4YO9A

Hku4 3clpro unbound structure
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
b'SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
molecule keywords 3C-like proteinase
source organism Bat coronavirus hku4
molecule tags Hydrolase
total genus 84
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yo9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yo9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yo9A02
1HJAB 3PMJA 4JYUH 4Y8XA 2O9QA 1SL3A 2G51A 3TJNA 3S69A 1V2OT 4X0WU 1INCA 2H6MA 3E8LA 9LPRA 1NT1A 4CHAB 1ZGVA 3UPEA 4X2VA 1O3BA 4AFZA 1O5AB 4GCHG 2TPIZ 1F7ZA 1GJBB 1LCYA 5DPAA 5AVDA 1O3NA 4TYDA 1JWTA 1MD8A 3A81A 2G55A 3VB5A 3TGIE 2OC8A 1TIOA 1ZRKA 1G2MA 1MTNC 3GY2A 1JRSA 1MTWA 1HAGE 1MCVA 1HV7A 2XC4A 5E0JA 1TYNA 1L1GA 4Q2KA 3KL6A 1DFPA 3RXOA 2H9HA 3DUXH 3LT3A 3K6ZA 1J15A 2GT8A 1LVBA 2FZZA 4KGAA 4H4FA 2HWLB 3N7OA 5EQSA 1VCQA 4ESTE 1NU7B 2GCTC 1UK3A 1TNJA 3SO3A 3GCOA 1LVOA 2ZHQH 1ESTA 2GVFA 5DGJA 3ZVBA 1GI8B 1A2CH 1V2MT 4MNXA 2AYWA 2FOAA 4Y8ZA 4BTIB 1TGSZ 4JZIA 4BAMB 1ELFA 2BDHA 1Y3WA 3PB1E 1QB1A 1ANBA 5EXLA 4MTBA 3P6ZB 3RXGA 1P9SA 3MHWU 1DS2E 1GHBF 1AFEH 1ZHPA 1MKXH 2BMGB 4INKA 2GDEH 3JZ2B 2G81E 2NU1E 4ZKSU 1FY4A 1SGEE 1YPHE 5I46H 3A7ZA 3MU5A 1K1JA 4NSYA 3SHAH 4AFUA 1KDQA 2HRVA 2ZO3H 1J16A 1BRUP 4FUHA 1W10U 4JK5A 4YLUA 2PUXB 1YCPK 3ZZAA 5EQQA 5GDSH 2J4IA 4B2CA 2BOKA 3T29A 1DPOA 1Z71A 1DE7H 1GMCF 4UFDH 1Z6EA 2AS9A 3V0XA 1HRTH 1SFIA 2AGEX 3LJJA 1PYTD 1O34A 2C8ZB 4DY7B 3A85A 1TPAE 4OGYA 4OS4A 1K1PA 3D49H 1KXEA 4IGDA 3U8OH 3UWIA 4X8UH 1W8BH 4BNRA 4DJZB 5FPTA 1THSH 1SMFE 4B76A 1W13U 1GVZA 3NUMA 1CT2E 1ETRH 4LK4A 4Z0KA 3ZVDA 4X6NA 1MBMA 2OC7A 1ZSLA 1K2I1 1C5TA 2ALPA 2KAIA 1EUFA 4A1VA 4INLA 4FUCA 1GI5A 1ELDE 1O2IA 1AWFH 1TQ0B 3UNSA 4BANB 2C3SA 4D9QA 1A7SA 2H5CA 2QXGA 2B7DH 1SB1H 2PW8H 2WUBA 4B1TA 1C1OA 1F5KU 1IQMA 2JH5D 2ZTYA 4DVAU 1CGIE 3F68H 1EP5A 1G36A 1ESAA 2VIOA 1C5YB 1C2JA 1SLUB 1ID5H 2ZCHP 4Y8YA 5JDUB 1IQKA 2GT7A 1BOQA 4Y71A 2BHGA 1GCTB 2D2DA 2XCFA 1DICA 1HAZB 1ARCA 1IQHA 1AB9C 3RXCA 3A7TA 4VGCB 3SHCH 5BPEA 3BG4C 1B5GH 1O2LA 3S7HB 1EJAA 2ZI2H 3RLWH 3LGWA 1FJSA 3GY8A 3M36A 4FUIA 1F0RA 2IPHA 2OQUA 4MNYA 3SGAE 4IN2A 2D1JA 3AW1A 3H7TA 4M7GA 1HAYB 4X6MA 1KLTA 4AX9H 1JRTA 1QB9A 1C5OH 1E36B 1BBRH 2I6QA 3VXEH 3UR9A 4IS5A 3ZZ3A 1O3PB 2Q1JA 2FP7B 4D7FA 3TNSA 2BB4A 2ZDNA 1CSOE 1OWIA 2LIZA 3A7XA 2C90B 3OX7U 2EC9H 3E16B 1AFQB 5DO4H 1YPJH 1FY5A 4SGBE 2IJOB 2Y5FA 2R9PA 2Y6TA 3C1KA 3BEFB 2FMJA 3FFGA 1V2NT 4WY3A 3SJOA 5FHTA 1K1MA 5E2PA 1GVLA 2BDGA 3NXPA 1PQ5A 3BEUA 4FUGA 4F4OC 1K22H 1BJUA 1NRNH 3M35A 3A88A 1TFXA 2A5AA 2ZGJA 4Y0YE 5L2ZH 2QYIA 2BOHB 3SNCA 2BD3A 4OGXA 2AIPA 4X2WA 3A86A 1TOCB 3U1JB 3S0NA 3H5CB 3W94A 1S84A 1EZUC 1C2EA 1NO9H 3GY6A 2OBOA 2F9UA 1O5FH 1PPZA 1Y5UT 1KXBA 1NFXA 2ZF0H 1PPEE 3RC4A 1GHZA 1KXAA 2Z3DA 1GL1A 1WUNH 1Y3VA 1AE8H 1HNEE 3EGKH 3B9FH 1C1PA 3ZVCA 1SGFA 2R3UA 4YM9A 3QWCH 2FO9A 4Y7AA 2BDYA 3P17H 3SU1A 1A5IA 2EI6A 4ABAA 4FU8A 1FONA 4BAOB 1SQTA 3MU8A 2G8TA 4NA8A 1ZTLA 3SV6A 3HKJB 3EA7A 4K8BA 4XFQA 3P8FA 2ODPA 5LH8A 2ZQ2A 4UONA 1C5LH 2BD8A 1NZQH 3WY8A 4H42U 1K21H 1V2VT 3GISB 1ZSJA 2FOBA 1LPZB 4K1SA 5A09A 1SGCA 3SU5A 3QN7A 1UVPA 1KDQB 4AFQA 1K1OA 1CGHA 2XC0A 4ZHAA 1KY9A 3B23B 1AVXA 5EU8A 2AFQB 3KHVA 1VGCC 1O3GA 4CBNA 1VJAU 3FP7E 4OS7A 3U8TH 1KLJH 1HJAC 1QRZA 1SBWA 3HATH 1UK2A 4NG9H 1EXFA 1TX7A 5C5NA 1LHFH 1HLTH 4CHAC 1DUAA 1RIWB 1XUJA 3FVFB 1ARBA 3R0FA 2WPHS 1GCDA 1GBTA 2Z6BD 4IN1A 2B9LA 2XW9A 3MO9A 1BHXF 4RN6A 2FTMA 1SGRE 1WQSA 3STIA 4I7YH 3A8CA 2QA9E 2KAIB 1ABJH 2BXUH 2ZGXH 3BEIB 3TJOA 3IWMA 1MBQA 2TIOA 1OWDA 5F03A 1WV7H 3SNDA 1G9IE 1AHTH 1CHGA 1ANCA 3B8JA 3MU0A 1FIZA 4ZKOU 4ISIH 4X1QU 3EQ0H 2AGIX 5LGOA 4INHA 2I6SA 4ISHH 4K1TA 1GHYH 4NFEA 1WSSH 2WPJS 4CRFA 1ZR0A 1XUKA 1U6QA 1LKAA 1GJ9B 1MUEB 1S6HA 2B5TB 1TABE 1AQ7A 3E3TA 3RXUA 1HXEH 1V2UT 1P2KA 3PV4A 1K1LA 2STBE 4HTCH 2BQ6B 4NA7A 5C1UA 1D4PB 1CE5A 1E38B 3PROA 1ZGIA 1GBCA 5PTPA 1GG6B 1TB6H 1HAHH 3U8RH 1A3BH 1OYQA 5CHAB 1S0QA 1YCPH 4DURA 1Z6JH 1AO5A 2PKAA 4NFFA 2OXSA 1A0LA 4ABBA 1GBAA 2HPPH 1OKXA 1MTUA 1O3AA 2V3OH 2UWPA 1F5LA 2VINA 1HAVA 3AASA 4CR9A 3BTTE 1C5UA 3EA9A 1B0EA 1KXDA 2WYJA 1VCPA 1G2LA 3TLOA 1FAXA 1O37A 1DLEA 3ATIA 1MQ5A 2STAE 1TGTA 8LPRA 2ZTXA 1EOJA 3M37A 1C2KA 7KMEH 4TWWA 3OY6U 2VIVA 2GX4A 2G5NA 8ESTE 3RXBA 4D8NA 1LDTT 3BSQA 2PHBA 1HYLA 4MQAA 3RU4T 4BOHA 3PMAB 1HAPH 1BB0B 2RA3A 2P95A 2BLQA 2R0LA 4Y11E 3VXFH 3F9EA 2ZNKH 2YNAA 1UTLM 1WOFA 1ZHRA 4A92A 2G4TA 4OS1A 1SVPA 3I77A 5EODA 1TNIA 2Z9KA 1FXYA 1EZSC 1YCPM 1T32A 2HPQH 1EPTA 5EPYA 2OCVB 1TA6A 1SR5C 4YOJA 2O8WA 1B7XB 3C27B 2GTBA 1MZAA 3PO1B 3NKKA 1TGCA 1WTGH 1C5RA 1HDTH 3LU9B 1MU8B 4A6LA 4AG2A 3PMHB 5JB9S 4BTTB 5B6OA 2VVCA 4DCDA 2H9EH 4FXGH 2C93B 1NTPA 1O3MA 2ZQ1A 4WWYA 5GXPA 1UTMA 2A4GA 2BY8X 2PV9B 1DWEH 4B73A 2JH0D 1GHBG 1S82A 1HCGA 2QIQA 2F9NA 1DXWA 5DG6A 4GVUA 1C2LA 1EAXA 1YPHC 5H4IB 1VITH 2ZCLP 1XM1A 2FEQH 2VH0A 2XRCA 1O3KA 1YKTA 1V3XA 2GV7A 3E0NB 2ZFQH 1OP0A 1TAWA 1LTOA 3RXVA 4NZQA 2ZU1A 4ISNA 3ZZ6A 1O0DH 3TGKE 4GPGA 3ZVAA 3PLKA 3TVJB 1EJMA 1O3EA 3GCNA 1T8OA 2Z3CA 5C3NA 1D6WA 