4YO9A

Hku4 3clpro unbound structure
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
total genus 84
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yo9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yo9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yo9A02
1W8BH 1T8LA 4ZHMU 2WPKS 2A32A 2WINI 1GJ4H 1S85A 4AG1A 1A7SA 1NS3A 1UTJA 4GPGA 1BTZA 3BSQA 3TJUA 4BOHA 2ZGXH 2STBE 1GI7B 2BLQA 2ZKSA 1RTFB 4I7YH 1FPHH 1MD7A 2PWXA 4O97A 4X6PA 6CHAC 1EZXC 2AH4X 3A85A 4NA9H 4NSYA 4FUCA 4IGDA 2A31A 1LQEA 5DGJA 1PQAA 4A5TS 3VB5A 1V3XA 1SFIA 1D6WA 1DUEA 3SJ9A 1DOJA 4Y0ZE 1EX3A 5JDUB 4F4OC 3VB7A 4F49A 4OS4A 2CGAA 1C5MD 1CQQA 2TIOA 3O8CA 2O8LA 3FZDA 1BB0B 4K1TA 2Y80A 1P2OA 1V2QT 2QY0B 4I33A 4M7GA 3I29A 3PM3A 2J95A 5TCAA 1C2EA 6CHAB 4FUEA 1PJPA 1WV7H 4LOYH 2CF9H 3RU4D 1XKBC 2Y6TA 3TJVA 1TRNA 2Z9JA 2SGAA 4ZHAA 2GMTC 1S0QA 1EB2A 1O2JA 1DT2A 1ZRKA 1MMJN 2HNTC 3QGNB 2IN2A 4GCHF 4MPVA 3SV9A 4ABFA 1N8OB 1UVUH 2BD8A 1C1TA 1LVMA 3A88A 2C93B 3AAUA 1HAPH 2Y82A 1J16A 3QTOH 1Z8JB 1HAOH 1V2UT 2NU0E 2ZFFH 1QA7A 5C1UA 4MDSA 1O30A 1CGHA 4AN7A 5EPYA 3RXMA 2BDCA 3T62A 1LPGB 1OP8A 2Q6GA 1TQ0B 3O8DA 1QBNA 2K1QA 4X1RU 1AKSA 1EOJA 1ZZZA 1C2FA 1FY4A 1LCYA 2CMYA 3A7TA 3PMJA 5H4IB 1TNKA 3MI4A 1DVAH 3B23B 1BTYA 4R8TB 5F8XA 2HLCA 3GICB 1SGDE 3M3VA 4HZHA 3PMBB 1SOZA 3FVFB 3RC6A 2OXSA 1HUTH 1BMLA 1VZQH 1VJAU 5LH8A 2Q6FA 2C8WB 1QIXB 2FO9A 3QDZB 1O2IA 3BTTE 4BXSA 1C5PA 1O2HA 1BTPA 1GBAA 2OQ5A 2ILNA 4ZUHA 1G2MA 1GPZA 1CU1A 4CRGA 1OS8A 3VGCC 1YPHC 1NRNH 1KLIH 3SGAE 3K9XB 4B76A 1QL7A 1UTQA 1RIWB 1V6DA 1W2KH 3A7WA 1OWIA 1GL0E 1L4ZA 1E36B 1UHBB 1GL1A 1WSSH 4KTSA 5EODA 2WPHS 1B5GH 1OPHB 2UUYA 3HATH 1MKXK 1H9LB 3UNRA 1O3CA 1SHYA 2Q1JA 1BDAA 3QTVH 1YF4A 4K1SA 3UTUH 3SV6A 1HCGA 1B7XB 2FS9A 1O5DH 4ZKNU 1FXYA 2OC7A 2BZ6H 2ODQA 4IS5A 4X6MA 1EQ9A 3GCHC 4U01A 3VGCB 4JCNA 4FUHA 4B2BA 4B75A 3GY5A 1O2SA 4B73A 4GHQA 2FM2A 1WCZA 2Z6BD 2J38A 2QV1A 1GHBF 1FV9A 3PTBA 4B1TA 5K0HA 1EP5A 2UUKB 1C5TA 4E05H 4ABDA 1TOCB 1HIAA 1EKBB 3NPSA 1MBMA 1Q3XA 4AFQA 3PYHA 1DITH 4YLUA 2VWOA 4D76A 2AMQA 3AW0A 2VIVA 4X8VH 1XM1A 3A8AA 2ZDVH 3SQEE 1MAXA 2ZFSA 5K7RA 3SV7A 1BHXF 3TNTA 3ZV8A 1KTSB 3DA9B 2GCTB 4YOGA 1G30B 1S81A 4FU9A 2BLWA 2FI5E 1CT4E 3U69H 1TBZH 4DVAU 2BYAX 1G3BA 2BOKA 1IQHA 2XW9A 1MQ6A 5F6MA 2G4TA 2BDIA 3OYPA 4NZQA 2BMGB 4Q2KA 3LPRA 3DHKH 1P02A 1F0UA 2TGTA 1MQ5A 3IG6B 2ZCLP 3IITA 4NIYA 3RXBA 1SGCA 3SU5A 2W26A 4CRAA 1RFNA 4JZFH 1PPEE 3A87A 4YOIA 2G4UA 3TIUA 4GLYA 3BG4C 4WMFA 3AAVA 1A3BH 1O3FA 1PPCE 2FZZA 5HM2A 1QGFA 1ZGIA 2GT8A 5LGOA 3TGKE 1C2IA 1WBGB 3QK1A 3A89A 5FXLA 1D6RA 1DLEA 3S0NA 1NROH 1AHTH 4AFUA 1AO5A 4JZ1A 3ZZ3A 4JMYA 1V2KT 3UY9A 1AVWA 2QXHA 7GCHF 3MU0A 1XVMA 1S5SA 2GTBA 4Z6AH 4X2WA 3RXIA 3W94A 4I8GA 2XCFA 1ABIH 4A92A 2Y7XA 5GCHG 2PHBA 3OSYA 5T6FA 1MKWH 3GCNA 1GBEA 1W13U 3SI4H 3NZIA 1OWDA 1UCYE 2HRVA 1HV7A 1XXDA 2HOBA 3BV9B 2AS9A 1VGCC 2P95A 5TJXA 4CH8B 3GDUA 1ZMJA 2BD5A 3MU8A 4HTCH 3TH3H 1H4WA 1WUNH 1WQSA 1A0LA 2ZWLH 1FQ3A 3MFJA 3SU1A 1O2YA 2UWLA 4DGJA 2FMJA 4JZEH 3SW2B 4CR9A 1UJ1A 4NIXA 3BTME 4NWKA 2O8UA 1QFKH 5EXLA 1V2PT 3LGYA 2A1DB 2XYAA 1PPHE 1QJ1B 1F5RA 2SGDE 2ZGJA 1AB9C 1HRTH 1TMUH 2P16A 1V2JT 2XC4A 3FP8E 1QBOA 1DE7H 2H5DA 2Z7FE 1CHOG 3BTFE 4I31A 1UVSH 2A4GA 1O2LA 3F9GA 5T6DA 1T4UH 1JIRA 1V2WT 1BCUH 1DWBH 3MNBA 2Y5FA 1ELVA 2Z3DA 1YPJH 1VITG 3KHVA 1THPB 1NY22 3ZVGA 3RU4T 5JBAS 4IW4E 1KLJH 5FHTA 3HPTB 2A5KA 1O5GH 2ZHFH 1RGQA 1PFXC 2ZP0H 1EB1H 3SUFA 1QJ7B 1H1BA 1O3OA 3LKWA 2YNBA 3T25A 1L1GA 3PB1E 5FBIA 1O5EH 3LIWA 2WUBA 3M5MA 1C2KA 4WJG2 3ITIA 4CHAC 4INHA 1AB9B 1LVOA 4ZROA 3I77A 3LDXH 4Y7BA 1HJAB 4GVUA 1H9HE 1Z1IA 2ZC9H 4WH8A 1Z7KA 4A1VA 1C2MA 1XUJA 2SFAA 2BDHA 3LJJA 2PTCE 4BTUB 5C20A 3U1JB 4HGCA 2PFEA 3MNSA 1W12U 1IQIA 2AGIX 1YKTA 3GISB 2HNTF 5CHAC 1EZSC 4OS7A 4X2XA 1K1LA 3RXRA 2BY6X 1T32A 2VIQA 3HK6B 2BD9A 1DWCH 1LVBA 3SOSA 2VWLA 2BD4A 1Z71A 1P2KA 1YC0A 3P70B 2KAIA 1TLDA 3E6PH 1XX9A 1PPZA 1KXFA 2OC0A 4X8SH 2ZQ1A 4MPXA 1SGPE 2GCHF 3MWIU 8GCHF 2Y7ZA 2B7DH 4TPYA 1W7GH 3RC5A 1BMNH 1WU1A 1YGCH 5ESTE 4XE4A 2WPMS 9LPRA 1XUIA 1DFPA 1O2OA 3AVZA 1BUIA 3MMGA 3NCLA 3GY7A 5G4BA 1O3IA 3K65B 1E37B 2G81E 4DW2U 1Z1JA 1BBRK 1XMNB 1RD3B 1LKBA 1O3JA 2D1JA 4FU8A 3RXVA 2ASUB 1AU8A 3ATLA 4RKJB 1C5YB 1OOKB 2FEQH 4AB9A 4DIHH 1LDTT 5E2PA 3QN7A 1ELBA 3LJOA 3UQOA 4AFZA 2C8XB 1W7XH 4Y8ZA 5C1YA 3BEUA 3KIDU 1ELCA 1N6YA 2RA3A 3MU4A 5E8EH 2H1UA 2J4IA 1IAUA 2FX4A 3EDXB 2BVXH 2PV9B 2BTCE 1Y5BT 1DPOA 2G8TA 4O03A 7ESTE 2V3OH 1H9IE 5AFZH 1ARCA 1GHZA 4BAKB 4WF8A 4JZIA 1ETSH 3G01A 2FI4E 5A8ZA 2FOGA 3ZZ9A 1LHCH 2OLGA 2PUQH 1A3EH 4KKDA 2H5CA 1GMDG 1OYTH 1NZQH 1GJ8B 2ZA5A 4O9VA 5HMAA 5JB8S 4GHTA 5A0AE 2XBXA 2DE8A 1LKAA 2NU4E 1NRPH 3P17H 3WY8A 1N1LA 4LK4A 1O2QA 3SNEA 1Q31A 1HJ9A 4K3JA 3A80A 4OS1A 4ABHA 2OBOA 1ELFA 1J9CH 1L0ZA 3KQEA 3GY4A 2JH6D 2G5NA 1P05A 4Y6DA 1TGNA 1J15A 1DICA 2FODA 2TPIZ 1LHDH 3HGPA 2FXRA 2SNVA 2OINA 2LNCA 1P2JA 2DE9A 4TYDA 1TA2A 1KDQA 1G3CA 2LIZA 1LVYA 4I8JA 3F9FA 3MYWA 2C3SA 1AKSB 3UNQA 4HI3A 1GGDC 1AE8H 3GY6A 1QHRB 5DK1A 5JPMH 1SGYE 3RXHA 4ASHA 1OYQA 5C67A 3T29A 