4YO9A

Hku4 3clpro unbound structure
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
molecule tags Hydrolase
total genus 84
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yo9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yo9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yo9A02
1XUIA 2FX6A 1QB9A 1QGFA 3GY7A 1ZYOA 4GCHF 4Y8XA 1ELVA 3BEFB 4BTIB 1SHHB 3UNQA 2Y5HA 5EW1H 1O2GH 2PUXB 1TFXA 3LGIA 1E37B 1TNIA 2WUBA 3Q00A 3EE0B 3OU0A 4Y6DA 3WY8A 1A1RA 3SNCA 3KCGH 2BXUH 3K6YA 4TPYA 4ABJA 1WQSA 2XC0A 3RM2H 1SGFA 1P2OA 1KXDA 3A7VA 1V2RT 3MH5A 1GHYH 2ZU3A 3SNDA 1EKBB 6CHAB 5DP9A 4AN7A 4AYYB 2Z6BD 5ESBA 1JXPA 1UVTH 1Y5BT 2ZIQH 4AOQA 3C1KA 2QXJA 3E3TA 3U9AH 1L0ZA 5AVDA 1QL8A 2BLVA 2HNTE 1W13U 1AFEH 2ZTYA 2ZG0H 1D3PB 1C5PA 1TOCB 1TBQH 1EQ9A 1XXDA 4FUBA 1KXEA 2G51A 3RXFA 1YKTA 1UK4A 1UVUH 2BM2A 4TPIZ 1C1WH 4X2VA 3TNTA 3NCLA 3P6ZB 3KHVA 5GJ4B 2FI5E 2H9TH 1NFWA 1O2TA 4ISLA 1GMHF 3GYMA 3ZZ4A 3ENSB 2K7XA 1C5MD 1Y3YA 5G4BA 3UWJH 4CHAC 2STBE 2C93B 4JYUH 1HLTH 4BAQB 2GDEH 1GWAA 3RXLA 4ABHA 1MKWH 2OC8A 2XTTB 3QO6A 3E90B 2THFB 3S7KB 3ZZ9A 4HGCA 1HAZB 3RU4D 1SG8B 2EA3A 4NIVA 3SV7A 2CN0H 2ALVA 1P2MA 2A32A 1O5EH 1S5SA 4WH6A 1XUKA 2FS8A 1SFIA 1QB1A 1O33A 3QDZB 3ZZ7A 1DSTA 3QUMP 3PWBA 3C27B 5C5OA 3RXKA 4ZUHA 2NU3E 3SHCH 1O2KA 2BD5A 1DXPA 1LVMA 1KXAA 2G5NA 2GVFA 2YNBA 2GZ7A 3VFEA 5CMXH 1BMAA 1EZSC 2AEIH 2YOLA 1G37A 1S0QA 1GMCF 1YC0A 3CENA 4Z0KA 3RXHA 1TPSA 1ZJKA 1B0FA 1IQMA 1Y3UA 2W5EA 4SGBE 1P02A 3LGVA 3RMNH 1ID5H 3PMBB 4U2WA 1DXWA 3UOUA 1L1JA 3N7OA 3UIRA 4BANB 3S9BA 1C5RA 2Z9JA 1ESTA 2WPKS 1TOMH 7LPRA 5A0BA 1KLJH 1F0SA 2ZQ2A 3SQEE 2O8MA 1GJDB 1T4UH 1FJSA 4CRDA 1O5GH 3PTBA 2R2WU 5EU8A 3U8RH 3SJOA 1MD8A 3PLBA 1TWXB 1EJAA 1CSOE 2ESTE 3TNSA 2BQ7B 2ODQA 1TMBH 3FAOA 5E0JA 4UE7H 4HFPB 2BYAX 5LH8A 4AFSA 4OS6A 3E91A 3GDVA 4X8UH 2J95A 3KGPA 3RMLH 3LDXH 1ETTH 4Y79A 4Q80A 3RP2A 2AFQB 2OCVB 3HKJB 1AD8H 3M3VA 2H9EH 1NM6A 2TGTA 4OS4A 4H6TA 5A8XA 3MTYA 4HI3A 1A2CH 1AQ7A 1PQ7A 5E2PA 1FXYA 3S9AA 2XCNA 4U32A 2VIVA 3IITA 4AZ2B 1ANDA 3BG8A 1A7SA 4WJG2 2Y7XA 4K8BA 1JMOH 1W10U 3B23B 3T5FH 2Z3EA 1ZTKA 3A8DA 1DY8A 1O3NA 1J17T 3HPTB 4OS2A 5L30H 1T7CA 2PWXA 2QGRA 3RLYH 1CBWB 4MNVA 1AE5A 1O3LA 1A0LA 2QXGA 4VGCC 1CQQA 1KSNA 2Z3CA 1W0YH 3T62A 1C2HA 4RSPA 2CV3A 2TRMA 3SGAE 4Y10E 4FVDA 4YLUA 2ZDNA 4K5ZA 1GI1A 1ZGVA 1GI8B 1EAWA 3QX5H 3V12A 1HAGE 4I8JA 1T4VH 2P3UB 2GX4A 1SI5H 1EJNA 3SJ9A 2BX3A 1W14U 1O0DH 2BZ6H 1FI8A 4CH2B 4JZ1A 1NRNH 1V2PT 4IN1A 1SLUB 3LH3A 3SJ8A 1BRAA 1IAUA 1XUHA 1OWKA 5FX6A 3ZV8A 5FBEA 1EZXC 1SL3A 1TPOA 4A5TS 3PV4A 1TBRH 3U1JB 1RGQA 2HNTC 4KGAA 4KTSA 2DE9A 5DP6A 5JB9S 2D1JA 1GJ9B 2BVRH 1DOJA 5HM9A 1QR3E 3FP7E 2BLOA 2UWOA 1V2VT 1DUAA 2WV5A 1EPTC 2FPZA 1O2XA 2AGEX 2ZEBA 2ZP0H 2ILNA 2A7CA 3EA9A 2GCTC 2BOHB 3GCNA 1YPJH 5C20A 1K22H 1TIOA 4ZKOU 5L2YH 2GZ9A 2VH6A 4F49A 1C5ZB 3RXBA 2STAE 4O3UA 1AVXA 3I78A 5DGJA 1NY22 3NK8A 1TYNA 1D9IA 3K2UA 3TK5A 2ZGHA 4NCYA 1DPOA 1C4V2 1HNEE 5A0CA 2FO9A 5JYIA 3M37A 1TPPA 2GKVE 3LJJA 2VWMA 1IQKA 1KY9A 3HKIB 1LPZB 3PO1C 2TIOA 1EP6A 2V35A 1T8NA 3EGKH 3F9EA 1GBMA 3A7YA 4JYTA 4TWYA 3LONA 3R0FA 1ZHPA 1C1RA 4YOJA 1MAYA 3PYHA 4ABDA 1CT4E 5A2MH 2BD9A 3M7TA 3RMOH 1C2JA 1OS8A 2VH0A 5TCCA 3RMMH 1TGSZ 1NRRH 2EC9H 2LPRA 2ZPQA 4NFEA 1TPAE 1LVBA 1Y3WA 2FOBA 1HBTH 1Y59T 1F2SE 1VGCB 2BDGA 1QIXB 4U30A 4WH8A 1SLWB 2H5DA 1PYTD 1OWHA 2OBOA 1GHZA 1V2WT 1O3JA 1MUEB 1VZQH 1MU6B 4LZ1H 2Z9GA 3M61U 5HYOA 4ABGA 4KTCA 1YPGH 1ELTA 3L6PA 1OWJA 1S81A 1TNGA 1VR1H 3JZ2B 3TGJE 1MTSA 2IJOB 2QF0A 2HPPH 3SU3A 1OKXA 4M7GA 1LDTT 1THSH 5DP8A 1T8LA 1YBWA 4CH8B 2FI4E 3RXJA 1K1NA 4DG4A 3F68H 1UTPA 2BLQA 1Q2WA 1EOJA 1MQ6A 5LPRA 2PGBB 1GI2A 2F91A 2F3CE 2ZGCA 3U98H 2AMQA 1W2KH 3A87A 4CRFA 1KLTA 2ZFFH 4A7IB 3M5LA 2J94A 2EI6A 3ZZBA 1HJAC 1JWTA 1O3GA 1T8MA 1UCYE 2G00A 2TGAA 1NU9A 1C1UH 1O5DH 1AFQC 2BTCE 5DKMA 4MPXA 1K21H 2XBYA 1TX7A 2Q6DA 4MNXA 1NU7B 4AB9A 1P2NA 2BY6X 1TRNA 1GJCB 2H6MA 1GBAA 1GCTC 1RTFB 2BD8A 2VNTA 1ELFA 3P95A 3DFJA 1SGEE 3ZVEA 2BZAA 2WPHS 1N1LA 3VPKA 5FHTA 3SU4A 2ZGBH 3SV6A 2FYQA 5TCAA 1UHBB 1W12U 2B0FA 1ANEA 2PTNA 1UHBA 3SUEA 2H2ZA 3H7TA 1SGYE 3A81A 4FUGA 4X1PU 4AB8A 3BTHE 3BG4B 1GI0A 1S82A 4NZLA 1P2KA 3M7UA 1LVYA 2OLGA 2QF3A 3LOXA 1WSSH 1SR5C 1OWDA 3A8CA 4QT8C 1PPBH 5GIBA 1MTWA 1TNHA 2H5CA 2ZWLH 3D62A 1TGNA 3OYPA 4YOGA 1K2I1 4MTBA 1UTOA 1CVWH 3VXFH 1C2LA 1MAXA 1D4PB 1ZMJA 1GI9B 4UONA 2AMDA 1UTLM 1ZJDA 1Z7KA 4D7GA 2H9HA 1QRWA 1SGTA 1O3CA 3PLKA 4YO9A 5DK1A 3SU5A 1TLDA 1BMLA 4XOJA 5FXLA 1AWHB 1DICA 4I8LA 5EODA 1FZZA 1LQDB 1D6RA 1O39A 2BY9X 4ZXYH 2WYGA 3GDUA 1XMNB 2BDAA 2GD4B 1CT0E 4INHA 1ZTLA 5T6DA 1FY3A 4A1XA 3NPSA 3VB3A 4ABAA 3S0NA 3VB5A 1ZHMA 2Y6TA 1AZZA 5AFYH 3RC5A 3SNBA 1TGBA 4DURA 2ZDVH 5TJXA 4ABBA 1F92A 2JKHA 2OTVA 1ETSH 2VWLA 3EDXB 2ZNKH 2HOBA 3RXQA 1A46H 2FXRA 3ZYEA 1C1VH 1AKSB 1BQYA 2LIZA 2FESH 7GCHG 1AKSA 4BXSA 1ZSKA 4DY7B 5GCHG 3A84A 2CMYA 1IQEA 1MKXH 3S7HB 3MMGA 1FDPA 4I33A 1AGJA 1SFQB 1P09A 1INCA 4CRGA 1F5KU 1AY6H 3QZRA 3KN2A 1YPMH 2UWPA 2C8YB 2P3TB 4K1TA 3QGNB 2A2QH 3PLPA 5HGGA 2YNAA 1FMGA 4NZQA 1TE0A 1A3EH 1DY9A 