2A5IA

Crystal structures of sars coronavirus main peptidase inhibited by an aza-peptide epoxide in the space group c2
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Main Peptidase from the SARS Coronavirus Inhibited by a Substrate-like Aza-peptide Epoxide
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like peptidase
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2a5iA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a5iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a5iA02
4X8VH 2H5DA 1Q3XA 1AVWA 3RXVA 3HKIB 1V2RT 1RFNA 1H8IH 3T5FH 1ESTA 5L30H 1IQFA 4XFQA 2GCTC 1TB6H 1T8LA 1AVXA 1GBBA 4UONA 3H5CB 3FANA 1ANDA 5T6FA 1CVWH 2PW8H 1RD3B 3GYMA 2VU8E 3T26A 2VGCC 3BIUH 2GMTB 2Q6DA 3QUMP 3VPKA 1F0RA 3LOXA 2V6NA 2PHBA 4I8LA 3NUMA 1S5SA 4XSKU 3BTHE 3KEEA 5JBTA 4NWLA 2NWNA 2M5TA 1LQDB 2Z9IA 1O3PB 2AGEX 5K0HA 3AAUA 3LGTA 1P0SH 1O3DA 3U1IB 1TOCB 1YKTA 2A4GA 1GI3A 4MPXA 2ZA5A 1C1TA 1BOQA 3BTTE 4YZUA 4K1SA 4F49A 1GHZA 1K1OA 1RJXB 1C2GA 1EP5A 3MU5A 3NXPA 4B76A 3RXQA 1KXBA 1KLIH 1JXPA 1GBFA 1MU6B 3T27A 2WPKS 4X8UH 1GBIA 2NU4E 1DY9A 3BG8A 1P05A 1QHRB 1BB0B 2FS8A 2ODPA 2ULLA 1V2MT 3DA9B 4IN2A 2Y82A 1SLXB 1TA6A 2EA3A 1ZHPA 1F7ZA 3LC3A 4JK5A 2Y7XA 1QL9A 1TOMH 2R9PA 1O35A 2SGDE 1BRCE 2HOBA 3E6PH 1YYY1 1XMNB 1H4WA 1C2FA 4X1RU 4WWYA 1BMNH 2VNTA 3ZVEA 2V35A 2ZFRH 3A7ZA 3A83A 2AGIX 2TIOA 3F1SB 2B8OH 2FZZA 1XUIA 4RKOB 1SPJA 1RTLA 1UCYK 1D6WA 3ZVBA 3OX7U 1YPEH 1C4V2 1L1NA 1SHHB 1YPHE 1Z8GA 1C9PA 3ZVAA 2ZC9H 2J4IA 1THPB 3LGUA 4BXWA 4LZ1H 3RXPA 5EW2H 5LPEA 3O8CA 5EPNA 5I25A 1TIOA 5GCHG 1P04A 2CF9H 2QYIA 1PPBH 1UTMA 1ANCA 2B5TB 4B71A 4OS5A 3M5OA 4YM9A 3KIDU 3A7WA 3SUGA 2AMDA 1GI8B 2R0LA 4BAQB 4ABEA 3ATMA 1GHAG 2BZ6H 3OYPA 1ZSLA 5GJ4B 3CS0A 1TNJA 1ACBE 3RDZA 2P59A 2SGEE 2WPLS 2BVRH 6ESTA 2HLCA 3D62A 2JKHA 4A1XA 3GCTF 4GSOA 1AFQC 2GX4A 4IN1A 3TH3H 2PFEA 2GD4B 1GBMA 1XVMA 2BDCA 1GJ4H 1E34B 5L6NH 5F6MA 3ZV9A 2NU1E 1INCA 1O2KA 2O8TA 3I78A 1UTJA 3EDXB 4J1YA 2ZU2A 2ODQA 2PSYA 4X2YA 3RXKA 4D9QA 1ZSJA 2XCNA 2D1JA 4IMZA 3RXRA 1OWDA 1YPMH 3KQEA 1F0TA 1N1LA 2FOBA 3QZRA 4UD9H 1BBRH 4YLQH 3DHKH 4JMYA 1AN1E 4AFQA 1HAZB 1MTSA 3BSQA 5A8ZA 1LDTT 4Q7YA 5LGOA 1P2OA 1FPHH 3PLPA 1A0LA 4ZKOU 1OWKA 1PQ8A 2QY0B 1MCTA 4CRDA 1PPGE 5FPTA 2OC8A 4YOJA 3BN9A 1Q2WA 2ANKH 3P8OA 2OXSA 3FZZA 1P8VC 1WAYB 1H9LB 1A5HA 2GDDA 2W7SA 5EXNA 4UFDH 3LGVA 3P92A 5GWZA 1F5RA 5C5NA 1Y3VA 4WF8A 1TBRH 4X6OA 1A7SA 1ARBA 2C90B 1TQ0B 5DP4A 2NU2E 2R3YA 2ZHWH 1HNEE 3QGNB 2BVSH 2QXJA 1MTUA 3F9GA 1TGTA 1ESAA 2BY5X 1SGYE 3AW1A 3JZ1B 3C1KA 3L33A 3OY5U 4K1TA 3U8RH 3A81A 2STAE 3QX5H 4Y7BA 3KN2A 1HAVB 3MNBA 2ZWLH 2RCEA 1GJCB 1TGNA 3BG4C 3MFJA 1K9OE 1HAHH 1V2JT 4ZMAH 5C67A 3QO6A 3M5NA 1SGFG 1C4Y2 1TMTH 1GL0E 2P93A 3PTNA 4E7RG 7ESTE 2BD2A 3FZDA 1EZSC 4GCHG 3V3MA 2FOAA 1GJ7B 2A2QH 1HXFH 4CH8B 1UHBB 1K1PA 2A4OA 3A7XA 2W5EA 4ABGA 1V2UT 1SVPA 1AUTC 1SMFE 4DIHH 2H9EH 1E36B 2G8TA 3RU4D 3VB7A 1AE8H 2VH0A 2VWOA 2C8XB 1GDNA 1O34A 4FUJA 3BTDE 1ANBA 1KIGH 3ATKA 2XNIA 3D23A 1K22H 2BY8X 1IHSH 1C1VH 4TY7A 3BEFB 2H9HA 4UE7H 2BX4A 3ZYDA 3MU8A 2FPZA 3F6UH 3MTYA 1C5LH 5ABWA 2WYJA 4Z0KA 4ABDA 3E1XB 4FU9A 5L2ZH 1UVTH 5FAHA 1XX9A 4AX9H 5ESTE 4AYVB 4NSVA 2ZTZA 2FMJA 1HFDA 2ZDNA 3SOSA 2PV9B 3RMMH 4RKJB 3UOUA 3SHAH 4NA8A 1JWTA 2P16A 1JIMA 1GBHA 2C8WB 3LJOA 2ZU3A 4AGKA 1GHAF 4XOJA 1UTLM 4JZ1A 1O3JA 1ZRKA 4NIWA 4UDWH 2LIZA 2KAIA 3BIVH 1EZXC 1GI6A 3LH3A 2OTVA 4UFFH 4ZKNU 1O0DH 1QIXB 5HMAA 2HNTE 1NESE 1O2QA 3P8NA 1C5UA 3KHVA 1FUJA 4DVAU 1AWHB 4JZIA 5JBCS 3GDSA 1ELBA 2GKVE 4Q7XA 1CGIE 2TRMA 2C8ZB 1PPFE 1S83A 2BY9X 1FQ3A 2THFB 2O8WA 1GGDC 4U01A 5E0GA 1ZTJA 4Q80A 5C1XA 4JK6A 1TNHA 2FXRA 2J94A 3I29A 1G30B 2BVXH 1Z8IB 1EKBB 1BBRK 1O38A 1P02A 5F8XA 1JMOH 3HKJB 3V13A 1V3XA 1THRH 5EODA 3S69A 4OS6A 4ZUHA 1HAVA 4AYYB 2XC4A 1HJ8A 5GDSH 1HIAA 3ZYEA 1DLEA 2ANYA 3S9BA 2C3SA 2QF0A 1FV9A 8LPRA 1C1PA 1ID5H 2ZU1A 4CH2B 1LO6A 2F9VA 1G37A 4ISLA 1ZRBA 2ZCHP 4FU8A 4JYUH 4TY6A 3KQDA 1UTKA 2RDLA 2KAIB 1AWFH 2BXTH 3SW2B 1DE7H 4I8JA 3DFLA 4O3TA 3SGQE 2ZDKA 1LPGB 3K2UA 2D8WA 3P8FA 2A4QA 1LHDH 4CR9A 4YESB 2Z3CA 1MU8B 1GVKB 3UR9A 1ZGIA 4ZKSU 1NRQH 3RXTA 1RS0A 2ZHQH 3H7OA 3Q3KA 5EQQA 5HM9A 