3MOCA 1P12E 2W7SA 1FMGA 1TONA 1DS2E 2ZTZA 1QY6A 1K1MA 1SBWA 1C2DA 1BTXA 2QXJA 2STAE 3SU0A 3ZZDA 5FPYA 3RU4E 2CF8H 3RMMH 2GGVB 1UK2A 4YT7H 4KTUA 3P95A 1B0FA 1MBQA 1BRAA 3UWJH 1OSSA 3ZVDA 1E0FD 1EAWA 4BAMB 3RC4A 1TNIA 4AX9H 3SNDA 3ENSB 3V7TA 4ABBA 3SNCA 1CSOE 1BRUP 4XFQA 2FI3E 2EA3A 2WV4A 3SU6A 1QR3E 2NU1E 5JYIA 2Z3EA 2QYIA 4AORA 3KEEA 4X1PU 1QTFA 2ALVA 2WPIS 3A84A 2A2XH 3GOVB 3Q3KA 3A8BA 1H8IH 5GPIB 1A2CH 1CE5A 2P8OC 5A09A 3TPIZ 3ZVAA 3C1KA 4ZAEA 4YZUA 3B9FH 2GT7A 1GI4A 4K1EA 3OU0A 4AG2A 4MPWA 1ESAA 2BDAA 3U8TH 2VWNA 1VCPA 3D65E 4ISNA 4LXBH 2J34A 1A4WH 1PYTC 1Y3WA 1HAYB 1L1JA 5J4QA 3BTQE 4I8HA 2JKHA 4NIWA 5DJ7A 3TK5A 2H9HA 1W0ZU 2B0FA 1SGFA 3UPEA 1JMOH 4FVBA 1SQOA 5FX5A 1O3GA 2WV5A 3P8NA 2BQ6B 5HGGA 1O3LA 1UTLM 1SLUB 1O2MA 4WMDA 3BTHE 4FUDA 2QN5T 2BD7A 1BJVA 1SLVB 1GBKA 2P93A 1TPAE 1HIAB 2OQUA 4JYUH 5IDKA 1QRXA 3D49H 4K60A 1DY8A 1L4DA 4CRDA 3TJNA 1LHFH 2D2DA 1DWDH 2SGPE 2IOTA 3A8CA 2GZ7A 1NT1A 1Z8IB 1EPTC 2A7CA 3UUZA 4ABAA 3TGIE 2TGAA 2BY7X 3L33A 8LPRA 2PW8H 4RN6A 2M5TA 4FUGA 1SGRE 2SNWA 4A1XA 3RXGA 2ESTE 3AW1A 1GHYH 3SU4A 2BY5X 1GI1A 4RSPA 4H4FA 2P3UB 2OP9A 2ZU4A 4FUJA 3SHAH 2GDEH 2PKSC 5CE1A 2JH0D 1ELGA 2A7JA 3CS7A 3FP6E 2AMPA 5L2ZH 5DO4H 4FUBA 1TGSZ 1BBRH 1QCPA 4H6TA 1GHAG 2GMTB 1D3TB 3MH7A 1EATA 1ZTLA 2F9VA 2ZHDA 4UDWH 4OGYA 4UFFH 4ZKSU 4YESB 3M35A 2Z9LA 1EJMA 3Q00A 3P8FA 3S7HB 2XBWA 4CRFA 1IHSH 2A2QH 3ZZAA 4SGBE 2GKVE 1MCTA 1K28D 4Y8YA 2PLXA 2ZZUH 4XBBA 5JBCS 5AFYH 2W3KA 1HBTH 4YT6H 5LPFA 1EOLA 2VIOA 4TY6A 5CMXH 5GCHF 3SJKA 1O2ZA 2JETC 4K8BA 3P8OA 2FESH 1C5ZB 3H5CB 3ZVBA 1CVWH 2J9NA 3MU1A 2UWOA 3KL6A 3MNXA 4ISIH 1C1UH 3ZZ6A 4XBDA 3UOUA 1BMAA 4WH6A 1C5NH 1SQAA 5FPTA 4VGCC 1RTKA 2I6QA 3T28A 1C2HA 1ZTJA 2ZNKH 1P0SH 1O2RA 2BX3A 2F9OA 4TWYA 3ZZ4A 1KXEA 2F83A 1ZHPA 2VIDA 2B9LA 5C3NA 2V35A 1SC8U 3ZVFA 1D4PB 1Y3VA 1KTTB 1U6QA 5DG6A 5GJ4B 4ESTE 5E0JA 4ZKOU 1GG6C 3QLPH 3A83A 1O2GH 3T26A 5LPRA 1FONA 1O35A 1AUTC 2F9NA 4NA8A 4NCYA 1GBMA 3SNAA 1O2PA 5GDSH 3S7KB 3SU3A 1VITF 1MTWA 1NRRH 2XCNA 4VGCB 5DP8A 4BANB 1THSH 1VCWA 5J4SA 1O3HA 1S6HA 1ZPBA 3STIA 1WAYB 4NFEA 1QURH 2YNAA 1BTUA 3UIRA 4X0WU 1UVPA 3RP2A 3ATWA 5FBEA 1P01A 1SI5H 2OUAA 1CA0C 4WMEA 1EZQA 3RXDA 3V13A 4B2CA 1SR5C 5E0GA 4FXGH 4X1QU 3GCHB 4X6NA 2ZPRA 1J17T 2BHGA 5L6NH 1MCVA 1DXPA 1O2NA 2PKAA 2FOHA 2KAIB 1C5QA 1ANEA 1LQDB 2PUXB 1P9SA 1P03A 3OY5U 5A8XA 2VH0A 4XOJA 1PPBH 2UUFB 1HNEE 4IBLH 2CN0H 3MO9A 2AIPA 3F6UH 3URDA 4DY7B 1BT7A 1OXGA 2BVRH 1TNGA 3SQHE 4DIIH 1ZLRA 7KMEH 1NFXA 1SG8B 5BPEA 1WYKA 3PLPA 2H6MA 3L6PA 4IN2A 1BITA 1LHEH 3CENA 2A7HA 1FLEE 1CGJE 4AOQA 3OX7U 3CP7A 3GDSA 5I25A 3NUMA 1JRSA 1SB1H 2ZF0H 2A45B 1O0DH 1GBTA 1ANDA 4AYVB 1J14A 2D26C 1SMFE 1SLXB 3SJ8A 1EPTA 1AY6H 1C1VH 1C5LH 1GMCG 1SGFG 1TABE 1ELEE 1TBRH 2IJOB 4BTIB 1IOEA 4I8LA 2EI8A 5EW1H 1EJAA 1P3CA 4UFGH 1YCPK 1QB9A 5FX6A 1MTVA 4WXIA 4IN1A 5C5NA 2ZU2A 1HGTH 3A7ZA 1H8DH 1CGIE 4KGAA 3GCTG 2HNTE 3BG4B 4Y0YE 5BRRE 1EJNA 1FJSA 2EEKA 4D9RA 1ZSKA 2AMDA 4IC6A 1GVLA 2SGQE 1ZR0A 4PROA 1JWTA 2R2MB 1GBBA 3ATIA 2ULLA 4MG3A 3UFAA 3O8BA 1X7AC 3SJOA 1GVKB 1UCYK 2ZU3A 3GDVA 1DANH 4QT8C 5EQSA 1FZZA 3V3MA 1YPEH 3ZV9A 4E7RG 1AZ8A 2ANMH 2JH5D 3U8OH 2XBVA 3EA9A 5AVDA 4AZ2B 1WTHD 1M9UA 1VGCB 3BTEE 1FY3A 5C1XA 1V2RT 1GJCB 1KXCA 3HGNA 4X2YA 1AN1E 1PQ7A 2AERH 1ETRH 1EAIA 3LH1A 5EXNA 1GMDF 1CT0E 3MHWU 1CBWC 4I32A 5ABWA 6ESTA 4K8YA 1G37A 3RMLH 1YPMH 1PYTD 1OX1A 1AFEH 2FWWA 1A0JA 4NGAH 1KDQB 1T4VH 5EPNA 2D8WA 2FOBA 1GI5A 2ZDNA 2ZCHP 3SO3A 2SGFE 1IQMA 4NA7A 2W5EA 1BJUA 3SV2H 1HAHH 3BN9A 3EA8A 1XUKA 1Y3YA 4NFFA 2Z94A 3RXUA 1GHXH 1ZPZA 2A5AA 5EOKA 1ZSJA 3RXOA 1KIGH 1S82A 2BD3A 3GCOA 2TBSA 1SQTA 1YPHE 3GY8A 1UTKA 3KQBA 1MTNC 3E90B 2EI6A 1O5BB 1PQ8A 4U30A 2K7XA 1RXPA 2WPLS 3E0NB 4Y71A 1P10A 1VITH 1ZPCA 1YLCA 1C1WH 3PV4A 2ZDLA 3LGWA 1ESTA 1K1JA 4BAQB 1DSUA 1Y3UA 1GDQA 1NFWA 2QAAA 2ZFQH 1AQ7A 3M3SA 1KXDA 3PROA 4CHAB 1O33A 2G51A 1TE0A 1DX5M 1HXEH 4YO9A 1Z6EA 3UQVA 5FCKA 4UE7H 1O34A 3T27A 1BMMH 1D3PB 3UWIA 3M37A 5DKMA 4DOQA 1B0EA 5EU8A 1BBRE 4YTAA 2PTNA 1T31A 2ZQ2A 1HFDA 1P2QA 2SGEE 2BDGA 2EI7A 5C5OA 2VIWA 3MO3A 5CHAB 1XVOA 3E1XB 2Y81A 2TRMA 4D8NA 3PWBA 1OWJA 2Q6DA 4SGAE 1SHHB 1ELTA 1HB0B 1QRWA 1XKAC 5IYTA 2OCVB 3CS0A 2G55A 1PPGE 3H7TA 3RMNH 2ANYA 3T2NA 7LPRA 1MKXH 1A0HB 1DLKB 4NZLA 2ZIQH 4AFSA 2ZDKA 1P57B 1F92A 4XSKU 2QF0A 1GBIA 1ARBA 3LC3A 1SSXA 1GJ6A 1GI9B 4GUXA 2QF3A 2J94A 3TVJB 3PMHB 4LZ1H 1C4U2 3MO6A 1V2LT 3RLWH 3NKKA 3PO1C 8KME2 3KGPA 3QO6A 3A82A 5GXPA 2FOMB 1UVOA 1L2EA 1HAVA 2GV7A 3SJIA 2RCEA 4RKOB 2R3UA 1GJ5H 1MTUA 5T3HA 1IQFA 2ZDMA 1T8MA 1FY5A 1TYNA 2W7UA 1K1NA 1DM4B 2AYWA 3A86A 1LTOA 2Y5GA 1FY8E 4BAOB 1MU6B 1FAXA 1WTGH 3SBKA 1PPFE 3Q3YA 2FS8A 1O3BA 3RUOA 2ZFTA 4ZXXH 3EE0B 1UK3A 3Q3XA 3PO1B 2F9BH 1GJAB 1BIOA 1RRKA 3TK6A 5DP4A 1FDPA 1O36A 2RG3A 3TK9A 1KXBA 6LPRA 3DD2H 4ABGA 3HK3B 1THRH 2CHAC 2Z3CA 1YM0A 1QB1A 2XWAA 3W95A 1JBUH 1TX8A 1V2VT 3IWMA 6GCHG 1QL8A 4YLQH 1C5XB 1TWXB 3TGJE 1O2VA 3DUXH 1IQJA 5FAHA 3O8RA 2BM2A 3ZVEA 2A0QB 2G00A 5DP6A 1PQ5A 1Y8TA 2FYRA 4JYVH 1W3CA 1ZHMA 1O39A 3M7QA 3OY6U 2A4OA 4ISHH 3EGKH 3BF6H 