 3GDVA 2WUCA 3V7TA 1GBEA 3ZVEA 4ZHMU 1ZLRA 4A1TA 3QN7A 2PWXA 4U2WA 2D8WA 4D76A 1H9LB 4SGAE 1O5CB 2AYWA 2STAE 3Q77A 3EBNA 2ZTZA 4INKA 3FP6E 5AF9H 5L6NH 1O35A 4CR9A 4XBCA 1BOQA 1NO9H 1N6XA 2WPJS 2C8YB 2ZI2H 3EA8A 2BY5X 3U8OH 3P8GA 2AMPA 3PWBA 2WYJA 3T62A 1AE5A 2A4GA 3GY5A 3ZZ4A 2W7UA
chains in the Genus database with same CATH superfamily
1BRCE 3BTHE 1S84A 3VXEH 3UAIC 1WXRA 1FPCH 1CE5A 3A89A 2ZFFH 2Y81A 2A5KA 4MNWA 1SLWB 1AVGH 2H5CA 1TX6A 4MG3A 2ZHFH 9ESTA 4QT8C 1GJ9B 2FWWA 2ZTXA 5C5NA 4Y71A 1P12E 3UNSA 3TJUA 2BXUH 1AB9B 2R3UA 4CRAA 1J15A 1V2ST 3KGPA 3STJA 2ZF0H 1Z8GA 1UTLM 4K60A 4Q80A 3QLPH 1P2NA 4BTTB 4O3TA 2LP6A 2FS9A 2AGEX 4ZMAH 5C1YA 2BD2A 4MQAA 1BDAA 1S83A 2XTTB 3MU8A 1RD3B 3TGKE 3A83A 2ZCKP 4E05H 4FUCA 1GJCB 2PKAB 4AYVB 2ZG0H 1HFDA 1TBQH 5FX6A 2BVSH 2Y5GA 2QXHA 3OEED 4K3JA 1E38B 2OC7A 3D23A 3GY4A 4FU7A 1CHOG 1O5DH 1P09A 2F3CE 3E8LA 3RXVA 3OE7D 1UHBB 3KHVA 2RA3A 1EATA 1FJSA 4AORA 3GISB 2BYAX 2UWOA 5IDKA 4A7IB 4E7RG 1W0JD 1ID5H 3QK1A 1OOKB 1TMTH 2A0QB 5FBEA 3HGPA 2BLQA 4YO9A 3S9AA 1Y8TA 1AHTH 5AVDA 2VGCC 3QGNB 1L4ZA 1AWFH 1LKAA 1ZSKA 1BUIA 2ZCLP 1GBHA 5HKKD 5EW2H 2CV3A 1C1SA 4DT4A 1DLEA 3NPSA 4GLYA 1OX1A 2BDYA 2O8UA 2YNAA 4K2YA 4ISNA 1EPTB 3PROA 1C5UA 1ZPCA 1WV7H 1IQNA 4FOUC 1NROH 2C90B 4Q63A 1PFXC 3SJ8A 3PMHB 2QIQA 1EOJA 1QBVH 1Z8RA 2VIVA 1O3NA 2JH0D 1UW7A 3P95A 1SLXB 4YT7H 2QA9E 4CR5A 1H8IH 1SGTA 3MOCA 3PRDA 1LMWB 1LVOA 1CO7E 1QY6A 3ZIAD 1P05A 2BD9A 4TY6A 3FP8E 2WPDD 4NIVA 4HG6A 2BD8A 2Y80A 1ETTH 1P2OA 2CXVA 3SUDA 2VIOA 3W94A 4YESB 5DP7A 1ABJH 2GMTB 4INLA 1T8MA 5E0HA 3VB3A 4F48B 3MNXA 4IBLH 4B2CA 1E37B 2THFB 1ELFA 1O34A 1W0KD 1TNIA 2IJD1 1O2MA 2XNIA 2AEIH 1UTQA 2AHME 1YC0A 2FM2A 2ZDVH 2VWNA 2XBXA 5TJXA 1TONA 5JDUB 4DGJA 5FBIA 2VGCB 1O3PB 3ZZDA 5T6GA 1O3DA 1H9IE 2ZNKH 1LO6A 1DPOA 3A7ZA 2WPMS 1TRYA 3UWIA 1YPHE 1NS3A 1YF4A 5L2ZH 4F55A 1O39A 1IOEA 2QN5T 1A0JA 1GCTB 1WSSH 3F9HA 1LVYA 3CS0A 1OWJA 4CRBA 3S9BA 1MTVA 2H6MA 2PSXA 2V3MA 3RXQA 3ZZ9A 1WOFA 1OP0A 3FZDA 2QGRA 3OTJE 2FOBA 1CHOF 1ABIH 1C2IA 2QXGA 2RDEA 1QURH 1K1JA 1HDTH 1BCUH 1AFQB 3WWFA 3GY2A 1S5SA 3EA9A 5FPYA 1GL0E 1DVAH 1O33A 3B9FH 1WUNH 1TGNA 2BLOA 3ZZ3A 5A8XA 1GHBF 3PWCA 1YPGH 3UIRA 1A7SA 3ZYDA 1LPGB 2FIRH 2TIOA 2CK3D 2ZFQH 3KN2A 1G3CA 1NU9A 1CA0B 3KNXA 1CGJE 1E79D 2EI8A 1HYLA 1OPHB 2F9VA 1N6YA 3L33A 1FY3A 3GY6A 1HUTH 2BY6X 4OS6A 4JZDH 2VVCA 1O3BA 1ETSH 1O2IA 1O2TA 3SU3A 2JDID 2AFQB 3HATH 1P3EA 4U30A 2CHAC 3T26A 1AZ8A 1FY8E 4NZLA 2ZGXH 1GI3A 1ARCA 4AGKA 3SNDA 4XD7D 2J98B 3LJJA 1ZRBA 3SI3H 1LCYA 1C2KA 3A8AA 2Y5HA 4H42U 1MAXA 1JIRA 2VINA 1YPJH 1GHVH 2FESH 2LELA 1G3BA 5KECA 4MTBA 1FY1A 2BMGB 3RXHA 5F53A 3GYLB 5A0CA 4UEHH 2IPHA 1O5BB 1SI5H 3RMNH 2WUBA 1AZZA 2FLRH 4INHA 1UTJA 1IQKA 5CHAB 1O38A 3SO3A 5DKMA 4CRFA 5C20A 4BNRA 5DP3A 1RIWB 1P2QA 3RP2A 7LPRA 2XRCA 2HGTH 1C9PA 1KXDA 1OHHD 4ABFA 3H5CB 1WAYB 1GHBG 2BVXH 1SFIA 1D3PB 5GDSH 3D62A 1CBWC 1C2LA 1NZQH 4K8YA 4DCDA 1G32B 2PUXB 1UTMA 2F43B 5JB9S 1A5HA 3AW0A 2A2QH 3SUEA 4X8VH 1ZZZA 2RA0A 3MHWU 5L2YH 4AB8A 2IJOB 1KTSB 4NIXA 5JBAS 1O5GH 1OKXA 3URDA 3MO9A 2FI4E 1D3QB 2OBOA 3RMMH 1XXDA 2ZQ1A 1J17T 2FMJA 