1W0YH 1GGDB 1QGFA 5K7RA 2AERH 1B5GH 4WXIA 1K28D 1DT2A 3VXFH 1UVPA 2AMPA 1MTVA 4VGCB 2P94A 1SGIB 2GZ8A 1LHCH 1FAKH 2QXIA 1O2YA 4UFEH 2Z6BD 1CHGA 2J34A 3RC6A 1ABJH 1K2I1 1P57B 1HXEH 3OTJE 4AOQA 4NZQA 1LVBA 4TPIZ 3MO6A 1BJVA 1O3IA 6GCHG 3M61U 3ZVGA 1A61H 2ZQ2A 3ZZ7A 3LJJA 1A3EH 3MOCA 1BTYA 5G4BA 1TBQH 5H4IB 5B6OA 2GMTC 2BDBA 1C5WB 1QNJA 2Y5HA 1EPTA 5AHGH 3E91A 3MMGA 4LOYH 3E0PB 1EASA 2WV4A 2FI3E 3PO1C 3PYHA 3TJOA 1ZHMA 3FP8E 2BQWB 3BTQE 1O5GH 3TH4H 1L4ZA 3SV9A 5C1UA 3MYWA 2A5AA 1SGTA 1C5PA 1PYTC 5L2YH 3CENA 3U8TH 1UTPA 1K21H 1YPLH 1YCPM 2SGQE 1GBAA 3A8DA 3BTWE 1WBGB 2SGFE 3R3GB 4JCNA 3EA9A 2BOKA 1BZXE 1ZMNA 2GGVB 2TGDA 2FEQH 1C5ZB 4MNVA 5A8XA 3DFJA 4ISHH 2FESH 1OWHA 1YC0A 1C1SA 4D8NA 5IDKA 3TJVA 1LVOA 1FXYA 2ESTE 6CHAC 2FTMA 3RLYH 3S0NA 2Z94A 3TH2H 4Y8ZA 1NRPH 3P95A 2ZTXA 1TMUH 4U2WA 2PTCE 3A86A 4TPYA 1MD7A 1TPPA 2SGAA 1LKAA 2GT7A 2BY7X 2ZECA 1IQHA 1ETRH 1GBTA 8KME2 4WH8A 3AVZA 4D76A 1GPZA 2G4TA 1LCYA 4DT7B 4KKDA 1C2LA 1UMAH 1C5NH 1T32A 4OGXA 3MNCA 2ZQ1A 4O03A 4FUGA 2OC7A 1XXDA 1AQ7A 5FX6A 4B2BA 4NZLA 1THSH 3BF6H 4FUIA 5F03A 3SU6A 3ZVFA 1TPAE 1A5GH 2XYAA 1QL7A 2P8OB 5F8ZA 3PV4A 2BZAA 3TITA 5DKMA 2ZPRA 3NPSA 5CMXH 1RGQA 1VJAU 3V7TA 1KYNA 1D6RA 1HAIH 1QRXA 2WINI 2IN2A 1ZZZA 1LHEH 1PJPA 5A2MH 1C2MA 1NZQH 1ELTA 4X0WU 2C8YB 2PSXA 2LNCA 2ASUB 3L6PA 2K7XA 2YNBA 2GT8A 3K65B 4AORA 3SU0A 4AZ2B 1V6DA 2CHAC 2WPHS 1QB6A 2G4UA 3ESTA 1YP9A 4NCYA 4O3UA 1V2QT 2JH5D 4DY7B 2EI6A 4BAMB 1P2IA 2TPIZ 2FX6A 1NN6A 4RN6A 1GHXH 1MZAA 1DANH 4I31A 3NZIA 3GCTG 2ZP0H 1QTFA 1XKBC 4AFUA 1UVOA 1NY22 2RG3A 2Q6FA 3S9CA 3EQ0H 3RXGA 3NKKA 4DURA 1J15A 1WCZA 1C5OH 1G36A 3ZZDA 5A0BA 3UQVA 1BHXF 1TONA 1GWAA 2FLBH 2W3IA 3ODDA 4KTSA 5IYTA 1OYTH 1O2LA 5LPFA 1CBWC 1RIWB 2HPQH 2XBVA 1W7XH 5FPSA 1QQUA 3PB1E 1SR5C 4B1TA 1DFPA 5DJ7A 1C5VA 3CP7A 3TGIE 4VGCC 2XWAA 3GY2A 2RA3A 2B7DH 4HGCA 1OOKB 5DP7A 1W14U 3UPEA 2XTTB 1CT2E 1ZPBA 2BMGB 3RXIA 4BAOB 3RC4A 3BTGE 1QA0A 4O97A 1GHVH 1BTXA 3TGJE 4XE4A 3CS7A 2ZGHA 1BTHH 2TGTA 4MDSA 1MKWH 4NIYA 3LIWA 2ZDVH 3LH1A 1WTHD 3A82A 3S9AA 2OD3B 1C1MA 4Y76A 1VITG 2SGPE 4ISNA 4A6LA 1A2CH 4TWWA 2D2DA 3M7TA 4DW2U 1O31A 1BIOA 1O37A 1LVMA 1Z6JH 3GY6A 3KL6A 1C5YB 1G2MA 4MNXA 1EXFA 1KDQA 1XM1A 1ZMJA 2DE8A 4K1EA 3O8DA 1D4PB 3SHCH 1AZ8A 1HJAB 1ELCA 1ELGA 2ZGCA 2P3FH 1GI7B 2B9LA 1XUKA 1D3DB 3GCNA 5SGAE 3STIA 4LZ4B 3VFEA 4A7IB 1TA2A 2ZCKP 2BHGA 1T31A 2Z3EA 1AKSA 2OQUA 4IMQA 3NCLA 1WQSA 2PR3A 3SV2H 2PTNA 3P8GA 1S0RA 1W3CA 4M7GA 2PUQH 2OC0A 4BAHB 1ZYOA 1ZTLA 3SNDA 1Z1JA 4WH6A 1GHBF 1GMDF 1O2RA 1B0EA 1XXFA 1DWEH 1F0SA 1SSXA 4OS4A 3RC5A 4FVDA 5CE1A 3GY4A 1VR1H 3G01A 2ZTYA 4ZXYH 4ZKRU 1NM6A 1RIWC 1Y5BT 2WPMS 2ZGBH 5TJXA 1SQTA 1S6HA 5EW1H 3SNEA 5HM2A 5HGGA 2V3HH 1FIWA 3MWIU 3GDUA 3MU0A 4XBCA 4XBDA 2AFQB 1OPHB 3O8RA 1O2PA 2TGPZ 2ZG0H 3RXCA 1S0QA 1UTNA 5DP9A 1S85A 2FYQA 2WPIS 3ZZ3A 3STJA 1FY3A 4MLFB 1EATA 5DP6A 1MKWK 2D26C 3ZZ5A 1GMDG 1RTKA 3U8OH 4WMEA 4AB9A 4LXBH 1Z7KA 2Z9JA 1EAIA 1CSOE 3RXLA 4H4FA 1C2KA 1OKXA 1OP8A 4NWKA 3SQHE 5T6DA 1S6FA 3EAJA 1YLCA 2VB0A 2TGAA 2CHAB 3UY9A 3KF2A 4I7YH 4ZHAA 3O8BA 1TPSA 3P70B 5C20A 1LHGH 4U32A 4CRCA 1B0FA 1GJ8B 1O3LA 3T29A 3F9FA 2W26A 3E3TA 1O2HA 1P2QA 1VCWA 2HVXA 1P9UA 3QN7A 5A8YA 1P2JA 1ZSKA 3D49H 1SGEE 1SFQB 2P8OC 3AASA 1C2DA 4AG1A 3S7KB 1YPGH 2Z9LA 3QDZB 1BMMH 4B2AA 5JPMH 1CA0B 4HZHA 4INLA 4X8SH 1S81A 4X8TH 1P03A 5HXFA 1IOEA 1TAWA 2ZFPH 1CGHA 5JBAS 5FX5A 2GVFA 3W95A 4WVPE 3FVFB 2H5CA 1DUEA 3E16B 5EXMA 3GISB 7LPRA 2AIPA 1NFXA 2BD9A 5EPYA 1O3OA 4KELA 2I6QA 4GPGA 2VIDA 3UWJH 1EOJA 1CQQA 1GBKA 4OGYA 1FDPA 3GY7A 4I32A 1HDTH 7KMEH 1O36A 5PTPA 3ATIA 1SHYA 1TABE 4K2YA 4FUHA 1GJ9B 3TJUA 1RTFB 1SGFA 2BDHA 1NU7B 3EYDA 1A3BH 1C2IA 1XUFA 2XRCA 2BD5A 3R0FA 3MNXA 1P9SA 1LPZB 3UNRA 1GCTB 4AN7A 4MVNA 3ATWA 1SI5H 1SQAA 1NC6A 2FP7B 2PKAB 4E06H 2ZIQH 4DG4A 1MCVA 1TNGA 1PPHE 3MNSA 4NIVA 3ZZ9A 2OC1A 1AVGH 1YM0A 5JB9S 5JB8S 4MPUA 1HAOH 1PPCE 1O3MA 1UVSH 1H1BA 4GHTA 2OBQA 4K69A 3RM0H 2JETC 2NU3E 2PLXA 1NPMA 4YT6H 2ZU5A 1GMHF 1VZQH 2R3UA 4KP0A 4CRGA 1M9UA 1N6YA 5EGMA 4ZHLU 2BD4A 3ZVCA 3LU9B 4CRFA 1BHXB 1GVZA 1O3FA 1SOTA 2ANWA 3P17H 3I77A 1KXFA 2QXGA 1EAWA 5DG6A 1C4U2 3Q76A 1TALA 4WXVA 1SBWA 