1Q2WA 3ZYEA 1IQLA 5DP7A 1DWEH 1NTPA 2RA0A 2XWBI 3MH6A 2O8MA 1O3NA 3SU2A 1YCPH 1MZDA 3VB3A 1KLTA 1GWAA 1C5VA 1GHAF 1AFQC 1A5IA 4AYYB 1ZRBA 2ZHWH 2ZTXA 3OTJE 2TGPZ 4A7IB 5JBTA 3RXQA 1GGDB 4TWWA 2VH6A 3VPKA 3EBNA 2HWLB 8GCHG 1TA6A 3S9AA 3RXCA 2HPQH 2AGEX 1EAUA 2XC0A 4MTBA 5EQQA 1O32A 1RJXB 1S83A 2ZPSA 3BTWE 1CT2E 2XBYA 5AHGH 4WY3A 3GYLB 1C4V2 2BVSH 1LPZB 4UONA 3SGQE 3RXKA 1LPKB 5PTPA 1SOTA 2O8WA 4Y10E 1YPKH 4MPUA 2FOFA 3K6ZA 1JRTA 2VVCA 3TITA 2PGBB 2OD3B 1AFQB 1A5GH 1BRCE 1FI8A 4J1YA 1D3QB 1O2XA 1K22H 4R0IA 2C8YB 2C4FH 4FUIA 2I6SA 4A6LA 4MLFB 3UNSA 2ZECA 1TAWA 1GMHG 1S84A 3VB4A 1GBHA 3RXSA 3MH5A 1QA0A 4BAHB 1AE5A 1FPCH 2BZAA 1JOUB 1FUJA 3ATMA 1V2ST 4K5ZA 3SN8A 1S0RA 4IMQA 2FLRH 3P6ZB 2FPZA 1GI2A 4ABIA 1C9PA 4IMZA 2WYGA 3V0XA 4B2AA 3BIVH 1UK4A 2P8OB 3QWCH 1DUAA 1AI8H 1SLWB 1MKWK 4NG9H 1ABJH 1OWHA 1OKXA 1GBLA 1MD8A 3GY2A 2ZO3H 3ESTA 4X1SU 2VU8E 1E34B 1TRYA 2ANWA 1P11E 2BY9X 2ZGBH 2ZGHA 4UFEH 1VCQA 1TB6H 4UFDH 4DT7B 1W14U 1CHGA 1N8OC 4X8TH 1TIOA 2XNIA 2VIPA 3MH4A 4INKA 3TLOA 4XDEA 3P8GA 4OS2A 3SNBA 1DSTA 2FOAA 2GVFA 5HXFA 1FY1A 5A0BA 4K69A 4CBOA 3FP7E 2FOCA 4H42U 4ISLA 3MNCA 2PKAB 2ZTYA 4D7FA 1GCTC 1TNJA 2OBQA 1T8OA 1TFXA 1C5OH 4ZKRU 1O38A 5I46H 3VFEA 1JIMA 2GV6A 2NU2E 2THFB 1GDUA 2F91A 2QXIA 5F03A 3ODDA 1GCDA 3KQDA 2GZ8A 1BQYA 1O3PB 4FUFA 2UWPA 5C2ZA 1FIZA 3EYDA 3SV8A 3A7VA 4BXWA 1C5UA 2VINA 4U2WA 3A81A 2CXVA 2P3FH 3M5OA 3A8DA 5E2OA 4BNRA 1TNHA 3H7OA 3U9AH 2AGGX 3E16B 5TCCA 3F1SB 3A7YA 4TY7A 4UD9H 1ZOMA 1EPTB 4DJZB 1GCTB 1TX6A 1LO6A 3ZVCA 1ETTH 3NXPA 2A4QA 2HVXA 1UTMA 1ACBE 1GHVH 1W10U 2FDAA 2G5VA 3M5LA 2BOHB 4JK6A 3KNXA 4D9QA 1YP9A 5EQRA 3GYMA 1NRSH 1NU9A 3NK8A 2F9UA 1TALA 3QGJA 4IC5A 2ZPQA 2ZU5A 4KP0A 1GBDA 3K2UA 2H9EH 2H9TH 1ANBA 3VXEH 2PKSB 1BA8B 1GMCF 3FZZA 4MNWA 3U8RH 2WPJS 3U98H 2OTVA 1O3DA 1O2KA 2C8ZB 1RIWC 2XC5A 4ZMAH 4CBNA 1QB6A 2FTMA 2QGRA 1ZTKA 4D7GA 1SGQE 3M5NA 3TU7H 1QQ4A 5HYOA 2ANKH 2V0BA 3A7XA 1TNLA 2CV3A 1E35B 1GJBB 5EW2H 2BXTH 1P2IA 1NO9H 3LGIA 2HGTH 1MZAA 1K21H 1XUHA 3MTYA 2LPRA 1HLTH 1WQVH 3GCTF 3C27B 5E0HA 3RXAA 2GX4A 1A5HA 2P59A 3BTDE 3JZ2B 4KTCA 1GDNA 3N7OA 1GJDB 3PLBA 2B8OH 5A2MH 4E7NA 1YLDA 1QNJA 3RM2H 1O2TA 4X6OA 2BLOA 3E8LA 3SUGA 1O5CB 2FTLE 1P06A 1MTSA 1TOMH 5DP3A 5L30H 2ZFRH 2JETB 1IQNA 1HYLA 3DFLA 1SVPA 4DG4A 1O2UA 1UMAH 3BIUH 1P3EA 1WOFA 3S69A 3URCA 1SL3A 1CHOF 4DCDA 1T7CA 1CO7E 5AF9H 2R3YA 4THNH 2PSXA 2BY8X 4WVPE 2FP7B 2VB0A 1QJ6B 3VXFH 1F0RA 1GI6A 1ANCA 2BQ7B 3QX5H 1K1OA 1ZSLA 2XRCA 3SUDA 3K6YA 1O3KA 2GCTC 5LPEA 2A4RA 1GI8B 5HM9A 1HAZB 1ZJKA 4X1NU 3E91A 1A1RA 1MAYA 1F7ZA 5SGAE 3B8JA 3R0FA 1IQGA 3ZZ5A 1AMHA 2BXUH 1TGCA 4K2YA 1J8AA 1GG6B 4Y79A 2O8TA 4UEHH 1C5WB 2B5TB 3ZYDA 4A1TA 1C2GA 3D62A 3TNSA 4ISOA 1C1MA 1UTOA 4GCHG 2QIQA 3LOXA 1S6FA 3STJA 2QXGA 2QCYA 3VEQB 1C2JA 1Y5UT 1GBCA 4WWYA 1HPGA 1SGTA 1HJ8A 2ZCKP 3MU5A 5DPAA 4Q80A 4KELA 1NFUA 4MVNA 1XUGA 4GAWA 2C90B 3M3TA 2GP9B 1G9IE 1KY9A 5EG4A 5GIBA 1NN6A 1E38B 3F9HA 1BRBE 1LMWB 1GVZA 2GZ9A 2FYQA 1CA0B 1P04A 1O5AB 3RXPA 3Q76A 1TBQH 2UUJB 4INLA 5F8TA 1OP0A 4XBCA 3ZZBA 4ZHLU 1IQEA 2G52A 3SHCH 1DDJA 3RMOH 1BTHH 2BB4A 1TX7A 2DUCA 4WXVA 3P92A 1JXPA 1TPSA 3PLKA 4E06H 2R9PA 1EXFA 3PTNA 2ALPA 4OGXA 4BTTB 3VB6A 1RS0A 4AGKA 2BDBA 3E0PB 2BDYA 4OS5A 1CA8B 1SGNE 1IQKA 4FU7A 3TH2H 1MUEB 4Z0KA 2ODPA 1HAVB 2J2UA 1XUFA 1A61H 1YYY1 1VR1H 1GBFA 2FIRH 1GHWH 2Z9IA 1AGJA 2EC9H 1FIWA 3LT3A 1NU7B 2PR3A 1P09A 2ZI2H 4X8UH 1K1IA 1UO6A 1ID5H 1V2TT 1UTNA 5A0CA 3RXEA 1HAXB 1EZUC 5JB9S 1TMTH 1VJ9U 4O3TA 1P2NA 2RDLA 2FX6A 3PMAB 1QL9A 3AASA 3TH4H 1O5FH 1AVXA 1GJ7B 1Y59T 1ZHRA 1TQ7B 3S9CA 2VGCC 2HALA 1Z6JH 3EA7A 1O37A 1AZZA 1HJAC 1YBWA 3QZQA 3ODFA 3F9EA 1C1SA 1UHBA 1SPJA 3HKJB 1G32B 3UREA 1V2OT 1BOQA 1IHTH 1HAIH 1D3DB 1QRZA 4ABJA 1N6XA 2VVUA 4GSOA 2R0KA 3UR6A 2P94A 1GHBG 2FOEA 6GCHF 4JZDH 4CRCA 2A5IA 2XXLA 4ZXYH 3UR9A 3SZNA 3DT0H 3Q77A 3RDZA 3M61U 3ZZ7A 3QUMP 3SORA 1HDTH 1INCA 2TGDA 1CBWB 2VGCB 2ZGCA 1KXAA 1TPOA 1Y5AT 4Y11E 2VWMA 1G3EA 3T5FH 4Q7ZA 1NRQH 1EP6A 4HFPB 4MQAA 3PWCA 1AWFH 1EASA 1K2I1 3L3TA 1Z8RA 2NWNA 1ESBA 3M7TA 1UVTH 3RLYH 3BEIB 1DXWA 3ZZ8A 1AUJA 1C5RA 1D9IA 2ZEBA 4CR5A 1GI0A 3F68H 1KSNA 5L2YH 2BD2A 2J92A 3NWUA 1O3EA 3KQCA 1O3MA 3DFJA 3U1IB 4Y8XA 3KF2A 1MTNB 3RM0H 1AD8H 2ZG0H 3KN2A 1ZYOA 4ZH8A 1OP2A 4MNVA 1BTWA 3LONA 5ESBA 1P8VC 7GCHG 3LGVA 4FVDA 1EAXA 1G3DA 2VJ1A 2NU3E 1C4Y2 1KYNA 1NC6A 3LGTA 4AB8A 3LH3A 1GI3A 2OC8A 1F0TA 1G36A 1FN6A 1ELAA 4MNYA 1AVGH 1O31A 4MNXA 1SGIB 4TPIZ 5EGMA 3LGUA 1RTLA 2P3TB 1OWEA 1YCPM 2ZU1A 1GBJA 4JK5A 2IPHA 2ZHEH 4AGJA 2QA9E 3ZZCA 1GMHF 1NM6A 1NPMA 2Z9GA 2BX4A 1YPLH 2GDDA 2VVVA 2PGQB 5A8YA 1T8NA 1O2WA 3SUEA 1FAKH 4U32A 4Q7YA 5FPSA 3EQ0H 1AWHB 3QZRA 1C1NA 1ZGVA 3SGBE 2R0LA 2F3CE 1FN8A 3KCGH 3FFGA 1A46H 3V12A 1P9UA 4Y76A 1C5SA 1TRMA 1L1NA 2BQWB 2CJIA 2V6NA 1O3AA 2O9QA 5DP5A 5FCRA 1YPGH 1QQUA 2V3HH 5ETXA 4JYTA 3BG8A 4H6SB 5DP9A 1K1PA 3GY3A 1C2LA 1K9OE 1QBVH 2AFQB 3M36A 1F2SE 2HPPH 3BTKE 1ELDE 4LZ4B 2YOLA 2AIQA 1F5KU 1TPPA 4NWLA 1XXFA 2WUCA 1ZMLA 4NSVA 1W11U 1EUFA 4J2YB 2QC2A 2ZHQH 3ELAH 3UOPA 3FANA 1NFYA 2Z9KA 3M7UA 4I8KA 9ESTA 1OWKA 1P2MA 3TJOA 1GJ9B 2W3IA 3RXJA 1AIXH 1Z8GA 2PSYA 4Y7AA 4DURA 4YOJA 2ODYB 4B74A 1TMBH 3HKIB 4CREA 2XTTB 3FAOA 4O3UA 5EXMA 1SFQB 4OS6A 3RXFA 5T6GA 3E3TA 2ZFPH 2F9PA 4ABEA 3ATKA 1MU8B 2R2WU 3RXTA 1LHGH 2BLVA 3LU9B 5JBBS 2CHAB 1FNIA 4X2VA 1SGEE 4YM9A 1TGBA 2H2ZA 5GWZA 8ESTE 1HAGE 1C1OA 4Q7XA 3I78A 1MH0A 2GD4B 1F0SA 3S9BA 1BHXB 1C9TA 1C1PA 3RXLA 2WYJA 1HXFH 2VNTA 4B71A 3LC5A 3BEFB 4CRBA 2AEIH 2GCHG 1Y3XA 3SI3H 1V2MT 3JZ1B 1BZXE 1DY9A 1C1QA 1F5LA 3EAJA 3R3GB 1NESE 1V2NT 5B6OA 3BTGE 2ZDAH 4NIVA 5F8ZA 1W0YH 2Y5HA 1UCYH 2FLBH 1ORFA 1G2LA 2OC1A 1UTPA 4CH2B 3D23A 1ZMNA 1TGTA 1C1RA 1ZJDA