1O3FA 2OTVA 4I8JA 1EPTA 3UOUA 3FFGA 1F0TA 3Q3YA 3SV7A 7GCHG 5AFZH 4YXWD 3SQHE 4FXGH 1BJVA 3MO3A 1EZSC 1Q31A 3M37A 2YNBA 2G00A 1Y3VA 3LIWA 2OXSA 1GI9B 3C27B 5EW1H 4WH8A 2SNWA 5EU8A 1C1NA 4OM9A 1W0YH 1O2LA 2V6NA 5DN6D 4HZHA 2FOMB 3FOAA 2SGDE 2GDEH 2FI5E 2BLVA 4X6OA 4GUXA 4I33A 3F2GA 2ZU1A 4Q7XA 5I46H 4O97A 4ZXXH 1RTLA 3DT0H 1C1TA 1TMUH 2GVFA 5GIBA 4WMEA 1T8LA 2V3OH 2PUQH 4X8TH 5T1VA 3SNCA 1BTZA 4M9FA 3ZYEA 1YYY1 4MPUA 1EQ9A 1PPZA 4AFUA 5HIZA 3V3MA 1DM4B 5GPIB 1C5LH 1CVWH 5F8XA 1O3JA 5EXLA 3JZ1B 3PV5A 2VBCA 4Y8XA 3PMBB 1MTWA 2ODPA 2Y7ZA 3BEIB 1PQAA 2CF9H 2H9HA 2G4TA 4BAQB 5T6DA 1A3EH 2KCOA 1GJDB 1K0HA 1IQLA 4YLUA 1JRSA 4M7GA 1MZDA 2EEKA 4WJG2 3ENSB 5CHBA 1VCPA 4ZROA 1C5QA 1F0UA 1W8BH 2J38A 1GMCG 3OEHD 1TALA 4YLQH 3S69A 1TMBH 1QB1A 4J2YB 3K6YA 1GJBB 4CREA 4O3UA 1BT7A 5C3NA 1GHZA 2AERH 2K1QA 3URCA 3SJOA 4I31A 5DG6A 4ACBA 2HPPH 1O5FH 3SUGA 1D4PB 2SGAA 4NSYA 4IMQA 1KXFA 1QR3E 3PLKA 1ELDE 1GJ6A 3PB1E 2PTCE 2AS9A 4B76A 3FZZA 2W26A 1P2JA 3FVFB 3U8RH 1BHXF 1OWEA 2WV9A 1DOJA 2ZEBA 3P8NA 1SR5C 2VIPA 2OLGA 5EIYA 1P9SA 4E7NA 2GV7A 3FANA 1TOCB 4TWWA 3RXSA 3RLWH 2GP9B 1A5GH 3KF2A 1BRAA 1DUAA 2GCHF 1YWUA 3MTYA 1TPOA 3P6ZB 2C4FH 4UE7H 6CHAC 1SB1H 1BTUA 1ZSLA 3SBKA 1V2WT 1DXPA 4NG9H 5T3HA 4X1NU 1GMHF 1K22H 1KMHB 1O3CA 1RGQA 3D49H 1PQ7A 1S0QA 3F2HA 4CRDA 1O2QA 1TAWA 1FI8A 3MQKC 1HAGE 2JKHA 5FPTA 4AN7A 2GZ9A 3C1KA 2ZQ2A 1QBOA 1A3BH 2ZO3H 3HK6B 4LZ1H 3N7OA 1CT0E 4ESTE 3LGWA 3A87A 1TNGA 3SV9A 1VZQH 5GJ4B 2ZFTA 3ZZ5A 1A0HB 4YTAA 3SZNA 3RXCA 5CE1A 4A6LA 5FXLA 1UMAH 1O2HA 4LK4A 5GNDA 5LPFA 3CP7A 3EE7A 4WWYA 4X8SH 5ETXA 3BTWE 3Q76A 2A31A 2DUCA 1V2VT 5GCHF 1BTYA 4TT3D 1E35B 1BZXE 1QZ8A 3BTTE 2ANMH 1YY3A 3HGNA 2TPIZ 1V2TT 1AFQC 2P94A 3LGTA 1O0DH 1C1PA 2OINA 1EJAA 5KGOA 3RXLA 4AG1A 5K7RA 1MQ6A 5DSFA 4YT6H 3PLPA 1VGCC 3QWCH 1AKSB 1TGSZ 4DIIH 1DY9A 5EODA 3KEEA 3T2NA 4NSVA 1C2GA 1C5OH 1UTNA 1JIMA 1L1NA 2B8OH 4CH8B 4CRGA 1GBDA 3A8CA 3SU5A 2O9QA 2VIWA 3UQOA 3RXRA 3ZVDA 4Y76A 1UVSH 4NZQA 1HJAC 4UONA 1O2VA 1EUFA 2ASUB 5EJLA 1ELEE 3LU9B 3PO1C 2ZDLA 2PLXA 4BTUB 3TH4H 3DD2H 1COWD 1H8ED 1ESTA 2P3UB 4FUFA 1P3CA 3BN9A 3JZ2B 4NA9H 4JZ1A 1GJ8B 1GPZA 4K1EA 2RG3A 2XOKD 1MTSA 1WBGB 1QL7A 5JBBS 1LQEA 1W11U 2SGQE 3PLBA 4BAHB 3BTQE 4HFPB 5C0UA 2FXRA 2H1UA 1K1NA 1PQ5A 3KQBA 1B7XB 4AGJA 1YPMH 3TIUA 1T32A 4AFZA 1X7AC 1C2JA 1GBFA 1HRTH 3RLYH 1W3CA 3OSYA 1KIGH 5A09A 3U28C 1CSOE 2VH6A 1B0FA 1C5ZB 1O3HA 3RXAA 1F5LA 4FVBA 1V2JT 1TNKA 3WY8A 3IWMA 3QGJA 1GJ5H 1AVWA 3RXTA 1A0LA 2BXTH 3TITA 4ASUD 2STBE 2PFEA 3BTDE 3SV6A 3MFJA 1AO5A 1D9IA 4NA7A 1ZHMA 1UK3A 1QRWA 2SGEE 2YMSC 2EI7A 4Y0ZE 4B73A 1O5EH 2GV6A 4ABAA 5LPRA 2A5AA 3U98H 3L3TA 2P8OB 2KAIB 1XKAC 3RXIA 1N1LA 2FEQH 2YOLA 4Q7ZA 1C5WB 1FY4A 4Y10E 3B23B 3F9FA 3S7HB 1ZRKA 2FYQA 4OS5A 3GYMA 5B6OA 4J1YA 1NRQH 4ZKOU 3E0NB 3G01A 5AHGH 2XWBI 1LHDH 2HVYB 3TK6A 1V3XA 3PO1B 2CN0H 1S85A 3Q00A 4ABHA 1AU8A 1C9TA 1KDQB 3NK8A 1EJMA 5J4SA 3VG8A 1HJAB 1A1RA 3MNBA 1UCYE 1GVZA 3U9AH 1RIWC 1LPKB 1ARBA 1D6WA 4D8NA 1F0RA 2UUKB 2TGPZ 2KR7A 3SGBE 2VWLA 1WDIA 5HM2A 1FQ3A 3SZEA 5C1XA 2ZWLH 1OP8A 2VWOA 3ZVGA 1O2SA 3BG8A 2AMQA 5LPEA 1HLTH 