1VJ9U 4X2WA 2A4RA 3A84A 1KXDA 2Y80A 1HAPH 2G52A 1T4UH 1AY6H 3TIUA 3UWIA 4Y11E 1TMBH 1QA7A 2ZEBA 3UNQA 3SJOA 1P12E 2VJ1A 3LONA 1ARCA 4X1QU 3ZZ6A 1PQ7A 3EBNA 3GY3A 1WQVH 2XC5A 3ENSB 5ESBA 1FNIA 1TNKA 1NROH 5EQRA 5FPYA 4FXGH 3BEIB 2IJOB 4B2CA 1MBMA 3SU2A 1N8OC 5ETXA 4A1VA 3SUDA 3VGCC 2JH6D 2OQ5A 1WV7H 2XXLA 2XWBI 3JZ2B 4ABIA 3HK6B 2R0KA 1C1OA 1CBWB 2J38A 4Y0YE 1QBNA 1FONA 1ANEA 3KCGH 3VB5A 1EUFA 4MPWA 2DUCA 1XUHA 4DIIH 1Q31A 2VWLA 3TK5A 1FY4A 1O3BA 4R0IA 1GL1A 1ZGVA 2FM2A 4BTIB 1GHWH 3RXBA 1NRNH 1V2VT 3RMOH 5F8TA 1O3EA 3SV8A 4I8GA 3PMBB 2BD8A 3BTME 2UUFB 5LH8A 1A4WH 2AIQA 4IGDA 4JZDH 1UVUH 2BXUH 1SLWB 3A87A 3SO3A 1Y5AT 1GI5A 2C4FH 1EZQA 4X2XA 4YOGA 1QCPA 1OS8A 3B9FH 4INKA 3SORA 4O9VA 1A0HB 1J9CH 2QCYA 1NTPA 1EAUA 2A45B 2VWMA 1GI2A 3URCA 7GCHF 2HALA 4CHAC 1C5MD 1MTNC 5BPEA 4Z6AH 1O3GA 4SGAE 7GCHG 2R2MB 3RLWH 1E37B 3KGPA 5C5OA 1GVLA 4NA9H 1DSTA 2HRVA 1SOZA 2FOFA 3TK6A 1HYLA 1BTWA 3LGIA 1JBUH 1ELFA 1C9TA 4ZH8A 1OXGA 3BTFE 1NFWA 2PGQB 3BV9B 1O2GH 1VCPA 4BTUB 1GG6C 1O5DH 3HPTB 3WY8A 4MPVA 4K8BA 2G00A 1EJMA 3H7TA 2UWPA 2FX4A 4CREA 3RXJA 1LMWB 1O3AA 4GVUA 1S82A 2ZF0H 5E0HA 3M35A 3VXEH 1PQAA 3MH7A 2ZO3H 2BDYA 2FS9A 4GUXA 1K1IA 2A7HA 2QIQA 2ZHEH 1AI8H 1J16A 3SQEE 1AIXH 1W13U 2Q1JA 1HCGA 1KXEA 3ODFA 1C1WH 5GPIB 1GCTC 5FHTA 2CXVA 2BYAX 2J92A 1EB2A 4ZAEA 2V3OH 3ZV8A 2BQ6B 5JDUB 3K6YA 5JBBS 3QLPH 1ELAA 2CV3A 4IC6A 3NK8A 4ZROA 3SZNA 1ZMLA 1HIAB 3GDVA 1J14A 1ELEE 3A89A 3SNCA 2ALPA 2FIRH 2SNWA 4X1PU 2YNAA 4MTBA 1L1JA 4FUEA 4X1NU 3ZZ4A 4B73A 3RMNH 1AUJA 4QT8C 1BMAA 1GBDA 1PYTD 1YLDA 1CHOG 1G3EA 3NWUA 1Y3UA 5FXLA 5I46H 1Y59T 1CE5A 3PMAB 1KSNA 4Q2KA 2QA9E 2GZ7A 4UFGH 1Y5UT 3PWBA 2ILNA 1HJ9A 3FAOA 1GI9B 1C5RA 1MMJN 3QGJA 4WMDA 1FIZA 4ASHA 3T25A 1T8MA 4ABAA 1UK4A 2FDAA 5J4QA 1MTWA 1TGCA 1DOJA 2AMQA 1Z6EA 1OSSA 3MH5A 2VVVA 1P09A 1AO5A 3Q3XA 2BB4A 3Q3YA 4OS1A 4K60A 4BNRA 2FYRA 3SBKA 1TGSZ 2A7JA 1MKXH 4RSPA 1NRRH 4Y71A 2BLOA 3UFAA 3RXDA 5E2OA 1ZR0A 2QC2A 1UCYH 3A85A 4YT7H 2FI4E 2R2WU 3UQOA 1O3NA 1V2NT 3U1JB 2CGAA 1HJAC 1QR3E 4MQAA 4YTAA 3QTVH 2TBSA 2FOEA 5FCKA 1GI4A 3SJIA 2F9PA 1IQMA 2AH4X 2Z9GA 4A5TS 1KLJH 1HRTH 1A1RA 2F91A 2ZDLA 1D3TB 1JRSA 3PWCA 1HLTH 1TYNA 2UUYA 3SJ8A 1V2TT 2HWLB 3BG4B 1O2OA 2ZHFH 4K3JA 2ANMH 1F0UA 4Y6DA 4FU7A 3TJNA 2HNTF 3LPRA 3QK1A 3SI4H 1VITF 3PLBA 2XW9A 2ZZUH 1GBJA 2BDIA 2G5NA 1GJ6A 3E0NB 3LGWA 1LKBA 3MO3A 4THNH 9LPRA 1C5SA 1KXAA 1G32B 3RMLH 1QFKH 1FN8A 1GMCG 1N6XA 2UWOA 2ZDAH 4U30A 1IQLA 1CGJE 1J17T 1MBQA 1SG8B 2J9NA 5EXLA 3SGAE 1KTTB 1CT4E 1E0FD 2FOHA 4IW4E 4ABBA 1F5LA 4DCDA 1AB9B 2ALVA 1VGCC 2EC9H 4SGBE 4HTCH 4BTTB 3V0XA 4I33A 2GTBA 3RXAA 2PGBB 2F3CE 2A0QB 3T2NA 3IITA 1WSSH 2FO9A 2BM2A 1LTOA 3RXOA 1BRBE 1K1NA 1PQ5A 1J8AA 1W7GH 6LPRA 4X6MA 4E05H 3PO1B 3GYLB 3SV7A 2ZCLP 1LVYA 1P2NA 2UWLA 5FCRA 3VEQB 1NFYA 5J4SA 1YPHC 3B23B 1YCPK 2J2UA 1O2UA 1MH0A 4UEHH 3M3SA 2ZNKH 4DGJA 1O2ZA 1BUIA 2WUBA 3EA8A 1EPTB 2FWWA 1G9IE 1DVAH 1XVOA 2H2ZA 1O2TA 2ZPQA 4CRBA 1EX3A 4WY3A 1LPKB 4A1TA 1IHTH 3BTEE 2FTLE 3VGCB 3ZZCA 1G3BA 6GCHF 1VGCB 4PROA 4X6NA 2BLVA 2ZHDA 1QBVH 2Z9KA 4CBOA 1UHBA 3A7VA 1MQ5A 1UTOA 3ZVDA 3HK3B 4JZEH 3PTBA 1K1JA 3MH6A 4CR5A 1MAXA 1O3CA 2BX3A 1SGNE 3E8LA 4NA7A 1HAGE 3SV6A 1QL8A 1C5QA 3M5LA 1EAXA 5DP3A 2HNTC 3HGPA 2VVUA 3M36A 1NU9A 1DLKB 3DD2H 3HGNA 4ABJA 1NT1A 1V2ST 1DY8A 1UO6A 4INHA 2FOGA 1IQEA 3T62A 1A0JA 2BLWA 4Y7AA 3TLOA 1JIRA 2OINA 1QURH 1Y3WA 4Q7ZA 4ZXXH 2JETB 1O5BB 3GICB 4FUCA 3GCHC 1BRUP 1UK2A 2AEIH 1K1LA 1U6QA 1ZJKA 1PPZA 3V12A 5TCAA 1P2KA 2H6MA 1O39A 5T6GA 4BANB 3SNBA 1GJAB 2ZI2H 6CHAB 1ZHRA 3S7HB 3A80A 1FY8E 4JZFH 4CBNA 3SJ9A 1O30A 1QJ6B 3ELAH 4Y79A 1GJDB 3VB4A 3SJKA 2VWNA 1BCUH 1C5TA 3IWMA 1QJ7B 2OUAA 1ABIH 2GCHF 2UUJB 1Z8JB 3N7OA 2ZKSA 1HBTH 2PKSB 4NFFA 4NFEA 4I8HA 3TNSA 1LHFH 1O2WA 2UUKB 2XBYA 1ZTKA 1SGPE 1O5EH 1CU1A 2B0FA 1EPTC 2AS9A 3UREA 3SUEA 1HAXB 3RXSA 1O3HA 2EI8A 1TLDA 1XUGA 3OSYA 2LPRA 1D3PB 1QJ1B 5AFZH 3TNTA 4AG2A 1KDQB 3M5MA 3OU0A 2V0BA 4FVBA 4E7NA 1CHOF 3P6ZB 1YGCH 2ZFSA 1HAYB 2O8MA 1BJUA 2EEKA 1TNLA 2SFAA 2NU0E 3SNAA 3D65E 3KNXA 1W12U 2P3TB 1EJNA 3VB3A 1MZDA 1CA0C 1O2NA 4CHAB 1QRWA 2VIOA 2RA0A 1FAXA 4KGAA 1ZPZA 2FI5E 2Z7FE 1EB1H 1SB1H 4YO9A 3ZZBA 