chains in the Genus database with same CATH superfamily
1W8BH 1T8LA 4ZHMU 2WPKS 2A32A 2WINI 1GJ4H 1S85A 4AG1A 1A7SA 1NS3A 1UTJA 4GPGA 1BTZA 3BSQA 3TJUA 4BOHA 2ZGXH 2STBE 4Q4LA 1GI7B 2BLQA 2ZKSA 1RTFB 4I7YH 1FPHH 1MD7A 2PWXA 4O97A 4X6PA 6CHAC 1EZXC 2AH4X 3A85A 4NA9H 4NSYA 1OHHD 4FUCA 4IGDA 2A31A 1LQEA 5DGJA 1PQAA 4A5TS 3VB5A 4ACAA 1V3XA 1SFIA 1D6WA 1DUEA 3SJ9A 1DOJA 4Y0ZE 1EX3A 5JDUB 4F4OC 3VB7A 4F49A 4OS4A 2CGAA 1C5MD 1CQQA 2TIOA 3O8CA 2O8LA 3FZDA 1BB0B 4K1TA 2Y80A 1P2OA 1V2QT 2QY0B 3PV5A 4I33A 4M7GA 3I29A 3PM3A 2J95A 5TCAA 1C2EA 6CHAB 4Z1MD 4FUEA 1PJPA 1WV7H 4LOYH 2CF9H 3RU4D 1XKBC 2Y6TA 3TJVA 1TRNA 2Z9JA 2SGAA 4ZHAA 2GMTC 1S0QA 1EB2A 1O2JA 1DT2A 1ZRKA 1MMJN 2HNTC 3QGNB 2IN2A 4GCHF 4MPVA 3SV9A 4ABFA 1N8OB 1UVUH 2BD8A 1C1TA 1LVMA 3A88A 2C93B 3AAUA 1HAPH 2Y82A 1J16A 3OE7D 3QTOH 1Z8JB 1HAOH 1V2UT 2NU0E 2ZFFH 1QA7A 5C1UA 4MDSA 1O30A 1CGHA 4AN7A 5EPYA 3RXMA 2BDCA 3T62A 1LPGB 1OP8A 2Q6GA 1TQ0B 2KCPA 3O8DA 1QBNA 3ZIAD 2K1QA 4X1RU 1AKSA 1EOJA 1ZZZA 1C2FA 1FY4A 1LCYA 2CMYA 3A7TA 3PMJA 5H4IB 1TNKA 3MI4A 1DVAH 3B23B 1BTYA 4R8TB 5F8XA 2HLCA 3GICB 1SGDE 4ACBA 3DSOA 3M3VA 4HZHA 3PMBB 1SOZA 3FVFB 3RC6A 2OXSA 1HUTH 1BMLA 1VZQH 1VJAU 5LH8A 2Q6FA 2C8WB 1QIXB 2FO9A 3QDZB 1O2IA 3BTTE 4BXSA 1C5PA 1O2HA 1BTPA 1GBAA 2OQ5A 2ILNA 4ZUHA 1G2MA 1GPZA 1CU1A 4CRGA 1OS8A 3VGCC 2M2AA 1YPHC 1NRNH 1KLIH 3SGAE 3K9XB 4B76A 2J97A 1QL7A 1UTQA 1RIWB 3OEHD 1V6DA 1W2KH 2KZ4A 3A7WA 1OWIA 3N99A 1GL0E 1L4ZA 1E36B 1UHBB 1GL1A 1WSSH 4KTSA 5EODA 2WPHS 1B5GH 1OPHB 2UUYA 3HATH 1MKXK 1UW7A 1H9LB 3UNRA 1O3CA 1SHYA 2Q1JA 1BDAA 3QTVH 1YF4A 4K1SA 3UTUH 5EIYA 3SV6A 1HCGA 1B7XB 2FS9A 1O5DH 4ZKNU 1FXYA 2OC7A 2BZ6H 2ODQA 4IS5A 3F2FA 4X6MA 1EQ9A 3GCHC 4U01A 3VGCB 4JCNA 3DSPA 4FUHA 4B2BA 4B75A 3GY5A 1O2SA 4B73A 4GHQA 2FM2A 1WCZA 2Z6BD 4P00A 2J38A 4XRNA 2QV1A 1GHBF 1FV9A 3PTBA 4B1TA 5K0HA 1WXRA 1EP5A 2UUKB 1C5TA 4E05H 4ABDA 1TOCB 1HIAA 1EKBB 3NPSA 1MBMA 1Q3XA 4AFQA 3PYHA 1DITH 3SZEA 4YLUA 2VWOA 4D76A 2AMQA 3AW0A 2VIVA 4X8VH 1XM1A 3KQ5A 3A8AA 2ZDVH 3SQEE 1MAXA 2ZFSA 5K7RA 4ASUD 3SV7A 1BHXF 3TNTA 3FN8A 3ZV8A 1KTSB 3DA9B 2GCTB 4YOGA 1G30B 1S81A 4FU9A 2BLWA 2FI5E 1CT4E 3U69H 1TBZH 4DVAU 2BYAX 1G3BA 1E79D 2BOKA 1IQHA 2XW9A 3NRLA 1MQ6A 5F6MA 2G4TA 2BDIA 3OYPA 4NZQA 2BMGB 4Q2KA 3LPRA 3DHKH 1P02A 1F0UA 2TGTA 1MQ5A 3IG6B 2ZCLP 3IITA 4NIYA 3RXBA 1SGCA 3SU5A 2W26A 4CRAA 1RFNA 4JZFH 1PPEE 3A87A 4B6EA 4YOIA 2G4UA 3TIUA 4GLYA 3BG4C 4WMFA 3AAVA 1A3BH 1O3FA 1PPCE 2FZZA 5HM2A 1QGFA 1ZGIA 2GT8A 5LGOA 3TGKE 1C2IA 1WBGB 3QK1A 3A89A 5CHBA 1D6RA 5FXLA 1DLEA 3S0NA 1NROH 1AHTH 4AFUA 1AO5A 4JZ1A 3ZZ3A 4JMYA 1V2KT 3UY9A 1AVWA 2QXHA 7GCHF 3MU0A 3OEED 1XVMA 1S5SA 2GTBA 4Z6AH 4X2WA 3RXIA 3W94A 4I8GA 2XCFA 1ABIH 4A92A 2Y7XA 5GCHG 2PHBA 3OSYA 5T6FA 1MKWH 3GCNA 1GBEA 1W13U 2OK5A 3SI4H 3NZIA 1OWDA 1UCYE 2HRVA 1HV7A 1XXDA 2HOBA 3BV9B 2AS9A 1VGCC 2P95A 4TT3D 5TJXA 4CH8B 3GDUA 1ZMJA 2BD5A 3MU8A 4HTCH 3TH3H 1H4WA 3PRBA 1WUNH 1WQSA 1A0LA 3WWFA 2ZWLH 1FQ3A 3MFJA 3SU1A 1O2YA 2UWLA 4DGJA 2FMJA 4JZEH 3SW2B 4CR9A 1UJ1A 4NIXA 3BTME 4NWKA 2O8UA 1QFKH 5EXLA 1V2PT 3LGYA 2A1DB 2XYAA 1PPHE 1QJ1B 1F5RA 2SGDE 2ZGJA 1AB9C 1HRTH 1TMUH 2P16A 1V2JT 2XC4A 3FP8E 1QBOA 1DE7H 2H5DA 2Z7FE 1CHOG 3BTFE 4I31A 1UVSH 2A4GA 2RFKC 1O2LA 3F9GA 5T6DA 1T4UH 1JIRA 1V2WT 4TSFD 2J98B 2CK3D 1BCUH 1DWBH 3MNBA 5HIYA 2Y5FA 1ELVA 2Z3DA 1YPJH 5C17A 1VITG 3KHVA 1THPB 1NY22 3ZVGA 3RU4T 5JBAS 4IW4E 1KLJH 5FHTA 3HPTB 2A5KA 1O5GH 2ZHFH 1RGQA 1PFXC 2KM0A 2ZP0H 1EB1H 3SUFA 1QJ7B 1H1BA 1O3OA 3LKWA 2YNBA 3T25A 1L1GA 3PB1E 5FBIA 1O5EH 3LIWA 2WUBA 3M5MA 1C2KA 4WJG2 3ITIA 4CHAC 4INHA 1AB9B 1LVOA 4ZROA 3I77A 3LDXH 4Y7BA 1HJAB 4GVUA 1H9HE 1Z1IA 2ZC9H 4WH8A 1Z7KA 4A1VA 1C2MA 1XUJA 2SFAA 2BDHA 3LJJA 2K0QA 3FO8D 2PTCE 4BTUB 5C20A 3U1JB 4HGCA 2PFEA 3MNSA 1W12U 1IQIA 2AGIX 1YKTA 3GISB 2HNTF 5CHAC 1EZSC 4OS7A 4X2XA 1K1LA 3RXRA 2BY6X 1T32A 1H8HD 2VIQA 3HK6B 2BD9A 1DWCH 1LVBA 3SOSA 2VWLA 2BD4A 1Z71A 1P2KA 5FL7D 1YC0A 3P70B 2KAIA 1TLDA 3E6PH 1XX9A 1PPZA 1KXFA 2OC0A 4X8SH 2ZQ1A 4MPXA 1SGPE 2GCHF 3MWIU 8GCHF 2Y7ZA 5EJZA 2B7DH 4TPYA 1W7GH 3RC5A 1BMNH 1WU1A 1YGCH 5ESTE 4XE4A 2WPMS 9LPRA 1XUIA 1DFPA 1O2OA 3AVZA 1BUIA 3MMGA 3NCLA 2PP6A 3GY7A 5G4BA 1O3IA 3K65B 1E37B 2G81E 4DW2U 1Z1JA 1BBRK 1XMNB 1RD3B 1LKBA 1O3JA 2D1JA 4FU8A 3RXVA 2ASUB 1AU8A 3ATLA 4RKJB 1C5YB 1OOKB 2FEQH 4AB9A 4DIHH 1LDTT 5E2PA 2HVYB 3QN7A 1ELBA 3LJOA 3UQOA 4AFZA 2C8XB 1W7XH 4Y8ZA 5C1YA 3BEUA 3KIDU 1ELCA 1N6YA 