3ENSB 2JH6D 1CHOG 1C1MA 2WPKS 1C5QA 1HJ9A 2ZFPH 1AGJA 1V2ST 2SNVA 3TH3H 1C2FA 1GMCG 2A31A 2TGAA 3PM3A 1FZZA 1AFQC 1ACBE 2FOHA 3GY3A 2ZDLA 3GCHB 1DWCH 2FM2A 2FWWA 2QF3A 3CP7A 2Z7FE 4AORA 2A1DB 3R3GB 3MTYA 1DLKB 1GI6A 1EAIA 4GHTA 3ZZBA 5HM9A 2B0FA 3SU3A 1LHCH 2EI8A 1Y8TA 1ANEA 2A32A 3RXSA 1GJAB 3UOUA 2FOFA 1NFWA 1BRAA 3GCTF 3QX5H 1O36A 1O38A 2BDAA 1EZXC 5JBAS 3A89A 2UUFB 1K1IA 4Q7YA 3A82A 1A5HA 3Q77A 4X6PA 1QCPA 3CENA 1BHXB 3RMOH 2ZGHA 1E35B 2SGEE 3A7WA 5A0BA 1LVYA 1O3DA 3CS0A 5L2YH 4CRBA 3E6PH 4NIVA 1EAWA 1RRKA 2ZWLH 1OWEA 3BTDE 2K7XA 1C1TA 3SJIA 1RTFB 2SGQE 3T62A 1FY8E 4DG4A 2BLVA 1TBZH 4I8GA 2XWAA 3TH2H 2WUCA 2ZTZA 1ZHMA 1PPCE 1T4UH 2NU3E 2CV3A 5EW1H 1Y3XA 2VJ1A 1OWHA 3BG8A 2DE9A 2QGRA 4MVNA 3KQDA 5EPNA 1GBEA 2ANMH 1A3EH 2J9NA 2OD3B 3OTJE 4B74A 3ZZ8A 2AGGX 4H6SB 1SGQE 3BIUH 2C8YB 2Q6FA 3KQBA 1ELBA 1LHGH 1O2NA 1YF4A 2VIQA 2A5IA 2YOLA 1FUJA 3EE0B 1GBDA 1GWAA 2PKAB 3A83A 1YPGH 3RXPA 2ULLA 2VNTA 3GDUA 1Q31A 3LKWA 3BV9B 5L6NH 1S0RA 1SLVB 4SGAE 1ZPBA 5GPIB 3V12A 1K28D 2RDLA 2H2ZA 2XC5A 4K8YA 1P06A 3ATWA 1C4V2 1HAVB 2SGPE 3JZ1B 3SU0A 5EW2H 1RGQA 5DKMA 4AN7A 3SJ9A 3EDXB 3EBNA 4JZDH 2BDCA 6CHAC 3PWBA 1ELVA 1L4ZA 3GYLB 1NRRH 2ANWA 1YP9A 5J4QA 1UCYK 3BTFE 3UUZA 4DW2U 1A0JA 6ESTA 2ZFTA 2Z3EA 2FTLE 3D62A 5JBBS 1KTTB 5GCHF 4HI3A 2UUJB 3AAUA 2W5EA 3S9BA 4BAQB 4GUXA 3UFAA 1GJ8B 1QGFA 1EPTB 1SGFG 4WXIA 3T26A 1H9LB 1PPFE 1C1WH 3ZYDA 1IQGA 5JPMH 2W26A 1W7GH 2CF8H 3ZZCA 3GY4A 1C1UH 3RMNH 2ZPSA 1XUIA 3DFJA 3MI4A 1GBBA 1SGPE 3RXHA 4AG1A 1JMOH 2SFAA 3A8AA 3T2NA 1P09A 1P12E 1QHRB 2CHAC 1SPJA 3SOSA 4LZ4B 1GDUA 1NFUA 1BRBE 1G3EA 3U9AH 1SLXB 1CHOF 3MH7A 3PLBA 4J1YA 3ZYEA 3QUMP 5EGMA 1GBLA 1TWXB 2Y81A 2QC2A 3UTUH 1GG6C 1PQAA 2AMDA 5IYTA 4CH8B 2ZU5A 2SGAA 1BUIA 2A7HA 1GGDB 4ZHLU 1K1NA 3DD2H 1C5PA 1XUHA 3QK1A 3RC5A 1P8VC 1QTFA 4XE4A 2XXLA 2QN5T 4Y76A 3AVZA 2QXJA 4K69A 2ZKSA 1DDJA 4UDWH 5C5OA 3SUDA 1TX8A 1RFNA 2XYAA 1FLEE 2FESH 2PKSB 1SOZA 4A7IB 3U69H 4AOQA 1Z8RA 2HNTF 4B75A 1T31A 2P94A 2GMTC 1BMMH 4KELA 1LMWB 1FN6A 3SJ8A 1PPBH 1E34B 3F6UH 3GICB 4IMZA 5T3HA 2FDAA 1DVAH 1JBUH 4NGAH 1O2WA 2CF9H 1GMHG 1HBTH 4DIIH 1QQ4A 1TOMH 2A4RA 2FIRH 2CJIA 1FMGA 1N6XA 1ZLRA 4KTCA 4D7GA 1G3DA 1EB1H 4O9VA 3F9GA 1TRYA 1P2IA 2NU2E 2H9TH 2FXRA 4K60A 2BD4A 2ZP0H 3OY5U 5A0CA 5BRRE 2PSYA 1RD3B 2ZC9H 4CBOA 2NU0E 2XTTB 1ZMJA 3RM2H 1CT4E 3P92A 3U98H 1O2KA 1MKWK 2ZFFH 2AIQA 1TNGA 1QA7A 2RA0A 1GI3A 3UOPA 1S81A 1E37B 1N8OB 1IAUA 4ABDA 2OTVA 1S6FA 2AERH 1KXFA 3V7TA 5FBIA 1XKBC 1FNIA 1YBWA 1GJ5H 5E0GA 2ZPQA 1V6DA 2O8TA 3P8NA 2J94A 4UFEH 4B2BA 4YESB 1TPPA 3P8GA 2H5DA 2ZU2A 2GGVB 2HALA 2A7CA 3SV2H 1TBQH 1AVWA 2P8OB 3F1SB 1CA0C 1SGNE 4NWKA 1EX3A 4MG3A 3T28A 4XBBA 2BD9A 1O5BB 1NRSH 1BTHH 4I32A 4UE7H 2OC1A 2Z94A 2JETC 1AUJA 2BLOA 3Q3XA 3IITA 1J9CH 1EATA 3MNSA 3V13A 1W3CA 4WJG2 1BA8B 2G4UA 2V3HH 4CRCA 2O8UA 4XOJA 1EOLA 1JOUB 4FUJA 1SSXA 1BBRE 3K65B 3SV8A 2BDBA 3SQEE 3ITIA 4MLFB 4OS6A 3VGCB 4JMYA 3MH6A 1IQLA 2Y7XA 2W3KA 2WYGA 1AN1E 1S83A 2PFEA 2BZ6H 4AFSA 2EA3A 1A5GH 1OPHB 4X2YA 3PMBB 3ZZ9A 3E1XB 2HNTE 1QY6A 1XUGA 3DFLA 1UTJA 1BTXA 1F92A 1O2ZA 1ZOMA 1ESBA 1D9IA 1TBRH 5FX6A 2QXHA 5ETXA 3RXDA 2DE8A 4ZKNU 1Y59T 3ZV9A 3HPTB 4FUDA 5LPEA 1V2JT 2ZHEH 4YT6H 5DP9A 2J2UA 3T5FH 4E7NA 4XDEA 1YC0A 3TITA 1MMJN 1G37A 2GZ8A 4MPUA 1FIWA 1JXPA 2VGCB 1GHAF 4XBCA 1LVMA 1Q3XA 4WXVA 3E0PB 1ELTA 1O5EH 1QIXB 3BTKE 1TPOA 2H1UA 2R2WU 5C1YA 1ZTKA 4Y6DA 1SGYE 4X2XA 3RXFA 1TMBH 3TNTA 1P02A 1C4U2 2XBVA 1NY22 1OWKA 3L33A 5DP3A 3ZVFA 5TCCA 1CVWH 3M7TA 1O32A 1O2SA 5JYIA 2A2QH 4YOIA 4XBDA 3FZDA 1N1LA 1UHBA 4MPWA 1ETTH 2ZG0H 3URCA 3VB3A 1GJ4H 4YLQH 1TE0A 3GYMA 1O5DH 4K2YA 5LPRA 1MTNB 1G30B 3MH4A 1GMHF 5K7RA 1QURH 1UCYH 3VFEA 1S5SA 2THFB 4ZMAH 1BTYA 4HGCA 5FX5A 4CH2B 2TBSA 2F9PA 4BAKB 1LHDH 5EXMA 4I8KA 4LXBH 2P3TB 1GJDB 1P2JA 1JIMA 4X6OA 1XXFA 3GCTG 2F9BH 1ELEE 4MPVA 1W0ZU 2FOGA 1RJXB 3QZRA 4FVDA 5A8YA 1O2GH 3LC5A 5L30H 2B8OH 4FUFA 5DP7A 3K9XB 5FCKA 1AD8H 5EQRA 5FPYA 1HAOH 1MAXA 1C1SA 4CRAA 2ZECA 3SUGA 2BZAA 2J38A 1EPTC 1LHEH 1THRH 3M5LA 3RXKA 1C2DA 5HMAA 1W0YH 2FX6A 4O3UA 3VB7A 1H4WA 2CXVA 2FX4A 2Y7ZA 1T7CA 3ZZDA 2VIWA 1KXCA 3ZV8A 1P10A 1DANH 1THPB 2R2MB 1UTQA 1P0SH 3RXJA 1ORFA 3NK8A 1Y3YA 1O5GH 1UK4A 3TJVA 4WMFA 3LONA 4OS5A 2GKVE 1LO6A 5A2MH 2FYQA 1AKSA 2VWNA 1WYKA 3S9CA 1CO7E 3E90B 4KP0A 5G4BA 4ZHMU 2XNIA 1Z1IA 3F9FA 1VITF 3QO6A 3PWCA 2ZDAH 1H8DH 3SI3H 2UWLA 2Y80A 3MNXA 2FOCA 2ZHWH 1KYNA 4WH6A 3W95A 2A4OA 3MWIU 1AIXH 1ZTJA 5A0AE 1BIOA 3BTQE 1G3BA 2P3FH 2FYRA 3LGIA 1GI1A 1PYTC 2PGBB 2G52A 1GI7B 1BDAA 5JBCS 1BTPA 2AMPA 2CN0H 3M7QA 8KME2 1V2PT 2Z9LA 1C9TA 1C5ZB 1H1BA 4FU9A 1O2XA 1E0FD 2RG3A 1GBHA 1C2IA 3P95A 1GJCB 1TNHA 4XSKU 1P2QA 4ABHA 3LH3A 3M5NA 5GCHG 4FVBA 4GLYA 1O31A 4I8JA 2XBYA 1EAUA 1AB9B 1HAXB 1NRPH 4FUBA 1BJVA 3S9AA 4A5TS 4Y0ZE 2V0BA 2JKHA 1GCTC 1TALA 3BG4B 3ELAH 3AW0A 2OINA 1MTSA 1QR3E 1MKWH 2ZDMA 2C8WB 1WTHD 4VGCC 2BD5A 3E91A 3SZNA 1UTPA 4R0IA 2A7JA 1D3TB 1GHXH 4X8SH 1F2SE 3BTEE 2VB0A 1AMHA 5EOKA 3BIVH 1CBWB 1GI4A 2WPIS 1CGJE 3KQCA 4AZ2B 1KLIH 3UWJH 2OQ5A 1VCWA 2FI5E 5ABWA 2O8LA 3RU4E 3EA8A 1K9OE 3P8OA 1N8OC 