3H5CB 3MU5A 3HGPA 1GBIA 6ESTA 1YCPH 2VU8E 1IOEA 1CA0B 1LPGB 2OC1A 2LNCA 2WINI 4X6PA 4JZIA 1BUIA 2ANYA 1O3FA 4Y8ZA 3RXSA 1G9IE 1FN6A 1FY4A 1K1OA 3E1XB 3FFGA 1O2RA 2VINA 5EPYA 3PB1E 4WMDA 1GJAB 2FX4A 1ARCA 1P3EA 1JIMA 3A7ZA 3UY9A 1WUNH 3SI4H 1A0JA 3SZNA 3SUDA 1MTNC 3LGTA 2G55A 4BTUB 5C1UA 2RCEA 4TWWA 1QTFA 4GUXA 1AB9C 9ESTA 3A7WA 1GI4A 2Y80A 1SGNE 4I31A 2ZGXH 5DP3A 1RFNA 1YPHE 1ELGA 7GCHF 1QBVH 1P2JA 1QJ6B 3H7OA 2EI7A 4J2YB 5GCHF 4XBBA 4ZKNU 2C8ZB 6GCHG 2XRCA 2HPQH 3P8NA 3Q76A 1DE7H 1SGPE 1WYKA 4DCDA 1PPZA 1GDQA 2FWWA 1SLXB 1UO6A 4WXVA 2NWNA 2JH0D 4X1QU 3NWUA 4UFDH 2RA3A 2O8TA 1MQ5A 1V3XA 1GMHG 3M7QA 2A5KA 2SGFE 1C5QA 3G01A 2D2DA 2TGPZ 4ZH8A 3RXTA 1UK3A 2HNTF 4ZHLU 4K8YA 1Z1IA 1W11U 2Z9LA 4TYDA 1G3EA 2FYRA 4NSVA 4I8HA 2XYAA 1O3HA 3UQOA 3HATH 1GG6C 2VB0A 3GCHB 3OTJE 1QRZA 3BTTE 1W0ZU 1QY6A 1V2OT 2WPJS 2GMTC 4KELA 4D76A 1ZPZA 3FANA 1KXCA 1HJ8A 3QZQA 4IC5A 1GVKB 1BZXE 2CXVA 2W3IA 3BIVH 3TPIZ 3MO6A 1GMCG 3QTOH 1GBCA 1QB6A 1O2PA 4UFFH 1ZZZA 1E36B 6GCHF 1NS3A 2A0QB 1ABJH 3ATIA 1HAPH 3HGNA 1UMAH 1BITA 1N8OC 3E0NB 4YESB 3SNEA 1Y5AT 1BTWA 3SQHE 3BV9B 1D3DB 4R8TB 1GGDC 1GBJA 1IQLA 1WOFA 1LTOA 2VGCC 1P11E 3TIUA 1EAXA 3SU6A 1S84A 4JYVH 1O3AA 2Q6GA 3GCOA 1WTHD 4CBNA 1G3BA 4DVAU 1LHDH 1DWDH 3JZ1B 3RXRA 5F8TA 1CHGA 1PQAA 2JETC 2AIQA 1RD3B 1G30B 3S69A 2VWNA 2UUFB 1O2HA 4Y0ZE 1EZQA 1HFDA 3NKKA 3A8BA 5EW2H 2AMPA 2ANMH 3BEUA 1CGIE 1VITG 1CGJE 3RU4E 5ABWA 3Q77A 1C2IA 2ZU1A 3RXUA 1TNJA 1EXFA 1ZMNA 2BDIA 4UDWH 5C1YA 2FMJA 3URDA 1GVLA 1LQEA 4DIHH 4X6MA 1JBUH 4Q7XA 2FTMA 3K6ZA 2DUCA 2ZA5A 4UD9H 1C1TA 1O5BB 4K2YA 3VGCB 4FU8A 3QTVH 1Y5UT 5FPTA 4HTCH 2ZHWH 5EPNA 1O3EA 3SUGA 4A92A 3GY4A 3RXDA 4MVNA 2O8WA 2PTCE 4YZUA 2ZQ1A 3GY5A 5CHAB 3SORA 2F9NA 4ABEA 1EATA 3PMHB 2P8OB 1C2MA 4IGDA 2NU4E 3ATLA 1OXGA 1OWEA 3TJUA 3K9XB 3M5OA 2GV7A 1QL9A 4K3JA 1A5HA 1AIXH 3T26A 3TU7H 4E06H 1YPHC 1DUEA 1MZDA 1VITF 4XFQA 1O30A 2QYIA 3LGYA 1ABIH 1O31A 4AGKA 1ZHRA 1J8AA 5FAHA 3P8FA 1IQJA 4CR9A 1EUFA 2ZCHP 5C1XA 2BX4A 2BXTH 1XUFA 3SUFA 1PPHE 3OY6U 5E8EH 5JPMH 1DANH 1BRBE 2BD2A 3KQEA 4J1YA 2BQWB 5BPEA 3A88A 1MCVA 4FUEA 1RIWB 2F9OA 2ZFPH 3B8JA 4WY3A 4OS1A 1C1SA 3GYLB 4PROA 1E35B 1RTKA 2A4QA 4YM9A 2VWOA 4NFFA 5C67A 1L4DA 4NGAH 1UK2A 1V2TT 4Y8YA 2C3SA 1EX3A 3RXMA 1HJ9A 1LCYA 1HAYB 1X7AC 3M5MA 3O8BA 1ACBE 3SU1A 3ZVAA 2CF8H 1QCPA 2FZZA 1V2UT 5JBAS 1P0SH 1QJ1B 3SJKA 3RC4A 2J34A 2BDYA 1GBTA 3BG4C 2WYJA 1C5NH 4CRAA 5K7RA 2Q6FA 2BY7X 2A1DB 4RN6A 1LO6A 1FPHH 2RA0A 3LT3A 3M3TA 2ZFSA 4BOHA 1U6QA 1O5CB 1DITH 5FX5A 1O34A 1UTKA 1S6HA 2ZHQH 3MWIU 1DM4B 1C5UA 1DWCH 1TX6A 4GAWA 1V2JT 4MG3A 4WXIA 1TA6A 1WTGH 1C1PA 3IG6B 5JB8S 2FM2A 2CF9H 1GL1A 4LOYH 1D3QB 1YM0A 1O37A 2VIPA 3NUMA 1GHWH 2QY0B 2ZO3H 1MD7A 1L1NA 1UTNA 2PKSC 4GHTA 3UFAA 4B73A 2EI8A 4FUFA 4AG2A 1KXBA 2QN5T 1GHAF 1XVMA 3ZVFA 4CHAB 4ISNA 4CR5A 5C5NA 7ESTE 1P05A 1G3DA 1UVOA 2ZFQH 3ELAH 1Q3XA 1VCPA 2OQUA 2HGTH 2NU0E 1G36A 3QK1A 5DG6A 1E0FD 1EP5A 1QBOA 2OBQA 2BVSH 3MHWU 3P17H 1T8OA 2QAAA 4X1NU 1NZQH 1SHYA 3AVZA 1ESAA 1PJPA 1Q31A 1O2WA 2K1QA 1KDQB 1VITH 1O36A 1Z8GA 1BTUA 1KDQA 1ZPCA 2ZU2A 5PTPA 1PPFE 3T28A 4CBOA 1SGDE 2XBXA 1SC8U 1CA0C 1L1GA 4FUCA 1CGHA 2PSYA 4ABIA 5A8YA 1Z6EA 3SBKA 1FY5A 4KP0A 1QJ7B 3MI4A 3KIDU 1HYLA 1EB2A 1ELDE 1O3KA 1IHSH 3STIA 2O8UA 1O2MA 4B71A 2W26A 3ESTA 1NRPH 4CREA 3RDZA 3MNCA 5AHGH 3RXIA 1A61H 2VIDA 4WVPE 1O2YA 2ZCLP 2I6SA 1SBWA 1IQHA 1HXFH 1WQVH 3BTME 1Z8JB 1C9TA 8ESTE 1Z8IB 3E8LA 3TGIE 4Y76A 1AU8A 2F9PA 3FZZA 1GJ4H 1PFXC 4H42U 2M5TA 1LVOA 4ZHAA 1GI6A 1JIRA 1FAXA 1A5GH 2P95A 1Y3XA 3QN7A 1K1JA 2D26C 3SOSA 3QLPH 2FOCA 1V2ST 2AH4X 2BD4A 3I77A 3TLOA 2AGGX 1H9IE 1S6FA 1BJUA 4ZMAH 5LPEA 1P01A 5JBTA 1XKAC 3RC6A 1FPCH 1K28D 2JH5D 2CJIA 2RDLA 1YLCA 4AFZA 1P9SA 4O9VA 1FONA 1HXEH 2TPIZ 5BRRE 1P9UA 1OWIA 4VGCB 3MU0A 1HAOH 3OY5U 4B75A 1EJMA 5EG4A 2SNWA 3RUOA 3ZZAA 1GJBB 4AFQA 3D23A 4WWYA 4D7FA 1ETRH 2R2MB 1AVWA 2QV1A 2V3OH 1LHGH 1GJ5H 2BY5X 1C5LH 2ZU4A 4H4FA 1O5FH 4YT6H 4LK4A 2PHBA 3UWIA 1HAVB 1O2SA 1TQ7B 6CHAC 5J4SA 4TY7A 1HAVA 4O97A 2IN2A 3SO3A 4LXBH 5JBBS 2FOAA 1XX9A 2GT8A 5EXLA 2ODPA 1BTYA 1ZSLA 1TNKA 4Y11E 1O2UA 1XKBC 2OQ5A 3PMJA 4H6SB 4X6NA 1ELCA 2ZECA 1OP2A 1MMJN 3SU0A 4THNH 4IN2A 2J92A 3PROA 1K1MA 4AYVB 1PPCE 2BD3A 1TRMA 1AE8H 3CS7A 1JRTA 1O2NA 1WU1A 3ZZ8A 2FOFA 2ULLA 2WV4A 1ESBA 4IMZA 1EPTB 1K9OE 2Z94A 4X2YA 1YF4A 1EPTA 1UCYK 1RTLA 1C4Y2 4GVUA 2OP9A 1DDJA 2XWBI 5IYTA 2GCTB 3TH4H 4BAKB 2UUKB 3LGUA 5IDKA 4FUHA 4XBDA 1C5VA 4ISOA 3P8GA 3SV2H 2PSXA 1C5XB 1SOZA 2GP9B 3O8RA 1UJ1A 1Y8TA 3MYWA 2J38A 4B2AA 2V6NA 4DJZB 5J4QA 2OD3B 2A31A 3ZVBA 1SSXA 1THPB 3OX7U 4X8TH 1NT1A 2CGAA 3LC5A 4BAOB 1MKXK 1BBRH 1HUTH 1FNIA 2OUAA 4X6OA 4Q7YA 3PO1B 4FUIA 2G4UA 1VJ9U 3F9FA 3TJNA 1Z71A 2GCHF 5AFZH 1H9HE 1XUGA 3MH7A 4GSOA 3ODFA 3E16B 4I8KA 4U01A 1BDAA 1YYY1 2GDDA 2QXHA 3ZYDA 7KMEH 1C9PA 3ATKA 1XXFA 1OPHB 1YCPK 3ODDA 3RXOA 2ZDAH 2ANKH 4INLA 1UTMA 3A7XA 4JK5A 5T3HA 1QA7A 1FV9A 4GHQA 1TQ0B 2QA9E 4NIYA 4WF8A 5AF9H 4BAMB 1E34B 1LKAA 3KNXA 2QC2A 4IW4E 2ZF0H 1N6XA 2PFEA 1W8BH 1ZRKA 3U8TH 2SGQE 3GY6A 2VIQA 1TBZH 1C2EA 1F0UA 1SGQE 