2RA3A 3MU4A 5E8EH 2H1UA 2J4IA 1IAUA 2FX4A 3EDXB 2BVXH 2PV9B 2BTCE 1Y5BT 1DPOA 2G8TA 4O03A 7ESTE 2V3OH 1H9IE 5AFZH 1ARCA 1GHZA 4BAKB 4WF8A 4JZIA 1ETSH 3G01A 2FI4E 5A8ZA 2FOGA 3ZZ9A 1LHCH 2OLGA 2PUQH 1A3EH 4KKDA 2H5CA 1GMDG 1OYTH 1NZQH 1GJ8B 2ZA5A 4O9VA 5HMAA 5JB8S 4GHTA 5A0AE 2XBXA 2DE8A 1LKAA 2NU4E 1NRPH 3UAIC 3P17H 3WY8A 1N1LA 4LK4A 1O2QA 3SNEA 1Q31A 5KECA 1HJ9A 4K3JA 3A80A 4OS1A 4ABHA 2OBOA 1ELFA 1J9CH 1L0ZA 3KQEA 3GY4A 2JH6D 2G5NA 1P05A 4Y6DA 1TGNA 1J15A 1DICA 2FODA 2TPIZ 1LHDH 3HGPA 2FXRA 2SNVA 2OINA 2LNCA 1P2JA 2DE9A 4TYDA 1TA2A 1COWD 1KDQA 1G3CA 2LIZA 1LVYA 4I8JA 3F9FA 2F4LA 2C3SA 1AKSB 3MYWA 4HI3A 1GGDC 1AE8H 3GY6A 3UNQA 1QHRB 5DK1A 5JPMH 1SGYE 3RXHA 4ASHA 1OYQA 5C67A 3T29A 3MOCA 1P12E 2W7SA 1FMGA 1TONA 1DS2E 2ZTZA 1QY6A 1K1MA 1SBWA 1C2DA 1BTXA 2QXJA 2STAE 3SU0A 3ZZDA 5FPYA 3RU4E 2CF8H 3RMMH 2GGVB 1UK2A 4YT7H 5C0TA 4KTUA 3P95A 1B0FA 1MBQA 1BRAA 3UWJH 1OSSA 3ZVDA 1E0FD 1EAWA 4BAMB 3RC4A 1TNIA 2VBCA 4AX9H 3SNDA 3ENSB 3V7TA 4ABBA 3SNCA 1CSOE 1BRUP 4XFQA 2FI3E 2EA3A 2WV4A 3SU6A 1QR3E 2NU1E 5JYIA 2Z3EA 2QYIA 4AORA 3KEEA 4X1PU 1QTFA 2ALVA 2WPIS 3A84A 2A2XH 3GOVB 3Q3KA 2WZQA 3A8BA 1H8IH 5GPIB 1A2CH 1CE5A 2P8OC 5A09A 3TPIZ 3ZVAA 2L6OA 3C1KA 4ZAEA 4YZUA 3B9FH 2GT7A 1GI4A 4K1EA 3OU0A 4AG2A 4MPWA 1ESAA 3EE7A 2BDAA 3U8TH 2VWNA 5KEDA 3OFND 1VCPA 3D65E 4ISNA 4LXBH 2J34A 1A4WH 1PYTC 1Y3WA 1HAYB 1L1JA 5J4QA 3BTQE 4I8HA 2JKHA 4NIWA 5DJ7A 3TK5A 2H9HA 1W0ZU 2B0FA 1SGFA 3UPEA 1JMOH 4FVBA 1SQOA 5FX5A 1O3GA 2WV5A 3P8NA 2BQ6B 5HGGA 1O3LA 1UTLM 1SLUB 1O2MA 4WMDA 3BTHE 4FUDA 1YWUA 2QN5T 2BD7A 1BJVA 1SLVB 1GBKA 2P93A 1TPAE 1HIAB 2OQUA 4JYUH 5IDKA 1QRXA 3D49H 4K60A 4XD7D 1DY8A 1L4DA 4CRDA 3TJNA 1LHFH 2D2DA 1DWDH 2SGPE 2IOTA 5T1VA 5DN6D 3A8CA 2GZ7A 1NT1A 1Z8IB 1EPTC 2A7CA 3UUZA 4ABAA 3TGIE 2TGAA 2BY7X 3L33A 8LPRA 2PW8H 4RN6A 2M5TA 4FUGA 1FX0B 1SGRE 2SNWA 4A1XA 3MQKC 3RXGA 2ESTE 3AW1A 1GHYH 3SU4A 2BY5X 1GI1A 4RSPA 4H4FA 2P3UB 5GNDA 2OP9A 2ZU4A 4FUJA 3SHAH 2GDEH 2PKSC 5CE1A 2JH0D 1ELGA 2A7JA 3CS7A 3FP6E 2AMPA 5L2ZH 5DO4H 4FUBA 1TGSZ 1BBRH 1QCPA 4H6TA 1GHAG 2GMTB 3F2HA 1D3TB 3MH7A 1EATA 1ZTLA 2F9VA 2ZHDA 4UDWH 4OGYA 4UFFH 4ZKSU 4YESB 3M35A 2Z9LA 1EJMA 3Q00A 3P8FA 3S7HB 2XBWA 4CRFA 1IHSH 2A2QH 3ZZAA 4SGBE 2GKVE 1MCTA 1K28D 4Y8YA 2PLXA 1SKYE 2ZZUH 4XBBA 5JBCS 3U28C 5AFYH 2W3KA 1HBTH 4YT6H 5LPFA 1EOLA 2VIOA 4TY6A 1YY3A 5GCHF 5CMXH 3SJKA 1O2ZA 2JETC 4K8BA 3P8OA 2FESH 5C94A 1C5ZB 3H5CB 3ZVBA 1CVWH 2J9NA 3MU1A 2UWOA 3KL6A 2KCAA 3MNXA 4ISIH 1C1UH 3ZZ6A 4XBDA 3UOUA 1BMAA 4WH6A 2EY4C 1C5NH 1SQAA 5FPTA 4VGCC 1RTKA 2I6QA 3T28A 1C2HA 1ZTJA 2ZNKH 1P0SH 1O2RA 2BX3A 2F9OA 4TWYA 3ZZ4A 1KXEA 2W6JD 2F83A 1ZHPA 2VIDA 4Q63A 2B9LA 5C3NA 2V35A 1SC8U 3ZVFA 1D4PB 1Y3VA 1KTTB 1U6QA 5DG6A 5GJ4B 4ESTE 2IJD1 5E0JA 4ZKOU 1GG6C 3QLPH 3A83A 1O2GH 3T26A 5LPRA 1FONA 1O35A 1AUTC 2F9NA 4NA8A 4NCYA 1GBMA 3SNAA 1O2PA 5GDSH 3S7KB 3SU3A 1VITF 1MTWA 1NRRH 4OM9A 2XCNA 4VGCB 5DP8A 4BANB 1THSH 1VCWA 5J4SA 1O3HA 1W0JD 1S6HA 2WPDD 1ZPBA 3STIA 1WAYB 4NFEA 1QURH 2YNAA 1BTUA 3UIRA 4X0WU 2F43B 2IPQX 1UVPA 3RP2A 2L74A 3ATWA 5FBEA 1P01A 1SI5H 2OUAA 1CA0C 4WMEA 1EZQA 3RXDA 3V13A 4B2CA 1SR5C 5E0GA 4DT4A 4FXGH 4X1QU 3GCHB 4X6NA 2ZPRA 1J17T 2JJ2D 2BHGA 5L6NH 1MCVA 1DXPA 1O2NA 2PKAA 2FOHA 2RDEA 2KAIB 2KCYA 1C5QA 1ANEA 1LQDB 2PUXB 2QF4A 2W6ID 1P9SA 1P03A 3OY5U 5A8XA 2VH0A 4XOJA 1PPBH 2UUFB 1HNEE 4IBLH 2CN0H 3MO9A 2AIPA 3F6UH 3URDA 4DY7B 1BT7A 1OXGA 2BVRH 1TNGA 3SQHE 5C0UA 4DIIH 1ZLRA 7KMEH 1NFXA 1SG8B 5BPEA 1WYKA 3PLPA 2H6MA 3L6PA 4IN2A 1BITA 1LHEH 3CENA 2A7HA 1FLEE 1CGJE 4AOQA 3OX7U 3CP7A 3GDSA 5I25A 3NUMA 1JRSA 1SB1H 2ZF0H 2A45B 1O0DH 1GBTA 1ANDA 4AYVB 1J14A 2D26C 1SMFE 1SLXB 3SJ8A 1EPTA 1AY6H 1C1VH 1C5LH 1GMCG 1SGFG 1TABE 1ELEE 1TBRH 2IJOB 4BTIB 1IOEA 4I8LA 2EI8A 5EW1H 1EJAA 1P3CA 4UFGH 1YCPK 1QB9A 5FX6A 1MTVA 4WXIA 4IN1A 5C5NA 2ZU2A 1HGTH 3A7ZA 1H8DH 1CGIE 4KGAA 3GCTG 2HNTE 3BG4B 4Y0YE 5BRRE 1EJNA 1FJSA 2EEKA 4D9RA 1ZSKA 2AMDA 4IC6A 1GVLA 2SGQE 1ZR0A 4PROA 1JWTA 2R2MB 1GBBA 3ATIA 2ULLA 4MG3A 3UFAA 3O8BA 1X7AC 5HIZA 3SJOA 1GVKB 1UCYK 2ZU3A 3GDVA 1DANH 4QT8C 5EQSA 1FZZA 3V3MA 1YPEH 3ZV9A 4E7RG 2WHXA 1AZ8A 2ANMH 2JH5D 3U8OH 2XBVA 3EA9A 5AVDA 3AK5A 4AZ2B 1WTHD 1M9UA 1VGCB 3BTEE 1FY3A 5C1XA 1V2RT 1GJCB 1KXCA 3HGNA 4X2YA 1AN1E 1PQ7A 2AERH 1ETRH 1W0KD 1EAIA 3LH1A 5EXNA 1GMDF 1CT0E 2WV9A 3MHWU 1CBWC 4I32A 5ABWA 6ESTA 4K8YA 1G37A 3RMLH 1YPMH 1PYTD 1OX1A 1AFEH 2FWWA 1A0JA 4NGAH 1KDQB 1T4VH 5EPNA 2D8WA 2FOBA 4RI0A 1GI5A 2ZDNA 2ZCHP 3N7EA 3SO3A 2SGFE 1IQMA 4NA7A 2W5EA 1BJUA 3SV2H 1HAHH 3PV2A 3BN9A 3EA8A 1XUKA 1Y3YA 4NFFA 2Z94A 3RXUA 1GHXH 1ZPZA 2A5AA 5EOKA 1ZSJA 3RXOA 1KIGH 1S82A 2BD3A 3GCOA 2TBSA 1SQTA 1YPHE 3GY8A 1UTKA 3KQBA 1MTNC 3E90B 2EI6A 1O5BB 1PQ8A 4U30A 2K7XA 1RXPA 2WPLS 3E0NB 4Y71A 1P10A 1VITH 1ZPCA 1YLCA 1C1WH 3PV4A 2ZDLA 1NBMD 3LGWA 1ESTA 1K1JA 4BAQB 1DSUA 1Y3UA 1GDQA 1NFWA 2QAAA 2ZFQH 1AQ7A 3M3SA 1KXDA 3PROA 4CHAB 1O33A 2G51A 1TE0A 1DX5M 1HXEH 4YO9A 1Z6EA 3UQVA 5FCKA 2JIZD 4UE7H 1O34A 3T27A 1BMMH 1D3PB 3UWIA 3M37A 5DKMA 4DOQA 1B0EA 5EU8A 1BBRE 4YTAA 2PTNA 1T31A 2ZQ2A 1HFDA 