2HNTC 1JXPA 4ISOA 2FO9A 2O8MA 1Z1JA 1GI1A 3MMGA 1E36B 1O2PA 1EKBB 3FO8D 2VVUA 1NM6A 3M36A 2ZU4A 1P01A 1YPLH 1QA7A 1VCQA 5GXPA 2FI3E 2GX4A 5JBTA 2GKVE 1W0ZU 1O2GH 1XUKA 4X1QU 4X6NA 1F7ZA 2KZ4A 5JBCS 1HAVA 3V12A 3DFJA 1PPCE 4JZEH 1P2KA 3OYPA 2GD4B 1J16A 8GCHF 3TGJE 1G9IE 3F1SB 1C4V2 3BTFE 2ZHWH 4R0IA 1K1PA 3OX7U 1O2RA 4OS1A 3TJVA 3T28A 4DJZB 3UWJH 3SU0A 1ZTKA 1LTOA 1ZJDA 4WMFA 2XBYA 2OBQA 2Z9JA 2FX4A 2QE7D 1XM1A 3A86A 4MVNA 1BMFD 1FDPA 3ZVCA 1MCTA 1THRH 1C1OA 1YM0A 1OP2A 4I8HA 2WPLS 4H4FA 3BEUA 3N7EA 2J5UA 4Y7BA 3BG4C 3MH6A 3UREA 1VGCB 4LOYH 1WCZA 3MO6A 4NGAH 2W6ID 3SNAA 3E90B 1JRTA 3OTPA 2ZU2A 1VITG 2O8TA 3MWIU 2M2AA 4IW4E 4WY3A 3RM0H 3SW2B 3TNSA 7KMEH 1BTWA 4NIWA 2FX6A 1IHSH 1GI4A 3AVZA 3DHKH 3UY9A 1BMNH 3EYDA 4Z1MD 1AY6H 5A0BA 1EB2A 4CHAB 3NRLA 1AB9C 1ZHRA 3SOSA 4UFGH 4FETA 3I29A 3DCLA 1ELGA 2ZFRH 3GICB 4CH2B 1CGHA 1UTOA 2QCYA 5A2MH 4WXIA 3SYJA 1QHRB 1EZQA 5DO4H 1HCGA 1FZZA 1DFPA 5A0AE 3RUOA 4RI0A 4F4OC 2OP9A 1SGQE 2OC0A 2ZHDA 1SGFG 2KCAA 2R0LA 5PTPA 4XSKU 3H09A 2AIPA 5K0HA 4P02A 2R9PA 2CGAA 1C2HA 2SNVA 1ANCA 1YGCH 1SGCA 5FX5A 3ZVFA 3SUFA 4UDWH 3DSOA 2R3YA 3NWUA 3SNEA 1MU6B 3O8BA 1XUFA 3KYGA 1G30B 2BDCA 2SGFE 4XBBA 2NU2E 4Q2KA 1Q2WA 2SFAA 1MKWH 4KTCA 2P3TB 3EE0B 1T7CA 8ESTE 3MNSA 1GMCF 1BITA 4KTSA 2KX4A 1QTFA 4FUDA 1PQ8A 3LC5A 1FV9A 3KQEA 1DXWA 2W3KA 4A1XA 1QJ6B 1C5TA 3EQ0H 3OAAD 1EB1H 1XUIA 4DW2U 2A32A 1KXBA 2VH0A 1AIXH 2ZU5A 2G52A 1XMNB 2BX4A 3I77A 2FOCA 1QFKH 1HAOH 3MU0A 4Y0YE 4ABGA 2R2MB 1C1WH 3W1EA 4AX9H 1BTPA 3R3GB 6GCHG 3LGYA 1FXYA 2A7CA 3BEFB 3BTME 1P11E 2Z9IA 1TE0A 3P8FA 2BX3A 3WW7A 4Y8ZA 5DK1A 1L1GA 1D3TB 2VWMA 4RSPA 1YCPM 2F9PA 3A7XA 2J94A 1F92A 1PPFE 1YP9A 2WINI 2QYIA 3H7TA 1JWTA 3OU0A 4THNH 1GI7B 1FAXA 1RXPA 1AI8H 1KXAA 2PHBA 4GAWA 4TPYA 1AWHB 1H9HE 2PTNA 1O2UA 1YKTA 1YBWA 1XUGA 5LH8A 1OXGA 1FNIA 2WPIS 2FPZA 1NRNH 4PROA 1NTPA 4ABDA 2VJ1A 4FUGA 4K8BA 1ANBA 1C5PA 3RXUA 2BQWB 1V2RT 1C5SA 4TY7A 1LHFH 2A7JA 3UUZA 3RC6A 1V2MT 1TIOA 3M35A 2D1JA 2FODA 2AMDA 2VIQA 3F68H 1MZAA 2F9UA 4CBNA 2Q1JA 2ZGCA 1HAIH 1TRNA 1S0RA 1SGPE 1YCPK 1ZPZA 3LOXA 1TGBA 5I25A 1LVBA 1P57B 2ZDNA 3GCHB 2ZGBH 2FDAA 4WH6A 5ESTE 2ZC9H 6ESTA 1W14U 5DP5A 1ESAA 1GCDA 1UVOA 4IGDA 2F4LA 1G3DA 1AKSA 4FVDA 3RXKA 2L74A 1Y3WA 5AFYH 3N99A 3GCTF 1FIZA 1QL8A 1Y5UT 3N7DA 3AAUA 2ZDMA 1H8HD 1V2OT 1RRKA 4ABBA 1NESE 1W7GH 4NIYA 1GHWH 1TBZH 2Y5FA 3T29A 3O8RA 1HXFH 3VB4A 4B2BA 3PV4A 2Z94A 2GTBA 4YOGA 4Z0KA 1DS2E 5ESBA 5FPSA 1YPEH 3NZIA 5TCAA 1F2SE 4OS2A 4AB9A 1O36A 2RCEA 2FOFA 1K1IA 5C2ZA 3TJOA 2F83A 1LPZB 1EOLA 1JOUB 2JH5D 4LXBH 1HIAB 1K1OA 2AIQA 2QF4A 3DSPA 2FOGA 1MTNC 2A1DB 3A84A 5CMXH 2ANWA 4I86A 4IS5A 1Z1IA 3ZZ8A 2JETC 2Q6DA 2QC2A 3HKJB 4MNYA 1WU1A 3K9XB 3TU7H 5IK2D 2FZZA 2XCNA 1OWHA 1SLUB 4I32A 1VJAU 1L2EA 2OQUA 2J95A 1ZTLA 1ACBE 2TRMA 3P92A 4DURA 2VNTA 2ZA5A 2A4QA 1PPGE 4O9VA 1O2WA 5CHAC 1MAYA 4YOIA 3ZZBA 1GBTA 1FN6A 4HTCH 4I8GA 4WMDA 3GDUA 3KIDU 4AYYB 2GZ8A 1K21H 2K0QA 5C1UA 1MD8A 3F9GA 1UCYH 2ZECA 4MNVA 3VXFH 4BAOB 1Z8JB 1HAPH 1C4Y2 2SGPE 2ZGHA 1C1VH 2Z3CA 1BBRK 2BLWA 2XC5A 2A5IA 1QBNA 1A46H 4OGXA 3S7KB 4D7FA 1U6QA 2BDAA 1BA8B 1DWCH 