2Q6DA 3VB4A 1CA8B 3I78A 4J2YB 1YPKH 3UIRA 2FI3E 4ABFA 3D23A 1SI5H 3EAJA 2WPLS 3Q3YA 4ZKRU 3CS7A 4AGKA 1GBJA 1GBIA 3QDZB 5HXFA 3ATKA 2F91A 1SC8U 1HUTH 2ZHDA 1UHBB 4O03A 3KCGH 3D65E 5AFYH 3LC3A 5TCAA 1SHYA 3A87A 5FCRA 2G5VA 3SU2A 1O30A 1GL0E 1O3IA 2PTNA 2F3CE 3TK9A 2WINI 5F6MA 2ZDKA 4TY7A 1Y3UA 1GDNA 4JYTA 6GCHF 3A80A 1PFXC 3V3MA 4YTAA 1O2VA 2Y82A 3OSYA 3SU4A 4BXWA 3GY7A 2OP9A 2Y5HA 3TK5A 1S85A 4Y7BA 4U2WA 1EASA 1HGTH 3UY9A 1L1JA 2SGFE 3Q00A 4IC5A 2A45B 1ZJKA 1P2OA 1TX6A 4F49A 1C1NA 2ZGBH 1IQFA 3VGCC 1TQ7B 1A0HB 1O3JA 1UVTH 1CQQA 1T4VH 2QY0B 2GCHF 3UR6A 1XX9A 2TGDA 1T8LA 3ZZ5A 3NZIA 1DX5M 7ESTE 1NC6A 4TPIZ 4GHQA 3M3SA 1A61H 1B0FA 3KEEA 1QRXA 1KTSB 5FBEA 3DHKH 5J4SA 5SGAE 4X8VH 1TMUH 1N6YA 2ILNA 2BY7X 4RKOB 3ZVEA 3RMLH 1O2HA 1O2UA 5E0HA 3QTVH 1DSTA 1MAYA 1D6RA 1VGCB 2SGDE 3O8BA 1WCZA 3BTME 2A4QA 2BLWA 2ZGCA 4BAHB 1O3OA 1AKSB 1BCUH 1W12U 4RSPA 1AI8H 1V2RT 4ASHA 3Q3KA 1TPSA 1ZRBA 1SQOA 1QJ1B 1GMDF 1HPGA 1KIGH 3K6YA 3NCLA 4JCNA 1CU1A 1QL8A 1UVUH 3A7VA 2HOBA 3MU1A 1FI8A 1O3HA 2PR3A 5CMXH 1RIWC 1QBVH 1FY1A 1EP6A 1V2WT 1C5WB 2LNCA 4E7RG 2OBQA 1C1VH 1BTZA 1P2MA 2FLBH 3KGPA 3MFJA 3A7YA 5C2ZA 3BN9A 4I31A 3MO3A 3ZVGA 4JZ1A 3VEQB 1TLDA 3PTNA 2AMQA 2Z9JA 1TGNA 2OUAA 1D3DB 1BT7A 1Z8JB 3O8CA 1V2LT 1SGDE 3FZZA 4ZROA 1GHWH 1SQAA 1XMNB 1O39A 5C20A 3MNCA 2PWXA 3URDA 1OP2A 2HNTC 2GDDA 2M5TA 5T6DA 1V2TT 3KF2A 4LOYH 4E06H 1QBOA 4U30A 1YGCH 4X1SU 1NESE 1Y5BT 5GWZA 4ZAEA 5FPSA 1FV9A 4UD9H 1GJ6A 4ABEA 2BQ7B 1C5SA 3O8RA 1QA0A 4O3TA 1V2QT 1O2RA 1P11E 1ZMLA 1DM4B 1QJ7B 2BY9X 5A8XA 1O2YA 5AFZH 4BTUB 8GCHF 1ZSKA 2ANYA 4YOGA 1A1RA 1TMTH 4CRDA 1Z7KA 3SUFA 1GJ7B 1MQ6A 1GHAG 1QL7A 2ZCKP 3BTGE 1MH0A 1FAKH 5CHAC 1P04A 3M7UA 1FQ3A 2LPRA 3ATLA 1C5VA 1RXPA 3SN8A 3SUEA 3U1IB 1QJ6B 1WU1A 1RTKA 1NU9A 1Q2WA 4NCYA 4WMEA 4RKJB 2ODQA 3QZQA 5A8ZA 1LQEA 3RXLA 2W7UA 1Y5AT 1NS3A 2BVSH 3M3TA 1WQVH 4X1PU 1GDQA 1P01A 2BQWB 2V35A 2IN2A 3FP6E 3SW2B 2D26C 3SGQE 2WV5A 3RXMA 4K5ZA 1PQ8A 1W7XH 1F0SA 2ZU4A 4IC6A 1J17T 1ZMNA 1J14A 4UFGH 1OP8A 2BVRH 5JB8S 3HKIB 5ESBA 5DP6A 1DUEA 1EZQA 1IQNA 1JIRA 3UREA 1RTLA 4NSVA 4AYYB 3H7OA 1O33A 3EYDA 3RMMH 2BDIA 2CGAA 1W11U 2YNBA 2VH6A 5AF9H 1GVKB 3UQVA 1H9IE 1HB0B 4JK6A 3PO1C 2D8WA 2K1QA 4ABJA 4I33A 1UTKA 2A0QB 3FP8E 3PYHA 4THNH 1MZDA 1HIAA 4UFFH 5GIBA 4D9RA 4U32A 5AHGH 2BYAX 1GI9B 4ZH8A 1ELAA 1PQ7A 3MH5A 4QT8C 2ALVA 2GD4B 4I8LA 3O8DA 4WF8A 1AZZA 4DIHH 4AB9A 2Z9GA 2SNWA 2OLGA 2ASUB 1TA2A 3RUOA 2HGTH 1BMLA 1YPMH 5E2OA 1ELCA 7LPRA 1XKAC 1F0TA 2WPMS 3I29A 3RC6A 1CBWC 7GCHG 3ESTA 3DA9B 2P3UB 2NU4E 3RXIA 4KTSA 5I25A 4CR5A 1OSSA 4GCHF 2P93A 1H8IH 3LGUA 1Z1JA 1OYTH 3LJOA 2VWLA 3HGPA 1QBNA 3QGJA 5HYOA 1VITG 3M5OA 3MOCA 1IHTH 2VVVA 3UQOA 4D76A 1P3EA 4TWYA 4AB8A 3ATMA 1IQIA 1D3QB 5F8ZA 3GCHC 3RXTA 4JZEH 1C5XB 1EQ9A 2UUYA 1SHHB 4MNVA 5ESTE 2ODYB 3BTHE 3HK3B 3ODDA 2R3YA 4AYVB 3VPKA 3RDZA 2ZIQH 2FLRH 3GOVB 3RM0H 1P9UA 3ODFA 2Q6GA 3GDSA 1FDPA 2F9OA 1KSNA 2QF0A 1H9HE 2QXIA 3L3TA 4O97A 1PJPA 2Z9IA 3OU0A 1XXDA 1O2OA 1Z8IB 2FI4E 1UTOA 2ZZUH 3LH1A 3UNQA 5DP4A 2R0KA 4GSOA 2BY5X 2PSXA 2BX4A 2TRMA 1C1QA 1C2GA 1NPMA 3A8DA 4IMQA 1ZZZA 4LZ1H 5EXNA 4TPYA 1OXGA 2J95A 1O2TA 1V2KT 1TONA 4K3JA 3RXAA 1C2MA 2V6NA 3M61U 1A4WH 3SV9A 1G3CA 3LPRA 1P03A 2ANKH 4ISLA 5DK1A 2GP9B 4X1RU 1LPKB 3KQEA 5DP5A 3STJA 4WMDA 2HLCA 1D3PB 1XVMA 2ZA5A 1TNLA 1F5RA 1ABIH 3FANA 4HFPB 2XBXA 1C1RA 1O3FA 3UNRA 3QLPH 4NWLA 4NIWA 5CE1A 3RXQA 5T6FA 3TGJE 1X7AC 3MYWA 1DY9A 4YT7H 4MPXA 3OYPA 4MNWA 2FOMB 1AY6H 1LQDB 6CHAB 1AWHB 1QRWA 4ZXYH 3G01A 2IOTA 1HFDA 4BXSA 5IDKA 1UVOA 1PPGE 1MU6B 4ABIA 3SNBA 5F8TA 4B71A 4Q7XA 1SG8B 3QGNB 2GCTB 2J34A 1GI2A 1QB6A 1FN8A 4FUEA 1UTNA 1DT2A 4HZHA 1IHSH 6GCHG 1GPZA 2A2XH 1BTUA 1O2QA 4IW4E 3MU4A 4OS2A 1BMNH 3QTOH 1YLDA 1NRQH 2J92A 1EJNA 1FPHH 1SFQB 1DITH 1C4Y2 1P05A 1O35A 2TGTA 1AE5A 4KTUA 4WVPE 1EB2A 1BMAA 3HK6B 4PROA 2UUKB 4Q80A 3SJKA 3TPIZ 2VWMA 2ZPRA 3KN2A 5E8EH 1HIAB 4K1EA 1OX1A 4WH8A 2W7SA 2PLXA 2GCHG 1XUFA 1UCYE 2CHAB 2ZFRH 1UMAH 1MKXK 2NWNA 3M3VA 3LDXH 7GCHF 4DT7B 3ZZ7A 3P70B 2BXTH 5LPFA 3LOXA 4YZUA 3RP2A 4TY6A 3Q76A 2W3IA 4I8HA 1DWDH 3F9HA 1O3CA 3T27A 1QFKH 1RS0A 2BY6X 4MDSA 1A46H 1VZQH 2VIPA 5DJ7A 3SI4H 3M5MA 2VU8E 2AH4X 3ZZ4A 1C5NH 1IQEA 3FAOA 1AUTC 3MO6A 3RXEA 1MD7A 1L0ZA 1GGDC 1DWBH 1LPGB 5FXLA 1SOTA 3TU7H 3MMGA 4DOQA 1P2NA 1O2PA 1YPLH 1QQUA 1XVOA 3SBKA 2RCEA 1NROH 4Z6AH 1GMDG 3NWUA 3TJUA 3RLYH 1W14U 2GMTB 3MNBA 2PKSC 9ESTA 2DUCA 1ETSH 3LGYA 3IG6B 1GBKA 4Y10E 1T8NA 1M9UA 1YM0A 3L6PA 1NFYA 2QAAA 2VIDA 4H6TA 1G32B 1EKBB 3BTWE 1C5MD 2ZEBA 3T25A 1HJ8A 3SU6A 1L1NA 4UEHH 1L4DA 1DSUA 5C1XA 3TH4H 2GZ9A 3SNEA 1FPCH 3SNAA 2FS8A 1J8AA 2G00A 4GAWA 4X1NU 3AAVA 1Z8GA 3SGBE 1FY3A 3A84A 2BVXH 1HAIH 2O8MA 1BRCE 1MCTA 3LIWA 2WV4A 3PTBA 3PLPA 1BZXE 1ZYOA 3A8BA 5EG4A 3TK6A 4YO9A 1ANDA 1BTWA 2C8XB 3LGTA 4A1XA 1SGTA 2Y5GA 1ELGA 4ABGA 1WAYB 4JZFH 2FODA 2QCYA 3BF6H 4NIXA 2ZFSA 3KNXA 1WBGB 2EEKA 1OOKB 3TIUA 1IOEA 5T6GA 3SV7A 1GBMA 2TGPZ 8GCHG 1W2KH 2EI7A 1VR1H 1GBFA 1VJ9U 1BBRK 2XWBI 5HGGA 4NZLA 1TGBA 2C4FH 1MTVA 1SGIB 4Y79A 1ZPCA 1BQYA 1O5CB 1CA0B 4KKDA 5FAHA 2FS9A 5TJXA 4IBLH 4FU7A 2P8OC 5F8XA 1O3LA 2FPZA 4ZUHA 2BM2A 4B2AA 2VWOA 2CMYA 2OC0A 2JETB 2AEIH 1BITA 2PTCE 1GI0A 1DOJA 5C67A 1SLWB 2BD2A 3GDVA 5GJ4B 2HVXA 1NM6A 3S7KB 2XCNA 2ZU3A 1F0UA 1ZJDA 2UWOA 5DP8A 1IQJA 1P57B 2BX3A 3VB6A 5HM2A 4DGJA 2A5KA 3LGVA 4ZXXH 1C2HA 3DT0H 4NIYA 1YPEH 6LPRA 2QV1A 1YYY1 4CREA 2VVUA 1L2EA 3RXRA 4X8TH 1QNJA 2GZ7A 3KIDU 1HXFH 4ISOA 3NPSA 1T8MA 1AU8A 4CRGA 1DXPA 1UJ1A 2BTCE 4A1TA 1NN6A 1GHVH 3GY5A 4E05H 3SORA 2FOEA 4AGJA 5JBTA 1O2MA 2PGQB 4U01A 1YLCA 2F9VA 2GV6A 1TNKA 2ZDVH 1OS8A 2ESTE 1LKBA 1QL9A 1UVSH 2XBWA 1UO6A 1AZ8A 1P3CA 3K2UA 1ZPZA 1O2JA 1TRNA 2ZHFH 4R8TB 1TRMA 1CT0E 1PPHE 3HGNA 4JYVH 2P59A 1AVGH 1C9PA 1DY8A 2P16A 3SQHE 2VGCC 2PUQH 2BD7A 5K0HA 3RU4D 4Q7ZA 1OWJA 4NA9H 2F83A