1P2QA 2SGEE 2BDGA 2EI7A 5C5OA 2VIWA 3MO3A 5CHAB 1XVOA 3E1XB 2Y81A 2TRMA 3WW7A 4D8NA 3PWBA 1OWJA 2Q6DA 4SGAE 1SHHB 1ELTA 1HB0B 1QRWA 1XKAC 3FOAA 5IYTA 2OCVB 3CS0A 2G55A 1PPGE 3H7TA 3RMNH 2ANYA 3T2NA 2LELA 4B6FA 7LPRA 1MKXH 1A0HB 1DLKB 4NZLA 2ZIQH 4AFSA 2ZDKA 1P57B 1F92A 4XSKU 2QF0A 1GBIA 1ARBA 3LC3A 1SSXA 1GJ6A 1GI9B 4GUXA 2QF3A 2J94A 3TVJB 4YXWD 3PMHB 4LZ1H 1C4U2 3MO6A 1V2LT 3RLWH 2YMSC 3NKKA 3PO1C 8KME2 3KGPA 3QO6A 3A82A 5GXPA 2FOMB 1UVOA 1L2EA 1HAVA 2GV7A 3SJIA 2RCEA 4RKOB 2R3UA 3KYGA 1GJ5H 1MTUA 5T3HA 1IQFA 2ZDMA 1T8MA 1FY5A 1TYNA 5IK2D 2W7UA 1K1NA 1DM4B 2AYWA 3A86A 1LTOA 2Y5GA 3W1EA 1FY8E 4BAOB 1MU6B 1FAXA 1WTGH 3SBKA 1PPFE 3Q3YA 2FS8A 1O3BA 3RUOA 2ZFTA 4ZXXH 4FETA 3EE0B 1UK3A 3Q3XA 3PO1B 2F9BH 1GJAB 1BIOA 1RRKA 3TK6A 5DP4A 1FDPA 3GS9A 1O36A 2RG3A 3TK9A 1KXBA 6LPRA 3DD2H 4ABGA 3HK3B 1THRH 2CHAC 2Z3CA 1YM0A 1QB1A 2XWAA 3KYFA 3W95A 1JBUH 1TX8A 1V2VT 3IWMA 6GCHG 1QL8A 4YLQH 1C5XB 1TWXB 3TGJE 1O2VA 2J98A 3DUXH 1IQJA 5FAHA 3O8RA 2BM2A 3DSGA 3ZVEA 2A0QB 2G00A 5DP6A 1PQ5A 1Y8TA 2FYRA 4JYVH 1W3CA 1ZHMA 1O39A 3M7QA 3OY6U 2A4OA 4ISHH 3EGKH 3BF6H 1Q2WA 3ZYEA 1IQLA 5DP7A 1DWEH 1NTPA 2RA0A 2XWBI 3MH6A 2O8MA 1O3NA 3SU2A 1YCPH 1MZDA 3VB3A 1KLTA 1GWAA 1C5VA 1GHAF 1AFQC 1A5IA 4AYYB 1ZRBA 2HLDD 2ZHWH 2ZTXA 3OTJE 2TGPZ 4RT1A 4A7IB 5JBTA 3RXQA 1GGDB 4TWWA 2VH6A 3VPKA 3EBNA 2HWLB 8GCHG 1TA6A 3S9AA 3RXCA 2HPQH 5CDFE 2KFWA 2AGEX 1EAUA 2XC0A 4MTBA 5EQQA 1O32A 1RJXB 1S83A 2ZPSA 3BTWE 1CT2E 2XBYA 5AHGH 4WY3A 3GYLB 1C4V2 2BVSH 1LPZB 4UONA 3SGQE 3RXKA 1LPKB 5PTPA 1SOTA 2O8WA 4Y10E 1YPKH 3CNRA 4MPUA 2FOFA 3K6ZA 1JRTA 2VVCA 3TITA 2PGBB 2OD3B 1AFQB 1A5GH 1BRCE 1FI8A 4J1YA 1D3QB 2JDID 1O2XA 1K22H 4R0IA 2C8YB 2C4FH 4FUIA 2I6SA 4A6LA 4MLFB 3UNSA 2ZECA 1TAWA 1GMHG 1S84A 3VB4A 1GBHA 3RXSA 3MH5A 1QA0A 4BAHB 1AE5A 1FPCH 2BZAA 1JOUB 1FUJA 3ATMA 1V2ST 4K5ZA 3SN8A 1S0RA 4IMQA 2FLRH 3P6ZB 2FPZA 3PRDA 1GI2A 4ABIA 1C9PA 4IMZA 2WYGA 1VKYA 3V0XA 3BIVH 4B2AA 1UK4A 2P8OB 3QWCH 1DUAA 1AI8H 1SLWB 1MKWK 2V3MA 1ABJH 4NG9H 5EJLA 1OWHA 1OKXA 1GBLA 1MD8A 3GY2A 2ZO3H 3ESTA 4X1SU 2VU8E 1E34B 1TRYA 2ANWA 1P11E 2BY9X 2ZGBH 2ZGHA 4UFEH 1VCQA 2V7QD 1TB6H 4UFDH 4DT7B 1W14U 1CHGA 1N8OC 4X8TH 1TIOA 2XNIA 2VIPA 3MH4A 4INKA 3TLOA 4XDEA 3P8GA 4M9FA 4OS2A 3SNBA 1DSTA 2FOAA 2GVFA 5HXFA 1FY1A 5A0BA 4K69A 4CBOA 3FP7E 2FOCA 4H42U 4ISLA 3MNCA 2PKAB 2ZTYA 4D7FA 1GCTC 1TNJA 2OBQA 2JJ1D 3N7DA 1T8OA 1TFXA 1C5OH 4ZKRU 1O38A 5I46H 3VFEA 1JIMA 2GV6A 2NU2E 2THFB 1GDUA 2F91A 2QXIA 5F03A 3ODDA 1GCDA 3KQDA 2GZ8A 2AHME 1BQYA 1O3PB 4FUFA 2UWPA 5C2ZA 1FIZA 3EYDA 3SV8A 3A7VA 4BXWA 1C5UA 2K8IA 2VINA 4U2WA 1K0HA 2QE7D 3A81A 2CXVA 2P3FH 3M5OA 3A8DA 5E2OA 4BNRA 1TNHA 3H7OA 3U9AH 2AGGX 3E16B 5TCCA 3F1SB 3A7YA 4TY7A 4UD9H 1ZOMA 1EPTB 4DJZB 1GCTB 1E1QD 1S6LA 1TX6A 1LO6A 3ZVCA 1ETTH 2KX4A 3NXPA 2A4QA 2HVXA 1UTMA 1ACBE 1GHVH 1W10U 2FDAA 2G5VA 3M5LA 2BOHB 4JK6A 3KNXA 4D9QA 1YP9A 5EQRA 3GYMA 1NRSH 1NU9A 3NK8A 2F9UA 1TALA 3QGJA 4IC5A 2ZPQA 2ZU5A 4KP0A 1GBDA 3K2UA 2H9EH 2H9TH 1ANBA 3VXEH 2PKSB 1BA8B 1GMCF 3FZZA 4MNWA 3U8RH 2WPJS 3U98H 2OTVA 1O3DA 1O2KA 2C8ZB 1RIWC 2XC5A 4ZMAH 4CBNA 1QB6A 2FTMA 2QGRA 1ZTKA 4D7GA 1SGQE 3M5NA 3TU7H 1QQ4A 5HYOA 2ANKH 2V0BA 3A7XA 1TNLA 2CV3A 1E35B 1BMFD 1GJBB 5KGOA 5EW2H 2BXTH 1P2IA 1NO9H 3LGIA 2HGTH 1MZAA 1K21H 1XUHA 3MTYA 2LPRA 1HLTH 1WQVH 3GCTF 3C27B 5E0HA 3RXAA 2GX4A 1A5HA 2P59A 3BTDE 3JZ2B 4KTCA 2XOKD 1GDNA 3N7OA 1GJDB 3PLBA 2B8OH 5A2MH 4E7NA 1YLDA 1QNJA 3RM2H 1O2TA 4X6OA 2BLOA 3E8LA 1QZ8A 3SUGA 1O5CB 4RT0A 2FTLE 1P06A 1MTSA 1TOMH 5DP3A 5L30H 2ZFRH 2JETB 1IQNA 1HYLA 3DFLA 1SVPA 4DG4A 1O2UA 1UMAH 3BIUH 1P3EA 1WOFA 3S69A 3URCA 1SL3A 1CHOF 4DCDA 1T7CA 1KMHB 1CO7E 5AF9H 2R3YA 4THNH 2PSXA 2BY8X 4WVPE 2FP7B 2VB0A 1QJ6B 3VXFH 1F0RA 1GI6A 1ANCA 2BQ7B 2YMSD 3QX5H 2KCOA 1K1OA 1ZSLA 2XRCA 3SUDA 4ZCNA 3K6YA 1O3KA 2EQNA 2GCTC 5LPEA 2A4RA 1GI8B 5HM9A 1HAZB 1ZJKA 4X1NU 3E91A 1A1RA 1MAYA 1F7ZA 5SGAE 3B8JA 3R0FA 1IQGA 3ZZ5A 1AMHA 2BXUH 1TGCA 4K2YA 1J8AA 1GG6B 4Y79A 2O8TA 4UEHH 1C5WB 2B5TB 3ZYDA 4A1TA 1C2GA 3D62A 3F0PA 3TNSA 4ISOA 1C1MA 1UTOA 1YLNA 4GCHG 2QIQA 3LOXA 1S6FA 3STJA 2XNDD 2QXGA 2QCYA 3VEQB 1C2JA 1Y5UT 1GBCA 3F0OA 4WWYA 1HPGA 1SGTA 1HJ8A 2ZCKP 3MU5A 1SQRA 5DPAA 4Q80A 4KELA 1NFUA 4MVNA 3WWBA 1XUGA 4GAWA 2C90B 3M3TA 2GP9B 1G9IE 1KY9A 5EG4A 5GIBA 1NN6A 1E38B 3F9HA 1BRBE 1LMWB 1GVZA 2GZ9A 2FYQA 1CA0B 1P04A 1O5AB 3RXPA 3Q76A 1TBQH 2UUJB 4INLA 5F8TA 1OP0A 4XBCA 3ZZBA 4ZHLU 1IQEA 2G52A 3SHCH 1DDJA 3RMOH 1BTHH 5DSFA 2BB4A 1TX7A 2DUCA 4WXVA 3P92A 1JXPA 1TPSA 3PLKA 4E06H 2R9PA 1EXFA 3PTNA 2ALPA 4OGXA 4BTTB 3UB0A 3VB6A 1RS0A 1NBME 4AGKA 2BDBA 3E0PB 2BDYA 4OS5A 1CA8B 1SGNE 1IQKA 4FU7A 3OTPA 1MUEB 4Z0KA 3TH2H 2ODPA 1HAVB 2J2UA 1XUFA 1A61H 1YYY1 1VR1H 1GBFA 2FIRH 1GHWH 2Z9IA 1AGJA 2EC9H 1FIWA 3LT3A 4P02A 1NU7B 2KR7A 2PR3A 1P09A 2ZI2H 4X8UH 1K1IA 3SYJA 1UO6A 1ID5H 1V2TT 1EFRD 1UTNA 5A0CA 3RXEA 1HAXB 1EZUC 5JB9S 1TMTH 1VJ9U 4O3TA 1P2NA 2RDLA 2FX6A 3PMAB 1QL9A 2WSSD 3AASA 3TH4H 4AC9A 1O5FH 1AVXA 1GJ7B 1Y59T 1ZHRA 4F48B 1TQ7B 3S9CA 2VGCC 2HALA 1Z6JH 3EA7A 1O37A 1AZZA 1HJAC 1YBWA 