2ZGJA 2JJ1D 4ZH8A 2IOTA 8KME2 2YMSD 1S6LA 1PPBH 4KTUA 8LPRA 3F6UH 4O03A 4UFDH 3U1IB 2RDLA 3U8TH 3SN8A 2Z3DA 2AH4X 1SGYE 1SHHB 1T8NA 1UHBA 8GCHG 1SVPA 3MH5A 5DP8A 3D65E 2ZFSA 3F0OA 1IHTH 4CHAC 1O3AA 1AD8H 3STIA 3BTEE 3V13A 2UWPA 4ABEA 3DUXH 2A45B 2XXLA 1PPEE 1O32A 2F91A 3MU4A 3BV9B 4RKJB 3DSGA 1G2MA 2OK5A 1SFQB 2HWLB 1TOMH 3AK5A 2CMYA 1SGIB 2BQ6B 2W3IA 1CHGA 2WPKS 1O30A 4TSFD 1EAXA 3SV8A 1WTHD 2BTCE 1DE7H 1P2IA 1V2UT 2BQ7B 2FLBH 1JMOH 4AZ2B 1GMDF 1J9CH 1V2KT 3A8BA 1TFXA 2ZPRA 2V0BA 1ZGVA 4KELA 4B6FA 6LPRA 2K8IA 2HNTF 1Y59T 3MYWA 1TPSA 2GCTB 1DICA 1IQEA 1KLIH 3EAJA 1V2LT 1EP5A 1KLJH 5F03A 1P2MA 2LNCA 1A5IA 1GBJA 1C5NH 2EI6A 1LDTT 2FTLE 5C94A 4RKOB 4NWLA 1ZMJA 3VFEA 1HAHH 1O3EA 2B7DH 3E3TA 3LGIA 5IYTA 2OUAA 1VJ9U 2AGGX 3SQEE 1E34B 1BJUA 3IITA 1VITH 2W7SA 1F5KU 3SU2A 2QY0B 3TNTA 3TH2H 1AVXA 2PGBB 1P02A 2G5NA 3LDXH 3SV2H 3S9CA 1D3DB 2W5EA 3RU4D 3RXPA 5FAHA 4MDSA 1ANEA 1BMLA 3W95A 1TNLA 4FUEA 3S0NA 1HPGA 4KKDA 1MU8B 1ZPBA 1FMGA 2TGTA 1P04A 5E8EH 2ANKH 5EPYA 3NXPA 2OC8A 1SQAA 2F9BH 4B2AA 3GCOA 1W7XH 2FS8A 1ELCA 4ZKNU 4Y6DA 1NFYA 2OC1A 3A7YA 5EJ1A 5HM9A 4X6PA 3NCLA 2Z7FE 2C8XB 2BD5A 3ATWA 5HMAA 4MPWA 3PRBA 3SI4H 3KQDA 1C2DA 3QUMP 1MBQA 4AC9A 1GBMA 1O2KA 3ATLA 5EPNA 2V35A 1GI0A 3VPKA 3CENA 4OS4A 1HV7A 1L4DA 5FL7D 1V2QT 2XBWA 1G3EA 1P10A 3ATKA 1C5MD 2JETB 2ESTE 3OFND 3TLOA 4BAKB 1C5VA 4D9QA 1EJNA 4JK5A 1EPTC 2XW9A 2WSSD 1JBUH 1Z6EA 2GDDA 3RM2H 1ZTJA 2VIDA 1O3MA 2ZDKA 3A81A 4JYVH 2ULLA 3RXMA 1KYNA 2YMSB 3SJKA 3P70B 4JYTA 1QIXB 1S6FA 1NRRH 2QF0A 4FU9A 4Y11E 5F6MA 1AQ7A 3RXDA 1GG6C 1GJAB 1HIAA 2BDIA 1O31A 4WXVA 4JCNA 2JJ2D 3QDZB 1BHXB 2G4UA 2J98A 1H1BA 4I7YH 1C2EA 1KLTA 2PW8H 3UB0A 1NRSH 3LH3A 3FP7E 1PYTC 1GI8B 3RC4A 1FAKH 1OWDA 3PTBA 3SNBA 1OYTH 2XC4A 5FCRA 1BTHH 1CT2E 1P06A 1ZMLA 1Z71A 1SC8U 1UVTH 1NY22 2ZHEH 5EXMA 1NFWA 1B5GH 4GSOA 3GCHC 3U69H 4D7GA 4ZAEA 2BDHA 2HPQH 4A92A 1Y3XA 2UWLA 1TNJA 1SOZA 1O3LA 3UNQA 5BPEA 1E1QD 1SQRA 1XUHA 3F0PA 2OCVB 3K2UA 1ZR0A 2PSYA 1EP6A 1T4VH 3BIVH 4AOQA 4ZKRU 1NC6A 3KQCA 4IC6A 3T27A 1O3OA 1G37A 2G81E 1QB9A 3A80A 1K1LA 1QCPA 3HK3B 1CQQA 1QJ7B 2KCPA 5JPMH 2WV4A 3F3BA 1NU7B 4JYUH 1AN1E 2NU1E 1S6HA 1WYKA 1AE8H 3TPIZ 1F5RA 1GHAF 4XFQA 3NUMA 4DY7B 2TGDA 6CHAB 1NFXA 2K7XA 5H4IB 4H6TA 1KXEA 1Z6JH 4B1TA 1O3GA 1HAYB 3MH7A 4X2XA 1O3KA 1TPAE 2WV5A 4AG2A 1Y3UA 5G4BA 2A7HA 5TCCA 5B6LA 1TB6H 3PMJA 4Q7YA 4DVAU 1AUTC 5CDFE 2F9NA 1TGTA 1H8DH 2G8TA 1ANDA 2ZKSA 3MU5A 5EQRA 1SLVB 5DP9A 1KSNA 2J9NA 1VR1H 1T8OA 3GCTG 4VGCB 3KYFA 1BRBE 4XOJA 2A4RA 2Z9KA 3CNRA 4MPXA 4FUJA 1GGDC 1C1QA 3RDZA 2PV9B 5T6FA 1FUJA 2XC0A 3EA7A 3FN8A 3GCNA 5JYIA 1UO6A 2ZHQH 3I78A 1EAUA 6GCHF 1QB6A 1BB0B 2C8WB 4NWKA 2I6QA 3QTOH 5DPAA 1T4UH 4X8UH 4X6MA 5KEDA 3TGIE 3ODFA 1NRPH 2CHAB 1GBAA 1CA8B 4TPIZ 1FIWA 2F9OA 1XXFA 2BM2A 2H2ZA 4ZXYH 2PGQB 5JB8S 3Q3XA 1TA6A 3GY7A 1DUEA 1WTGH 2FTMA 3M5LA 1SQOA 4I8LA 1BTXA 1MABB 1LKBA 4ZCNA 2FP7B 1FLEE 2OD3B 1XKBC 4X0WU 3O8CA 5HYOA 2ZCHP 1YPKH 4BAMB 2R0KA 3HPTB 4VGCC 2Y7XA 4ISLA 2KCYA 3M3SA 1HXEH 2O8WA 1XVMA 3EGKH 3LJOA 3UR9A 2Z3EA 2EA3A 4ZHAA 3E0PB 1FONA 3PV2A 4F49A 1LHCH 1INCA 3L6PA 1A4WH 3NKKA 