chains in the Genus database with same CATH superfamily
1HJAB 4YXWD 5DSFA 3PMJA 4JYUH 4Y8XA 2O9QA 1SL3A 2G51A 3TJNA 3S69A 1V2OT 4X0WU 1INCA 2H6MA 3E8LA 9LPRA 1NT1A 4CHAB 1ZGVA 3UPEA 4X2VA 1O3BA 4AFZA 5KECA 1O5AB 4GCHG 2TPIZ 1F7ZA 1GJBB 1LCYA 5DPAA 5AVDA 1O3NA 4TYDA 1JWTA 1MD8A 3A81A 2G55A 3VB5A 3TGIE 2JJ2D 2OC8A 2L74A 1TIOA 1ZRKA 1G2MA 1MTNC 3GY2A 1JRSA 1MTWA 1HAGE 1MCVA 1HV7A 2XC4A 5E0JA 1TYNA 1L1GA 4Q2KA 3KL6A 1DFPA 3RXOA 2H9HA 4XD7D 3FO8D 3DUXH 3LT3A 3K6ZA 1J15A 2GT8A 1LVBA 2FZZA 4KGAA 4H4FA 2HWLB 3N7OA 5EQSA 1VCQA 4ESTE 1NU7B 2GCTC 1UK3A 3F2GA 1TNJA 3SO3A 3GCOA 1LVOA 2ZHQH 1ESTA 2GVFA 5DGJA 3ZVBA 1GI8B 1A2CH 1V2MT 4MNXA 2AYWA 2FOAA 4Y8ZA 4BTIB 1TGSZ 4JZIA 4BAMB 1ELFA 2BDHA 1Y3WA 3PB1E 4Q63A 1QB1A 1ANBA 5EXLA 4MTBA 3P6ZB 3RXGA 1P9SA 3MHWU 1DS2E 1GHBF 1AFEH 1ZHPA 1MKXH 2BMGB 4INKA 2GDEH 3JZ2B 2G81E 2JJ1D 2NU1E 4ZKSU 1FY4A 1SGEE 1YPHE 5I46H 3A7ZA 3MU5A 1K1JA 4NSYA 2W6JD 3SHAH 4AFUA 1KDQA 2HRVA 2ZO3H 1J16A 1BRUP 4FUHA 1W10U 4JK5A 4YLUA 2PUXB 1YCPK 3ZZAA 5EQQA 5GDSH 2J4IA 4B2CA 2BOKA 3T29A 1DPOA 1Z71A 2HVYB 1DE7H 1GMCF 4UFDH 1Z6EA 2AS9A 3V0XA 1HRTH 1SFIA 2AGEX 3LJJA 1PYTD 1O34A 2C8ZB 4DY7B 3A85A 1TPAE 4OGYA 4OS4A 1K1PA 3D49H 1KXEA 4IGDA 3U8OH 3UWIA 4X8UH 1W8BH 4BNRA 4DJZB 5FPTA 1THSH 1SMFE 4B76A 1W13U 1GVZA 3NUMA 1CT2E 1ETRH 4LK4A 4Z0KA 3ZVDA 2KCYA 4X6NA 1MBMA 2OC7A 1ZSLA 1K2I1 1YLNA 1C5TA 2ALPA 2KAIA 1EUFA 4A1VA 4INLA 4FUCA 1GI5A 1ELDE 1O2IA 1AWFH 1TQ0B 3UNSA 4BANB 2C3SA 4D9QA 1A7SA 1BMFD 2H5CA 2QXGA 2B7DH 1SB1H 2PW8H 2WUBA 4B1TA 1C1OA 1F5KU 1IQMA 2JH5D 2ZTYA 4DVAU 1CGIE 3F68H 1EP5A 1G36A 1ESAA 2VIOA 1C5YB 1C2JA 3OFND 1SLUB 1ID5H 2ZCHP 2QF5A 4Y8YA 5JDUB 1IQKA 2GT7A 1BOQA 4Y71A 3OAAD 2BHGA 1GCTB 2D2DA 2XCFA 1DICA 1HAZB 1ARCA 1IQHA 1AB9C 3RXCA 3A7TA 4VGCB 3SHCH 5BPEA 3BG4C 1B5GH 1O2LA 3S7HB 1EJAA 2ZI2H 3RLWH 3LGWA 1FJSA 3GY8A 3M36A 4FUIA 1F0RA 2IPHA 2OQUA 4MNYA 3SGAE 4IN2A 2D1JA 3AW1A 3H7TA 4M7GA 1HAYB 4X6MA 1KLTA 4AX9H 1JRTA 1QB9A 1C5OH 1E36B 1BBRH 2I6QA 3VXEH 3UR9A 4IS5A 3ZZ3A 1O3PB 2Q1JA 2FP7B 4D7FA 3TNSA 2BB4A 2ZDNA 1CSOE 1OWIA 3DSOA 2LIZA 3A7XA 2C90B 3OX7U 2EC9H 3E16B 1AFQB 5DO4H 1YPJH 1FY5A 4SGBE 2IJOB 2Y5FA 2R9PA 2Y6TA 3C1KA 3BEFB 2FMJA 3FFGA 1V2NT 4WY3A 3SJOA 5FHTA 1K1MA 5E2PA 1GVLA 2BDGA 3NXPA 1PQ5A 3BEUA 4FUGA 4F4OC 1K22H 1BJUA 1NRNH 3M35A 3A88A 1TFXA 2A5AA 2L6OA 2ZGJA 4Y0YE 5L2ZH 2QYIA 2BOHB 3SNCA 2BD3A 4OGXA 5KGOA 2AIPA 4X2WA 3A86A 1TOCB 3U1JB 3S0NA 3H5CB 3W94A 1S84A 1EZUC 1C2EA 1NO9H 3GY6A 2OBOA 2F9UA 1O5FH 1PPZA 1Y5UT 1KXBA 1NFXA 2ZF0H 1PPEE 3RC4A 1WDIA 1GHZA 3OEED 1KXAA 2Z3DA 1GL1A 1WUNH 1Y3VA 1AE8H 1HNEE 3N99A 2VBCA 3EGKH 3B9FH 1C1PA 3ZVCA 1SGFA 2R3UA 4YM9A 3QWCH 2FO9A 4Y7AA 2BDYA 5EIYA 3P17H 2KZ4A 1A5IA 3SU1A 2EI6A 4ABAA 3GS9A 4FU8A 1FONA 4BAOB 1SQTA 3MU8A 2G8TA 4NA8A 1ZTLA 3SV6A 3HKJB 3EA7A 4K8BA 4XFQA 3P8FA 2ODPA 5LH8A 2ZQ2A 4UONA 1C5LH 2BD8A 1NZQH 3WY8A 4H42U 1K21H 1V2VT 3GISB 1ZSJA 2FOBA 1LPZB 4K1SA 5A09A 1SGCA 2M2AA 3SU5A 3QN7A 1UVPA 1KDQB 4AFQA 1K1OA 1CGHA 2XC0A 4ZHAA 1KY9A 3B23B 1AVXA 5EU8A 2AFQB 3KHVA 1VGCC 1O3GA 4CBNA 1VJAU 3FP7E 4OS7A 3U8TH 1KLJH 1HJAC 1QRZA 1SBWA 3HATH 1UK2A 4NG9H 1EXFA 1TX7A 5C5NA 4F48B 1LHFH 1HLTH 4CHAC 1DUAA 1RIWB 1XUJA 3FVFB 1ARBA 3R0FA 2WPHS 1GCDA 1GBTA 2Z6BD 4IN1A 2B9LA 2XW9A 3MO9A 1BHXF 4RN6A 2FTMA 1SGRE 1WQSA 3STIA 4I7YH 3A8CA 2QA9E 2KAIB 1ABJH 2BXUH 2ZGXH 3BEIB 3TJOA 3IWMA 1MBQA 2TIOA 1OWDA 5F03A 1WV7H 3SNDA 5T1VA 1G9IE 1AHTH 1CHGA 1ANCA 3B8JA 3MU0A 1FIZA 4ZKOU 2J98A 4ISIH 4X1QU 3EQ0H 2AGIX 5LGOA 4INHA 2I6SA 4ISHH 3KYFA 4K1TA 1GHYH 4NFEA 1WSSH 2WPJS 4CRFA 1ZR0A 1XUKA 1U6QA 1LKAA 1GJ9B 1MUEB 1S6HA 2B5TB 1TABE 1AQ7A 3E3TA 3RXUA 1HXEH 1V2UT 1P2KA 2WZQA 3PV4A 1K1LA 2STBE 4HTCH 2BQ6B 4NA7A 5C1UA 1D4PB 1CE5A 1E38B 3PROA 1ZGIA 1GBCA 2AHME 5PTPA 1GG6B 1TB6H 1HAHH 3U8RH 1A3BH 1OYQA 5CHAB 1S0QA 1YCPH 2F4LA 4DURA 1Z6JH 2CK3D 5DN6D 1AO5A 1NBME 2PKAA 3H09A 2OXSA 4NFFA 1A0LA 4ABBA 1GBAA 2HPPH 1OKXA 1MTUA 1O3AA 2V3OH 2UWPA 1F5LA 2VINA 1HAVA 3AASA 4CR9A 3BTTE 1C5UA 3EA9A 1B0EA 1KXDA 2WYJA 1VCPA 1G2LA 3TLOA 1FAXA 1O37A 1DLEA 3ATIA 1MQ5A 2STAE 1TGTA 8LPRA 2IPQX 2ZTXA 1EOJA 3M37A 1C2KA 7KMEH 4TWWA 3OY6U 2VIVA 2GX4A 2G5NA 8ESTE 3RXBA 4D8NA 1LDTT 3BSQA 2PHBA 1HYLA 2RDEA 4MQAA 3RU4T 4BOHA 3PMAB 1HAPH 1BB0B 2RA3A 2P95A 2BLQA 2R0LA 4Y11E 3VXFH 3F9EA 2ZNKH 2YNAA 1UTLM 1WOFA 4B6FA 1ZHRA 1YY3A 4A92A 2G4TA 4OS1A 