3QZQA 3ODFA 3F9EA 1C1SA 1UHBA 1SPJA 3HKJB 1G32B 3UREA 1V2OT 1BOQA 1IHTH 1HAIH 1D3DB 1H8ED 1QRZA 4ABJA 1N6XA 2VVUA 4GSOA 2R0KA 3UR6A 2P94A 1GHBG 1WDIA 2FOEA 6GCHF 4JZDH 4CRCA 2A5IA 2XXLA 4ZXYH 3UR9A 3SZNA 3DT0H 3Q77A 3RDZA 3M61U 3ZZ7A 3QUMP 3SORA 5HKKD 1HDTH 1INCA 2TGDA 1CBWB 2VGCB 2ZGCA 1KXAA 1TPOA 1Y5AT 4Y11E 2VWMA 1G3EA 3T5FH 4Q7ZA 1NRQH 1EP6A 4HFPB 4MQAA 3PWCA 1AWFH 1EASA 1K2I1 3L3TA 1Z8RA 2NWNA 1ESBA 3M7TA 1UVTH 3RLYH 3BEIB 1DXWA 3ZZ8A 1AUJA 1C5RA 1D9IA 2ZEBA 4CR5A 1GI0A 3F68H 1KSNA 5L2YH 2BD2A 2J92A 3NWUA 1O3EA 3KQCA 1O3MA 3DFJA 3U1IB 4Y8XA 3KF2A 1MTNB 3RM0H 1AD8H 2ZG0H 3KN2A 1ZYOA 4ZH8A 1OP2A 4MNVA 1BTWA 3LONA 5B6LA 5ESBA 1P8VC 7GCHG 3LGVA 4FVDA 1EAXA 1G3DA 2VJ1A 2NU3E 3H09A 1C4Y2 1KYNA 1NC6A 3LGTA 4AB8A 3LH3A 1GI3A 2OC8A 1F0TA 1G36A 1FN6A 1ELAA 4MNYA 1AVGH 1O31A 4MNXA 1SGIB 4TPIZ 5EGMA 3LGUA 1RTLA 2P3TB 1OWEA 1YCPM 2ZU1A 1GBJA 4JK5A 2IPHA 2ZHEH 4AGJA 2QA9E 3FKSD 3ZZCA 1GMHF 1NM6A 1NPMA 2Z9GA 2BX4A 1YPLH 2GDDA 2VVVA 2PGQB 5A8YA 1T8NA 2J5UA 3F3BA 1O2WA 3SUEA 1FAKH 4U32A 4Q7YA 5FPSA 5F53A 3EQ0H 1AWHB 3QZRA 1C1NA 4F55A 1ZGVA 3SGBE 2R0LA 2F3CE 1FN8A 3KCGH 3FFGA 1A46H 3V12A 1P9UA 4Y76A 1C5SA 4I86A 1TRMA 1L1NA 2BQWB 2CJIA 2V6NA 1O3AA 2GJGA 2O9QA 2YMSB 5DP5A 1YPGH 1QQUA 2V3HH 5ETXA 5FCRA 4JYTA 3BG8A 4H6SB 5DP9A 1K1PA 3GY3A 1C2LA 1K9OE 1QBVH 2AFQB 3M36A 1F2SE 2HPPH 3BTKE 1ELDE 4LZ4B 2YOLA 1MABB 2AIQA 1F5KU 1TPPA 4NWLA 1XXFA 2WUCA 1ZMLA 4NSVA 1W11U 1EUFA 1E1RD 4J2YB 2QC2A 2ZHQH 3ELAH 3UOPA 3FANA 1NFYA 2Z9KA 4HG6A 3M7UA 4I8KA 9ESTA 1OWKA 1P2MA 3TJOA 1GJ9B 2W3IA 3RXJA 1AIXH 1Z8GA 2PSYA 4Y7AA 4DURA 4YOJA 2ODYB 4B74A 1TMBH 3HKIB 4CREA 2XTTB 3FAOA 4O3UA 5EXMA 1SFQB 4OS6A 3RXFA 5T6GA 4FOUC 3E3TA 2ZFPH 2F9PA 4ABEA 3ATKA 1MU8B 2R2WU 3RXTA 1LHGH 2BLVA 3LU9B 5JBBS 2CHAB 1FNIA 4X2VA 1SGEE 4YM9A 1TGBA 2H2ZA 5GWZA 8ESTE 3OAAD 1HAGE 1C1OA 4Q7XA 3I78A 1MH0A 2GD4B 1F0SA 3S9BA 1BHXB 1C9TA 1C1PA 3RXLA 2WYJA 1HXFH 2VNTA 4B71A 3LC5A 3BEFB 4CRBA 2AEIH 2GCHG 1Y3XA 3SI3H 1V2MT 3JZ1B 1BZXE 1DY9A 1C1QA 1F5LA 3EAJA 3R3GB 1NESE 3DCLA 1V2NT 5B6OA 3BTGE 2ZDAH 4NIVA 5F8ZA 1W0YH 2QF5A 2Y5HA 1UCYH 2FLBH 3VG8A 2LP6A 1ORFA 1G2LA 2OC1A 3F2GA 5EJ1A 1UTPA 4CH2B 3D23A 1ZMNA 1TGTA 1C1RA 1ZJDA
chains in the Genus database with same CATH topology
1W8BH 1T8LA 4ZHMU 2WPKS 2A32A 2WINI 1GJ4H 1S85A 4AG1A 1A7SA 1NS3A 1UTJA 4GPGA 1BTZA 3BSQA 3TJUA 4BOHA 2ZGXH 2STBE 1GI7B 2BLQA 2ZKSA 1RTFB 4I7YH 1FPHH 1MD7A 2PWXA 4O97A 4X6PA 6CHAC 1EZXC 2AH4X 3A85A 4NA9H 4NSYA 4FUCA 4IGDA 2A31A 1LQEA 5DGJA 1PQAA 4A5TS 3VB5A 1V3XA 1SFIA 1D6WA 1DUEA 3SJ9A 1DOJA 4Y0ZE 1EX3A 5JDUB 4F4OC 3VB7A 4F49A 4OS4A 2CGAA 1C5MD 1CQQA 2TIOA 3O8CA 2O8LA 3FZDA 1BB0B 4K1TA 2Y80A 1P2OA 1V2QT 2QY0B 4I33A 4M7GA 3I29A 3PM3A 2J95A 5TCAA 1C2EA 6CHAB 4FUEA 1PJPA 1WV7H 4LOYH 2CF9H 3RU4D 1XKBC 2Y6TA 3TJVA 1TRNA 2Z9JA 2SGAA 4ZHAA 2GMTC 1S0QA 1EB2A 1O2JA 1DT2A 1ZRKA 1MMJN 2HNTC 3QGNB 2IN2A 4GCHF 4MPVA 3SV9A 4ABFA 1N8OB 1UVUH 2BD8A 1C1TA 1LVMA 3A88A 2C93B 3AAUA 1HAPH 2Y82A 1J16A 3QTOH 1Z8JB 1HAOH 1V2UT 2NU0E 2ZFFH 1QA7A 5C1UA 4MDSA 1O30A 1CGHA 4AN7A 5EPYA 3RXMA 2BDCA 3T62A 1LPGB 1OP8A 2Q6GA 1TQ0B 3O8DA 1QBNA 2K1QA 4X1RU 1AKSA 1EOJA 1ZZZA 1C2FA 1FY4A 1LCYA 2CMYA 3A7TA 3PMJA 5H4IB 1TNKA 3MI4A 1DVAH 3B23B 1BTYA 4R8TB 5F8XA 2HLCA 3GICB 1SGDE 3M3VA 4HZHA 3PMBB 1SOZA 3FVFB 3RC6A 2OXSA 1HUTH 1BMLA 1VZQH 1VJAU 5LH8A 2Q6FA 2C8WB 1QIXB 2FO9A 3QDZB 1O2IA 3BTTE 4BXSA 1C5PA 1O2HA 1BTPA 1GBAA 2OQ5A 2ILNA 4ZUHA 1G2MA 1GPZA 1CU1A 4CRGA 1OS8A 3VGCC 1YPHC 1NRNH 1KLIH 3SGAE 3K9XB 4B76A 1QL7A 1UTQA 1RIWB 1V6DA 1W2KH 3A7WA 1OWIA 1GL0E 1L4ZA 1E36B 1UHBB 1GL1A 1WSSH 4KTSA 5EODA 2WPHS 1B5GH 1OPHB 2UUYA 3HATH 1MKXK 1H9LB 3UNRA 1O3CA 1SHYA 2Q1JA 1BDAA 3QTVH 1YF4A 4K1SA 3UTUH 3SV6A 1HCGA 1B7XB 2FS9A 1O5DH 4ZKNU 1FXYA 2OC7A 2BZ6H 2ODQA 4IS5A 4X6MA 1EQ9A 3GCHC 4U01A 3VGCB 4JCNA 4FUHA 4B2BA 4B75A 3GY5A 1O2SA 4B73A 4GHQA 2FM2A 1WCZA 2Z6BD 2J38A 2QV1A 1GHBF 1FV9A 3PTBA 4B1TA 5K0HA 1EP5A 2UUKB 1C5TA 4E05H 4ABDA 1TOCB 1HIAA 1EKBB 3NPSA 1MBMA 1Q3XA 4AFQA 3PYHA 1DITH 4YLUA 2VWOA 4D76A 2AMQA 3AW0A 2VIVA 4X8VH 1XM1A 3A8AA 2ZDVH 3SQEE 1MAXA 2ZFSA 5K7RA 3SV7A 1BHXF 3TNTA 3ZV8A 1KTSB 3DA9B 2GCTB 4YOGA 1G30B 1S81A 4FU9A 2BLWA 2FI5E 1CT4E 3U69H 1TBZH 4DVAU 2BYAX 1G3BA 2BOKA 1IQHA 2XW9A 1MQ6A 5F6MA 2G4TA 2BDIA 3OYPA 4NZQA 2BMGB 4Q2KA 3LPRA 3DHKH 1P02A 1F0UA 2TGTA 1MQ5A 3IG6B 2ZCLP 3IITA 4NIYA 3RXBA 1SGCA 3SU5A 2W26A 4CRAA 1RFNA 4JZFH 1PPEE 3A87A 4YOIA 2G4UA 3TIUA 4GLYA 3BG4C 4WMFA 3AAVA 1A3BH 1O3FA 1PPCE 2FZZA 5HM2A 1QGFA 1ZGIA 2GT8A 5LGOA 3TGKE 1C2IA 1WBGB 3QK1A 3A89A 5FXLA 1D6RA 1DLEA 3S0NA 1NROH 1AHTH 4AFUA 1AO5A 4JZ1A 3ZZ3A 4JMYA 1V2KT 3UY9A 1AVWA 2QXHA 7GCHF 3MU0A 1XVMA 1S5SA 2GTBA 4Z6AH 4X2WA 3RXIA 3W94A 4I8GA 2XCFA 1ABIH 4A92A 2Y7XA 5GCHG 2PHBA 3OSYA 5T6FA 1MKWH 3GCNA 1GBEA 1W13U 3SI4H 3NZIA 1OWDA 1UCYE 2HRVA 1HV7A 1XXDA 2HOBA 3BV9B 2AS9A 1VGCC 2P95A 5TJXA 4CH8B 3GDUA 1ZMJA 2BD5A 3MU8A 4HTCH 3TH3H 1H4WA 1WUNH 1WQSA 1A0LA 2ZWLH 1FQ3A 3MFJA 3SU1A 1O2YA 2UWLA 4DGJA 2FMJA 4JZEH 3SW2B 4CR9A 1UJ1A 4NIXA 3BTME 4NWKA 2O8UA 1QFKH 5EXLA 1V2PT 