3M3TA 1PPHE 3SJ9A 1W2KH 3KQ5A 2H9EH 2O8LA 1L1JA 3MI4A 1D6RA 3SHAH 1MBMA 2BD3A 5A8YA 1C2MA 1K2I1 3M7QA 3RXGA 5ABWA 1SGRE 4ZUHA 1QQUA 2VU8E 4ZKSU 1YLCA 2BY9X 1DITH 3BTKE 1TQ7B 3RU4T 1C5RA 4ISIH 2Z9GA 2ZTYA 4GHQA 2VB0A 1GJ4H 1GHAG 3VGCC 4BOHA 2ZP0H 3A85A 3CS7A 3OY5U 4DOQA 1B0EA 1BBRH 1DSTA 1C4U2 1W12U 1DSUA 2CJIA 1VKYA 3ODDA 5C0TA 1ZSJA 3VB6A 4OS7A 3RXOA 4A5TS 1GG6B 1HJ8A 1GI2A 1GVLA 2VVVA 1SGDE 1V2NT 3TJNA 3P17H 1P0SH 5E2PA 1CU1A 4UFFH 1V2PT 3A7WA 1SGEE 2NU3E 2BB4A 1GDUA 4IMZA 1O2NA 4LZ4B 1GHXH 4GHTA 5A8ZA 4ABIA 4CBOA 5F8ZA 1O5AB 1ZYOA 3TH3H 1J8AA 1GBBA 1TQ0B 1RS0A 4NFEA 2EC9H 1K1MA 5L30H 2GGVB 1N8OB 3TVJB 1GBLA 1BQYA 1DANH 1EFRD 1QRZA 3FKSD 3R0FA 4FU8A 1ORFA 3LT3A 3ITIA 3UPEA 1IQMA 1HAXB 2B0FA 1IQIA 2UUYA 3GS9A 1IQHA 1UTKA 1HB0B 2FOHA 1OS8A 2ALVA 4FUIA 1GDQA 2Y82A 3MH4A 1TX8A 1UVUH 4GVUA 1QGFA 1DWBH 4NCYA 2WYGA 3IG6B 2C3SA 2QF5A 3AASA 2QV1A 5DP4A 3SU6A 5BRRE 1DY8A 1OYQA 2BOHB 1TNHA 1WQSA 4RT1A 1A61H 2OQ5A 4NFFA 5GCHG 1ELAA 2B9LA 1LHGH 2GJGA 2C8ZB 2QXJA 3KCGH 1UCYK 4Y7AA 5EQSA 1L0ZA 2BZAA 4TWYA 2ZIQH 3RMOH 1IQGA 4OGYA 5LGOA 1QJ1B 4ISHH 1MKWK 4KGAA 1C1MA 1RTKA 2Q6FA 3TK5A 1OSSA 2BDBA 2P59A 3RXBA 2HLDD 5F8TA 4X2YA 3ZV8A 1DWEH 3ZZAA 1SL3A 2PP6A 4K1TA 1HAZB 1P9UA 3ESTA 1CA0C 1NBME 3QO6A 1E1RD 1GGDB 3UR6A 1SQTA 3M7TA 4X2WA 5DP6A 4AFQA 2ILNA 2J4IA 2PKSB 2HVXA 3PYHA 1SOTA 1BMMH 1HNEE 1O3IA 3SU4A 4HI3A 1ZGIA 5SGAE 1O2ZA 1GVKB 2GCHG 3HKIB 1H4WA 2J92A 5HIYA 4UD9H 2NWNA 3LONA 2Z9LA 3Q3KA 1V6DA 2TGAA 3SORA 2W6JD 1EASA 1MKXH 3ZZCA 1FX0B 1SHYA 3H7OA 4X1RU 1KTTB 1THPB 2J2UA 3VEQB 2G5VA 2HALA 2WZQA 4ABJA 1NT1A 1ELBA 1XUJA 1ZMNA 1F0SA 1AGJA 1TGCA 4HGCA 7GCHF 1RJXB 2PKAA 4YM9A 4TYDA 1Q3XA 2A2XH 2WPHS 3GY3A 3M5MA 1S81A 1TA2A 1VCWA 1GBIA 1SBWA 1UJ1A 1UK2A 3E6PH 3SJIA 1O2JA 1SG8B 2DE9A 4FUHA 1ZOMA 5EOKA 4IC5A 4FUBA 3SU1A 1DX5M 3PMAB 1MMJN 1KDQA 2Y6TA 1KY9A 3B8JA 2GCTC 1QL9A 2PR3A 3M5NA 2FYRA 4B71A 4Q4LA 1BIOA 1Z8IB 4B74A 4IN2A 3VB5A 1UVPA 1GHYH 2C93B 4JK6A 4DT7B 1C1RA 4YZUA 3LH1A 1TABE 3BIUH 1NFUA 1S82A 1XVOA 1Y5BT 1NN6A 1RFNA 2Z6BD 2QF3A 2D2DA 1ELTA 1C1UH 3ATMA 3SGAE 3GDSA 1EAIA 2GT8A 5EQQA 1W13U 1MD7A 1ZHPA 3UQVA 1Y5AT 2FOAA 4K5ZA 4ZHLU 3LGUA 2PKSC 1GCTC 2Q6GA 4X1PU 3ZVBA 1C5XB 1GBKA 4JZFH 3BG4B 1P03A 1QQ4A 1RTFB 3A8DA 1MQ5A 1HAVB 1GI6A 4XBDA 1SGNE 2P95A 2P93A 1T31A 3ZZ7A 2DE8A 4JZIA 4BXSA 3ATIA 1C5YB 4K69A 4CRCA 3BTGE 5EJZA 2H5DA 2ZFPH 1XX9A 4BANB 2G51A 1MH0A 1EX3A 3QZQA 4XRNA 4RT0A 3UNRA 1PJPA 1O37A 1VITF 2P8OC 1MTNB 2UUJB 2ZDAH 4NA8A 1BRUP 1THSH 3MNCA 1EZUC 1FN8A 2ZPSA 5GWZA 2D26C 3DA9B 2HNTE 2ANYA 3E16B 2XNDD 3LC3A 1AFEH 3SHCH 1GDNA 3M61U 5E2OA 4DIHH 3VGCB 2GMTC 1OWIA 3BSQA 2J34A 2XBVA 1SGFA 4R8TB 3E91A 3DFLA 3PTNA 5DGJA 3MU1A 1SSXA 1WQVH 2QAAA 1N8OC 3O8DA 3QX5H 4SGBE 1GMHG 3K6ZA 3M3VA 2R2WU 2GT7A 2IPQX 3RC5A 3E1XB 3PM3A 1E0FD 1A2CH 1DWDH 4WVPE 3RMLH 4Z6AH 3UTUH 1CGIE 1TLDA 5DJ7A 2NU0E 4GPGA 2BY8X 3A82A 2CF8H 2P3FH 3M5OA 4X2VA 4ASHA 1W10U 1IQFA 4I8KA 4WF8A 1CT4E 1Y3YA 2ODYB 3T25A 5C17A 4B6EA 1ESBA 4BXWA 1YLDA 3QTVH 1IQJA 2HOBA 4GCHF 5EG4A 3V0XA 1GJ7B 1QNJA 4H6SB 1BBRE 5EXNA 3K65B 1MCVA 1O2OA 2KAIA 3RXEA 5HGGA 1TWXB 