1SVPA 3I77A 5EODA 1TNIA 2Z9KA 1FXYA 1EZSC 1YCPM 1T32A 2HPQH 1EPTA 5EPYA 2OCVB 1TA6A 1SR5C 4YOJA 2O8WA 2KCPA 1B7XB 3C27B 2GTBA 1MZAA 3PO1B 3NKKA 1TGCA 1WTGH 1C5RA 1HDTH 3LU9B 1MU8B 4A6LA 4AG2A 3PMHB 5JB9S 4BTTB 5B6OA 3PRBA 2VVCA 4DCDA 2H9EH 4RT1A 4FXGH 2C93B 3DCLA 1NTPA 1O3MA 2ZQ1A 4WWYA 5GXPA 1UTMA 2A4GA 2BY8X 2PV9B 1DWEH 2WSSD 2JH0D 1GHBG 4B73A 1S82A 1HCGA 2QIQA 2F9NA 1DXWA 5DG6A 4GVUA 1C2LA 1EAXA 1YPHC 5H4IB 1VITH 2ZCLP 1XM1A 2FEQH 2VH0A 2XRCA 1O3KA 1YKTA 1V3XA 2GV7A 3E0NB 2ZFQH 1OP0A 1TAWA 1LTOA 3RXVA 4NZQA 2ZU1A 4ISNA 3ZZ6A 1O0DH 3TGKE 4GPGA 3ZVAA 3PLKA 3TVJB 1EJMA 1O3EA 3GCNA 1T8OA 2Z3CA 5C3NA 1D6WA 3ENSB 2JH6D 1CHOG 1C1MA 2WPKS 2XNDD 1C5QA 1HJ9A 2ZFPH 5C0TA 1AGJA 1V2ST 2SNVA 3TH3H 1C2FA 1GMCG 2A31A 2TGAA 3PM3A 2FOHA 1FZZA 1AFQC 1ACBE 3GY3A 2ZDLA 3GCHB 1DWCH 2FM2A 2FWWA 2QF3A 3CP7A 2Z7FE 4AORA 2A1DB 3R3GB 3MTYA 1DLKB 1GI6A 1EAIA 4GHTA 3ZZBA 5HM9A 2B0FA 3SU3A 2OK5A 1H8HD 1LHCH 2EI8A 1Y8TA 1ANEA 2A32A 3RXSA 1GJAB 3UOUA 2FOFA 1NFWA 1BRAA 3GCTF 3QX5H 3OTPA 1O36A 1O38A 2BDAA 3UAIC 1EZXC 5JBAS 2J5UA 3A89A 2UUFB 1K1IA 4Q7YA 3A82A 1A5HA 3Q77A 4X6PA 1QCPA 3CENA 2EQNA 1BHXB 3RMOH 2ZGHA 3MQKC 1E35B 2SGEE 3A7WA 5A0BA 1LVYA 1O3DA 3CS0A 5L2YH 4CRBA 3E6PH 4NIVA 1EAWA 1RRKA 2ZWLH 1OWEA 3BTDE 2K7XA 2WV9A 1C1TA 3SJIA 1RTFB 2J98B 2SGQE 3T62A 1FY8E 4ACBA 4DG4A 2BLVA 1TBZH 4I8GA 2XWAA 3TH2H 2WUCA 2KCAA 2ZTZA 1ZHMA 1PPCE 1T4UH 2NU3E 2CV3A 2YMSC 5EW1H 1Y3XA 2VJ1A 1OWHA 3BG8A 2DE9A 2QGRA 4MVNA 3KQDA 5EPNA 1GBEA 2ANMH 1A3EH 2J9NA 2OD3B 3OTJE 4B74A 3ZZ8A 2AGGX 4H6SB 1SGQE 3BIUH 2C8YB 2Q6FA 3KQBA 1ELBA 1LHGH 1O2NA 1YF4A 2VIQA 2A5IA 2YOLA 1FUJA 3EE0B 1GBDA 1GWAA 2PKAB 3A83A 1YPGH 3RXPA 2ULLA 2VNTA 3GDUA 1Q31A 3LKWA 3BV9B 5L6NH 4HG6A 1S0RA 1SLVB 4SGAE 4M9FA 1ZPBA 5GPIB 3V12A 1K28D 2RDLA 2H2ZA 2XC5A 4K8YA 1P06A 3ATWA 1C4V2 1HAVB 2SGPE 3JZ1B 3SU0A 5EW2H 1RGQA 5DKMA 4AN7A 3SJ9A 3EDXB 3EBNA 4JZDH 2BDCA 6CHAC 3PWBA 1ELVA 1L4ZA 3GYLB 1NRRH 5IK2D 5F53A 2ANWA 1YP9A 5J4QA 5EJZA 1UCYK 3BTFE 3UUZA 4DW2U 1A0JA 6ESTA 5CHBA 2KX4A 2ZFTA 2Z3EA 2FTLE 3D62A 5JBBS 1KTTB 5GCHF 4HI3A 2UUJB 3AAUA 2W5EA 3S9BA 4BAQB 4GUXA 3UFAA 1E1RD 1GJ8B 1QGFA 2F43B 1EPTB 1SGFG 4WXIA 3T26A 1H9LB 1PPFE 1C1WH 3ZYDA 1IQGA 5JPMH 1K0HA 2W26A 1W7GH 2CF8H 3ZZCA 3GY4A 1C1UH 3RMNH 2ZPSA 1XUIA 3DFJA 3MI4A 1GBBA 3DSGA 1SGPE 4XRNA 3RXHA 4AG1A 1JMOH 2SFAA 3A8AA 3T2NA 1P09A 1H8ED 1P12E 1QHRB 1SPJA 2CHAC 3SOSA 4LZ4B 1GDUA 1NFUA 1BRBE 1G3EA 3U9AH 1SLXB 1CHOF 3MH7A 3PLBA 4J1YA 3ZYEA 3QUMP 5EGMA 1GBLA 1TWXB 2Y81A 2QC2A 3UTUH 1GG6C 1PQAA 4ZCNA 2AMDA 5IYTA 4CH8B 2ZU5A 2SGAA 1BUIA 2A7HA 1GGDB 4ZHLU 1K1NA 3DD2H 1C5PA 1XUHA 3QK1A 3RC5A 1P8VC 1QTFA 4P02A 4XE4A 2RFKC 2XXLA 2QN5T 4Y76A 3AVZA 2QXJA 4K69A 2ZKSA 1DDJA 4UDWH 5C5OA 3SUDA 1TX8A 1RFNA 2XYAA 1FLEE 2FESH 2PKSB 1SOZA 4A7IB 3U69H 4AOQA 1Z8RA 2HNTF 2KFWA 4B75A 1T31A 2P94A 2GMTC 1BMMH 4KELA 1LMWB 1FN6A 3SJ8A 1PPBH 1E34B 3F6UH 3GICB 4IMZA 5T3HA 2FDAA 1DVAH 1JBUH 4NGAH 1O2WA 2CF9H 1GMHG 1HBTH 4DIIH 1QQ4A 1TOMH 2A4RA 2FIRH 2CJIA 1FMGA 1N6XA 1ZLRA 4KTCA 4D7GA 1G3DA 1EB1H 4O9VA 3F9GA 1TRYA 1P2IA 2NU2E 2H9TH 2FXRA 4K60A 2BD4A 1EFRD 2ZP0H 3OY5U 5A0CA 5BRRE 2PSYA 1RD3B 2ZC9H 4CBOA 1WXRA 2NU0E 2XTTB 1ZMJA 3RM2H 1CT4E 3P92A 3U98H 1O2KA 1MKWK 2ZFFH 2AIQA 1TNGA 1QA7A 2RA0A 1GI3A 3UOPA 1S81A 1E37B 1N8OB 1IAUA 4ABDA 2OTVA 1S6FA 2AERH 1KXFA 3VG8A 3V7TA 5FBIA 1XKBC 1FNIA 1YBWA 1GJ5H 5E0GA 2ZPQA 1V6DA 2O8TA 3P8NA 2J94A 4UFEH 4B2BA 4YESB 1TPPA 3P8GA 2H5DA 2ZU2A 2GGVB 2HALA 2A7CA 3SV2H 1TBQH 1AVWA 2P8OB 4TT3D 3F1SB 1CA0C 1SGNE 4NWKA 1EX3A 1FX0B 4MG3A 3T28A 4XBBA 2BD9A 1O5BB 1NRSH 1BTHH 4I32A 4UE7H 2OC1A 2Z94A 2JETC 2QF4A 1AUJA 5C17A 2BLOA 3Q3XA 3IITA 1J9CH 1EATA 3MNSA 3V13A 1W3CA 4WJG2 1BA8B 2G4UA 2V3HH 4CRCA 2O8UA 4XOJA 1E79D 1EOLA 1JOUB 4FUJA 3W1EA 1SSXA 1BBRE 3K65B 3SV8A 2BDBA 3SQEE 3ITIA 4MLFB 4OS6A 3VGCB 4JMYA 3MH6A 1IQLA 2Y7XA 2W3KA 2WYGA 1AN1E 1S83A 2PFEA 2BZ6H 4AFSA 2EA3A 1A5GH 1OPHB 4X2YA 3PMBB 3ZZ9A 3E1XB 2HNTE 1QY6A 1XUGA 3DFLA 1UTJA 1BTXA 1F92A 1O2ZA 1ZOMA 1ESBA 1D9IA 1TBRH 5FX6A 2QXHA 5ETXA 2WHXA 3RXDA 2DE8A 4ZKNU 1Y59T 3ZV9A 3HPTB 4FUDA 5LPEA 1V2JT 2ZHEH 4YT6H 5DP9A 2J2UA 2YMSD 3T5FH 4E7NA 4XDEA 1YC0A 3TITA 1MMJN 1G37A 2GZ8A 4MPUA 1FIWA 1JXPA 2VGCB 1YWUA 1GHAF 4XBCA 1LVMA 1Q3XA 4WXVA 3E0PB 1ELTA 1O5EH 1QIXB 3BTKE 1TPOA 2H1UA 2R2WU 5C1YA 1ZTKA 4Y6DA 1SGYE 4X2XA 3RXFA 1TMBH 3TNTA 1P02A 2LP6A 1C4U2 2XBVA 1NY22 1OWKA 3L33A 5DP3A 3ZVFA 5TCCA 1CVWH 3M7TA 1O32A 1O2SA 5JYIA 2A2QH 4YOIA 4XBDA 3FZDA 1N1LA 1UHBA 4MPWA 1ETTH 2ZG0H 3URCA 3VB3A 1GJ4H 4YLQH 1TE0A 2K0QA 3GYMA 1O5DH 4K2YA 5LPRA 1MTNB 1G30B 3MH4A 1GMHF 5K7RA 1QURH 1UCYH 3VFEA 1S5SA 2THFB 4ZMAH 1BTYA 4HGCA 5FX5A 4CH2B 2KCOA 2TBSA 2F9PA 4BAKB 1LHDH 5EXMA 4B6EA 4I8KA 4LXBH 2P3TB 1GJDB 1P2JA 1JIMA 4X6OA 1XXFA 3GCTG 2F9BH 1ELEE 4MPVA 1W0ZU 2FOGA 1RJXB 3QZRA 1COWD 4FVDA 5A8YA 1O2GH 3LC5A 5L30H 2B8OH 4FUFA 5DP7A 4P00A 3K9XB 5FCKA 1E1QD 1AD8H 5EQRA 5FPYA 1HAOH 1MAXA 1C1SA 4CRAA 2ZECA 3SUGA 2BZAA 1UW7A 2J38A 1EPTC 1LHEH 1THRH 3M5LA 3RXKA 3WWFA 1C2DA 5HMAA 1W0YH 2FX6A 4O3UA 3VB7A 1H4WA 2CXVA 2FX4A 2Y7ZA 1T7CA 3ZZDA 