4X1SU 2OP9A 1G2LA 3M7QA 1DUAA 1EOLA 1F92A 2C93B 3AAVA 3LKWA 5AVDA 2JH0D 3GOVB 4XBBA 3M37A 1OWIA 1P2MA 3MU4A 3C27B 1SFIA 1IQKA 3ATLA 3MO9A 1C2JA 1O2XA 2SNVA 1GHYH 1FPCH 1NFUA 2P95A 4BAKB 1GMHG 5A0AE 4HI3A 4Y8XA 3SUFA 1P01A 5DO4H 1PPEE 3F68H 1GI1A 1OWEA 1ZLRA 4NSYA 3U9AH 3RU4T 2A2XH 1V2WT 4BOHA 1WOFA 4CRAA 1TRMA 4R8TB 4Y0ZE 2STBE 4I8KA 5DP8A 5JYIA 4YOIA 1TX6A 1ETSH 1WYKA 2GV7A 2H9TH 1Y3YA 4GCHF 3TK9A 3URDA 3MH4A 1DPOA 1FN6A 1MTNB 4GLYA 1P3EA 1C1QA 2G51A 5E2PA 5T3HA 1O32A 3L3TA 2HPPH 1SQOA 3QWCH 1BMLA 1QB1A 3DUXH 4B74A 1EP6A 3FP7E 4OS2A 3VB6A 1C5XB 2FOCA 1BRAA 1QQ4A 3RXUA 3QTOH 3MU1A 2QF3A 1PFXC 1FY5A 3F9HA 1SLVB 2O8LA 1IQJA 4BXSA 4Y10E 1IQNA 2ZU4A 1TX7A 1C2HA 1UK3A 2ZFFH 8ESTE 2IPHA 3Q00A 5BRRE 2GDEH 1H8DH 1AFEH 3TGKE 1OYQA 4MNWA 5HYOA 2CMYA 4MG3A 2IOTA 1DS2E 3SU1A 2ZGJA 3PM3A 1P3CA 4IC5A 1WU1A 2O9QA 1Z1IA 2Z3DA 1P06A 2ZPSA 1G3DA 1TFXA 3UUZA 1HGTH 2G55A 1V2LT 1MKXK 3GCOA 1KTSB 1C1UH 2BD3A 2H1UA 5EG4A 1L1GA 1H9IE 3SU4A 2WV5A 2GCTB 4NG9H 4ZHMU 1O2IA 2VIQA 1ETTH 2Y5FA 2ZFQH 1F2SE 1P11E 9ESTA 1EQ9A 4H6TA 1AHTH 1MQ6A 1AFQB 1ORFA 1XUJA 3T28A 1FMGA 2Q6GA 1OWJA 2VINA 1A5IA 4FUDA 4D9RA 4B75A 1HB0B 1W11U 1GBEA 3SU5A 1WTGH 1BDAA 5C2ZA 5LPRA 2PWXA 1K1MA 2Y7ZA 4JYVH 1VCQA 3RXHA 2VH6A 1ELVA 3EE0B 1AE5A 1BITA 1E38B 1S84A 4H42U 1TRYA 1QB9A 2AYWA 3GCHB 1O2VA 2VVCA 3A8CA 1FLEE 3Q77A 2W3KA 3U69H 1MUEB 4WJG2 8GCHF 1IQGA 4AFSA 3K9XB 1KXCA 1RRKA 3MI4A 3LT3A 2VIPA 3ZZAA 1TWXB 1SL3A 3A88A 2VIVA 3IG6B 1BBRE 1CA8B 4AGJA 1EJAA 1EZUC 2A32A 2A5IA 2P3UB 2BOHB 2BDAA 2WPJS 1DDJA 4WMFA 1FJSA 2K1QA 1DXWA 3GY5A 2J95A 1WUNH 1TNIA 3RUOA 3A8AA 2G5VA 5DPAA 1W0ZU 1O5FH 5CHAC 2A31A 5GCHF 2XBXA 4X2VA 3A7YA 2BDGA 1HV7A 1DWBH 5AFYH 2HGTH 1H9HE 4ISIH 4AB8A 1F5KU 3GY8A 1BTUA 4J2YB 1GDQA 2Y6TA 2AGGX 1HPGA 1BQYA 5FBIA 3EA7A 1TBZH 1TX8A 1W8BH 2A7CA 2BLQA 3A8BA 1OP0A 1AKSB 4FUFA 5EU8A 3AW0A 3FP6E 1GI0A 3K6ZA 1HUTH 1SC8U 1P10A 3DT0H 5TCCA 2GCHG 3LGYA 2PUXB 2I6SA 1GBLA 4DJZB 2ZDMA 2QV1A 3F9EA 3RP2A 2GZ9A 1GDUA 4ABHA 2CN0H 4K5ZA 2ZFTA 5C1YA 4TYDA 2WYGA 2YOLA 4Y8YA 1DITH 1D9IA 5FBEA 1MAYA 3MHWU 3M7UA 2BQ7B 1SGDE 3PLKA 4KTCA 5A09A 1FY1A 1AD8H 1ZPCA 1MD8A 1NS3A 2VIWA 1BTPA 3UNSA 3TVJB 1DICA 1C2EA 5DGJA 2Y5GA 3SGBE 5DK1A 1IQIA 4GHQA 1TE0A 1Z8RA 2EI7A 3RM2H 1JOUB 4H6SB 3BEUA 2BD7A 1Y8TA 2GV6A 1YPJH 3UR6A 1T7CA 1SGQE 1Y3XA 4HFPB 1YPKH 1GMCF 3TPIZ 4TWYA 1QY6A 3RU4E 2QAAA 3QZQA 1YBWA 1VITH 3PROA 4GAWA 3W94A 1SLUB 1TGBA 1AGJA 1IAUA 2PKAA 2W7UA 3UOPA 2CJIA 3HATH 3ITIA 2QN5T 4XDEA 1GHBG 2ZGXH 1UTQA 3UIRA 2XBWA 3LDXH 1W10U 1O33A 1RXPA 3PMHB 3UTUH 1C1NA 1A46H 4K8YA 1B7XB 1GG6B 5EOKA 5GIBA 8GCHG 1G3CA 3M3TA 2QXHA 3B8JA 4NGAH 1AMHA 3SN8A 1UJ1A 2FLRH 4X6PA 1CO7E 2G81E 1BTZA 4IS5A 2DE9A 4YLUA 3EGKH 1ZOMA 1SGCA 4D7GA 2BTCE 2XC0A 4AFZA 1O2JA 1FZZA 1GCDA 4LK4A 3SI3H 1AZZA 3M3VA 4A92A 5AF9H 3LC5A 2F9UA 4FUBA 1L4DA 5E0JA 1X7AC 4OS7A 3KQCA 1DWDH 1T4VH 1Z71A 4DOQA 1E35B 1CT0E 1DWCH 4IBLH 1AB9C 3ZZ8A 1YCPH 1O5AB 3TU7H 1DM4B 1L2EA 4ISOA 2ODYB 4ABFA 1O2SA 2OCVB 5GXPA 1GBCA 1GJBB 2FODA 5DP5A 5E8EH 3RXFA 1GJ5H 4MNYA 5CHAB 3E90B 1O2MA 1OX1A 2A5KA 3FFGA 2F83A 2WUCA 5EQSA 1V2KT 1KY9A 1QRZA 1ZJDA 1O5CB 2F9OA 2A1DB 1JRTA 4D7FA 4F4OC 1T8NA 2BY6X 3SU3A 1O3KA 1BT7A 2F9NA 2O8UA 1DXPA 3OY6U 4JYTA 2GP9B 1KLTA 1LQEA 2VGCB 1NO9H 4ESTE 3RXMA 2QGRA 1NRSH 1OP2A 3BTKE 1TRNA 1ESBA 1FI8A 1YF4A 1W2KH 1ELDE 1TQ7B 3PMJA 1T8OA 2FOMB 2PKSC 1C1RA 1D3QB 4KTUA 1N8OB 1V2OT 2XCFA 4NIXA 1DSUA 5C3NA 2CF8H 1QBOA 1AU8A 2F9BH 2OLGA 2OBOA 1DX5M 1BA8B 1V2PT 3A7TA 3U98H 1SGRE 1TPOA 3KQBA 1UCYE 3RXEA 2Y81A 5A0CA 1L0ZA 1XKAC
chains in the Genus database with same CATH superfamily