3AW0A 2JH6D 1O3DA 4DOQA 3AW1A 3VEQB 1PYTC 5CHAC 3ZVCA 4Q2KA 2G4TA 1GMDF 4IS5A 2A7JA 4K60A 3URCA 2VJ1A 3F9GA 1OP8A 3BEIB 1CE5A 2AGIX 1NTPA 2GGVB 3EYDA 2TGDA 3VXEH 1C1NA 2Q1JA 5FPYA 1A4WH 1FY1A 3DHKH 1O2LA 3SV9A 3RXVA 4OGYA 1BTZA 4BTTB 3SU2A 1GHXH 1J15A 2PV9B 2FOGA 2OC7A 1RXPA 2CHAB 1TABE 3A85A 4NA8A 2HVXA 2AIPA 4MPUA 4TY6A 2VIOA 1AZ8A 4ISIH 1QFKH 2P93A 2ZGJA 3A89A 2PUQH 4DT7B 1HAHH 2H1UA 2G8TA 4E05H 3FVFB 3RXCA 1AFQB 3DA9B 1CBWC 5F6MA 3RXPA 1QNJA 3D65E 3F1SB 2AERH 3L33A 5LPFA 4NSYA 1GCTB 1HB0B 4E7NA 3QGJA 2SGPE 1ARBA 2WPIS 1QL7A 3UOPA 1O2JA 4X8SH 3RM0H 1GBFA 1H8IH 1DX5M 3W94A 1FIZA 3M3SA 4K1EA 4WMFA 3ZZ3A 1ZSJA 1IQIA 1ORFA 5H4IB 1O2VA 2Y82A 2FLBH 4JZFH 4B1TA 2ZTXA 3MFJA 3SGQE 1VJAU 2FTLE 2C4FH 2HLCA 2FODA 1UVSH 2SNVA 3UNSA 1A0HB 4JCNA 2R0LA 1DWBH 1QA0A 1OSSA 1XVOA 1KYNA 3KQCA 5JBCS 2ZTZA 1O3PB 2ZDMA 1MTVA 2V3HH 1NFUA 2GTBA 3Q3KA 4ABFA 1H9LB 3M36A 4ZHMU 1MCTA 3CS0A 1UTJA 1ANBA 2AS9A 1WCZA 3T27A 1V2LT 3GISB 1QQUA 1PPEE 2KAIB 1N6YA 1JOUB 2KAIA 3ZZ6A 1DLKB 4SGAE 3L3TA 3BTDE 3BTWE 4BNRA 1AWFH 1MKWK 1QBNA 1YP9A 3TGKE 3U69H 1C5YB 2XC5A 1GJ6A 1GBKA 4ZKRU 2FOHA 3A80A 3RXAA 4JZDH 1O2QA 1Z1JA 3VB7A 2BDCA 4MQAA 4ZXXH 2ZU5A 1S85A 2R3YA 1DSUA 4OS5A 5L6NH 2C8XB 2VIWA 1VCWA 1V2QT 2ZI2H 1GHVH 1F0RA 1SGFG 1MTUA 1P8VC 1O2IA 1KLIH 1M9UA 4DW2U 4FUDA 3T2NA 5B6OA 1LHEH 1BHXF 1TAWA 1J14A 4BAHB 4Y0YE 1HV7A 3DFLA 1ANCA 3SI3H 2XC4A 3BTKE 2Z3DA 3W95A 5GWZA 1C5SA 2SGEE 1BCUH 3RXEA 2P59A 4JK6A 3FP6E 2ZDKA 1AI8H 3LKWA 3IWMA 2XWAA 3BTFE 3Q3XA 1D3TB 1XUJA 4RKOB 4NWKA 4ZKSU 4GLYA 2UUJB 3B9FH 1VGCC 1C2FA 3K65B 4NIWA 4O3TA 1DFPA 4AX9H 3DT0H 1BJVA 2Y5GA 3A82A 4IBLH 4K69A 4I8GA 4YT7H 5EGMA 3KQBA 3RXGA 1GPZA 1UTQA 1HIAB 3R3GB 1HIAA 2NU2E 1F5LA 3ZVGA 1K1IA 1SGIB 2SGAA 1MTNB 2B7DH 1VCQA 3GOVB 1BIOA 1EAIA 2GT7A 1W7GH 1AN1E 1O3MA 3GY3A 3MOCA 1G2LA 2UUYA 1AB9B 1GBEA 1CO7E 5EQRA 5FCKA 1BB0B 1O3IA 5FPSA 2B5TB 3E6PH 1NRQH 2Y81A 2ZFRH 4HZHA 5L2ZH 1H8DH 1TMUH 1ZMLA 2BDHA 1J16A 3TK6A 2ZPSA 4E7RG 1ELEE 1BRUP 1O2ZA 2BLWA 2Y7ZA 1F0TA 2ZHDA 3S9CA 1SQTA 1DT2A 2ZHEH 3GDSA 3LU9B 3UTUH 2IOTA 1AHTH 1NESE 3GCTG 4CRBA 2WPMS 1GHAG 1O2OA 4JMYA 4NA7A 3HK3B 3U1IB 1FN8A 3MH6A 1AUTC 1QHRB 1O3BA 1C1QA 3GY2A 2EEKA 1P06A 1P2IA 2ZHFH 1BA8B 2B9LA 4MDSA 2HALA 1UVPA 1ZRBA 5A8ZA 1PPGE 1B0EA 5E2OA 3LH1A 2PR3A 1OOKB 1IQFA 1AVGH 4AGJA 1GVZA 3EQ0H 1GG6B 2A5IA 2FIRH 2QIQA 3ATWA 3LPRA 2GMTB 3QWCH 1QQ4A 4FXGH 4YLQH 3T25A 1RRKA 3SJIA 1WV7H 4UFGH 3P92A 2PLXA 1O38A 1W3CA 1ZOMA 4NIXA 5F8ZA 5EOKA 1EZUC 3ZZ5A 5HXFA 1HDTH 1NN6A 1LPKB 1Y3VA 3SW2B 3SNAA 1DVAH 3TH3H 1WBGB 1P04A 5SGAE 5GXPA 1IHTH 1KTTB 1YPEH 1AUJA 1FY8E 1GI7B 1KXFA 8LPRA 4X2XA 4AORA 1P3CA 1SLVB 1MZAA 1T32A 4B76A 1T31A 4FVBA 1MU8B 1NRSH 1GBHA 1N8OB 1NFXA 1SQOA 2OC0A 1MH0A 3UUZA 1Z6JH 3BTEE 3V7TA 3ATMA 4AFUA 1D6WA 4KKDA 1GGDB 4B2CA 3GCTF 2PW8H 4DIIH 2VGCB 1DLEA 3MH4A 2F83A 2A4RA 2ZKSA 3BIUH 1O3OA 3LC3A 2F9BH 3STJA 3TJOA 3UR6A 3HK6B 1S83A 2G52A 4BXWA 3SHAH 1ZR0A 1YPLH 2DE8A 1BRCE 2A5AA 1V6DA 1MBMA 4ZAEA 1P2QA 4UEHH 2JETB 3DUXH 5I25A 1B7XB 1P57B 3ZVDA 2XXLA 1CU1A 4A1VA 2D8WA 3E0PB 5DJ7A 3BSQA 4ISHH 3FZDA 3LIWA 3SN8A 2O8LA 2R3UA 2FS9A 1ELAA 2PKAB 2PKAA 1K1LA 1A5IA 2PGQB 1W7XH 2FI3E 2VVCA 3TJVA 1LHCH 3GY8A 4X1SU 5E0GA 3O8CA 1V2MT 1YLDA 3MNBA 1OX1A 2J9NA 2G81E 2C90B 5GPIB 1FIWA 3Q3YA 3EA7A 1GI5A 1THRH 4FU9A 3RU4T 3KL6A 1K1PA 2P94A 1NROH 1HRTH 4IMQA 1GDNA 1SPJA 3RLWH 3PTNA 2A2XH 2Y5FA 4X0WU 1NPMA 4MNWA 3BTGE 2XCFA 1H4WA 3A8AA 3TH2H 2R9PA 2HWLB 4FUJA 1P10A 3MU1A 4O03A 4LZ4B 1FLEE 3A86A 5T6FA 4Q7ZA 3D49H 1TA2A 3MNSA 3UREA 3M35A 5A0AE 1L2EA 3UNRA 2VVVA 1OP0A 1FQ3A 1IQGA 1GBBA 1DS2E 1SOTA 1ZPBA 3MU8A 5F03A 5F8XA 1ZLRA 2NU1E 1GCDA 1RJXB 5CE1A 3U8OH 1FAKH 3VB6A 2XNIA 4NWLA 2FLRH 5ESTE 3V0XA 1ELBA 3V13A 1F7ZA 1Z8RA 5EXNA 1J9CH 4UFEH 2FOMB 3P70B 5DPAA 1EB1H 2CHAC 1G2MA 1SMFE 2BHGA 4ZROA 1G32B 1TRYA 3AASA 1TGTA 3SGBE 1TMTH 3F9HA 2V0BA 4YOIA 1G3CA 2QCYA 1V2KT 2SFAA 4B2BA 2GZ8A 2ASUB 1PQ5A 3M5NA 4X1RU 3MO3A 4Y7AA 2Z9IA 3TK9A 1BT7A 1O32A 4Y7BA 2P16A 2A7HA 1ZTJA 2F9UA 3CP7A 1TNLA 1C1OA 3NXPA 1SB1H 1HCGA 3BTQE 3LGWA 1BTHH 1BBRE 1C1MA 5ETXA 2QXIA 1NFYA 3GCHC 3OSYA 1GDUA 1F5RA 2XBWA 4D9RA 1OYTH 3ZZCA 2C8WB 1TONA 3UQVA 3AAVA 2ZDLA 1CA8B 2ZZUH 3GICB 1LHFH 1NC6A 3EBNA 1EOLA 3A7TA 3TVJB 4D8NA 1FUJA 1GJ8B 5HMAA 2A45B 2BY8X 1GHBG 5T6GA 2ZC9H 4I7YH 3UPEA 3BN9A 1H1BA 1PQ8A 2O9QA 2TBSA 5K0HA 2GCHG 1BTXA 3EA8A 4YTAA 2WUCA 2XBVA 1C2KA 2BD7A 3NZIA 1C5TA 4Y71A 5EXMA 4XE4A 3A83A 5EQQA 5FBIA 4XSKU 1SVPA 2ODYB 2P3FH 2FP7B 3F6UH 1IQNA 5A09A 3MO9A 1QRXA 2OXSA 2Z7FE 3ZZDA 2J2UA 3PMAB 1HPGA 4MPVA 2WPLS 4INKA 1WAYB 4X2WA 4ESTE 5JDUB 2ZPRA 1GI3A 2RG3A 2F9VA 1C2GA 1KTSB 4B74A 3T29A 1E38B 1GMDG 4D9QA 1BOQA 4OS7A 1CHOG 2W7SA 3V3MA 1TX8A 1C5WB 8KME2 4R0IA 1EAUA 3ITIA 1UCYH 2PKSB 4CRCA 1NO9H 4A6LA 1XM1A 1GJ7B 3DD2H 2UWLA 5HM2A 5DP5A 1SGCA 1LKBA 3MNXA 1HAIH 4XDEA 5EQSA 1L4ZA 1SGRE 1BBRK 5DP4A 1GHBF 8GCHG 5LGOA 1SQAA 1OYQA 4KTUA 3UR9A 4F4OC 2BOKA 4X8VH 5DP7A 1C4U2 4A1TA 1DWEH 1GBLA 1JRSA 2VVUA 2BQ6B 4MPWA 3PWCA 2IPHA 2ZCKP 1CT2E 1QURH 2BDBA 4ASHA 1BTPA 3VGCC 1EASA 1C5OH 1MBQA 2FOEA 2BB4A 4IC6A 1TGCA 2ALPA 3MU4A 1HGTH 1O35A 4I32A 2B8OH 2GV6A 4XBCA 2SGDE 3KEEA 4GCHG 4MNYA 2W3KA 4Z6AH 3SV8A 1LMWB 2FEQH 1BMMH 4NA9H 5GDSH 2ZFTA 4NG9H 5C2ZA 1AO5A 3I29A 2J4IA 1GBDA 2I6QA 2FDAA 2P8OC 1CHOF 3KF2A 4RKJB 4GPGA 1TALA 1P12E 3O8DA 1V2NT 1YCPM 2XW9A 2HRVA 1P03A 3AAUA 2R0KA 1BHXB 4AG1A 1TB6H 5I46H 3PM3A 4K1SA 2A4GA 2BVXH 4MLFB 1AMHA 1ZGIA 2A4OA 3EAJA 1KIGH 9LPRA 2G5VA 5E0HA 1O5AB 3ZV9A 1RS0A 5C3NA 2AYWA 3P8OA 2W7UA 4DGJA 8GCHF 2Z9KA 1C2DA 1YGCH 6LPRA 2ANWA 4WMEA 3VB4A 1HJAB 1HAXB 1RIWC 4FU7A 4JZEH 2BMGB 3TITA 1A3BH 5FCRA 1YPKH 3KQDA 3LJOA 1BMNH 3BF6H 3FP8E 1S0RA 4OGXA 5DO4H 1GL0E 1B5GH 2OINA