2VIWA 3FN8A 1KXCA 2GJGA 3ZV8A 1P10A 1DANH 1THPB 2R2MB 5HIZA 1UTQA 1P0SH 3RXJA 1ORFA 3NK8A 1Y3YA 1O5GH 1UK4A 3TJVA 4WMFA 3LONA 4OS5A 2GKVE 1LO6A 5A2MH 2FYQA 1AKSA 3KQ5A 2VWNA 1WYKA 3S9CA 1CO7E 3E90B 4KP0A 5G4BA 4ZHMU 2XNIA 1Z1IA 3F9FA 1VITF 3QO6A 3WWBA 3PWCA 2ZDAH 1H8DH 3FKSD 3SI3H 2UWLA 2Y80A 3MNXA 2FOCA 2ZHWH 1KYNA 4WH6A 3W95A 2A4OA 3MWIU 1AIXH 1ZTJA 5A0AE 1BIOA 3BTQE 1G3BA 2P3FH 2FYRA 3LGIA 1GI1A 1PYTC 2PGBB 2G52A 1GI7B 1BDAA 5JBCS 1BTPA 2AMPA 2CN0H 3M7QA 8KME2 1V2PT 2Z9LA 1C9TA 1C5ZB 1H1BA 3NRLA 4FU9A 1O2XA 1E0FD 2RG3A 1GBHA 1C2IA 3P95A 1GJCB 1TNHA 4XSKU 1P2QA 4ABHA 3LH3A 3M5NA 5GCHG 4FVBA 4GLYA 1O31A 4I8JA 2XBYA 1EAUA 1AB9B 3PRDA 1HAXB 1NRPH 4FUBA 1BJVA 3S9AA 4A5TS 4Y0ZE 2V0BA 2JKHA 3OEHD 1GCTC 1TALA 3BG4B 3ELAH 3AW0A 2OINA 1MTSA 1QR3E 1MKWH 2ZDMA 2C8WB 1WTHD 4VGCC 2BD5A 4Z1MD 3E91A 3SZNA 1UTPA 4R0IA 2A7JA 3F2FA 1D3TB 1GHXH 4X8SH 1F2SE 3BTEE 2VB0A 1AMHA 5EOKA 1SQRA 3BIVH 1CBWB 1GI4A 2WPIS 5CDFE 1CGJE 3KQCA 4AZ2B 1KLIH 3UWJH 2OQ5A 1VCWA 2FI5E 1NBMD 2O8LA 3UB0A 5ABWA 3RU4E 3EA8A 1K9OE 3P8OA 1N8OC 2Q6DA 3VB4A 1CA8B 3I78A 3OE7D 1YPKH 4J2YB 2FI3E 3UIRA 4ABFA 3D23A 1SI5H 3EAJA 2WPLS 3Q3YA 4ZKRU 3CS7A 2KR7A 4AGKA 5B6LA 1GBJA 1GBIA 3QDZB 5HXFA 2V7QD 3ATKA 2F91A 1SC8U 1HUTH 2ZHDA 1UHBB 4O03A 3KCGH 3D65E 5AFYH 3LC3A 3FOAA 5TCAA 1SHYA 3A87A 5FCRA 2G5VA 3SU2A 1O30A 1GL0E 1O3IA 1S6LA 2PTNA 2F3CE 4AC9A 3TK9A 2WINI 5F6MA 2ZDKA 4TY7A 1Y3UA 1GDNA 4JYTA 6GCHF 3A80A 1PFXC 3V3MA 4YTAA 1O2VA 2Y82A 3OSYA 3SU4A 4BXWA 3GY7A 2OP9A 2Y5HA 3TK5A 1S85A 4Y7BA 4U2WA 1EASA 1HGTH 3UY9A 1L1JA 2SGFE 3Q00A 4IC5A 1MABB 2A45B 1ZJKA 1P2OA 1TX6A 4F49A 1C1NA 2ZGBH 1IQFA 3KYGA 3VGCC 1TQ7B 1A0HB 1O3JA 1UVTH 2XOKD 1CQQA 1T4VH 2QY0B 2GCHF 3UR6A 1XX9A 2TGDA 1T8LA 3ZZ5A 3NZIA 1DX5M 7ESTE 1NC6A 2EY4C 4GHQA 4TPIZ 3M3SA 1A61H 1B0FA 3KEEA 4FOUC 1QRXA 1KTSB 3F2HA 5FBEA 3DHKH 5J4SA 5SGAE 4X8VH 1TMUH 1N6YA 2ILNA 2BY7X 4RKOB 3ZVEA 3RMLH 1O2HA 1O2UA 2HLDD 5E0HA 3QTVH 1DSTA 1MAYA 1D6RA 1VGCB 2JDID 2SGDE 3O8BA 1WCZA 3BTME 2A4QA 2BLWA 2ZGCA 4BAHB 1O3OA 1AKSB 2PP6A 1BCUH 1W12U 4RSPA 1AI8H 1V2RT 4ASHA 3Q3KA 1TPSA 2KM0A 1ZRBA 1SQOA 1QJ1B 1GMDF 1HPGA 1KIGH 3K6YA 4Q4LA 3NCLA 4JCNA 1CU1A 1QL8A 1UVUH 3A7VA 2HOBA 3MU1A 1FI8A 1O3HA 2PR3A 5CMXH 1RIWC 3U28C 1QBVH 4TSFD 1FY1A 1EP6A 1V2WT 1C5WB 2LNCA 4E7RG 2OBQA 2JIZD 1C1VH 5KEDA 1BTZA 1P2MA 2FLBH 3KGPA 3MFJA 3A7YA 5C2ZA 3BN9A 4I31A 3MO3A 3ZIAD 3N7EA 3ZVGA 4JZ1A 3VEQB 1TLDA 3PTNA 2AMQA 2Z9JA 1TGNA 2OUAA 1D3DB 1BT7A 1Z8JB 3O8CA 1V2LT 1SGDE 3FZZA 4ZROA 1GHWH 2IJD1 1SQAA 1XMNB 1O39A 5C20A 3MNCA 3CNRA 2PWXA 3URDA 1OP2A 2HNTC 2GDDA 2M5TA 5T6DA 1V2TT 3KF2A 4LOYH 4E06H 1QBOA 4U30A 1YGCH 5HIYA 4X1SU 1NESE 1Y5BT 1VKYA 5GWZA 4ZAEA 5FPSA 1FV9A 4UD9H 1GJ6A 4ABEA 2BQ7B 1SKYE 1C5SA 3O8RA 1QA0A 4O3TA 1V2QT 1O2RA 1P11E 1ZMLA 1DM4B 1QJ7B 2BY9X 5A8XA 1O2YA 5AFZH 4BTUB 8GCHF 1ZSKA 2ANYA 4YOGA 1A1RA 1TMTH 4CRDA 1Z7KA 3SUFA 1GJ7B 1MQ6A 1GHAG 1QL7A 2ZCKP 3BTGE 1MH0A 1FAKH 5CHAC 1P04A 4FETA 3M7UA 1FQ3A 2LPRA 3ATLA 3PV5A 1C5VA 1RXPA 3SN8A 3SUEA 3U1IB 1QJ6B 1WU1A 1RTKA 1NU9A 1Q2WA 4NCYA 4WMEA 4RKJB 2ODQA 3QZQA 5A8ZA 1LQEA 3RXLA 2W7UA 1Y5AT 1NS3A 2BVSH 3M3TA 1WQVH 4X1PU 1GDQA 1P01A 2BQWB 2V35A 2IN2A 3FP6E 3SW2B 2D26C 3SGQE 2WV5A 3RXMA 4K5ZA 1PQ8A 1W7XH 1F0SA 2ZU4A 4IC6A 1J17T 1ZMNA 3F0OA 1J14A 4UFGH 4ASUD 1OP8A 2BVRH 5JB8S 3HKIB 5ESBA 5DP6A 1DUEA 1EZQA 1IQNA 1JIRA 3DSPA 3UREA 1RTLA 4NSVA 4AYYB 3H7OA 1O33A 3EYDA 3RMMH 2BDIA 2CGAA 1W11U 2YNBA 2VH6A 5AF9H 1GVKB 3UQVA 1H9IE 1HB0B 4JK6A 3PO1C 2D8WA 2K1QA 4ABJA 4I33A 1UTKA 2A0QB 3FP8E 3PYHA 4THNH 1MZDA 1HIAA 4UFFH 5GIBA 4D9RA 4U32A 5AHGH 2BYAX 1GI9B 4ZH8A 1ELAA 1PQ7A 3MH5A 4QT8C 2ALVA 2GD4B 4I8LA 3O8DA 4WF8A 1AZZA 4DIHH 4AB9A 2Z9GA 3EE7A 2SNWA 3WW7A 4ACAA 2OLGA 2ASUB 1TA2A 3RUOA 2HGTH 1BMLA 1YPMH 5E2OA 1ELCA 7LPRA 1XKAC 1F0TA 2WPMS 3I29A 3RC6A 1CBWC 7GCHG 3ESTA 3DA9B 1OHHD 2P3UB 2NU4E 3RXIA 4KTSA 4RI0A 5I25A 4CR5A 1OSSA 4GCHF 2P93A 1H8IH 3LGUA 1Z1JA 1OYTH 2WPDD 3LJOA 2VWLA 3HGPA 1QBNA 3QGJA 5HYOA 1VITG 3M5OA 2LELA 1IHTH 2VVVA 3MOCA 3UQOA 4D76A 1P3EA 4TWYA 4AB8A 3ATMA 1IQIA 1D3QB 5F8ZA 3GCHC 3RXTA 4JZEH 1C5XB 1EQ9A 2UUYA 1SHHB 4MNVA 5ESTE 2ODYB 3BTHE 3HK3B 3ODDA 2R3YA 4AYVB 3VPKA 3RDZA 2ZIQH 2FLRH 3GOVB 3RM0H 1P9UA 3ODFA 2Q6GA 3GDSA 1FDPA 2F9OA 1KSNA 2QF0A 1H9HE 2QXIA 3L3TA 4O97A 2K8IA 1PJPA 2Z9IA 3OU0A 1XXDA 1O2OA 1Z8IB 2FI4E 1UTOA 2ZZUH 3LH1A 3UNQA 5DP4A 2R0KA 4GSOA 2BY5X 2PSXA 2BX4A 2TRMA 1C1QA 1C2GA 1NPMA 3A8DA 2YMSB 4IMQA 1ZZZA 4LZ1H 5EXNA 2QE7D 4TPYA 1OXGA 2J95A 1O2TA 1V2KT 1TONA 4K3JA 3RXAA 1C2MA 2V6NA 3M61U 1A4WH 3SV9A 1G3CA 3LPRA 1P03A 2ANKH 4ISLA 5DK1A 2GP9B 4X1RU 1LPKB 3KQEA 5DP5A 3STJA 4WMDA 2HLCA 1D3PB 1XVMA 2ZA5A 1TNLA 1F5RA 1ABIH 3FANA 4HFPB 1KMHB 2XBXA 1C1RA 1O3FA 3UNRA 3QLPH 4NWLA 4NIWA 5CE1A 3RXQA 5GNDA 5T6FA 3TGJE 1X7AC 3MYWA 1DY9A 4YT7H 4MPXA 3OYPA 4MNWA 2FOMB 1AY6H 1LQDB 6CHAB 1AWHB 1QRWA 4ZXYH 3G01A 2IOTA 1HFDA 4BXSA 5IDKA 1UVOA 1PPGE 1MU6B 4ABIA 3SNBA 5F8TA 4B71A 4Q7XA 1SG8B 3QGNB 2GCTB 2J34A 1W0KD 3N7DA 1GI2A 1QB6A 1FN8A 4FUEA 1UTNA 1DT2A 4HZHA 1IHSH 6GCHG 1GPZA 2A2XH 1BTUA 1O2QA 4IW4E 3MU4A 