4X8VH 2H5DA 1Q3XA 1AVWA 3RXVA 3HKIB 1V2RT 1RFNA 1H8IH 3T5FH 1ESTA 5L30H 1IQFA 4XFQA 2GCTC 1TB6H 1T8LA 1AVXA 1GBBA 4UONA 3H5CB 3FANA 1ANDA 5T6FA 1CVWH 2PW8H 1RD3B 3GYMA 3AK5A 2VU8E 3T26A 2VGCC 3BIUH 2GMTB 2Q6DA 3QUMP 3VPKA 1F0RA 3LOXA 2V6NA 2PHBA 4I8LA 3NUMA 1S5SA 4XSKU 3BTHE 3KEEA 5JBTA 4NWLA 2NWNA 2M5TA 1LQDB 2Z9IA 1O3PB 2AGEX 5K0HA 3AAUA 3LGTA 1P0SH 1O3DA 3U1IB 1TOCB 1YKTA 2A4GA 1GI3A 4MPXA 2ZA5A 1C1TA 1BOQA 3BTTE 4YZUA 4K1SA 4F49A 1GHZA 1K1OA 1RJXB 1C2GA 1EP5A 3MU5A 3NXPA 4B76A 3RXQA 2J98A 1KXBA 1KLIH 1JXPA 1GBFA 1MU6B 3T27A 2WPKS 4X8UH 1GBIA 2NU4E 1DY9A 3BG8A 1P05A 1QHRB 1BB0B 2FS8A 2ODPA 2ULLA 4DT4A 1V2MT 3DA9B 4IN2A 2Y82A 1SLXB 1TA6A 2EA3A 1ZHPA 1F7ZA 3LC3A 4JK5A 5DN6D 2Y7XA 1QL9A 1TOMH 2R9PA 1O35A 2SGDE 1BRCE 2HOBA 3E6PH 1K0HA 1YYY1 1XMNB 1H4WA 1C2FA 4X1RU 4WWYA 2F4LA 1BMNH 2VNTA 1WXRA 3ZVEA 4XD7D 2V35A 2ZFRH 3A7ZA 3A83A 2AGIX 2TIOA 3F1SB 2B8OH 2FZZA 1XUIA 4RKOB 1SPJA 1RTLA 1UCYK 1D6WA 3ZVBA 3OX7U 1YPEH 1C4V2 1L1NA 1SHHB 1YPHE 1Z8GA 1C9PA 3ZVAA 2ZC9H 2J4IA 1THPB 3LGUA 4BXWA 4LZ1H 3RXPA 5EW2H 5LPEA 3O8CA 3OFND 5EPNA 5I25A 1TIOA 5GCHG 1P04A 2CF9H 2QYIA 1PPBH 1UTMA 1ANCA 2B5TB 4B71A 4OS5A 3M5OA 4YM9A 2RDEA 3KIDU 3A7WA 3SUGA 2AMDA 1GI8B 2R0LA 4BAQB 4ABEA 3ATMA 1GHAG 2BZ6H 3OYPA 1ZSLA 5GJ4B 3CS0A 1TNJA 1ACBE 3RDZA 2P59A 2AHME 2SGEE 2BVRH 2WPLS 6ESTA 2HLCA 3D62A 2JKHA 4A1XA 3GCTF 4GSOA 3ZIAD 1AFQC 2GX4A 4IN1A 3TH3H 2PFEA 2GD4B 1GBMA 1XVMA 2BDCA 1GJ4H 1E34B 5L6NH 5F6MA 3ZV9A 2NU1E 1INCA 1O2KA 2O8TA 3I78A 1UTJA 3EDXB 4J1YA 2ZU2A 2ODQA 2PSYA 4X2YA 3RXKA 4D9QA 1ZSJA 2XCNA 2D1JA 4IMZA 3RXRA 1OWDA 1YPMH 5KEDA 3KQEA 1F0TA 1N1LA 2FOBA 3QZRA 4UD9H 1BBRH 4YLQH 3DHKH 4JMYA 1AN1E 4AFQA 1HAZB 1MTSA 3BSQA 5A8ZA 1LDTT 4Q7YA 5LGOA 1P2OA 1FPHH 3PLPA 1A0LA 4ZKOU 1OWKA 5C94A 1PQ8A 2V7QD 2QY0B 1MCTA 4CRDA 1PPGE 5FPTA 2OC8A 3F0PA 4YOJA 3BN9A 1Q2WA 3F3BA 2ANKH 3P8OA 2OXSA 3FZZA 1P8VC 1WAYB 1H9LB 1A5HA 2GDDA 2W7SA 5EXNA 4UFDH 5C0UA 3LGVA 3P92A 5GWZA 1F5RA 5C5NA 1Y3VA 4WF8A 1TBRH 4X6OA 1A7SA 1ARBA 2C90B 1TQ0B 1YY3A 4ASUD 5DP4A 2NU2E 2R3YA 2ZHWH 1HNEE 3QGNB 2BVSH 2QXJA 1MTUA 3F9GA 1TGTA 1ESAA 2BY5X 1SGYE 3AW1A 3JZ1B 3C1KA 3L33A 3OY5U 4K1TA 2YMSD 3A81A 2STAE 3U8RH 2RFKC 3QX5H 4Y7BA 3KN2A 1HAVB 3MNBA 2ZWLH 2RCEA 1GJCB 1TGNA 3BG4C 3MFJA 1K9OE 1HAHH 1V2JT 4ZMAH 4ACBA 5C67A 3QO6A 1E1RD 3M5NA 1SGFG 1C4Y2 1TMTH 1GL0E 2P93A 3PTNA 4E7RG 7ESTE 2BD2A 3FZDA 1EZSC 4GCHG 3V3MA 2FOAA 1GJ7B 2A2QH 1HXFH 4CH8B 1UHBB 1K1PA 2A4OA 3A7XA 2W5EA 4ABGA 1V2UT 1SVPA 1AUTC 1SMFE 4DIHH 2H9EH 1E36B 2G8TA 3RU4D 3VB7A 5DSFA 1AE8H 2VH0A 2VWOA 2C8XB 1GDNA 1O34A 4FUJA 3BTDE 1ANBA 1KIGH 3ATKA 2XNIA 3D23A 1K22H 2BY8X 1IHSH 1C1VH 4TY7A 3BEFB 2H9HA 4UE7H 1OHHD 2BX4A 3ZYDA 3MU8A 2FPZA 3F6UH 3MTYA 1C5LH 5ABWA 2WYJA 4Z0KA 4ABDA 3E1XB 4FU9A 5L2ZH 1UVTH 1MABB 5FAHA 1XX9A 4AX9H 5ESTE 4AYVB 4NSVA 2ZTZA 2FMJA 1HFDA 2ZDNA 3DSPA 3SOSA 2PV9B 3RMMH 3OEED 4RKJB 3UOUA 3SHAH 4NA8A 1JWTA 2P16A 1JIMA 1GBHA 2C8WB 3LJOA 2ZU3A 4AGKA 1GHAF 4XOJA 1UTLM 1KMHB 4JZ1A 1O3JA 1ZRKA 4NIWA 4UDWH 2LIZA 2KAIA 3BIVH 1EZXC 1GI6A 3LH3A 2OTVA 4UFFH 4ZKNU 1O0DH 1QIXB 5HMAA 2HNTE 1NESE 1O2QA 2LP6A 3P8NA 1C5UA 3KHVA 1FUJA 4DVAU 1AWHB 4JZIA 5JBCS 3GDSA 1ELBA 2GKVE 4Q7XA 1CGIE 2TRMA 2C8ZB 1PPFE 1S83A 2BY9X 1FQ3A 2THFB 3GS9A 2O8WA 1GGDC 4U01A 5E0GA 1ZTJA 4Q80A 5C1XA 1BMFD 3FN8A 4JK6A 1TNHA 2FXRA 2J94A 3I29A 1G30B 2BVXH 1Z8IB 2IPQX 1EKBB 1BBRK 3N7EA 1O38A 1P02A 5F8XA 1JMOH 2QF5A 3HKJB 3V13A 1V3XA 1THRH 5EODA 3S69A 4OS6A 4ZUHA 1HAVA 4AYYB 2XC4A 1HJ8A 5GDSH 1HIAA 3ZYEA 1DLEA 2ANYA 3S9BA 2C3SA 2QF0A 1FV9A 8LPRA 1C1PA 1ID5H 2ZU1A 4CH2B 1LO6A 2F9VA 1G37A 4ISLA 1ZRBA 2ZCHP 4FU8A 4JYUH 4TY6A 3KQDA 1UTKA 2RDLA 2KAIB 1AWFH 2BXTH 3SW2B 1DE7H 4I8JA 3DFLA 4O3TA 3SGQE 2ZDKA 1LPGB 3K2UA 2D8WA 3P8FA 2A4QA 1LHDH 4CR9A 4YESB 2Z3CA 1MU8B 1GVKB 3UR9A 1ZGIA 4ZKSU 1NRQH 3RXTA 1RS0A 2ZHQH 3H7OA 3Q3KA 5EQQA 5HM9A 1W0YH 1GGDB 1QGFA 5K7RA 2AERH 1B5GH 4WXIA 1K28D 1DT2A 3VXFH 1UVPA 2AMPA 1MTVA 4VGCB 2P94A 1SGIB 2GZ8A 1LHCH 1FAKH 2QXIA 1O2YA 4UFEH 2Z6BD 1CHGA 2J34A 3RC6A 1ABJH 1K2I1 1P57B 1HXEH 3OTJE 4AOQA 4NZQA 1LVBA 4TPIZ 3MO6A 1BJVA 1O3IA 6GCHG 3M61U 3ZVGA 1A61H 2ZQ2A 3ZZ7A 3LJJA 1A3EH 3MOCA 1BTYA 5G4BA 1TBQH 1YWUA 5B6OA 5H4IB 2GMTC 2BDBA 1C5WB 1QNJA 2Y5HA 1EPTA 5AHGH 3E91A 3MMGA 4LOYH 3E0PB 1EASA 1VKYA 2WV4A 2FI3E 3PO1C 2HLDD 3PYHA 3TJOA 1ZHMA 3FP8E 2BQWB 3BTQE 1O5GH 3TH4H 1L4ZA 3SV9A 5C1UA 3MYWA 2A5AA 1SGTA 1C5PA 1PYTC 5L2YH 3CENA 3U8TH 1UTPA 1K21H 1YPLH 1YCPM 2SGQE 1GBAA 3A8DA 2WZQA 3BTWE 1WBGB 2SGFE 3R3GB 4JCNA 3EA9A 2BOKA 1BZXE 1ZMNA 2GGVB 2TGDA 2FEQH 3FO8D 1C5ZB 4MNVA 5A8XA 3DFJA 4ISHH 2FESH 1OWHA 1YC0A 1C1SA 4D8NA 5IDKA 3TJVA 1LVOA 1FXYA 2ESTE 6CHAC 2FTMA 3RLYH 3S0NA 3KQ5A 2Z94A 3TH2H 4Y8ZA 