1TRMA 4U01A 3KL6A 3RXFA 4MNXA 1P8VC 2XYAA 2B5TB 4DG4A 3F2FA 1G36A 3ZV9A 2JIZD 1FY5A 2AGIX 3UFAA 1YPHC 2ALPA 2KFWA 1OWKA 5C5OA 2BOKA 2TBSA 4IN1A 1TX7A 3EDXB 4U32A 4Y8YA 2NU4E 1MKXK 1SPJA 5C67A 3TK9A 1DLKB 2ZZUH 3F9EA 2IN2A 1G2LA 3LGVA 4MLFB 1YCPH 1DDJA 2L6OA 3BF6H 1UK4A 4RN6A 2BY7X 2BD4A 2ZU3A 3A7TA 1ZJKA 2BZ6H 3FAOA 2XCFA 2UUFB 1HBTH 5EGMA 2HRVA 1MUEB 1HGTH 4XE4A 4X1SU 4B75A 2XWAA 4D9RA 3LKWA 3UOPA 5HXFA 9LPRA 2V7QD 1GMDG 3M7UA 2V3HH 1UTPA 2BHGA 4XDEA 3RU4E 3SGQE 1TBRH 3QZRA 3AW1A 1AMHA 4YOJA 3T5FH 1GL1A 1O2YA 1PYTD 2G55A 4UFEH 2EQNA 2EY4C 4K1SA 5J4QA 2WHXA 7ESTE 1TPPA 1HJ9A 1ETRH 1GWAA 1K28D 1LVMA 1M9UA 3ZZ6A 3VB7A 1AUJA 2BDGA 2I6SA 2LIZA 1EZXC 4E06H 4BTIB 1FPHH 4GCHG 2BD7A 1SKYE 3GOVB 2P16A 1LHEH 5E0GA 1KXCA 2ZPQA 3AAVA 4JMYA 1CBWB 3OY6U 3A88A 1IAUA 4AFSA 4P00A 2A4OA 1DT2A 4MPVA 2HLCA 1O2XA 1SMFE 1BMAA 2H9TH 2ODQA 2BVRH 3P8OA 5FCKA 4Y79A 1C2FA 3ZVAA 1ELVA 1QRXA 1K9OE 1EAWA 2JH6D 2LPRA 2M5TA 3WWBA 5FHTA 4A1VA 2J97A 4KP0A 3A7VA 1MTUA 1TYNA 3ELAH 1LQDB 2FOEA 1NPMA 1QA0A 2KM0A 1Z7KA 5E0JA 1GI5A 1GBCA 2GZ7A 1J14A 3GY8A 1EXFA 3LPRA 3U1JB 3RXJA 2QXIA 3GDVA 2RFKC 2WUCA 3V7TA 1GBEA 3ZVEA 4ZHMU 1ZLRA 4A1TA 3QN7A 2PWXA 4U2WA 2D8WA 4ACAA 4D76A 1H9LB 4SGAE 1O5CB 2AYWA 2STAE 1YLNA 3EBNA 3Q77A 2ZTZA 4INKA 3FP6E 5AF9H 5L6NH 1O35A 4CR9A 4XBCA 1BOQA 1NO9H 1N6XA 2WPJS 2C8YB 2ZI2H 3EA8A 2BY5X 3U8OH 3P8GA 2AMPA 3PWBA 2WYJA 3T62A 1NBMD 1AE5A 2A4GA 3GY5A 3ZZ4A 2W7UA
chains in the Genus database with same CATH topology
1BRCE 3BTHE 1S84A 3VXEH 1FPCH 1CE5A 3A89A 2ZFFH 2Y81A 2A5KA 4MNWA 1SLWB 1AVGH 2H5CA 1TX6A 4MG3A 2ZHFH 9ESTA 4QT8C 1GJ9B 2FWWA 2ZTXA 5C5NA 4Y71A 1P12E 3UNSA 3TJUA 2BXUH 1AB9B 2R3UA 4CRAA 1J15A 1V2ST 3KGPA 3STJA 2ZF0H 1Z8GA 1UTLM 4K60A 4Q80A 3QLPH 1P2NA 4BTTB 4O3TA 2FS9A 2AGEX 4ZMAH 5C1YA 2BD2A 4MQAA 1BDAA 1S83A 2XTTB 3MU8A 1RD3B 3TGKE 3A83A 2ZCKP 4E05H 4FUCA 1GJCB 2PKAB 4AYVB 2ZG0H 1HFDA 1TBQH 5FX6A 2BVSH 2Y5GA 2QXHA 4K3JA 1E38B 2OC7A 3D23A 3GY4A 4FU7A 1CHOG 1O5DH 1P09A 2F3CE 3E8LA 3RXVA 1UHBB 3KHVA 2RA3A 1EATA 1FJSA 4AORA 3GISB 2BYAX 2UWOA 5IDKA 4A7IB 4E7RG 1ID5H 3QK1A 1OOKB 1TMTH 2A0QB 5FBEA 3HGPA 2BLQA 4YO9A 3S9AA 1Y8TA 1AHTH 5AVDA 2VGCC 3QGNB 1L4ZA 1AWFH 1LKAA 1ZSKA 1BUIA 2ZCLP 1GBHA 5EW2H 2CV3A 1C1SA 1DLEA 3NPSA 4GLYA 1OX1A 2BDYA 2O8UA 2YNAA 4K2YA 4ISNA 1EPTB 3PROA 1C5UA 1ZPCA 1WV7H 1IQNA 1NROH 2C90B 1PFXC 3SJ8A 3PMHB 2QIQA 1EOJA 1QBVH 1Z8RA 2VIVA 1O3NA 2JH0D 3P95A 1SLXB 4YT7H 2QA9E 4CR5A 1H8IH 1SGTA 3MOCA 1LMWB 1LVOA 1CO7E 1QY6A 1P05A 2BD9A 4TY6A 3FP8E 4NIVA 2BD8A 2Y80A 1ETTH 1P2OA 2CXVA 3SUDA 2VIOA 3W94A 4YESB 5DP7A 1ABJH 2GMTB 4INLA 1T8MA 5E0HA 3VB3A 3MNXA 4IBLH 4B2CA 1E37B 2THFB 1ELFA 1O34A 1TNIA 1O2MA 2XNIA 2AEIH 1UTQA 1YC0A 2FM2A 2ZDVH 2VWNA 2XBXA 5TJXA 1TONA 5JDUB 4DGJA 5FBIA 2VGCB 1O3PB 3ZZDA 5T6GA 1O3DA 1H9IE 2ZNKH 1LO6A 1DPOA 3A7ZA 2WPMS 1TRYA 3UWIA 1YPHE 1NS3A 1YF4A 5L2ZH 1O39A 1IOEA 2QN5T 1A0JA 1GCTB 1WSSH 3F9HA 1LVYA 3CS0A 1OWJA 4CRBA 3S9BA 1MTVA 2H6MA 2PSXA 3RXQA 3ZZ9A 1WOFA 1OP0A 3FZDA 2QGRA 3OTJE 2FOBA 1CHOF 1ABIH 1C2IA 2QXGA 1QURH 1K1JA 1HDTH 1BCUH 1AFQB 3GY2A 1S5SA 3EA9A 5FPYA 1GL0E 1DVAH 