4OS2A 1BMNH 3QTOH 1YLDA 1NRQH 2J92A 1EJNA 1FPHH 1SFQB 1DITH 1C4Y2 1P05A 1O35A 2TGTA 1AE5A 4KTUA 4WVPE 1EB2A 1BMAA 3HK6B 4RT0A 5HKKD 4PROA 2UUKB 4Q80A 3SJKA 3TPIZ 2VWMA 2ZPRA 3KN2A 5E8EH 1HIAB 2J97A 1OX1A 4K1EA 4WH8A 2W7SA 2PLXA 2GCHG 1XUFA 1UCYE 2CHAB 2ZFRH 1UMAH 1MKXK 2NWNA 3M3VA 3LDXH 7GCHF 4DT7B 4I86A 3ZZ7A 3P70B 2BXTH 5LPFA 3LOXA 4YZUA 5C94A 3RP2A 4TY6A 3F0PA 3Q76A 3SYJA 2W3IA 4I8HA 1DWDH 3F9HA 1O3CA 3T27A 1QFKH 1RS0A 2BY6X 4MDSA 1A46H 1VZQH 2VIPA 5DJ7A 3SI4H 3M5MA 2VU8E 2AH4X 3ZZ4A 1C5NH 5FL7D 1IQEA 3FAOA 1AUTC 3MO6A 3RXEA 1MD7A 1L0ZA 1GGDC 1DWBH 1LPGB 5FXLA 1SOTA 3TU7H 3MMGA 4DOQA 1P2NA 1O2PA 1YPLH 1QQUA 1XVOA 3SBKA 2RCEA 1NROH 4Z6AH 1GMDG 3NWUA 3TJUA 3RLYH 1W14U 2GMTB 3MNBA 2PKSC 9ESTA 2DUCA 1ETSH 3LGYA 3IG6B 1GBKA 4Y10E 2W6ID 1T8NA 1M9UA 1YM0A 3L6PA 1NFYA 2QAAA 2VIDA 4H6TA 1G32B 1EKBB 3BTWE 1C5MD 2ZEBA 3T25A 1HJ8A 3SU6A 1L1NA 4UEHH 1L4DA 1DSUA 5C1XA 3F3BA 3TH4H 2GZ9A 3SNEA 1FPCH 3SNAA 2FS8A 1J8AA 2G00A 4GAWA 4X1NU 3AAVA 1Z8GA 3SGBE 1FY3A 3A84A 2BVXH 1HAIH 2O8MA 1BRCE 1MCTA 3LIWA 2WV4A 3PTBA 3PLPA 1BZXE 1ZYOA 3A8BA 5EG4A 3TK6A 4YO9A 1ANDA 1BTWA 2C8XB 3LGTA 4A1XA 1SGTA 2Y5GA 1ELGA 4ABGA 1WAYB 4JZFH 2FODA 2QCYA 4OM9A 3BF6H 4NIXA 2ZFSA 3KNXA 1WBGB 2EEKA 1OOKB 3TIUA 1IOEA 5T6GA 3SV7A 1GBMA 2TGPZ 8GCHG 1W2KH 2EI7A 1VR1H 1GBFA 1VJ9U 1BBRK 2XWBI 5HGGA 4NZLA 2V3MA 1TGBA 2C4FH 1MTVA 1SGIB 4Y79A 1ZPCA 1BQYA 1O5CB 1CA0B 4KKDA 5FAHA 2FS9A 5EJ1A 5TJXA 4IBLH 1QZ8A 4FU7A 2P8OC 5F8XA 1O3LA 2FPZA 4ZUHA 2BM2A 5EJLA 3PV2A 4B2AA 2VWOA 4F55A 2CMYA 2OC0A 2JETB 2AEIH 1BITA 2PTCE 1GI0A 1DOJA 5C67A 1SLWB 2BD2A 3GDVA 5GJ4B 2HVXA 1NM6A 3S7KB 2XCNA 2ZU3A 1F0UA 1ZJDA 2UWOA 5DP8A 1IQJA 1P57B 2BX3A 3VB6A 5HM2A 4DGJA 2A5KA 3LGVA 4ZXXH 1C2HA 3DT0H 4NIYA 1YPEH 6LPRA 2QV1A 1YYY1 4CREA 2VVUA 3SZEA 1L2EA 3RXRA 4X8TH 1QNJA 2GZ7A 3KIDU 1HXFH 4ISOA 3NPSA 1T8MA 1AU8A 4CRGA 1DXPA 1UJ1A 2BTCE 4A1TA 1NN6A 1GHVH 3GY5A 4E05H 3SORA 5C0UA 2FOEA 4AGJA 5JBTA 3AK5A 1O2MA 2PGQB 4U01A 1YLCA 2F9VA 1W0JD 1TNKA 2GV6A 2ZDVH 1OS8A 2ESTE 1LKBA 1QL9A 1UVSH 2XBWA 1UO6A 1AZ8A 1P3CA 3K2UA 1ZPZA 1O2JA 1TRNA 2ZHFH 4R8TB 1TRMA 1CT0E 1PPHE 3HGNA 4JYVH 2P59A 1AVGH 1C9PA 1DY8A 2P16A 3SQHE 2VGCC 4DT4A 2PUQH 2BD7A 5K0HA 3RU4D 4Q7ZA 1OWJA 4NA9H 2F83A
chains in the Genus database with same CATH topology
1HJAB 3PMJA 4JYUH 4Y8XA 2O9QA 1SL3A 2G51A 3TJNA 3S69A 1V2OT 4X0WU 1INCA 2H6MA 3E8LA 9LPRA 1NT1A 4CHAB 1ZGVA 3UPEA 4X2VA 1O3BA 4AFZA 1O5AB 4GCHG 2TPIZ 1F7ZA 1GJBB 1LCYA 5DPAA 5AVDA 1O3NA 4TYDA 1JWTA 1MD8A 3A81A 2G55A 3VB5A 3TGIE 2OC8A 1TIOA 1ZRKA 1G2MA 1MTNC 3GY2A 1JRSA 1MTWA 1HAGE 1MCVA 1HV7A 2XC4A 5E0JA 1TYNA 1L1GA 4Q2KA 3KL6A 1DFPA 3RXOA 2H9HA 3DUXH 3LT3A 3K6ZA 1J15A 2GT8A 1LVBA 2FZZA 4KGAA 4H4FA 2HWLB 3N7OA 5EQSA 1VCQA 4ESTE 1NU7B 2GCTC 1UK3A 1TNJA 3SO3A 3GCOA 1LVOA 2ZHQH 1ESTA 2GVFA 5DGJA 3ZVBA 1GI8B 1A2CH 1V2MT 4MNXA 2AYWA 2FOAA 4Y8ZA 4BTIB 1TGSZ 4JZIA 4BAMB 1ELFA 2BDHA 1Y3WA 3PB1E 1QB1A 1ANBA 5EXLA 4MTBA 3P6ZB 3RXGA 1P9SA 3MHWU 1DS2E 1GHBF 1AFEH 1ZHPA 1MKXH 2BMGB 4INKA 2GDEH 3JZ2B 2G81E 2NU1E 4ZKSU 1FY4A 1SGEE 1YPHE 5I46H 3A7ZA 3MU5A 1K1JA 4NSYA 3SHAH 4AFUA 1KDQA 2HRVA 2ZO3H 1J16A 1BRUP 4FUHA 1W10U 4JK5A 4YLUA 2PUXB 1YCPK 3ZZAA 5EQQA 5GDSH 2J4IA 4B2CA 2BOKA 3T29A 1DPOA 1Z71A 1DE7H 1GMCF 4UFDH 1Z6EA 2AS9A 3V0XA 1HRTH 1SFIA 2AGEX 3LJJA 1PYTD 1O34A 2C8ZB 4DY7B 3A85A 1TPAE 4OGYA 4OS4A 1K1PA 3D49H 1KXEA 4IGDA 3U8OH 3UWIA 4X8UH 1W8BH 4BNRA 4DJZB 5FPTA 1THSH 1SMFE 4B76A 1W13U 1GVZA 3NUMA 1CT2E 1ETRH 4LK4A 4Z0KA 3ZVDA 4X6NA 1MBMA 2OC7A 1ZSLA 1K2I1 1C5TA 2ALPA 2KAIA 1EUFA 4A1VA 4INLA 4FUCA 1GI5A 1ELDE 1O2IA 1AWFH 1TQ0B 3UNSA 4BANB 2C3SA 4D9QA 1A7SA 2H5CA 2QXGA 2B7DH 1SB1H 2PW8H 2WUBA 4B1TA 1C1OA 1F5KU 1IQMA 2JH5D 2ZTYA 4DVAU 1CGIE 3F68H 1EP5A 1G36A 1ESAA 2VIOA 1C5YB 1C2JA 1SLUB 1ID5H 2ZCHP 4Y8YA 5JDUB 1IQKA 2GT7A 1BOQA 4Y71A 2BHGA 1GCTB 2D2DA 2XCFA 1DICA 1HAZB 1ARCA 1IQHA 1AB9C 3RXCA 3A7TA 4VGCB 3SHCH 5BPEA 3BG4C 1B5GH 1O2LA 3S7HB 1EJAA 2ZI2H 3RLWH 3LGWA 1FJSA 3GY8A 3M36A 4FUIA 1F0RA 2IPHA 2OQUA 4MNYA 3SGAE 4IN2A 2D1JA 3AW1A 3H7TA 4M7GA 1HAYB 4X6MA 1KLTA 4AX9H 1JRTA 1QB9A 1C5OH 1E36B 1BBRH 2I6QA 3VXEH 3UR9A 4IS5A 3ZZ3A 1O3PB 2Q1JA 2FP7B 4D7FA 3TNSA 2BB4A 2ZDNA 1CSOE 1OWIA 2LIZA 3A7XA 2C90B 3OX7U 2EC9H 3E16B 1AFQB 5DO4H 1YPJH 1FY5A 4SGBE 2IJOB 2Y5FA 2R9PA 2Y6TA 3C1KA 3BEFB 2FMJA 3FFGA 1V2NT 4WY3A 3SJOA 5FHTA 1K1MA 5E2PA 1GVLA 2BDGA 3NXPA 1PQ5A 3BEUA 4FUGA 4F4OC 1K22H 1BJUA 1NRNH 3M35A 3A88A 1TFXA 2A5AA 2ZGJA 4Y0YE 5L2ZH 2QYIA 2BOHB 3SNCA 2BD3A 4OGXA 2AIPA 4X2WA 3A86A 1TOCB 3U1JB 3S0NA 3H5CB 3W94A 1S84A 1EZUC 1C2EA 1NO9H 3GY6A 2OBOA 2F9UA 1O5FH 1PPZA 1Y5UT 1KXBA 1NFXA 2ZF0H 1PPEE 3RC4A 1GHZA 1KXAA 2Z3DA 1GL1A 1WUNH 1Y3VA 1AE8H 1HNEE 3EGKH 3B9FH 1C1PA 3ZVCA 1SGFA 2R3UA 4YM9A 3QWCH 2FO9A 4Y7AA 2BDYA 3P17H 3SU1A 1A5IA 2EI6A 4ABAA 4FU8A 1FONA 4BAOB 1SQTA 3MU8A 2G8TA 4NA8A 1ZTLA 3SV6A 3HKJB 3EA7A 4K8BA 4XFQA 3P8FA 2ODPA 5LH8A 2ZQ2A 4UONA 1C5LH 2BD8A 1NZQH 3WY8A 4H42U 1K21H 1V2VT 3GISB 1ZSJA 2FOBA 1LPZB 4K1SA 5A09A 1SGCA 3SU5A 3QN7A 1UVPA 1KDQB 4AFQA 1K1OA 1CGHA 2XC0A 4ZHAA 1KY9A 3B23B 1AVXA 