chains in the Genus database with same CATH superfamily
1XUIA 2FX6A 1QB9A 1QGFA 3GY7A 1ZYOA 4GCHF 4Y8XA 1ELVA 3BEFB 2QF5A 4BTIB 1SHHB 3UNQA 2Y5HA 5EJZA 5EW1H 1O2GH 2PUXB 3KQ5A 1TFXA 2W6ID 3LGIA 1E37B 1TNIA 2WUBA 3Q00A 3EE0B 3OU0A 4Y6DA 3WY8A 1A1RA 3SNCA 3KCGH 2BXUH 3K6YA 4TPYA 4ABJA 1WQSA 2XC0A 3RM2H 1SGFA 1P2OA 1KXDA 3WWBA 3A7VA 1V2RT 3MH5A 1GHYH 2ZU3A 3SNDA 1EKBB 6CHAB 5DP9A 4AN7A 4AYYB 2Z6BD 5ESBA 1K0HA 1JXPA 1UVTH 1Y5BT 2ZIQH 4AOQA 1MABB 3C1KA 2QXJA 3E3TA 3U9AH 1L0ZA 5AVDA 1QL8A 2BLVA 2HNTE 1W13U 1AFEH 2ZTYA 2ZG0H 1D3PB 1C5PA 1TOCB 1TBQH 1EQ9A 1XXDA 4FUBA 1KXEA 2G51A 3RXFA 1YKTA 1UK4A 2RDEA 1UVUH 2BM2A 4TPIZ 1C1WH 4X2VA 3TNTA 3NCLA 3P6ZB 3KHVA 5GJ4B 2FI5E 2H9TH 1NFWA 1O2TA 4ISLA 1GMHF 3GYMA 3ZZ4A 3ENSB 2K7XA 1C5MD 1Y3YA 5G4BA 3UWJH 4CHAC 2STBE 2C93B 4JYUH 1HLTH 4BAQB 2GDEH 1GWAA 3RXLA 4ABHA 1MKWH 1W0KD 2OC8A 2XTTB 3QO6A 3E90B 2THFB 3S7KB 3ZZ9A 4HGCA 1HAZB 3RU4D 1SG8B 2EA3A 4NIVA 3SV7A 2CN0H 2ALVA 1P2MA 2A32A 1O5EH 1S5SA 4WH6A 1XUKA 2FS8A 1SFIA 1QB1A 1O33A 3QDZB 3ZZ7A 1DSTA 3QUMP 3PWBA 3C27B 5C5OA 3RXKA 4ZUHA 2NU3E 3SHCH 1O2KA 2BD5A 1DXPA 1LVMA 1KXAA 2G5NA 2GVFA 2YNBA 2GZ7A 3VFEA 5CMXH 1BMAA 1EZSC 2AEIH 2YOLA 1G37A 1S0QA 1GMCF 1YC0A 3CENA 4Z0KA 3RXHA 1TPSA 1ZJKA 5FL7D 1B0FA 1IQMA 1Y3UA 2W5EA 4SGBE 1P02A 3LGVA 3RMNH 1ID5H 3PMBB 4U2WA 1DXWA 3UOUA 1L1JA 3N7OA 3UIRA 4BANB 3S9BA 1C5RA 2Z9JA 1ESTA 2WPKS 1TOMH 7LPRA 5A0BA 1KLJH 1F0SA 2ZQ2A 3SQEE 2O8MA 1GJDB 1T4UH 1FJSA 4CRDA 1O5GH 5EJ1A 3PTBA 2R2WU 5EU8A 3U8RH 3SJOA 1MD8A 3PLBA 1TWXB 2KR7A 1EJAA 1CSOE 2ESTE 3TNSA 2BQ7B 2ODQA 1TMBH 3FAOA 5E0JA 4UE7H 4HFPB 2BYAX 5LH8A 4AFSA 4OS6A 3E91A 3GDVA 4X8UH 2J95A 3KGPA 3RMLH 3LDXH 1ETTH 4Y79A 4Q80A 3RP2A 2AFQB 2OCVB 3HKJB 1AD8H 3M3VA 2H9EH 1NM6A 2TGTA 4OS4A 4H6TA 5A8XA 1S6LA 3MTYA 4HI3A 1A2CH 1AQ7A 1PQ7A 5E2PA 1FXYA 3S9AA 2XCNA 3OEED 4U32A 2VIVA 3IITA 4AZ2B 1ANDA 3BG8A 1A7SA 1FX0B 4WJG2 2Y7XA 4K8BA 1JMOH 1W10U 2WHXA 3B23B 3T5FH 2Z3EA 1ZTKA 3A8DA 1DY8A 1O3NA 2HVYB 1J17T 3HPTB 4OS2A 5L30H 1T7CA 2PWXA 2QGRA 3RLYH 1CBWB 4MNVA 1AE5A 1O3LA 1A0LA 2QXGA 4VGCC 1CQQA 1KSNA 2Z3CA 1W0YH 3T62A 1C2HA 4RSPA 2CV3A 2TRMA 3SGAE 4XD7D 4Y10E 4FVDA 4YLUA 2ZDNA 4K5ZA 1GI1A 1ZGVA 1GI8B 1EAWA 3QX5H 3V12A 1HAGE 4I8JA 1T4VH 2P3UB 2KFWA 2GX4A 1SI5H 1EJNA 3SJ9A 2BX3A 1W14U 1O0DH 2BZ6H 1FI8A 4CH2B 4JZ1A 1NRNH 1V2PT 4IN1A 1SLUB 3LH3A 3SJ8A 1BRAA 1IAUA 1XUHA 1OWKA 5FX6A 3ZV8A 5FBEA 1EZXC 1SL3A 1TPOA 4A5TS 3PV4A 1TBRH 3U1JB 1RGQA 2HNTC 4KGAA 4KTSA 2DE9A 5DP6A 5JB9S 2D1JA 1GJ9B 2BVRH 3FOAA 1DOJA 5HM9A 1QR3E 3FP7E 2BLOA 2UWOA 1V2VT 1DUAA 2WV5A 1EPTC 2FPZA 1O2XA 2AGEX 2ZEBA 3PV2A 2ZP0H 2ILNA 2A7CA 3EA9A 2GCTC 2BOHB 3GCNA 1YPJH 5C20A 1K22H 1TIOA 4ZKOU 5L2YH 2GZ9A 2VH6A 4F49A 1C5ZB 3RXBA 2STAE 4O3UA 1AVXA 3I78A 5DGJA 4TSFD 1NY22 3NK8A 1TYNA 1D9IA 3K2UA 3TK5A 2ZGHA 4NCYA 2IJD1 1DPOA 1C4V2 1HNEE 4Z1MD 5A0CA 2FO9A 5JYIA 3M37A 1TPPA 2GKVE 3LJJA 2VWMA 1IQKA 1KY9A 3HKIB 1LPZB 3PO1C 1COWD 1EP6A 2TIOA 2V35A 1T8NA 1BMFD 3EGKH 3F9EA 1GBMA 4F55A 3A7YA 4JYTA 4TWYA 3LONA 3NRLA 3R0FA 1ZHPA 1C1RA 4YOJA 1MAYA 3PYHA 4ABDA 1CT4E 5A2MH 2BD9A 3M7TA 3RMOH 1C2JA 1OS8A 4TT3D 2VH0A 5TCCA 3RMMH 1TGSZ 1NRRH 2EC9H 2LPRA 2ZPQA 4NFEA 1TPAE 1LVBA 1Y3WA 2FOBA 1HBTH 1Y59T 1F2SE 1VGCB 2BDGA 1QIXB 4U30A 4WH8A 1SLWB 2H5DA 1PYTD 1OWHA 2OBOA 1GHZA 1V2WT 1O3JA 1MUEB 1VZQH 1MU6B 2V3MA 2Z9GA 4LZ1H 3M61U 5HYOA 4ABGA 4KTCA 1YPGH 1ELTA 3L6PA 1OWJA 1S81A 1TNGA 1VR1H 3JZ2B 3TGJE 1MTSA 2IJOB 2QF0A 2HPPH 3SU3A 1OKXA 4M7GA 1LDTT 1THSH 5DP8A 1T8LA 1YBWA 4CH8B 2FI4E 3RXJA 1K1NA 4DG4A 3F68H 1UTPA 2BLQA 1Q2WA 1EOJA 1MQ6A 4HG6A 2PGBB 5LPRA 1GI2A 2F91A 2F3CE 2ZGCA 3U98H 2AMQA 1W2KH 3A87A 4CRFA 1KLTA 2ZFFH 4A7IB 3M5LA 2J94A 2EI6A 3ZZBA 1HJAC 1JWTA 1O3GA 1T8MA 1UCYE 2G00A 2TGAA 1NU9A 1C1UH 1O5DH 1AFQC 2YMSB 2BTCE 5DKMA 4MPXA 1K21H 2XBYA 1TX7A 2Q6DA 4MNXA 1NU7B 4AB9A 1P2NA 2BY6X 1TRNA 1GJCB 1RTFB 1GBAA 1GCTC 2H6MA 2BD8A 2VNTA 1ELFA 3P95A 3DFJA 1SGEE 3ZVEA 2BZAA 2WPHS 1N1LA 2LP6A 3VPKA 5FHTA 3SU4A 2ZGBH 5HIYA 3SV6A 2FYQA 5TCAA 1UHBB 1W12U 2B0FA 1ANEA 2PTNA 1UHBA 3SUEA 2H2ZA 3H7TA 1SGYE 3A81A 4FUGA 4X1PU 4AB8A 3BTHE 3BG4B 1GI0A 1S82A 4NZLA 1P2KA 3M7UA 1LVYA 2OLGA 2QF3A 3LOXA 1WSSH 1SR5C 1OWDA 3A8CA 4QT8C 1PPBH 5GIBA 1MTWA 1TNHA 2H5CA 2ZWLH 3D62A 1TGNA 3OYPA 4YOGA 1K2I1 4MTBA 1UTOA 1CVWH 3VXFH 1C2LA 1MAXA 2K0QA 1D4PB 1ZMJA 1GI9B 5B6LA 4UONA 2AMDA 1UTLM 1ZJDA 1Z7KA 4D7GA 2H9HA 1QRWA 2LELA 1SGTA 3N7DA 1O3CA 3PLKA 