1O33A 3B9FH 1WUNH 1TGNA 2BLOA 3ZZ3A 5A8XA 1GHBF 3PWCA 1YPGH 3UIRA 1A7SA 3ZYDA 1LPGB 2FIRH 2TIOA 2ZFQH 3KN2A 1G3CA 1NU9A 1CA0B 3KNXA 1CGJE 2EI8A 1HYLA 1OPHB 2F9VA 1N6YA 3L33A 1FY3A 3GY6A 1HUTH 2BY6X 4OS6A 4JZDH 2VVCA 1O3BA 1ETSH 1O2IA 1O2TA 3SU3A 2AFQB 3HATH 1P3EA 4U30A 2CHAC 3T26A 1AZ8A 1FY8E 4NZLA 2ZGXH 1GI3A 1ARCA 4AGKA 3SNDA 3LJJA 1ZRBA 3SI3H 1LCYA 1C2KA 3A8AA 2Y5HA 4H42U 1MAXA 1JIRA 2VINA 1YPJH 1GHVH 2FESH 1G3BA 4MTBA 1FY1A 2BMGB 3RXHA 3GYLB 5A0CA 4UEHH 2IPHA 1O5BB 1SI5H 3RMNH 2WUBA 1AZZA 2FLRH 4INHA 1UTJA 1IQKA 5CHAB 1O38A 3SO3A 5DKMA 4CRFA 5C20A 4BNRA 5DP3A 1RIWB 1P2QA 3RP2A 7LPRA 2XRCA 2HGTH 1C9PA 1KXDA 4ABFA 3H5CB 1WAYB 1GHBG 2BVXH 1SFIA 1D3PB 5GDSH 3D62A 1CBWC 1C2LA 1NZQH 4K8YA 4DCDA 1G32B 2PUXB 1UTMA 5JB9S 1A5HA 3AW0A 2A2QH 3SUEA 4X8VH 1ZZZA 2RA0A 3MHWU 5L2YH 4AB8A 2IJOB 1KTSB 4NIXA 5JBAS 1O5GH 1OKXA 3URDA 3MO9A 2FI4E 1D3QB 2OBOA 3RMMH 1XXDA 2ZQ1A 1J17T 2FMJA 1O3FA 2OTVA 4I8JA 1EPTA 3UOUA 3FFGA 1F0TA 3Q3YA 3SV7A 7GCHG 5AFZH 3SQHE 4FXGH 1BJVA 3MO3A 1EZSC 1Q31A 3M37A 2YNBA 2G00A 1Y3VA 3LIWA 2OXSA 1GI9B 3C27B 5EW1H 4WH8A 2SNWA 5EU8A 1C1NA 1W0YH 1O2LA 2V6NA 4HZHA 2FOMB 2SGDE 2GDEH 2FI5E 2BLVA 4X6OA 4GUXA 4I33A 2ZU1A 4Q7XA 5I46H 4O97A 4ZXXH 1RTLA 3DT0H 1C1TA 1TMUH 2GVFA 5GIBA 4WMEA 1T8LA 2V3OH 2PUQH 4X8TH 3SNCA 1BTZA 3ZYEA 1YYY1 4MPUA 1EQ9A 1PPZA 4AFUA 3V3MA 1DM4B 5GPIB 1C5LH 1CVWH 5F8XA 1O3JA 5EXLA 3JZ1B 4Y8XA 3PMBB 1MTWA 2ODPA 2Y7ZA 3BEIB 1PQAA 2CF9H 2H9HA 2G4TA 4BAQB 5T6DA 1A3EH 1GJDB 1IQLA 4YLUA 1JRSA 4M7GA 1MZDA 2EEKA 4WJG2 3ENSB 1VCPA 4ZROA 1C5QA 1F0UA 1W8BH 2J38A 1GMCG 1TALA 4YLQH 3S69A 1TMBH 1QB1A 4J2YB 3K6YA 1GJBB 4CREA 4O3UA 1BT7A 5C3NA 1GHZA 2AERH 2K1QA 3URCA 3SJOA 4I31A 5DG6A 2HPPH 1O5FH 3SUGA 1D4PB 2SGAA 4NSYA 4IMQA 1KXFA 1QR3E 3PLKA 1ELDE 1GJ6A 3PB1E 2PTCE 2AS9A 4B76A 3FZZA 2W26A 1P2JA 3FVFB 3U8RH 1BHXF 1OWEA 1DOJA 2ZEBA 3P8NA 1SR5C 2VIPA 2OLGA 1P9SA 4E7NA 2GV7A 3FANA 1TOCB 4TWWA 3RXSA 3RLWH 2GP9B 1A5GH 3KF2A 1BRAA 1DUAA 2GCHF 3MTYA 1TPOA 3P6ZB 2C4FH 4UE7H 6CHAC 1SB1H 1BTUA 1ZSLA 3SBKA 1V2WT 1DXPA 4NG9H 5T3HA 4X1NU 1GMHF 1K22H 1O3CA 1RGQA 3D49H 1PQ7A 1S0QA 4CRDA 1O2QA 1TAWA 1FI8A 1HAGE 2JKHA 5FPTA 4AN7A 2GZ9A 3C1KA 2ZQ2A 1QBOA 1A3BH 2ZO3H 3HK6B 4LZ1H 3N7OA 1CT0E 4ESTE 3LGWA 3A87A 1TNGA 3SV9A 1VZQH 5GJ4B 2ZFTA 3ZZ5A 1A0HB 4YTAA 3SZNA 3RXCA 5CE1A 4A6LA 5FXLA 1UMAH 1O2HA 4LK4A 5LPFA 3CP7A 4WWYA 4X8SH 5ETXA 3BTWE 3Q76A 2A31A 2DUCA 1V2VT 5GCHF 1BTYA 1E35B 1BZXE 3BTTE 2ANMH 3HGNA 2TPIZ 1V2TT 1AFQC 2P94A 3LGTA 1O0DH 1C1PA 2OINA 1EJAA 3RXLA 4AG1A 5K7RA 1MQ6A 4YT6H 3PLPA 1VGCC 3QWCH 1AKSB 1TGSZ 4DIIH 1DY9A 5EODA 3KEEA 3T2NA 4NSVA 1C2GA 1C5OH 1UTNA 1JIMA 1L1NA 2B8OH 4CH8B 4CRGA 1GBDA 3A8CA 3SU5A 2O9QA 2VIWA 3UQOA 3RXRA 3ZVDA 4Y76A 1UVSH 4NZQA 1HJAC 4UONA 1O2VA 1EUFA 2ASUB 1ELEE 3LU9B 3PO1C 2ZDLA 2PLXA 4BTUB 3TH4H 3DD2H 1ESTA 2P3UB 4FUFA 1P3CA 3BN9A 3JZ2B 4NA9H 4JZ1A 1GJ8B 1GPZA 4K1EA 2RG3A 1MTSA 1WBGB 1QL7A 5JBBS 1LQEA 1W11U 2SGQE 3PLBA 4BAHB 3BTQE 4HFPB 2FXRA 2H1UA 1K1NA 1PQ5A 3KQBA 1B7XB 4AGJA 1YPMH 3TIUA 1T32A 4AFZA 1X7AC 1C2JA 1GBFA 1HRTH 3RLYH 1W3CA 3OSYA 1KIGH 5A09A 1CSOE 2VH6A 1B0FA 