5EU8A 2AFQB 3KHVA 1VGCC 1O3GA 4CBNA 1VJAU 3FP7E 4OS7A 3U8TH 1KLJH 1HJAC 1QRZA 1SBWA 3HATH 1UK2A 4NG9H 1EXFA 1TX7A 5C5NA 1LHFH 1HLTH 4CHAC 1DUAA 1RIWB 1XUJA 3FVFB 1ARBA 3R0FA 2WPHS 1GCDA 1GBTA 2Z6BD 4IN1A 2B9LA 2XW9A 3MO9A 1BHXF 4RN6A 2FTMA 1SGRE 1WQSA 3STIA 4I7YH 3A8CA 2QA9E 2KAIB 1ABJH 2BXUH 2ZGXH 3BEIB 3TJOA 3IWMA 1MBQA 2TIOA 1OWDA 5F03A 1WV7H 3SNDA 1G9IE 1AHTH 1CHGA 1ANCA 3B8JA 3MU0A 1FIZA 4ZKOU 4ISIH 4X1QU 3EQ0H 2AGIX 5LGOA 4INHA 2I6SA 4ISHH 4K1TA 1GHYH 4NFEA 1WSSH 2WPJS 4CRFA 1ZR0A 1XUKA 1U6QA 1LKAA 1GJ9B 1MUEB 1S6HA 2B5TB 1TABE 1AQ7A 3E3TA 3RXUA 1HXEH 1V2UT 1P2KA 3PV4A 1K1LA 2STBE 4HTCH 2BQ6B 4NA7A 5C1UA 1D4PB 1CE5A 1E38B 3PROA 1ZGIA 1GBCA 5PTPA 1GG6B 1TB6H 1HAHH 3U8RH 1A3BH 1OYQA 5CHAB 1S0QA 1YCPH 4DURA 1Z6JH 1AO5A 2PKAA 4NFFA 2OXSA 1A0LA 4ABBA 1GBAA 2HPPH 1OKXA 1MTUA 1O3AA 2V3OH 2UWPA 1F5LA 2VINA 1HAVA 3AASA 4CR9A 3BTTE 1C5UA 3EA9A 1B0EA 1KXDA 2WYJA 1VCPA 1G2LA 3TLOA 1FAXA 1O37A 1DLEA 3ATIA 1MQ5A 2STAE 1TGTA 8LPRA 2ZTXA 1EOJA 3M37A 1C2KA 7KMEH 4TWWA 3OY6U 2VIVA 2GX4A 2G5NA 8ESTE 3RXBA 4D8NA 1LDTT 3BSQA 2PHBA 1HYLA 4MQAA 3RU4T 4BOHA 3PMAB 1HAPH 1BB0B 2RA3A 2P95A 2BLQA 2R0LA 4Y11E 3VXFH 3F9EA 2ZNKH 2YNAA 1UTLM 1WOFA 1ZHRA 4A92A 2G4TA 4OS1A 1SVPA 3I77A 5EODA 1TNIA 2Z9KA 1FXYA 1EZSC 1YCPM 1T32A 2HPQH 1EPTA 5EPYA 2OCVB 1TA6A 1SR5C 4YOJA 2O8WA 1B7XB 3C27B 2GTBA 1MZAA 3PO1B 3NKKA 1TGCA 1WTGH 1C5RA 1HDTH 3LU9B 1MU8B 4A6LA 4AG2A 3PMHB 5JB9S 4BTTB 5B6OA 2VVCA 4DCDA 2H9EH 4FXGH 2C93B 1NTPA 1O3MA 2ZQ1A 4WWYA 5GXPA 1UTMA 2A4GA 2BY8X 2PV9B 1DWEH 4B73A 2JH0D 1GHBG 1S82A 1HCGA 2QIQA 2F9NA 1DXWA 5DG6A 4GVUA 1C2LA 1EAXA 1YPHC 5H4IB 1VITH 2ZCLP 1XM1A 2FEQH 2VH0A 2XRCA 1O3KA 1YKTA 1V3XA 2GV7A 3E0NB 2ZFQH 1OP0A 1TAWA 1LTOA 3RXVA 4NZQA 2ZU1A 4ISNA 3ZZ6A 1O0DH 3TGKE 4GPGA 3ZVAA 3PLKA 3TVJB 1EJMA 1O3EA 3GCNA 1T8OA 2Z3CA 5C3NA 1D6WA 3ENSB 2JH6D 1CHOG 1C1MA 2WPKS 1C5QA 1HJ9A 2ZFPH 1AGJA 1V2ST 2SNVA 3TH3H 1C2FA 1GMCG 2A31A 2TGAA 3PM3A 1FZZA 1AFQC 1ACBE 2FOHA 3GY3A 2ZDLA 3GCHB 1DWCH 2FM2A 2FWWA 2QF3A 3CP7A 2Z7FE 4AORA 2A1DB 3R3GB 3MTYA 1DLKB 1GI6A 1EAIA 4GHTA 3ZZBA 5HM9A 2B0FA 3SU3A 1LHCH 2EI8A 1Y8TA 1ANEA 2A32A 3RXSA 1GJAB 3UOUA 2FOFA 1NFWA 1BRAA 3GCTF 3QX5H 1O36A 1O38A 2BDAA 1EZXC 5JBAS 3A89A 2UUFB 1K1IA 4Q7YA 3A82A 1A5HA 3Q77A 4X6PA 1QCPA 3CENA 1BHXB 3RMOH 2ZGHA 1E35B 2SGEE 3A7WA 5A0BA 1LVYA 1O3DA 3CS0A 5L2YH 4CRBA 3E6PH 4NIVA 1EAWA 1RRKA 2ZWLH 1OWEA 3BTDE 2K7XA 1C1TA 3SJIA 1RTFB 2SGQE 3T62A 1FY8E 4DG4A 2BLVA 1TBZH 4I8GA 2XWAA 3TH2H 2WUCA 2ZTZA 1ZHMA 1PPCE 1T4UH 2NU3E 2CV3A 5EW1H 1Y3XA 2VJ1A 1OWHA 3BG8A 2DE9A 2QGRA 4MVNA 3KQDA 5EPNA 1GBEA 2ANMH 1A3EH 2J9NA 2OD3B 3OTJE 4B74A 3ZZ8A 2AGGX 4H6SB 1SGQE 3BIUH 2C8YB 2Q6FA 3KQBA 1ELBA 1LHGH 1O2NA 1YF4A 2VIQA 2A5IA 2YOLA 1FUJA 3EE0B 1GBDA 1GWAA 2PKAB 3A83A 1YPGH 3RXPA 2ULLA 2VNTA 3GDUA 1Q31A 3LKWA 3BV9B 5L6NH 1S0RA 1SLVB 4SGAE 1ZPBA 5GPIB 3V12A 1K28D 2RDLA 2H2ZA 2XC5A 4K8YA 1P06A 3ATWA 1C4V2 1HAVB 2SGPE 3JZ1B 3SU0A 5EW2H 1RGQA 5DKMA 4AN7A 3SJ9A 3EDXB 3EBNA 4JZDH 2BDCA 6CHAC 3PWBA 1ELVA 1L4ZA 3GYLB 1NRRH 2ANWA 1YP9A 5J4QA 1UCYK 3BTFE 3UUZA 4DW2U 1A0JA 6ESTA 2ZFTA 2Z3EA 2FTLE 3D62A 5JBBS 1KTTB 5GCHF 4HI3A 2UUJB 3AAUA 2W5EA 3S9BA 4BAQB 4GUXA 3UFAA 1GJ8B 1QGFA 1EPTB 1SGFG 4WXIA 3T26A 1H9LB 1PPFE 1C1WH 3ZYDA 1IQGA 5JPMH 2W26A 1W7GH 2CF8H 3ZZCA 3GY4A 1C1UH 3RMNH 2ZPSA 1XUIA 3DFJA 3MI4A 1GBBA 1SGPE 3RXHA 4AG1A 1JMOH 2SFAA 3A8AA 3T2NA 1P09A 1P12E 1QHRB 2CHAC 1SPJA 3SOSA 4LZ4B 1GDUA 1NFUA 1BRBE 1G3EA 3U9AH 1SLXB 1CHOF 3MH7A 3PLBA 4J1YA 3ZYEA 3QUMP 5EGMA 1GBLA 1TWXB 2Y81A 2QC2A 3UTUH 1GG6C 1PQAA 2AMDA 5IYTA 4CH8B 2ZU5A 2SGAA 1BUIA 2A7HA 1GGDB 4ZHLU 1K1NA 3DD2H 1C5PA 1XUHA 3QK1A 3RC5A 1P8VC 1QTFA 4XE4A 2XXLA 2QN5T 4Y76A 3AVZA 2QXJA 4K69A 2ZKSA 1DDJA 4UDWH 5C5OA 3SUDA 1TX8A 1RFNA 2XYAA 1FLEE 2FESH 2PKSB 1SOZA 4A7IB 3U69H 4AOQA 1Z8RA 2HNTF 4B75A 1T31A 2P94A 2GMTC 1BMMH 4KELA 1LMWB 1FN6A 3SJ8A 1PPBH 1E34B 3F6UH 3GICB 4IMZA 5T3HA 2FDAA 1DVAH 1JBUH 4NGAH 1O2WA 2CF9H 1GMHG 1HBTH 4DIIH 1QQ4A 1TOMH 2A4RA 2FIRH 2CJIA 1FMGA 1N6XA 1ZLRA 4KTCA 4D7GA 1G3DA 1EB1H 4O9VA 3F9GA 1TRYA 1P2IA 2NU2E 2H9TH 2FXRA 4K60A 2BD4A 2ZP0H 3OY5U 5A0CA 5BRRE 2PSYA 1RD3B 2ZC9H 4CBOA 2NU0E 2XTTB 1ZMJA 3RM2H 1CT4E 3P92A 3U98H 1O2KA 1MKWK 2ZFFH 2AIQA 1TNGA 1QA7A 2RA0A 1GI3A 3UOPA 1S81A 1E37B 1N8OB 1IAUA 4ABDA 2OTVA 1S6FA 2AERH 1KXFA 3V7TA 5FBIA 1XKBC 1FNIA 1YBWA 1GJ5H 5E0GA 2ZPQA 1V6DA 2O8TA 3P8NA 2J94A 4UFEH 4B2BA 4YESB 1TPPA 3P8GA 2H5DA 2ZU2A 2GGVB 2HALA 2A7CA 3SV2H 1TBQH 1AVWA 2P8OB 3F1SB 1CA0C 1SGNE 4NWKA 1EX3A 4MG3A 3T28A 4XBBA 2BD9A 1O5BB 1NRSH 1BTHH 4I32A 4UE7H 2OC1A 2Z94A 2JETC 1AUJA 2BLOA 3Q3XA 3IITA 1J9CH 1EATA 3MNSA 3V13A 1W3CA 4WJG2 1BA8B 2G4UA 2V3HH 4CRCA 2O8UA 4XOJA 1EOLA 1JOUB 4FUJA 1SSXA 1BBRE 3K65B 3SV8A 2BDBA 3SQEE 3ITIA 4MLFB 4OS6A 3VGCB 4JMYA 3MH6A 1IQLA 2Y7XA 2W3KA 2WYGA 1AN1E 1S83A 2PFEA 2BZ6H 4AFSA 2EA3A 1A5GH 1OPHB 4X2YA 3PMBB 3ZZ9A 3E1XB 2HNTE 1QY6A 1XUGA 3DFLA 1UTJA 1BTXA 1F92A 1O2ZA 1ZOMA 1ESBA 1D9IA 1TBRH 5FX6A 2QXHA 5ETXA 3RXDA 2DE8A 4ZKNU 1Y59T 3ZV9A 3HPTB 4FUDA 5LPEA 1V2JT 2ZHEH 4YT6H 5DP9A 2J2UA 3T5FH 4E7NA