4YO9A 5DK1A 3SU5A 2GJGA 1TLDA 1BMLA 4XOJA 5FXLA 1AWHB 1DICA 3GS9A 4I8LA 5EODA 1FZZA 1LQDB 1D6RA 1O39A 2BY9X 4ZXYH 2WYGA 3GDUA 1XMNB 2BDAA 2GD4B 1CT0E 4INHA 1ZTLA 5T6DA 1FY3A 4A1XA 3NPSA 3VB3A 4ABAA 3S0NA 3VB5A 1ZHMA 2Y6TA 1AZZA 5AFYH 3RC5A 3SNBA 1TGBA 4DURA 2ZDVH 5TJXA 4ABBA 1F92A 2JKHA 2OTVA 1ETSH 2VWLA 3EDXB 2ZNKH 2HOBA 3RXQA 1A46H 2FXRA 3ZYEA 1C1VH 1AKSB 1BQYA 2LIZA 2FESH 7GCHG 1AKSA 4BXSA 1ZSKA 4DY7B 5GCHG 3A84A 2CMYA 1IQEA 1MKXH 3S7HB 3MMGA 1FDPA 5EIYA 4I33A 1AGJA 1SFQB 1P09A 1INCA 4CRGA 3SZEA 1F5KU 1AY6H 3QZRA 3KN2A 1YPMH 2UWPA 2C8YB 2P3TB 4K1TA 3QGNB 2A2QH 3PLPA 5HGGA 2YNAA 1FMGA 4NZQA 1TE0A 1A3EH 1DY9A 3H5CB 3MU5A 3HGPA 1GBIA 6ESTA 1YCPH 2VU8E 1IOEA 1CA0B 1LPGB 2OC1A 2LNCA 2WINI 4X6PA 4JZIA 1BUIA 2ANYA 1O3FA 4Y8ZA 3RXSA 1G9IE 1FN6A 1FY4A 1K1OA 3E1XB 3FFGA 1O2RA 2VINA 5EPYA 3PB1E 4WMDA 1GJAB 2FX4A 1ARCA 1P3EA 1JIMA 3A7ZA 3UY9A 1WUNH 3SI4H 1A0JA 3SZNA 3SUDA 1MTNC 3UB0A 3MQKC 3LGTA 2G55A 4BTUB 5C1UA 2RCEA 4TWWA 1QTFA 4GUXA 1AB9C 9ESTA 3A7WA 1GI4A 2Y80A 1SGNE 4I31A 2ZGXH 5DP3A 1RFNA 1YPHE 1ELGA 7GCHF 1QBVH 1P2JA 1QJ6B 3H7OA 2EI7A 4J2YB 5GCHF 4XBBA 4ZKNU 2C8ZB 6GCHG 2XRCA 2HPQH 3P8NA 3Q76A 1DE7H 1SGPE 1WYKA 4DCDA 1PPZA 1GDQA 2FWWA 1SLXB 1UO6A 4WXVA 2NWNA 2JH0D 4X1QU 3NWUA 4UFDH 2RA3A 3DCLA 2O8TA 1E1RD 1MQ5A 1V3XA 1GMHG 3M7QA 2A5KA 2SGFE 4Q4LA 1C5QA 3G01A 2D2DA 2TGPZ 4ZH8A 3RXTA 1UK3A 2HNTF 4ZHLU 4K8YA 1Z1IA 1W11U 2Z9LA 4TYDA 1G3EA 2FYRA 4NSVA 4I8HA 2XYAA 5KECA 1O3HA 3UQOA 3HATH 3F2FA 1GG6C 2F4LA 2VB0A 3GCHB 3OTJE 1QRZA 3BTTE 3ZIAD 1W0ZU 1QY6A 1V2OT 2WPJS 2GMTC 4KELA 4D76A 1ZPZA 3FANA 1KXCA 1HJ8A 3OEHD 3QZQA 4IC5A 1GVKB 2JJ1D 1BZXE 2CXVA 2W3IA 3BIVH 3TPIZ 3MO6A 1GMCG 3QTOH 1GBCA 1QB6A 3DSOA 1O2PA 4UFFH 1ZZZA 1E36B 6GCHF 1NS3A 2A0QB 1ABJH 3ATIA 1HAPH 3HGNA 1UMAH 1BITA 1VKYA 1N8OC 3E0NB 4YESB 5DSFA 3SNEA 1Y5AT 1BTWA 3SQHE 3BV9B 1D3DB 4R8TB 1GGDC 1GBJA 1IQLA 1WOFA 1LTOA 2VGCC 1P11E 3TIUA 1EAXA 3SU6A 1S84A 4JYVH 1O3AA 2Q6GA 3GCOA 1WTHD 4CBNA 1G3BA 4DVAU 1LHDH 1DWDH 3JZ1B 3RXRA 5F8TA 1CHGA 1PQAA 2JETC 2AIQA 1RD3B 3F0PA 2OK5A 1G30B 3FN8A 3S69A 2WV9A 2VWNA 2UUFB 1O2HA 4Y0ZE 1EZQA 1HFDA 3NKKA 3A8BA 5EW2H 2AMPA 2ANMH 3BEUA 1CGIE 1VITG 1CGJE 3RU4E 5ABWA 3Q77A 4FOUC 1C2IA 2ZU1A 3RXUA 1TNJA 1EXFA 1ZMNA 2BDIA 4UDWH 5C1YA 2FMJA 3URDA 1GVLA 1LQEA 4DIHH 4X6MA 1JBUH 5DN6D 4Q7XA 2FTMA 3K6ZA 2DUCA 2ZA5A 3F0OA 4UD9H 1C1TA 1O5BB 4K2YA 4ASUD 3VGCB 3DSPA 4FU8A 3QTVH 1Y5UT 5FPTA 4HTCH 2ZHWH 5EPNA 1O3EA 3SUGA 4A92A 3GY4A 3RXDA 4MVNA 2WSSD 2O8WA 2PTCE 4YZUA 2ZQ1A 3GY5A 5CHAB 3SORA 2F9NA 4ABEA 1EATA 3PMHB 2P8OB 1C2MA 4IGDA 2KM0A 2NU4E 3ATLA 1OXGA 1OWEA 3TJUA 3K9XB 3M5OA 2GV7A 1QL9A 4K3JA 1A5HA 1AIXH 3T26A 3TU7H 4E06H 1YPHC 1DUEA 1MZDA 1VITF 4XFQA 1O30A 2QYIA 2VBCA 3LGYA 1ABIH 1O31A 4AGKA 1ZHRA 1J8AA 5FAHA 3P8FA 1IQJA 3FKSD 4CR9A 1EUFA 2ZCHP 5C1XA 2BX4A 2BXTH 5KEDA 1XUFA 3SUFA 1PPHE 3OY6U 5E8EH 5JPMH 1DANH 1BRBE 2BD2A 3KQEA 4J1YA 2BQWB 5BPEA 3A88A 1MCVA 4FUEA 1RIWB 2F9OA 2ZFPH 3B8JA 4WY3A 4OS1A 1C1SA 3GYLB 2YMSC 4PROA 1E35B 1RTKA 2A4QA 4YM9A 2VWOA 4NFFA 5C67A 1L4DA 4NGAH 1UK2A 2JDID 1V2TT 4Y8YA 2C3SA 1EX3A 3RXMA 1HJ9A 1LCYA 1HAYB 1X7AC 3M5MA 3O8BA 1ACBE 3SU1A 3ZVAA 2CF8H 1QCPA 2FZZA 1V2UT 5JBAS 1P0SH 1SKYE 1QJ1B 3SJKA 3RC4A 2J34A 3PRDA 2BDYA 1GBTA 3BG4C 2WYJA 1C5NH 4CRAA 5K7RA 2Q6FA 2BY7X 2A1DB 4RN6A 1LO6A 1FPHH 2RA0A 3LT3A 3M3TA 2ZFSA 4BOHA 1U6QA 1O5CB 4B6EA 1DITH 5FX5A 1O34A 1UTKA 1S6HA 2ZHQH 5F53A 3MWIU 1DM4B 1C5UA 1DWCH 1TX6A 4GAWA 1V2JT 4MG3A 4WXIA 1TA6A 1WTGH 1C1PA 3IG6B 5JB8S 2FM2A 2CF9H 1GL1A 4LOYH 1D3QB 1YM0A 2RFKC 1O37A 1UW7A 2VIPA 3NUMA 1GHWH 2QY0B 2ZO3H 1MD7A 1L1NA 1UTNA 2PKSC 4GHTA 3UFAA 4B73A 2EI8A 4FUFA 4AG2A 1KXBA 2QN5T 1GHAF 1XVMA 3ZVFA 4CHAB 4ISNA 4CR5A 5C5NA 7ESTE 1P05A 1G3DA 1UVOA 2ZFQH 3ELAH 1Q3XA 1VCPA 2OQUA 2J98B 2HGTH 2NU0E 3OFND 1G36A 2J98A 3QK1A 5DG6A 1E0FD 1EP5A 1QBOA 2OBQA 2QF4A 3PRBA 2BVSH 3MHWU 3P17H 2KCPA 1T8OA 2QAAA 4X1NU 1NZQH 1SHYA 3AVZA 1ESAA 2V7QD 1PJPA 1Q31A 1O2WA 2K1QA 3AK5A 1KDQB 1VITH 1O36A 1Z8GA 1BTUA 1KDQA 1ZPCA 2ZU2A 5PTPA 1PPFE 3T28A 4CBOA 1SGDE 2XBXA 1SC8U 1CA0C 1L1GA 4FUCA 1CGHA 2PSYA 4ABIA 5A8YA 1Z6EA 3SBKA 1FY5A 4KP0A 1QJ7B 3MI4A 3KIDU 1HYLA 1EB2A 1ELDE 1O3KA 1IHSH 3STIA 2O8UA 5HKKD 1O2MA 4B71A 2W26A 3ESTA 2WZQA 1NRPH 4CREA 3RDZA 3MNCA 5AHGH 3RXIA 1A61H 1SQRA 2VIDA 4WVPE 4P02A 1O2YA 2ZCLP 2I6SA 1SBWA 1IQHA 1HXFH 1WQVH 3BTME 1Z8JB 1C9TA 8ESTE 1Z8IB 3E8LA 3TGIE 4Y76A 1AU8A 2F9PA 3FZZA 1GJ4H 1PFXC 4H42U 2M5TA 1LVOA 4ZHAA 1GI6A 1JIRA 1FAXA 1A5GH 2P95A 1Y3XA 3QN7A 1K1JA 2D26C 3SOSA 3QLPH 2FOCA 1V2ST 2W6JD 2AH4X 2BD4A 3I77A 3TLOA 2AGGX 1H9IE 1S6FA 1BJUA 4ZMAH 5LPEA 1P01A 5JBTA 1XKAC 3RC6A 1FPCH 1K28D 2JH5D 2CJIA 2RDLA 2L6OA 1YLCA 4AFZA 1P9SA 1KMHB 4O9VA 1FONA 1HXEH 2TPIZ 5BRRE 1P9UA 1OWIA 4VGCB 3MU0A 1HAOH 3OY5U 4B75A 4ZCNA 1EJMA 5EG4A 2SNWA 3RUOA 3ZZAA 1GJBB 4AFQA 3D23A 4WWYA 2WPDD 4D7FA 1ETRH 2R2MB 1AVWA 2QV1A 2V3OH 3F2GA 1LHGH 1GJ5H 2CK3D 2BY5X 1C5LH 2ZU4A 4H4FA 1O5FH 4YT6H 4LK4A 2PHBA 3UWIA 1HAVB 1O2SA 1TQ7B 6CHAC 5J4SA 4TY7A 1HAVA 4O97A 2IN2A 3SO3A 4LXBH 5JBBS 3WW7A 2FOAA 1XX9A 2GT8A 