3KYFA 2GJGA 1NRPH 3P95A 2ZTXA 1TMUH 4U2WA 2PTCE 3A86A 4TPYA 1MD7A 1TPPA 2SGAA 1LKAA 2GT7A 2BY7X 2LELA 2ZECA 1IQHA 1ETRH 1GBTA 8KME2 4WH8A 3F0OA 3AVZA 4D76A 1GPZA 2G4TA 1LCYA 4DT7B 4KKDA 1C2LA 1UMAH 1C5NH 3DSGA 1T32A 4OGXA 3MNCA 2ZQ1A 4O03A 4FUGA 2OC7A 1XXDA 1AQ7A 5FX6A 4B2BA 4NZLA 1THSH 3BF6H 4FUIA 5F03A 3SU6A 3ZVFA 1TPAE 1A5GH 2XYAA 1QL7A 2P8OB 5F8ZA 3PV4A 2BZAA 3TITA 5DKMA 2ZPRA 3NPSA 5CMXH 4RT0A 1RGQA 1VJAU 1E1QD 3V7TA 1KYNA 1D6RA 1HAIH 1QRXA 4M9FA 2WINI 2IN2A 1ZZZA 1LHEH 1PJPA 5A2MH 1C2MA 1NZQH 1ELTA 4X0WU 2C8YB 2PSXA 2LNCA 2ASUB 3L6PA 2K7XA 2YNBA 2GT8A 3K65B 4AORA 3SU0A 4AZ2B 1V6DA 2CHAC 2WPHS 1QB6A 2G4UA 3ESTA 2KFWA 1YP9A 4NCYA 4O3UA 1V2QT 2JH5D 4DY7B 2EI6A 1SKYE 4BAMB 1P2IA 2TPIZ 2FX6A 1NN6A 4RN6A 1GHXH 1MZAA 1DANH 4I31A 3NZIA 3GCTG 2ZP0H 1QTFA 1XKBC 4AFUA 1UVOA 1NY22 2RG3A 2Q6FA 3S9CA 3EQ0H 3RXGA 3NKKA 4DURA 1J15A 1WCZA 1C5OH 1G36A 3ZZDA 5A0BA 3UQVA 1BHXF 1TONA 2FLBH 1GWAA 2W3IA 3ODDA 4KTSA 1YLNA 5IYTA 1OYTH 1O2LA 5LPFA 1CBWC 1RIWB 2JJ2D 2HPQH 2XBVA 1W7XH 5FPSA 1QQUA 3PB1E 1SR5C 4B1TA 1DFPA 5DJ7A 1C5VA 3CP7A 3TGIE 4VGCC 2XWAA 3GY2A 2RA3A 2B7DH 4HGCA 1OOKB 5DP7A 1W14U 3UPEA 4TT3D 2XTTB 1CT2E 1ZPBA 2BMGB 3RXIA 4BAOB 3RC4A 3BTGE 1QA0A 4O97A 1GHVH 1BTXA 3TGJE 4XE4A 3CS7A 2ZGHA 1BTHH 2TGTA 4MDSA 1MKWH 4NIYA 2WPDD 3LIWA 2ZDVH 3LH1A 1WTHD 3A82A 5KGOA 2OD3B 3S9AA 1C1MA 4Y76A 1NBMD 1VITG 4HG6A 2SGPE 4ISNA 4A6LA 1A2CH 4TWWA 2D2DA 3M7TA 4DW2U 1O31A 1BIOA 1O37A 5C0TA 1LVMA 1Z6JH 3GY6A 3KL6A 1C5YB 3WW7A 1G2MA 4MNXA 1EXFA 1KDQA 1XM1A 1ZMJA 1S6LA 2DE8A 4K1EA 3O8DA 4FETA 1D4PB 3SHCH 1AZ8A 1HJAB 1ELCA 1ELGA 2ZGCA 2P3FH 3N99A 1GI7B 2B9LA 5CHBA 1XUKA 1D3DB 3GCNA 5SGAE 3STIA 4LZ4B 3VFEA 4A7IB 1TA2A 2ZCKP 2BHGA 1T31A 2Z3EA 1AKSA 2OQUA 4IMQA 3NCLA 1WQSA 2PR3A 3SV2H 2PTNA 3P8GA 1S0RA 1W3CA 4M7GA 2PUQH 2OC0A 4BAHB 1ZYOA 1ZTLA 3SNDA 1Z1JA 4WH6A 1GHBF 1GMDF 1O2RA 1B0EA 1XXFA 1DWEH 1F0SA 1SSXA 3OE7D 4OS4A 3RC5A 2KCOA 4FVDA 5CE1A 3GY4A 1VR1H 3G01A 2ZTYA 3OTPA 4ZXYH 4ZKRU 1NM6A 1RIWC 1Y5BT 2WPMS 2ZGBH 5TJXA 1SQTA 1S6HA 5EW1H 3SNEA 5HM2A 5HGGA 2V3HH 1FIWA 3MWIU 3GDUA 3MU0A 4XBCA 4XBDA 2AFQB 1OPHB 3O8RA 1O2PA 2TGPZ 2ZG0H 3RXCA 1S0QA 1UTNA 5DP9A 1S85A 2FYQA 2WPIS 3ZZ3A 3STJA 1FY3A 4MLFB 1EATA 5DP6A 1MKWK 2D26C 3ZZ5A 3PV5A 1GMDG 1RTKA 3U8OH 4WMEA 4AB9A 4LXBH 1Z7KA 2Z9JA 1EAIA 1CSOE 3RXLA 4H4FA 1C2KA 1OKXA 1OP8A 4NWKA 3SQHE 5T6DA 1S6FA 3EAJA 1YLCA 2VB0A 2TGAA 2CHAB 3UY9A 3KF2A 4I7YH 4ZHAA 3O8BA 1TPSA 3P70B 5C20A 1LHGH 4U32A 2PP6A 4CRCA 1B0FA 1GJ8B 1O3LA 3T29A 3F9FA 2W26A 3E3TA 2KX4A 1O2HA 1P2QA 1VCWA 2HVXA 1P9UA 3QN7A 5A8YA 1P2JA 1ZSKA 3D49H 1SGEE 1SFQB 2P8OC 3AASA 1C2DA 4AG1A 3S7KB 1YPGH 2Z9LA 3QDZB 1BMMH 4B2AA 5JPMH 1CA0B 4HZHA 4INLA 4X8SH 1S81A 4X8TH 1P03A 5HXFA 1IOEA 1TAWA 2ZFPH 1CGHA 5JBAS 5FX5A 2GVFA 3W95A 4WVPE 3FVFB 2H5CA 1DUEA 3E16B 5EXMA 3GISB 7LPRA 2AIPA 1NFXA 3EE7A 2BD9A 5EPYA 1O3OA 4KELA 2I6QA 4GPGA 2VIDA 3UWJH 1EOJA 1CQQA 1GBKA 4OGYA 1FDPA 3GY7A 4I32A 1UW7A 1HDTH 7KMEH 1O36A 5PTPA 3ATIA 1SHYA 1TABE 4K2YA 4FUHA 1GJ9B 2WHXA 3TJUA 1RTFB 1SGFA 2BDHA 3MQKC 1NU7B 3EYDA 1A3BH 1C2IA 1XUFA 2XRCA 2BD5A 3R0FA 3MNXA 1P9SA 1LPZB 3UNRA 1GCTB 4AN7A 4MVNA 3ATWA 1SI5H 1SQAA 1NC6A 2FP7B 5HIYA 2PKAB 4E06H 2ZIQH 4DG4A 1MCVA 1TNGA 1PPHE 3MNSA 4NIVA 3ZZ9A 2OC1A 1AVGH 1YM0A 5JB9S 5JB8S 4MPUA 1HAOH 1PPCE 1O3MA 1UVSH 3W1EA 1H1BA 4GHTA 2OBQA 4K69A 3RM0H 2JETC 2NU3E 2PLXA 1NPMA 4YT6H 2ZU5A 1GMHF 1VZQH 2R3UA 4KP0A 4CRGA 1M9UA 1N6YA 5EGMA 4ZHLU 2BD4A 3ZVCA 3LU9B 4CRFA 1BHXB 1GVZA 3NRLA 1O3FA 1SOTA 1EFRD 2ANWA 3P17H 3I77A 1KXFA 2QXGA 1EAWA 5DG6A 1C4U2 3Q76A 1TALA 4WXVA 1SBWA 1VJ9U 4X2WA 2A4RA 2KZ4A 3A84A 1KXDA 2Y80A 1HAPH 2G52A 1T4UH 1AY6H 3TIUA 3UWIA 4Y11E 1TMBH 1QA7A 2ZEBA 3UNQA 3SJOA 1P12E 2VJ1A 3LONA 1ARCA 4F48B 4X1QU 3ZZ6A 1PQ7A 3EBNA 3GY3A 1WQVH 2XC5A 3ENSB 2IJD1 5ESBA 1FNIA 1TNKA 1NROH 5EQRA 5FPYA 4FXGH 3BEIB 2IJOB 4B2CA 1MBMA 3SU2A 1N8OC 5ETXA 4A1VA 1H8ED 3SUDA 3VGCC 2JH6D 2OQ5A 1WV7H 2XXLA 2XWBI 3JZ2B 4ABIA 3HK6B 2R0KA 5EIYA 1C1OA 1CBWB 2J38A 4Y0YE 1QBNA 5CDFE 1FONA 1ANEA 3KCGH 2K0QA 3VB5A 1EUFA 4MPWA 2DUCA 1XUHA 4DIIH 4B6EA 1Q31A 2VWLA 3TK5A 1FY4A 1O3BA 4R0IA 1GL1A 1ZGVA 2FM2A 4BTIB 1GHWH 3RXBA 