1C5ZB 1O3HA 3RXAA 1F5LA 4FVBA 1V2JT 1TNKA 3WY8A 3IWMA 3QGJA 1GJ5H 1AVWA 3RXTA 1A0LA 2BXTH 3TITA 2STBE 2PFEA 3BTDE 3SV6A 3MFJA 1AO5A 1D9IA 4NA7A 1ZHMA 1UK3A 1QRWA 2SGEE 2EI7A 4Y0ZE 4B73A 1O5EH 2GV6A 4ABAA 5LPRA 2A5AA 3U98H 3L3TA 2P8OB 2KAIB 1XKAC 3RXIA 1N1LA 2FEQH 2YOLA 4Q7ZA 1C5WB 1FY4A 4Y10E 3B23B 3F9FA 3S7HB 1ZRKA 2FYQA 4OS5A 3GYMA 5B6OA 4J1YA 1NRQH 4ZKOU 3E0NB 3G01A 5AHGH 2XWBI 1LHDH 3TK6A 1V3XA 3PO1B 2CN0H 1S85A 3Q00A 4ABHA 1AU8A 1C9TA 1KDQB 3NK8A 1EJMA 5J4SA 1HJAB 1A1RA 3MNBA 1UCYE 1GVZA 3U9AH 1RIWC 1LPKB 1ARBA 1D6WA 4D8NA 1F0RA 2UUKB 2TGPZ 3SGBE 2VWLA 5HM2A 1FQ3A 5C1XA 2ZWLH 1OP8A 2VWOA 3ZVGA 1O2SA 3BG8A 2AMQA 5LPEA 1HLTH 2HNTC 1JXPA 4ISOA 2FO9A 2O8MA 1Z1JA 1GI1A 3MMGA 1E36B 1O2PA 1EKBB 2VVUA 1NM6A 3M36A 2ZU4A 1P01A 1YPLH 1QA7A 1VCQA 5GXPA 2FI3E 2GX4A 5JBTA 2GKVE 1W0ZU 1O2GH 1XUKA 4X1QU 4X6NA 1F7ZA 5JBCS 1HAVA 3V12A 3DFJA 1PPCE 4JZEH 1P2KA 3OYPA 2GD4B 1J16A 8GCHF 3TGJE 1G9IE 3F1SB 1C4V2 3BTFE 2ZHWH 4R0IA 1K1PA 3OX7U 1O2RA 4OS1A 3TJVA 3T28A 4DJZB 3UWJH 3SU0A 1ZTKA 1LTOA 1ZJDA 4WMFA 2XBYA 2OBQA 2Z9JA 2FX4A 1XM1A 3A86A 4MVNA 1FDPA 3ZVCA 1MCTA 1THRH 1C1OA 1YM0A 1OP2A 4I8HA 2WPLS 4H4FA 3BEUA 4Y7BA 3BG4C 3MH6A 3UREA 1VGCB 4LOYH 1WCZA 3MO6A 4NGAH 3SNAA 3E90B 1JRTA 2ZU2A 1VITG 2O8TA 3MWIU 4IW4E 3SW2B 4WY3A 3RM0H 3TNSA 7KMEH 1BTWA 4NIWA 2FX6A 1IHSH 1GI4A 3AVZA 3DHKH 3UY9A 1BMNH 3EYDA 1AY6H 5A0BA 1EB2A 4CHAB 1AB9C 1ZHRA 3SOSA 4UFGH 3I29A 1ELGA 2ZFRH 3GICB 4CH2B 1CGHA 1UTOA 2QCYA 5A2MH 4WXIA 1QHRB 1EZQA 5DO4H 1HCGA 1FZZA 1DFPA 5A0AE 3RUOA 4F4OC 2OP9A 1SGQE 2OC0A 2ZHDA 1SGFG 2R0LA 5PTPA 4XSKU 2AIPA 5K0HA 2R9PA 2CGAA 1C2HA 2SNVA 1ANCA 1YGCH 1SGCA 5FX5A 3ZVFA 3SUFA 4UDWH 2R3YA 3NWUA 3SNEA 1MU6B 3O8BA 1XUFA 1G30B 2BDCA 2SGFE 4XBBA 2NU2E 4Q2KA 1Q2WA 2SFAA 1MKWH 4KTCA 2P3TB 3EE0B 1T7CA 8ESTE 3MNSA 1GMCF 1BITA 4KTSA 1QTFA 4FUDA 1PQ8A 3LC5A 1FV9A 3KQEA 1DXWA 2W3KA 4A1XA 1QJ6B 1C5TA 3EQ0H 1EB1H 1XUIA 4DW2U 2A32A 1KXBA 2VH0A 1AIXH 2ZU5A 2G52A 1XMNB 2BX4A 3I77A 2FOCA 1QFKH 1HAOH 3MU0A 4Y0YE 4ABGA 2R2MB 1C1WH 4AX9H 1BTPA 3R3GB 6GCHG 3LGYA 1FXYA 2A7CA 3BEFB 3BTME 1P11E 2Z9IA 1TE0A 3P8FA 2BX3A 4Y8ZA 5DK1A 1L1GA 1D3TB 2VWMA 4RSPA 1YCPM 2F9PA 3A7XA 2J94A 1F92A 1PPFE 1YP9A 2WINI 2QYIA 3H7TA 1JWTA 3OU0A 4THNH 1GI7B 1FAXA 1RXPA 1AI8H 1KXAA 2PHBA 4GAWA 4TPYA 1AWHB 1H9HE 2PTNA 1O2UA 1YKTA 1YBWA 1XUGA 5LH8A 1OXGA 1FNIA 2WPIS 2FPZA 1NRNH 4PROA 1NTPA 4ABDA 2VJ1A 4FUGA 4K8BA 1ANBA 1C5PA 3RXUA 2BQWB 1V2RT 1C5SA 4TY7A 1LHFH 2A7JA 3UUZA 3RC6A 1V2MT 1TIOA 3M35A 2D1JA 2FODA 2AMDA 2VIQA 3F68H 1MZAA 2F9UA 4CBNA 2Q1JA 2ZGCA 1HAIH 1TRNA 1S0RA 1SGPE 1YCPK 1ZPZA 3LOXA 1TGBA 5I25A 1LVBA 1P57B 2ZDNA 3GCHB 2ZGBH 2FDAA 4WH6A 5ESTE 2ZC9H 6ESTA 1W14U 5DP5A 1ESAA 1GCDA 1UVOA 4IGDA 1G3DA 1AKSA 4FVDA 3RXKA 1Y3WA 5AFYH 3GCTF 1FIZA 1QL8A 1Y5UT 3AAUA 2ZDMA 1V2OT 1RRKA 4ABBA 1NESE 1W7GH 4NIYA 1GHWH 1TBZH 2Y5FA 3T29A 3O8RA 1HXFH 3VB4A 4B2BA 3PV4A 2Z94A 2GTBA 4YOGA 4Z0KA 1DS2E 5ESBA 5FPSA 1YPEH 3NZIA 5TCAA 1F2SE 4OS2A 4AB9A 1O36A 2RCEA 2FOFA 1K1IA 5C2ZA 3TJOA 2F83A 1LPZB 1EOLA 1JOUB 2JH5D 4LXBH 1HIAB 1K1OA 2AIQA 2FOGA 1MTNC 2A1DB 3A84A 5CMXH 2ANWA 4IS5A