5EXLA 2ODPA 1BTYA 1ZSLA 1TNKA 4Y11E 1O2UA 1XKBC 3SYJA 3FO8D 2OQ5A 3PMJA 4H6SB 4X6NA 1ELCA 2ZECA 1OP2A 4P00A 1MMJN 3SU0A 2PP6A 4THNH 4IN2A 2J92A 3PROA 1K1MA 4AYVB 1PPCE 2BD3A 1TRMA 1AE8H 3CS7A 1JRTA 1O2NA 1WU1A 3ZZ8A 2FOFA 2ULLA 2WV4A 1ESBA 1W0JD 4IMZA 1EPTB 1K9OE 2Z94A 2KCYA 4X2YA 1YF4A 1EPTA 1UCYK 1RTLA 1C4Y2 4GVUA 2OP9A 1DDJA 2XWBI 5IYTA 2GCTB 3TH4H 4BAKB 2UUKB 3LGUA 1E1QD 4FUHA 5IDKA 4XBDA 1C5VA 4ISOA 3P8GA 3SV2H 2PSXA 1C5XB 1SOZA 2GP9B 3O8RA 1UJ1A 1Y8TA 3MYWA 4XRNA 4DT4A 2J38A 4B2AA 2V6NA 4DJZB 5C0UA 5J4QA 2OD3B 5KGOA 2A31A 3ZVBA 1SSXA 1THPB 3OX7U 4X8TH 1NT1A 4Q63A 2CGAA 3LC5A 4BAOB 1MKXK 1BBRH 1HUTH 1FNIA 2OUAA 4X6OA 4Q7YA 3PO1B 4FUIA 2G4UA 1VJ9U 3F9FA 3TJNA 1Z71A 2GCHF 5AFZH 1H9HE 1XUGA 3MH7A 4GSOA 3ODFA 3E16B 4I8KA 4U01A 1BDAA 1YYY1 2GDDA 2QXHA 3ZYDA 7KMEH 1C9PA 3ATKA 1XXFA 1OPHB 1YCPK 3ODDA 3RXOA 2ZDAH 2ANKH 4INLA 1UTMA 3A7XA 4JK5A 5T3HA 1QA7A 1NBMD 1FV9A 4GHQA 1TQ0B 2QA9E 4NIYA 4WF8A 5AF9H 2EQNA 4BAMB 1E34B 1LKAA 3KNXA 2QC2A 4IW4E 2ZF0H 1N6XA 2PFEA 1W8BH 1ZRKA 3U8TH 2SGQE 3GY6A 2VIQA 1TBZH 1C2EA 1F0UA 1SGQE 3AW0A 2JH6D 1O3DA 4DOQA 3AW1A 3VEQB 1PYTC 5CHAC 3ZVCA 4Q2KA 2G4TA 1GMDF 4IS5A 2A7JA 4K60A 3URCA 3N7EA 2VJ1A 3F9GA 1OP8A 2KCAA 3BEIB 2J97A 1CE5A 2AGIX 1NTPA 2GGVB 3EYDA 2TGDA 3VXEH 1C1NA 2Q1JA 5FPYA 1A4WH 1FY1A 3DHKH 1O2LA 3SV9A 3RXVA 4OGYA 1BTZA 4BTTB 3SU2A 1GHXH 1J15A 2PV9B 2FOGA 2OC7A 1RXPA 2CHAB 1TABE 3A85A 4NA8A 2HVXA 2AIPA 4MPUA 4TY6A 3VG8A 2VIOA 1AZ8A 4ISIH 1QFKH 2P93A 2ZGJA 3A89A 2PUQH 5HIZA 4DT7B 1HAHH 2H1UA 2G8TA 4E05H 3FVFB 3RXCA 1AFQB 3DA9B 5IK2D 1CBWC 5F6MA 3RXPA 5EJLA 1QNJA 3D65E 3F1SB 2AERH 3L33A 5LPFA 4NSYA 1GCTB 3WWFA 1HB0B 1OHHD 4E7NA 3QGJA 2SGPE 1ARBA 2WPIS 1QL7A 3UOPA 1O2JA 4X8SH 3RM0H 1GBFA 1H8IH 1DX5M 3W94A 1FIZA 3M3SA 4K1EA 4WMFA 3ZZ3A 1ZSJA 1IQIA 1ORFA 3KYGA 5H4IB 1O2VA 2Y82A 2FLBH 4JZFH 4B1TA 2ZTXA 3MFJA 3SGQE 1VJAU 2FTLE 2C4FH 2HLCA 2FODA 1UVSH 2SNVA 3UNSA 1A0HB 4JCNA 2R0LA 1DWBH 1QA0A 1OSSA 1XVOA 1KYNA 3KQCA 5JBCS 2ZTZA 1O3PB 2ZDMA 1MTVA 2V3HH 1WDIA 1NFUA 2GTBA 3Q3KA 4ABFA 1H9LB 3M36A 4ZHMU 1MCTA 3CS0A 1UTJA 1ANBA 2AS9A 1WCZA 3T27A 1V2LT 3GISB 4YXWD 5C94A 1H8ED 1QQUA 1PPEE 2KAIB 1N6YA 1JOUB 1QZ8A 2KAIA 3ZZ6A 1DLKB 4SGAE 3L3TA 3BTDE 3BTWE 4BNRA 1AWFH 1MKWK 1QBNA 3DSGA 1YP9A 3TGKE 3U69H 1C5YB 2XC5A 3OTPA 1GJ6A 1GBKA 4ZKRU 1H8HD 2FOHA 3A80A 3RXAA 4JZDH 1O2QA 1Z1JA 3VB7A 2BDCA 4MQAA 4ZXXH 2ZU5A 1S85A 2R3YA 1DSUA 4OS5A 5L6NH 2C8XB 2VIWA 1VCWA 1V2QT 2ZI2H 1GHVH 1F0RA 1SGFG 1MTUA 1P8VC 1O2IA 1KLIH 1M9UA 4DW2U 4FUDA 3T2NA 5B6OA 1LHEH 1BHXF 1TAWA 1J14A 4RT0A 4BAHB 2AHME 4Y0YE 1HV7A 3DFLA 1ANCA 3SI3H 2XC4A 3BTKE 2Z3DA 3W95A 5GWZA 1C5SA 2SGEE 1BCUH 3RXEA 2P59A 4JK6A 3FP6E 2ZDKA 1AI8H 3LKWA 3IWMA 2XWAA 3BTFE 3Q3XA 1D3TB 2M2AA 1XUJA 4RKOB 4NWKA 4ZKSU 4GLYA 2UUJB 3B9FH 1VGCC 3U28C 1C2FA 3K65B 4NIWA 2QE7D 4O3TA 1DFPA 4AX9H 3DT0H 1BJVA 2Y5GA 3A82A 4IBLH 4K69A 4I8GA 4YT7H 5EGMA 3KQBA 3RXGA 1GPZA 1UTQA 1HIAB 4OM9A 3R3GB 1HIAA 2NU2E 1F5LA 3ZVGA 1K1IA 1SGIB 2SGAA 1MTNB 2B7DH 1VCQA 3GOVB 1BIOA 1EAIA 4AC9A 2GT7A 1W7GH 1AN1E 1O3MA 3GY3A 3MOCA 1G2LA 2UUYA 1AB9B 1GBEA 1CO7E 5EQRA 5FCKA 1BB0B 1O3IA 5FPSA 2B5TB 3E6PH 1NRQH 2Y81A 2ZFRH 4HZHA 5L2ZH 1H8DH 1TMUH 1ZMLA 2BDHA 1J16A 3TK6A 2ZPSA 4E7RG 1ELEE 1BRUP 1O2ZA 2BLWA 2Y7ZA 1F0TA 2ZHDA 3S9CA 1SQTA 1DT2A 2ZHEH 3GDSA 4ACAA 3LU9B 3UTUH 2IOTA 1AHTH 1NESE 3GCTG 4CRBA 2WPMS 1GHAG 1O2OA 4JMYA 4NA7A 3HK3B 3U1IB 1FN8A 3MH6A 1AUTC 1QHRB 1O3BA 1C1QA 3GY2A 3UAIC 2EEKA 1P06A 1P2IA 2ZHFH 1BA8B 2B9LA 4MDSA 2HALA 1UVPA 1ZRBA 5A8ZA 1PPGE 1B0EA 5E2OA 3LH1A 2PR3A 1OOKB 1IQFA 1AVGH 4AGJA 1GVZA 3EQ0H 1GG6B 2A5IA 2FIRH 2QIQA 3ATWA 3LPRA 2GMTB 3QWCH 1QQ4A 4FXGH 4YLQH 3T25A 3N99A 1RRKA 3SJIA 1WV7H 4UFGH 3P92A 2PLXA 4M9FA 4B6FA 1O38A 1W3CA 1ZOMA 4NIXA 5F8ZA 5EOKA 1EZUC 3ZZ5A 5HXFA 1HDTH 1NN6A 1LPKB 1Y3VA 3SW2B 3SNAA 1DVAH 2F43B 3TH3H 1YWUA 1WBGB 1P04A 5SGAE 5GXPA 1IHTH 1KTTB 1YPEH 1AUJA 1FY8E 1GI7B 1KXFA 8LPRA 4X2XA 4AORA 1P3CA 1SLVB 1MZAA 1T32A 4B76A 1T31A 4FVBA 1MU8B 1NRSH 1GBHA 1N8OB 1NFXA 1SQOA 2OC0A 1MH0A 3UUZA 1Z6JH 3BTEE 3V7TA 3ATMA 2K8IA 4AFUA 1D6WA 4KKDA 1GGDB 4B2CA 3GCTF 2PW8H 4DIIH 2VGCB 1DLEA 3MH4A 2F83A 2A4RA 2ZKSA 3BIUH 1O3OA 1YY3A 2F9BH 3LC3A 3STJA 3TJOA 3UR6A 3HK6B 1S83A 2G52A 4BXWA 3SHAH 1ZR0A 1YPLH 2DE8A 1BRCE 2A5AA 2JIZD 1V6DA 1MBMA 4ZAEA 1P2QA 4UEHH 2JETB 3DUXH 5I25A 1B7XB 1P57B 3ZVDA 2XXLA 1CU1A 4I86A 4A1VA 2D8WA 3E0PB 5DJ7A 3BSQA 2EY4C 4ISHH 3FZDA 3LIWA 3SN8A 2O8LA 2R3UA 2FS9A 1ELAA 2PKAB 2PKAA 1K1LA 1A5IA 2PGQB 1W7XH 2FI3E 2VVCA 3TJVA 1LHCH 3GY8A 4X1SU 5E0GA 3PV5A 1V2MT 1YLDA 3O8CA 3MNBA 1OX1A 2J9NA 2G81E 2C90B 2HLDD 5GPIB 1FIWA 3Q3YA 3EA7A 1GI5A 1THRH 4FU9A 3RU4T 3KL6A 1K1PA 2P94A 1NROH 2KCOA 1HRTH 4IMQA 1GDNA 1SPJA 3RLWH 3PTNA 2A2XH 2Y5FA 4X0WU 1NPMA 4MNWA 3BTGE 2XCFA 1H4WA 3A8AA 5T1VA 1E79D 3TH2H 2R9PA 2XOKD 2HWLB 4FUJA 1P10A 3MU1A 4O03A 4LZ4B 1FLEE 3A86A 5T6FA 5C17A 4Q7ZA 3D49H 1TA2A 3MNSA 3UREA 3CNRA 3M35A 5A0AE 1L2EA 3UNRA 2VVVA 1OP0A 1FQ3A 1IQGA 1GBBA 4ACBA 1DS2E 1SOTA 1ZPBA 3MU8A 5F03A 5F8XA 1ZLRA 2NU1E 1GCDA 1RJXB 5CE1A 3U8OH 1FAKH 