1NRNH 1V2VT 3RMOH 5F8TA 1O3EA 3SV8A 4I8GA 3PMBB 2BD8A 3BTME 5HIZA 2UUFB 5LH8A 1A4WH 2AIQA 4IGDA 4JZDH 1UVUH 2BXUH 1SLWB 3A87A 3SO3A 1Y5AT 1GI5A 2C4FH 1EZQA 4X2XA 4YOGA 1QCPA 2J98B 1OS8A 3B9FH 4INKA 3SORA 4O9VA 1A0HB 1J9CH 2QCYA 1NTPA 1EAUA 2A45B 2VWMA 1GI2A 3URCA 7GCHF 2HALA 4CHAC 1C5MD 1MTNC 2QE7D 1QZ8A 2F43B 5BPEA 4Z6AH 1O3GA 4SGAE 7GCHG 2R2MB 3RLWH 1E37B 3KGPA 5C5OA 1GVLA 4NA9H 1DSTA 2HRVA 1SOZA 2FOFA 3TK6A 1HYLA 1BTWA 3LGIA 1JBUH 1ELFA 1C9TA 4ZH8A 1OXGA 3BTFE 1NFWA 2PGQB 3BV9B 1O2GH 1VCPA 4BTUB 1GG6C 1O5DH 3HPTB 3WY8A 5HKKD 4MPVA 3FOAA 3N7DA 4K8BA 2G00A 1EJMA 3H7TA 2UWPA 4Q63A 2FX4A 4CREA 3RXJA 1LMWB 1O3AA 4GVUA 1S82A 2ZF0H 5E0HA 3M35A 3VXEH 1PQAA 3MH7A 2ZO3H 2BDYA 2FS9A 4ACAA 4GUXA 1K1IA 2A7HA 2QIQA 2ZHEH 1AI8H 1J16A 3SQEE 1AIXH 1W13U 2Q1JA 1HCGA 1KXEA 3ODFA 4B6FA 1C1WH 5GPIB 2KCAA 1GCTC 3VG8A 5FHTA 2CXVA 2BYAX 2J92A 1EB2A 4ZAEA 2V3OH 3ZV8A 2BQ6B 5JDUB 3K6YA 5JBBS 3QLPH 1ELAA 2CV3A 4IC6A 3NK8A 4ZROA 3SZNA 1ZMLA 1HIAB 3GDVA 1J14A 1ELEE 3A89A 3SNCA 2ALPA 2FIRH 2SNWA 4X1PU 2YNAA 4MTBA 1L1JA 4FUEA 4X1NU 3ZZ4A 4B73A 3RMNH 1AUJA 4QT8C 1BMAA 1GBDA 3KYGA 1PYTD 1YLDA 1CHOG 1G3EA 3NWUA 4YXWD 1Y3UA 5T1VA 5FXLA 5I46H 1Y59T 1CE5A 3PMAB 1KSNA 4Q2KA 2QA9E 2GZ7A 4UFGH 1Y5UT 3PWBA 2ILNA 1HJ9A 3FAOA 2VBCA 1GI9B 2KCPA 1C5RA 1MMJN 3QGJA 4WMDA 1FIZA 4ASHA 3T25A 1T8MA 4ABAA 1UK4A 2FDAA 5J4QA 1MTWA 1TGCA 1DOJA 2AMQA 1Z6EA 1OSSA 3MH5A 2VVVA 1P09A 1AO5A 3Q3XA 2BB4A 3Q3YA 4OS1A 4K60A 4BNRA 2FYRA 3SBKA 3OEHD 1TGSZ 2A7JA 1MKXH 4RSPA 1NRRH 4Y71A 2BLOA 3UFAA 3RXDA 5E2OA 1ZR0A 2QC2A 1UCYH 3A85A 4YT7H 2FI4E 2R2WU 3UQOA 1O3NA 1V2NT 3U1JB 3H09A 2CGAA 1HJAC 1QR3E 4MQAA 4YTAA 3QTVH 2TBSA 2FOEA 5FCKA 1GI4A 3SJIA 2F9PA 1IQMA 2AH4X 2Z9GA 4A5TS 1KLJH 4FOUC 1HRTH 1A1RA 5GNDA 2F91A 2ZDLA 1D3TB 1JRSA 3PWCA 1HLTH 1TYNA 2UUYA 3SJ8A 1V2TT 2HWLB 3BG4B 1O2OA 2ZHFH 4K3JA 2ANMH 1F0UA 4Y6DA 4FU7A 3TJNA 2HNTF 3LPRA 3QK1A 3SI4H 1VITF 3PLBA 2EY4C 3F2FA 2XW9A 2EQNA 2ZZUH 1GBJA 3F2HA 2BDIA 2G5NA 1GJ6A 3E0NB 3LGWA 1LKBA 3MO3A 4THNH 9LPRA 1C5SA 1KXAA 1E79D 1G32B 3RMLH 1QFKH 1FN8A 1GMCG 1N6XA 2UWOA 2ZDAH 4U30A 1IQLA 1CGJE 1SG8B 1J17T 1H8HD 1MBQA 2J9NA 5EXLA 3SGAE 1KTTB 1CT4E 1E0FD 2FOHA 3OAAD 4IW4E 2K8IA 4ABBA 1F5LA 4DCDA 1AB9B 2ALVA 1VGCC 2EC9H 4SGBE 1FX0B 4HTCH 4BTTB 4P02A 3V0XA 4I33A 2GTBA 3RXAA 2PGBB 2F3CE 2A0QB 3T2NA 3IITA 1WSSH 2FO9A 2BM2A 1LTOA 3RXOA 1BRBE 1K1NA 1PQ5A 1J8AA 1W7GH 6LPRA 4X6MA 4E05H 3PO1B 3GYLB 3SV7A 2ZCLP 1LVYA 1P2NA 2UWLA 5FCRA 3VEQB 1NFYA 5J4SA 3PV2A 1YPHC 3B23B 1YCPK 2J2UA 1O2UA 1MH0A 4UEHH 3M3SA 2ZNKH 4DGJA 1O2ZA 1BUIA 2WUBA 2JJ1D 2XOKD 3EA8A 1EPTB 2FWWA 1G9IE 1DVAH 1XVOA 2H2ZA 1O2TA 2ZPQA 4CRBA 1EX3A 4WY3A 1LPKB 4A1TA 1IHTH 3BTEE 2FTLE 3VGCB 3DCLA 1G3BA 3ZZCA 6GCHF 1VGCB 4PROA 4X6NA 2BLVA 2ZHDA 1QBVH 2Z9KA 4CBOA 1UHBA 3A7VA 1MQ5A 1UTOA 3ZVDA 3HK3B 4JZEH 3PTBA 1K1JA 3MH6A 4CR5A 1MAXA 1O3CA 2BX3A 1SGNE 3E8LA 4NA7A 1HAGE 3SV6A 1QL8A 1C5QA 3M5LA 1EAXA 5DP3A 2HNTC 3HGPA 2VVUA 3M36A 1NU9A 5KECA 1DLKB 3DD2H 3HGNA 4ABJA 1NT1A 1V2ST 1DY8A 1UO6A 4INHA 2FOGA 1IQEA 3T62A 1A0JA 4TSFD 2BLWA 4Y7AA 3TLOA 1JIRA 2YMSB 2OINA 1QURH 1Y3WA 4Q7ZA 4ZXXH 2JETB 1O5BB 3GICB 4FUCA 3GCHC 1BRUP 1UK2A 2AEIH 1K1LA 3SZEA 1U6QA 1ZJKA 1PPZA 3V12A 5TCAA 1P2KA 2H6MA 1O39A 5T6GA 4BANB 3SNBA 1GJAB 2ZI2H 1W0JD 6CHAB 1ZHRA 3S7HB 3A80A 1FY8E 4JZFH 4CBNA 3SJ9A 1O30A 1QJ6B 3ELAH 4Y79A 1GJDB 3VB4A 3SJKA 2VWNA 1BCUH 1C5TA 3IWMA 1QJ7B 2OUAA 1ABIH 1SQRA 2GCHF 2UUJB 1Z8JB 3N7OA 2ZKSA 1HBTH 2PKSB 4NFFA 4NFEA 4I8HA 2M2AA 3TNSA 1LHFH 1O2WA 2UUKB 2XBYA 1ZTKA 1SGPE 1O5EH 4RI0A 1CU1A 2B0FA 1EPTC 2AS9A 3UREA 3SUEA 1HAXB 3RXSA 3SYJA 1O3HA 2EI8A 1TLDA 1XUGA 3OSYA 2LPRA 1D3PB 1QJ1B 5AFZH 3TNTA 4AG2A 1KDQB 3M5MA 3OU0A 2V0BA 4FVBA 4E7NA 1CHOF 1NBME 3P6ZB 1YGCH 2ZFSA 3WWFA 2L74A 1HAYB 2O8MA 1BJUA 2EEKA 1TNLA 2SFAA 2NU0E 3SNAA 3D65E 3PRDA 3KNXA 1W12U 2P3TB 1EJNA 3VB3A 1MZDA 1CA0C 1O2NA 4CHAB 1QRWA 3UAIC 2VIOA 2RA0A 1FAXA 4KGAA 1ZPZA 2FI5E 2Z7FE 1EB1H 1SB1H 4YO9A 3ZZBA 4X1SU 2OP9A 1G2LA 3M7QA 1DUAA 1EOLA 1F92A 2C93B 3AAVA 3LKWA 5AVDA 2JH0D 3GOVB 4XBBA 3M37A 1OWIA 1P2MA 3MU4A 3C27B 1SFIA 1IQKA 3ATLA 3MO9A 1C2JA 1O2XA 2SNVA 5IK2D 1GHYH 1FPCH 1NFUA 2P95A 4BAKB 