3LGYA 2A1DB 2XYAA 1PPHE 1QJ1B 1F5RA 2SGDE 2ZGJA 1AB9C 1HRTH 1TMUH 2P16A 1V2JT 2XC4A 3FP8E 1QBOA 1DE7H 2H5DA 2Z7FE 1CHOG 3BTFE 4I31A 1UVSH 2A4GA 1O2LA 3F9GA 5T6DA 1T4UH 1JIRA 1V2WT 1BCUH 1DWBH 3MNBA 2Y5FA 1ELVA 2Z3DA 1YPJH 1VITG 3KHVA 1THPB 1NY22 3ZVGA 3RU4T 5JBAS 4IW4E 1KLJH 5FHTA 3HPTB 2A5KA 1O5GH 2ZHFH 1RGQA 1PFXC 2ZP0H 1EB1H 3SUFA 1QJ7B 1H1BA 1O3OA 3LKWA 2YNBA 3T25A 1L1GA 3PB1E 5FBIA 1O5EH 3LIWA 2WUBA 3M5MA 1C2KA 4WJG2 3ITIA 4CHAC 4INHA 1AB9B 1LVOA 4ZROA 3I77A 3LDXH 4Y7BA 1HJAB 4GVUA 1H9HE 1Z1IA 2ZC9H 4WH8A 1Z7KA 4A1VA 1C2MA 1XUJA 2SFAA 2BDHA 3LJJA 2PTCE 4BTUB 5C20A 3U1JB 4HGCA 2PFEA 3MNSA 1W12U 1IQIA 2AGIX 1YKTA 3GISB 2HNTF 5CHAC 1EZSC 4OS7A 4X2XA 1K1LA 3RXRA 2BY6X 1T32A 2VIQA 3HK6B 2BD9A 1DWCH 1LVBA 3SOSA 2VWLA 2BD4A 1Z71A 1P2KA 1YC0A 3P70B 2KAIA 1TLDA 3E6PH 1XX9A 1PPZA 1KXFA 2OC0A 4X8SH 2ZQ1A 4MPXA 1SGPE 2GCHF 3MWIU 8GCHF 2Y7ZA 2B7DH 4TPYA 1W7GH 3RC5A 1BMNH 1WU1A 1YGCH 5ESTE 4XE4A 2WPMS 9LPRA 1XUIA 1DFPA 1O2OA 3AVZA 1BUIA 3MMGA 3NCLA 3GY7A 5G4BA 1O3IA 3K65B 1E37B 2G81E 4DW2U 1Z1JA 1BBRK 1XMNB 1RD3B 1LKBA 1O3JA 2D1JA 4FU8A 3RXVA 2ASUB 1AU8A 3ATLA 4RKJB 1C5YB 1OOKB 2FEQH 4AB9A 4DIHH 1LDTT 5E2PA 3QN7A 1ELBA 3LJOA 3UQOA 4AFZA 2C8XB 1W7XH 4Y8ZA 5C1YA 3BEUA 3KIDU 1ELCA 1N6YA 2RA3A 3MU4A 5E8EH 2H1UA 2J4IA 1IAUA 2FX4A 3EDXB 2BVXH 2PV9B 2BTCE 1Y5BT 1DPOA 2G8TA 4O03A 7ESTE 2V3OH 1H9IE 5AFZH 1ARCA 1GHZA 4BAKB 4WF8A 4JZIA 1ETSH 3G01A 2FI4E 5A8ZA 2FOGA 3ZZ9A 1LHCH 2OLGA 2PUQH 1A3EH 4KKDA 2H5CA 1GMDG 1OYTH 1NZQH 1GJ8B 2ZA5A 4O9VA 5HMAA 5JB8S 4GHTA 5A0AE 2XBXA 2DE8A 1LKAA 2NU4E 1NRPH 3P17H 3WY8A 1N1LA 4LK4A 1O2QA 3SNEA 1Q31A 1HJ9A 4K3JA 3A80A 4OS1A 4ABHA 2OBOA 1ELFA 1J9CH 1L0ZA 3KQEA 3GY4A 2JH6D 2G5NA 1P05A 4Y6DA 1TGNA 1J15A 1DICA 2FODA 2TPIZ 1LHDH 3HGPA 2FXRA 2SNVA 2OINA 2LNCA 1P2JA 2DE9A 4TYDA 1TA2A 1KDQA 1G3CA 2LIZA 1LVYA 4I8JA 3F9FA 3MYWA 2C3SA 1AKSB 3UNQA 4HI3A 1GGDC 1AE8H 3GY6A 1QHRB 5DK1A 5JPMH 1SGYE 3RXHA 4ASHA 1OYQA 5C67A 3T29A 3MOCA 1P12E 2W7SA 1FMGA 1TONA 1DS2E 2ZTZA 1QY6A 1K1MA 1SBWA 1C2DA 1BTXA 2QXJA 2STAE 3SU0A 3ZZDA 5FPYA 3RU4E 2CF8H 3RMMH 2GGVB 1UK2A 4YT7H 4KTUA 3P95A 1B0FA 1MBQA 1BRAA 3UWJH 1OSSA 3ZVDA 1E0FD 1EAWA 4BAMB 3RC4A 1TNIA 4AX9H 3SNDA 3ENSB 3V7TA 4ABBA 3SNCA 1CSOE 1BRUP 4XFQA 2FI3E 2EA3A 2WV4A 3SU6A 1QR3E 2NU1E 5JYIA 2Z3EA 2QYIA 4AORA 3KEEA 4X1PU 1QTFA 2ALVA 2WPIS 3A84A 2A2XH 3GOVB 3Q3KA 3A8BA 1H8IH 5GPIB 1A2CH 1CE5A 2P8OC 5A09A 3TPIZ 3ZVAA 3C1KA 4ZAEA 4YZUA 3B9FH 2GT7A 1GI4A 4K1EA 3OU0A 4AG2A 4MPWA 1ESAA 2BDAA 3U8TH 2VWNA 1VCPA 3D65E 4ISNA 4LXBH 2J34A 1A4WH 1PYTC 1Y3WA 1HAYB 1L1JA 5J4QA 3BTQE 4I8HA 2JKHA 4NIWA 5DJ7A 3TK5A 2H9HA 1W0ZU 2B0FA 1SGFA 3UPEA 1JMOH 4FVBA 1SQOA 5FX5A 1O3GA 2WV5A 3P8NA 2BQ6B 5HGGA 1O3LA 1UTLM 1SLUB 1O2MA 4WMDA 3BTHE 4FUDA 2QN5T 2BD7A 1BJVA 1SLVB 1GBKA 2P93A 1TPAE 1HIAB 2OQUA 4JYUH 5IDKA 1QRXA 3D49H 4K60A 1DY8A 1L4DA 4CRDA 3TJNA 1LHFH 2D2DA 1DWDH 2SGPE 2IOTA 3A8CA 2GZ7A 1NT1A 1Z8IB 1EPTC 2A7CA 3UUZA 4ABAA 3TGIE 2TGAA 2BY7X 3L33A 8LPRA 2PW8H 4RN6A 2M5TA 4FUGA 1SGRE 2SNWA 4A1XA 3RXGA 2ESTE 3AW1A 1GHYH 3SU4A 2BY5X 1GI1A 4RSPA 4H4FA 2P3UB 2OP9A 2ZU4A 4FUJA 3SHAH 2GDEH 2PKSC 5CE1A 2JH0D 1ELGA 2A7JA 3CS7A 3FP6E 2AMPA 5L2ZH 5DO4H 4FUBA 1TGSZ 1BBRH 1QCPA 4H6TA 1GHAG 2GMTB 1D3TB 3MH7A 1EATA 1ZTLA 2F9VA 2ZHDA 4UDWH 4OGYA 4UFFH 4ZKSU 4YESB 3M35A 2Z9LA 1EJMA 3Q00A 3P8FA 3S7HB 2XBWA 4CRFA 1IHSH 2A2QH 3ZZAA 4SGBE 2GKVE 1MCTA 1K28D 4Y8YA 2PLXA 2ZZUH 4XBBA 5JBCS 5AFYH 2W3KA 1HBTH 4YT6H 5LPFA 1EOLA 2VIOA 4TY6A 5CMXH 5GCHF 3SJKA 1O2ZA 2JETC 4K8BA 3P8OA 2FESH 1C5ZB 3H5CB 3ZVBA 1CVWH 2J9NA 3MU1A 2UWOA 3KL6A 3MNXA 4ISIH 1C1UH 3ZZ6A 4XBDA 3UOUA 1BMAA 4WH6A 1C5NH 1SQAA 5FPTA 4VGCC 1RTKA 2I6QA 3T28A 1C2HA 1ZTJA 2ZNKH 1P0SH 1O2RA 2BX3A 2F9OA 4TWYA 3ZZ4A 1KXEA 2F83A 1ZHPA 2VIDA 2B9LA 5C3NA 2V35A 1SC8U 3ZVFA 1D4PB 1Y3VA 1KTTB 1U6QA 5DG6A 5GJ4B 4ESTE 5E0JA 4ZKOU 1GG6C 3QLPH 3A83A 1O2GH 3T26A 5LPRA 1FONA 1O35A 1AUTC 2F9NA 4NA8A 4NCYA 1GBMA 3SNAA 1O2PA 5GDSH 3S7KB 3SU3A 1VITF 1MTWA 1NRRH 2XCNA 4VGCB 5DP8A 4BANB 1THSH 1VCWA 5J4SA 1O3HA 1S6HA 1ZPBA 3STIA 1WAYB 4NFEA 1QURH 2YNAA 1BTUA 3UIRA 4X0WU 1UVPA 3RP2A 3ATWA 5FBEA 1P01A 1SI5H 2OUAA 1CA0C 4WMEA 1EZQA 3RXDA 3V13A 4B2CA 1SR5C 5E0GA 4FXGH 4X1QU 3GCHB 4X6NA 2ZPRA 1J17T 2BHGA 5L6NH 1MCVA 1DXPA 1O2NA 2PKAA 2FOHA 2KAIB 1C5QA 1ANEA 1LQDB 2PUXB 1P9SA 1P03A 3OY5U 5A8XA 2VH0A 4XOJA 1PPBH 2UUFB 1HNEE 4IBLH 2CN0H 3MO9A 2AIPA 3F6UH 3URDA 4DY7B 1BT7A 1OXGA 2BVRH 1TNGA 3SQHE 4DIIH 1ZLRA 7KMEH 1NFXA 1SG8B 5BPEA 1WYKA 3PLPA 2H6MA 3L6PA 4IN2A 1BITA 1LHEH 3CENA 2A7HA 1FLEE 1CGJE 4AOQA 3OX7U 3CP7A 3GDSA 5I25A 3NUMA 1JRSA 1SB1H 2ZF0H 2A45B 1O0DH 1GBTA 1ANDA 4AYVB 1J14A 2D26C 1SMFE 1SLXB 3SJ8A 1EPTA 1AY6H 1C1VH 1C5LH 1GMCG 1SGFG 1TABE 1ELEE 1TBRH 2IJOB 4BTIB 1IOEA 4I8LA 2EI8A 5EW1H 1EJAA 1P3CA 4UFGH 1YCPK 1QB9A 5FX6A 1MTVA 4WXIA 4IN1A 5C5NA 2ZU2A 1HGTH 3A7ZA 1H8DH 1CGIE 4KGAA 3GCTG 2HNTE 3BG4B 4Y0YE 5BRRE 1EJNA 1FJSA 2EEKA 4D9RA 1ZSKA 2AMDA 4IC6A 1GVLA 2SGQE 1ZR0A 4PROA 1JWTA 2R2MB 1GBBA 3ATIA 2ULLA 4MG3A 3UFAA 3O8BA 1X7AC 3SJOA 1GVKB 1UCYK 2ZU3A 3GDVA 1DANH