3VB6A 2XNIA 4NWLA 2FLRH 5ESTE 3V0XA 1ELBA 3V13A 1F7ZA 1Z8RA 5EXNA 1J9CH 4UFEH 2FOMB 3P70B 5DPAA 1EB1H 2CHAC 1G2MA 1SMFE 2BHGA 4ZROA 1G32B 1TRYA 3AASA 1TGTA 3SGBE 1TMTH 3F9HA 1EFRD 2V0BA 4YOIA 1G3CA 2QCYA 1V2KT 2SFAA 4B2BA 2GZ8A 2ASUB 1PQ5A 3M5NA 4X1RU 3MO3A 4Y7AA 2Z9IA 3TK9A 1BT7A 1O32A 4Y7BA 2P16A 2A7HA 1ZTJA 2F9UA 3CP7A 1TNLA 1C1OA 2KX4A 3NXPA 1SB1H 1HCGA 3BTQE 3LGWA 1BTHH 1BBRE 2KZ4A 1C1MA 5ETXA 2QXIA 1NFYA 3GCHC 3OSYA 1GDUA 1F5RA 2XBWA 4D9RA 1OYTH 3ZZCA 2C8WB 1TONA 3UQVA 3AAVA 2ZDLA 5CDFE 1CA8B 2ZZUH 3GICB 1LHFH 1NC6A 3EBNA 1EOLA 3A7TA 3TVJB 4D8NA 1FUJA 1GJ8B 5HMAA 2A45B 2BY8X 1GHBG 5T6GA 2ZC9H 4I7YH 3UPEA 3BN9A 1H1BA 1PQ8A 2IPQX 2O9QA 2TBSA 5K0HA 2GCHG 1BTXA 3EA8A 4YTAA 2WUCA 2XBVA 1C2KA 2BD7A 3NZIA 1C5TA 4Y71A 5EXMA 2XNDD 4XE4A 3A83A 5EQQA 5FBIA 4XSKU 1SVPA 2ODYB 2P3FH 2FP7B 3F6UH 1IQNA 5A09A 3MO9A 1QRXA 2OXSA 2Z7FE 3ZZDA 2J2UA 3PMAB 1HPGA 4MPVA 2WPLS 4INKA 1WAYB 4X2WA 2L74A 4ESTE 5JDUB 2ZPRA 1GI3A 2RG3A 2F9VA 1C2GA 1KTSB 2J5UA 4B74A 3T29A 1E38B 1GMDG 4D9QA 1BOQA 4RT1A 4RI0A 4OS7A 1CHOG 2W7SA 3V3MA 1TX8A 5CHBA 1C5WB 8KME2 4R0IA 1EAUA 3ITIA 1UCYH 2PKSB 4CRCA 1NO9H 4A6LA 1XM1A 3F2HA 2JJ2D 1GJ7B 3DD2H 2UWLA 5HM2A 5DP5A 1SGCA 1LKBA 3MNXA 1HAIH 4XDEA 5EQSA 1L4ZA 1SGRE 1BBRK 5DP4A 1GHBF 8GCHG 5LGOA 1SQAA 1OYQA 4KTUA 3UR9A 4F4OC 2BOKA 4X8VH 5DP7A 1C4U2 4A1TA 1DWEH 1GBLA 1JRSA 2VVUA 2BQ6B 4MPWA 3PWCA 2IPHA 2ZCKP 1CT2E 1QURH 2BDBA 4ASHA 1BTPA 3VGCC 1EASA 1C5OH 1MBQA 2FOEA 2BB4A 4IC6A 1TGCA 2ALPA 3MU4A 1HGTH 1O35A 4I32A 2B8OH 2GV6A 3F3BA 4XBCA 3EE7A 2SGDE 3KEEA 4GCHG 4MNYA 2W3KA 3W1EA 4Z6AH 3SV8A 1LMWB 2FEQH 1BMMH 4NA9H 5GDSH 1NBME 2ZFTA 4NG9H 5C2ZA 1WXRA 1AO5A 3I29A 2J4IA 1GBDA 2I6QA 2FDAA 2P8OC 1CHOF 3KF2A 4RKJB 4GPGA 1TALA 1P12E 4F48B 3O8DA 1V2NT 1YCPM 2XW9A 2HRVA 1P03A 3AAUA 2R0KA 1BHXB 4AG1A 1TB6H 5I46H 3PM3A 4K1SA 2A4GA 2BVXH 4MLFB 1AMHA 1ZGIA 2A4OA 3EAJA 1KIGH 9LPRA 2G5VA 5E0HA 1O5AB 3ZV9A 1RS0A 5C3NA 2AYWA 3P8OA 2W7UA 3KYFA 4DGJA 8GCHF 5GNDA 2Z9KA 1C2DA 1YLNA 5C0TA 1YGCH 4FETA 6LPRA 2ANWA 4WMEA 3VB4A 1HJAB 1HAXB 2YMSD 1RIWC 4FU7A 4JZEH 2BMGB 3TITA 1A3BH 5FCRA 1YPKH 3KQDA 3LJOA 1BMNH 3BF6H 3FP8E 1S0RA 3H09A 4OGXA 5DO4H 1GL0E 3OAAD 1B5GH 2OINA 3OE7D
chains in the Genus database with same CATH topology
1XUIA 2FX6A 1QB9A 1QGFA 3GY7A 1ZYOA 4GCHF 4Y8XA 1ELVA 3BEFB 4BTIB 1SHHB 3UNQA 2Y5HA 5EW1H 1O2GH 2PUXB 1TFXA 3LGIA 1E37B 1TNIA 2WUBA 3Q00A 3EE0B 3OU0A 4Y6DA 3WY8A 1A1RA 3SNCA 3KCGH 2BXUH 3K6YA 4TPYA 4ABJA 1WQSA 2XC0A 3RM2H 1SGFA 1P2OA 1KXDA 3A7VA 1V2RT 3MH5A 1GHYH 2ZU3A 3SNDA 1EKBB 6CHAB 5DP9A 4AN7A 4AYYB 2Z6BD 5ESBA 1JXPA 1UVTH 1Y5BT 2ZIQH 4AOQA 3C1KA 2QXJA 3E3TA 3U9AH 1L0ZA 5AVDA 1QL8A 2BLVA 2HNTE 1W13U 1AFEH 2ZTYA 2ZG0H 1D3PB 1C5PA 1TOCB 1TBQH 1EQ9A 1XXDA 4FUBA 1KXEA 2G51A 3RXFA 1YKTA 1UK4A 1UVUH 2BM2A 4TPIZ 1C1WH 4X2VA 3TNTA 3NCLA 3P6ZB 3KHVA 5GJ4B 2FI5E 2H9TH 1NFWA 1O2TA 4ISLA 1GMHF 3GYMA 3ZZ4A 3ENSB 2K7XA 1C5MD 1Y3YA 5G4BA 3UWJH 4CHAC 2STBE 2C93B 4JYUH 1HLTH 4BAQB 2GDEH 1GWAA 3RXLA 4ABHA 1MKWH 2OC8A 2XTTB 3QO6A 3E90B 2THFB 3S7KB 3ZZ9A 4HGCA 1HAZB 3RU4D 1SG8B 2EA3A 4NIVA 3SV7A 2CN0H 2ALVA 1P2MA 2A32A 1O5EH 1S5SA 4WH6A 1XUKA 2FS8A 1SFIA 1QB1A 1O33A 3QDZB 3ZZ7A 1DSTA 3QUMP 3PWBA 3C27B 5C5OA 3RXKA 4ZUHA 2NU3E 3SHCH 1O2KA 2BD5A 1DXPA 1LVMA 1KXAA 2G5NA 2GVFA 2YNBA 2GZ7A 3VFEA 5CMXH 1BMAA 1EZSC 2AEIH 2YOLA 1G37A 1S0QA 1GMCF 1YC0A 3CENA 4Z0KA 3RXHA 1TPSA 1ZJKA 1B0FA 1IQMA 1Y3UA 2W5EA 4SGBE 1P02A 3LGVA 3RMNH 1ID5H 3PMBB 4U2WA 1DXWA 3UOUA 1L1JA 3N7OA 3UIRA 4BANB 3S9BA 1C5RA 2Z9JA 1ESTA 2WPKS 1TOMH 7LPRA 5A0BA 1KLJH 1F0SA 2ZQ2A 3SQEE 2O8MA 1GJDB 1T4UH 1FJSA 4CRDA 1O5GH 3PTBA 2R2WU 5EU8A 3U8RH 3SJOA 1MD8A 3PLBA 1TWXB 1EJAA 1CSOE 2ESTE 3TNSA 2BQ7B 2ODQA 1TMBH 3FAOA 5E0JA 4UE7H 4HFPB 2BYAX 5LH8A 4AFSA 4OS6A 3E91A 3GDVA 4X8UH 2J95A 3KGPA 3RMLH 3LDXH 1ETTH 4Y79A 4Q80A 3RP2A 2AFQB 2OCVB 3HKJB 1AD8H 3M3VA 2H9EH 1NM6A 2TGTA 4OS4A 4H6TA 5A8XA 3MTYA 4HI3A 1A2CH 1AQ7A 1PQ7A 5E2PA 1FXYA 3S9AA 2XCNA 4U32A 2VIVA 3IITA 4AZ2B 1ANDA 3BG8A 1A7SA 4WJG2 2Y7XA 4K8BA 1JMOH 1W10U 3B23B 3T5FH 2Z3EA 1ZTKA 3A8DA 1DY8A 1O3NA 1J17T 3HPTB 4OS2A 5L30H 1T7CA 2PWXA 2QGRA 3RLYH 1CBWB 4MNVA 1AE5A 1O3LA 1A0LA 2QXGA 4VGCC 1CQQA 1KSNA 2Z3CA 1W0YH 3T62A 1C2HA 4RSPA 2CV3A 2TRMA 3SGAE 4Y10E 4FVDA 4YLUA 2ZDNA 4K5ZA 1GI1A 1ZGVA 1GI8B 1EAWA 3QX5H 3V12A 1HAGE 4I8JA 1T4VH 2P3UB 2GX4A 1SI5H 1EJNA 3SJ9A 2BX3A 1W14U 1O0DH 2BZ6H 1FI8A 4CH2B 4JZ1A 1NRNH 1V2PT 4IN1A 1SLUB 3LH3A 3SJ8A 1BRAA 1IAUA 1XUHA 1OWKA 5FX6A 3ZV8A 5FBEA 1EZXC 1SL3A 1TPOA 4A5TS 3PV4A 1TBRH 3U1JB 1RGQA 2HNTC 4KGAA 4KTSA 2DE9A 5DP6A 5JB9S 2D1JA 1GJ9B 2BVRH 1DOJA 5HM9A 1QR3E 3FP7E 2BLOA 2UWOA 1V2VT 1DUAA 2WV5A 1EPTC 2FPZA 1O2XA 2AGEX 2ZEBA 2ZP0H 2ILNA 2A7CA 3EA9A 2GCTC 2BOHB 3GCNA 1YPJH 5C20A 1K22H 1TIOA 4ZKOU 5L2YH 2GZ9A 2VH6A 4F49A 1C5ZB 3RXBA 2STAE 4O3UA 1AVXA 3I78A 5DGJA 1NY22 3NK8A 1TYNA 1D9IA 3K2UA 3TK5A 2ZGHA 4NCYA 1DPOA 1C4V2 1HNEE 5A0CA 2FO9A 5JYIA 3M37A 1TPPA 2GKVE 3LJJA 2VWMA 1IQKA 1KY9A 3HKIB 1LPZB 3PO1C 2TIOA 1EP6A 2V35A 1T8NA 3EGKH 3F9EA 1GBMA 3A7YA 4JYTA 4TWYA 3LONA 3R0FA 1ZHPA 1C1RA 4YOJA 1MAYA 3PYHA 4ABDA 1CT4E 5A2MH 2BD9A 3M7TA 3RMOH 1C2JA 1OS8A 2VH0A 5TCCA 3RMMH 1TGSZ 1NRRH 2EC9H 2LPRA 2ZPQA 4NFEA 1TPAE 1LVBA 1Y3WA 2FOBA 1HBTH 1Y59T 1F2SE 1VGCB 2BDGA 1QIXB 4U30A 4WH8A 1SLWB 2H5DA 1PYTD 1OWHA 2OBOA 1GHZA 1V2WT 1O3JA 1MUEB 1VZQH 1MU6B 4LZ1H 2Z9GA 3M61U 5HYOA 4ABGA 4KTCA 1YPGH 1ELTA 3L6PA 1OWJA 1S81A 1TNGA 1VR1H 3JZ2B 3TGJE 1MTSA 2IJOB 2QF0A 2HPPH 3SU3A 1OKXA 4M7GA 1LDTT 1THSH 5DP8A 1T8LA 1YBWA 4CH8B 2FI4E 3RXJA 1K1NA 4DG4A 3F68H 1UTPA 2BLQA 1Q2WA 1EOJA 1MQ6A 5LPRA 2PGBB 1GI2A 2F91A 2F3CE 2ZGCA 3U98H 2AMQA 1W2KH 3A87A 4CRFA 1KLTA 2ZFFH 4A7IB 3M5LA 2J94A 2EI6A 3ZZBA 1HJAC 1JWTA 1O3GA 1T8MA 1UCYE 2G00A 2TGAA 1NU9A 1C1UH 1O5DH 1AFQC 2BTCE 5DKMA 4MPXA 1K21H 2XBYA 1TX7A 2Q6DA 4MNXA 1NU7B 4AB9A 1P2NA 2BY6X 1TRNA 1GJCB 2H6MA 1GBAA 1GCTC 1RTFB 2BD8A 2VNTA 1ELFA 3P95A 3DFJA 1SGEE 3ZVEA 2BZAA 2WPHS 1N1LA 3VPKA 5FHTA 3SU4A 2ZGBH 3SV6A 2FYQA 5TCAA 1UHBB 1W12U 2B0FA 1ANEA 2PTNA 1UHBA 3SUEA 2H2ZA 3H7TA 1SGYE 3A81A 4FUGA 4X1PU 4AB8A 3BTHE 3BG4B 1GI0A 1S82A 4NZLA 1P2KA 3M7UA 1LVYA 2OLGA 2QF3A 3LOXA 1WSSH 1SR5C 1OWDA 3A8CA 4QT8C 1PPBH 5GIBA 1MTWA 1TNHA 2H5CA 2ZWLH 3D62A 1TGNA 3OYPA 4YOGA 1K2I1 4MTBA 1UTOA 1CVWH 3VXFH 1C2LA 1MAXA 1D4PB 1ZMJA 1GI9B 4UONA 2AMDA 1UTLM 1ZJDA 1Z7KA 4D7GA 2H9HA 1QRWA 1SGTA 1O3CA 3PLKA 4YO9A 5DK1A 3SU5A 1TLDA 1BMLA 4XOJA 5FXLA 1AWHB 1DICA 4I8LA 5EODA 1FZZA 1LQDB 1D6RA 1O39A 2BY9X 4ZXYH 2WYGA 3GDUA 1XMNB 2BDAA 2GD4B 1CT0E 4INHA 1ZTLA 5T6DA 1FY3A 4A1XA 3NPSA 3VB3A 4ABAA 3S0NA 3VB5A 1ZHMA 2Y6TA 1AZZA 5AFYH 3RC5A 3SNBA 1TGBA 4DURA 2ZDVH 5TJXA 4ABBA 1F92A 2JKHA 2OTVA 1ETSH 2VWLA 3EDXB 2ZNKH 2HOBA 3RXQA 1A46H 2FXRA 3ZYEA 1C1VH 1AKSB 1BQYA 2LIZA 2FESH 7GCHG 1AKSA 4BXSA 1ZSKA 4DY7B 5GCHG 3A84A 2CMYA 1IQEA 1MKXH 3S7HB 3MMGA 1FDPA 4I33A 1AGJA 1SFQB 1P09A 1INCA 4CRGA 1F5KU 1AY6H 3QZRA 3KN2A 1YPMH 2UWPA 2C8YB 2P3TB 4K1TA 3QGNB 2A2QH 3PLPA 5HGGA 2YNAA 1FMGA 4NZQA 1TE0A 1A3EH 1DY9A 3H5CB 3MU5A 3HGPA 1GBIA 6ESTA 1YCPH 2VU8E 1IOEA 1CA0B 1LPGB 2OC1A 2LNCA 2WINI 4X6PA 4JZIA 1BUIA 2ANYA 1O3FA 4Y8ZA 3RXSA 1G9IE 1FN6A 1FY4A 1K1OA 3E1XB 3FFGA 1O2RA 2VINA 5EPYA 3PB1E 4WMDA 1GJAB 2FX4A 1ARCA 1P3EA 1JIMA 3A7ZA 3UY9A 1WUNH 3SI4H 1A0JA 3SZNA 3SUDA 1MTNC 3LGTA 2G55A 4BTUB 5C1UA 2RCEA 4TWWA 1QTFA 4GUXA 1AB9C 9ESTA 3A7WA 1GI4A 2Y80A 1SGNE 4I31A 2ZGXH 5DP3A 1RFNA 1YPHE 1ELGA 7GCHF 1QBVH 1P2JA 1QJ6B 3H7OA 2EI7A 4J2YB 5GCHF 4XBBA 4ZKNU 2C8ZB 6GCHG 2XRCA 2HPQH 3P8NA 3Q76A 1DE7H 1SGPE 1WYKA 4DCDA 1PPZA 1GDQA 2FWWA 1SLXB 1UO6A 4WXVA 2NWNA 2JH0D 4X1QU 3NWUA 4UFDH 2RA3A 2O8TA 1MQ5A 1V3XA 1GMHG 3M7QA 2A5KA 2SGFE 1C5QA 3G01A 2D2DA 2TGPZ 4ZH8A 3RXTA 1UK3A 2HNTF 4ZHLU 4K8YA 1Z1IA 1W11U 2Z9LA 4TYDA 1G3EA 2FYRA 4NSVA 4I8HA 2XYAA 1O3HA 3UQOA 3HATH 1GG6C 2VB0A 3GCHB 3OTJE 1QRZA 3BTTE 1W0ZU 1QY6A 1V2OT 2WPJS 2GMTC 4KELA 4D76A 1ZPZA 3FANA 1KXCA 1HJ8A 3QZQA 4IC5A 1GVKB 1BZXE 2CXVA 2W3IA 3BIVH 3TPIZ 3MO6A 1GMCG 3QTOH 1GBCA 1QB6A 1O2PA 4UFFH 1ZZZA 1E36B 6GCHF 1NS3A 2A0QB 1ABJH 3ATIA 1HAPH 3HGNA 1UMAH 1BITA 1N8OC 3E0NB 4YESB 3SNEA 1Y5AT 1BTWA 3SQHE 3BV9B 1D3DB 4R8TB 1GGDC 1GBJA 1IQLA 1WOFA 1LTOA 2VGCC 1P11E 3TIUA 1EAXA 3SU6A 1S84A 4JYVH 1O3AA 2Q6GA 3GCOA 1WTHD 4CBNA 1G3BA 4DVAU 1LHDH 1DWDH 3JZ1B 3RXRA 5F8TA 1CHGA 1PQAA 2JETC 2AIQA 1RD3B 1G30B 3S69A 2VWNA 2UUFB 1O2HA 4Y0ZE 1EZQA 1HFDA 3NKKA 3A8BA 5EW2H 2AMPA 2ANMH 3BEUA 1CGIE 1VITG 1CGJE 3RU4E 5ABWA 3Q77A 1C2IA 2ZU1A 3RXUA 1TNJA 1EXFA 1ZMNA 2BDIA 4UDWH 5C1YA 2FMJA 3URDA 1GVLA 1LQEA 4DIHH 4X6MA 1JBUH 4Q7XA 2FTMA 3K6ZA 2DUCA 2ZA5A 4UD9H 1C1TA 1O5BB 4K2YA 3VGCB 4FU8A 3QTVH 1Y5UT 5FPTA 4HTCH 2ZHWH 5EPNA 1O3EA 3SUGA 4A92A 3GY4A 3RXDA 4MVNA 2O8WA 2PTCE 4YZUA 2ZQ1A 3GY5A 5CHAB 3SORA 2F9NA 4ABEA 1EATA 3PMHB 2P8OB 1C2MA 4IGDA 2NU4E 3ATLA 1OXGA 1OWEA 3TJUA 3K9XB 3M5OA 2GV7A 1QL9A 4K3JA 1A5HA 1AIXH 3T26A 3TU7H 4E06H 1YPHC 1DUEA 1MZDA 1VITF 4XFQA 1O30A 2QYIA 3LGYA 1ABIH 1O31A 4AGKA 1ZHRA 1J8AA 5FAHA 3P8FA 1IQJA 4CR9A 1EUFA 2ZCHP 5C1XA 2BX4A 2BXTH 1XUFA 3SUFA 1PPHE 3OY6U 5E8EH 5JPMH 1DANH 1BRBE 2BD2A 3KQEA 4J1YA 2BQWB 5BPEA 3A88A 1MCVA 4FUEA 1RIWB 2F9OA 2ZFPH 3B8JA 4WY3A 4OS1A 1C1SA 3GYLB 4PROA 1E35B 1RTKA 2A4QA 4YM9A 2VWOA 4NFFA 5C67A 1L4DA 4NGAH 1UK2A 1V2TT 4Y8YA 2C3SA 1EX3A 3RXMA 1HJ9A 1LCYA 1HAYB 1X7AC 3M5MA 3O8BA 1ACBE 3SU1A 3ZVAA 2CF8H 1QCPA 2FZZA 1V2UT 5JBAS 1P0SH 1QJ1B 3SJKA 3RC4A 2J34A 2BDYA 1GBTA 3BG4C 2WYJA 1C5NH 4CRAA 5K7RA 2Q6FA 2BY7X 2A1DB 4RN6A 1LO6A 1FPHH 2RA0A 3LT3A 3M3TA 2ZFSA 4BOHA 1U6QA 1O5CB 1DITH 5FX5A 1O34A 1UTKA 1S6HA 2ZHQH 3MWIU 1DM4B 1C5UA 1DWCH 1TX6A 4GAWA 1V2JT 4MG3A 4WXIA 1TA6A 1WTGH 1C1PA 3IG6B 5JB8S 2FM2A 2CF9H 1GL1A 4LOYH 1D3QB 1YM0A 1O37A 2VIPA 3NUMA 1GHWH 2QY0B 2ZO3H 1MD7A 1L1NA 1UTNA 2PKSC 4GHTA 3UFAA 4B73A 2EI8A 4FUFA 4AG2A 1KXBA 2QN5T 1GHAF 1XVMA 3ZVFA 4CHAB 4ISNA 4CR5A 5C5NA 7ESTE 1P05A 1G3DA 1UVOA 2ZFQH 3ELAH 1Q3XA 1VCPA 2OQUA 2HGTH 2NU0E 1G36A 3QK1A 5DG6A 1E0FD 1EP5A 1QBOA 2OBQA 2BVSH 3MHWU 3P17H 1T8OA 2QAAA 4X1NU 1NZQH 1SHYA 3AVZA 1ESAA 1PJPA 1Q31A 1O2WA 2K1QA 1KDQB 1VITH 1O36A 1Z8GA 1BTUA 1KDQA 1ZPCA 2ZU2A 5PTPA 1PPFE 3T28A 4CBOA 1SGDE