1GMHG 5A0AE 4HI3A 4Y8XA 3SUFA 1P01A 5DO4H 4RT1A 1PPEE 3F68H 1GI1A 1OWEA 1ZLRA 4NSYA 3U9AH 3RU4T 2A2XH 1V2WT 4BOHA 1WOFA 2QF4A 4CRAA 1TRMA 4R8TB 4Y0ZE 2STBE 4I8KA 5DP8A 5JYIA 4YOIA 3CNRA 1TX6A 1ETSH 1WYKA 2GV7A 2H9TH 1Y3YA 4GCHF 3TK9A 3URDA 3MH4A 1DPOA 1FN6A 1MTNB 2CK3D 1P3EA 4GLYA 1C1QA 2G51A 5E2PA 5T3HA 1O32A 3L3TA 2HPPH 1SQOA 3QWCH 1BMLA 1QB1A 3DUXH 4B74A 1EP6A 3FP7E 4OS2A 3VB6A 1C5XB 3PRBA 2FOCA 1BRAA 1QQ4A 3RXUA 4ZCNA 3QTOH 3MU1A 2QF3A 1PFXC 1FY5A 3F9HA 1SLVB 2O8LA 1IQJA 4BXSA 4Y10E 1IQNA 2ZU4A 1TX7A 1C2HA 1UK3A 2ZFFH 8ESTE 2IPHA 3Q00A 5BRRE 2GDEH 1H8DH 1AFEH 3TGKE 1OYQA 4MNWA 4Z1MD 5HYOA 2CMYA 4MG3A 2IOTA 1DS2E 3SU1A 2ZGJA 3PM3A 1P3CA 4IC5A 1WU1A 2O9QA 1Z1IA 2Z3DA 1P06A 2ZPSA 1G3DA 1TFXA 3UUZA 1HGTH 2G55A 4OM9A 1V2LT 1MKXK 2OK5A 3GCOA 1KTSB 1C1UH 2BD3A 2H1UA 3DSOA 5EG4A 1L1GA 1H9IE 3SU4A 2WV5A 2GCTB 4NG9H 4ZHMU 1O2IA 2VIQA 1ETTH 2Y5FA 2ZFQH 1F2SE 1P11E 9ESTA 1EQ9A 4H6TA 1AHTH 1MQ6A 1AFQB 1ORFA 1XUJA 3T28A 1FMGA 2Q6GA 1OWJA 2VINA 1A5IA 4FUDA 4D9RA 4B75A 3WWBA 1HB0B 1W11U 1GBEA 3SU5A 1WTGH 1BDAA 5C2ZA 5LPRA 2PWXA 1K1MA 2Y7ZA 4JYVH 1VCQA 3RXHA 2VH6A 1ELVA 3EE0B 1AE5A 1BITA 1E38B 1S84A 4H42U 4I86A 1TRYA 1QB9A 2AYWA 3GCHB 1O2VA 2VVCA 5EJLA 3A8CA 1FLEE 3Q77A 2W3KA 3U69H 1MUEB 4WJG2 8GCHF 1IQGA 4AFSA 2YMSC 3K9XB 1KXCA 1RRKA 3MI4A 3LT3A 2VIPA 3ZZAA 1TWXB 1SL3A 3A88A 4F55A 2VIVA 3IG6B 1BBRE 1CA8B 4AGJA 1EJAA 1EZUC 2A32A 2A5IA 2P3UB 2BOHB 2BDAA 2WPJS 1DDJA 4WMFA 1FJSA 2K1QA 1DXWA 3GY5A 2J95A 2KR7A 1WUNH 1TNIA 3RUOA 3A8AA 2G5VA 5DPAA 1W0ZU 1O5FH 5CHAC 2A31A 5GCHF 2XBXA 4X2VA 3A7YA 5EJZA 2BDGA 1HV7A 1DWBH 5AFYH 2HGTH 1H9HE 4ISIH 2KM0A 4AB8A 1F5KU 3GY8A 1BTUA 4J2YB 1GDQA 2Y6TA 2AGGX 1HPGA 1BQYA 5FBIA 3EA7A 1TBZH 1TX8A 1W8BH 2A7CA 2BLQA 3A8BA 1OP0A 1AKSB 1W0KD 4FUFA 5EU8A 3AW0A 3FP6E 1GI0A 3K6ZA 1HUTH 1SC8U 1P10A 3DT0H 5TCCA 2GCHG 3LGYA 2WV9A 2PUXB 2I6SA 1GBLA 4DJZB 2ZDMA 2QV1A 3F9EA 3RP2A 2GZ9A 1GDUA 3UB0A 4ABHA 2CN0H 4K5ZA 2ZFTA 5C1YA 2W6JD 4TYDA 2WYGA 2YOLA 4Y8YA 1DITH 1D9IA 5FBEA 1MAYA 3MHWU 2J5UA 3M7UA 2BQ7B 1SGDE 3PLKA 4KTCA 5A09A 1FY1A 1AD8H 1ZPCA 1MD8A 1NS3A 2VIWA 1BTPA 5FL7D 3UNSA 3TVJB 1DICA 1C2EA 5DGJA 2Y5GA 3SGBE 5DK1A 1IQIA 4GHQA 1TE0A 1Z8RA 2EI7A 3RM2H 5B6LA 1JOUB 4H6SB 3BEUA 2BD7A 1Y8TA 2GV6A 1YPJH 3UR6A 1T7CA 2J97A 4Q4LA 1SGQE 1Y3XA 4HFPB 1YPKH 1GMCF 3TPIZ 4TWYA 1QY6A 3RU4E 2QAAA 3QZQA 1YBWA 1VITH 3PROA 4GAWA 3W94A 1SLUB 1TGBA 1AGJA 1IAUA 2PKAA 2W7UA 3UOPA 2CJIA 3HATH 3ITIA 2KCYA 2QN5T 4XDEA 1WDIA 1GHBG 2ZGXH 1UTQA 3UIRA 2XBWA 3LDXH 1W10U 1O33A 1RXPA 3F2GA 3PMHB 3UTUH 1C1NA 4XRNA 1A46H 2L6OA 1COWD 5C17A 4K8YA 1B7XB 1GG6B 5EOKA 5GIBA 8GCHG 1G3CA 3M3TA 2QXHA 3B8JA 4NGAH 1AMHA 3SN8A 1UJ1A 5EJ1A 2FLRH 4X6PA 1CO7E 2G81E 1BTZA 2XNDD 4IS5A 2DE9A 4YLUA 3EGKH 1ZOMA 1SGCA 4D7GA 2BTCE 2XC0A 4AFZA 1O2JA 1FZZA 1GCDA 4LK4A 3SI3H 1AZZA 3M3VA 4A92A 5AF9H 3LC5A 2F9UA 4FUBA 1L4DA 2JIZD 5E0JA 1X7AC 4OS7A 3KQCA 1DWDH 1T4VH 1Z71A 4DOQA 1E35B 1CT0E 1DWCH 4IBLH 1AB9C 3ZZ8A 1YCPH 1O5AB 3FKSD 3TU7H 1DM4B 1L2EA 4ISOA 2ODYB 4ABFA 1O2SA 2OCVB 5GXPA 2V3MA 1GBCA 1GJBB 2FODA 5DP5A 5E8EH 3RXFA 5F53A 1GJ5H 4MNYA 5CHAB 3E90B 1O2MA 1OX1A 2A5KA 3FFGA 2F83A 2WUCA 4AC9A 5EQSA 1V2KT 1KY9A 1QRZA 1ZJDA 1O5CB 2F9OA 2A1DB 1JRTA 4D7FA 4F4OC 1T8NA 2BY6X 3SU3A 2JDID 1O3KA 1BT7A 2F9NA 2O8UA 1DXPA 3OY6U 4JYTA 2GP9B 1KLTA 1LQEA 2VGCB 1NO9H 4ESTE 3RXMA 2QGRA 1NRSH 1OP2A 3BTKE 2HVYB 1TRNA 1ESBA 1FI8A 1YF4A 1W2KH 1ELDE 3U28C 1TQ7B 3PMJA 1T8OA 2FOMB 2PKSC 1C1RA 2WSSD 1D3QB 4KTUA 1N8OB 1V2OT 2XCFA 4NIXA 1DSUA 5C3NA 2CF8H 1QBOA 1AU8A 2F9BH 2OLGA 2OBOA 4P00A 1DX5M 1BA8B 1V2PT 3A7TA 3U98H 1SGRE 1TPOA 3KQBA 1UCYE 3RXEA 2Y81A 5A0CA 1L0ZA 1XKAC 2W6ID
chains in the Genus database with same CATH topology
4X8VH 2H5DA 1Q3XA 1AVWA 3RXVA 3HKIB 1V2RT 1RFNA 1H8IH 3T5FH 1ESTA 5L30H 1IQFA 4XFQA 2GCTC 1TB6H 1T8LA 1AVXA 1GBBA 4UONA 3H5CB 3FANA 1ANDA 5T6FA 1CVWH 2PW8H 1RD3B 3GYMA 2VU8E 3T26A 2VGCC 3BIUH 2GMTB 2Q6DA 3QUMP 3VPKA 1F0RA 3LOXA 2V6NA 2PHBA 4I8LA 3NUMA 1S5SA 4XSKU 3BTHE 3KEEA 5JBTA 4NWLA 2NWNA 2M5TA 1LQDB 2Z9IA 1O3PB 2AGEX 5K0HA 3AAUA 3LGTA 1P0SH 1O3DA 3U1IB 1TOCB 1YKTA 2A4GA 1GI3A 4MPXA 2ZA5A 1C1TA 1BOQA 3BTTE 4YZUA 4K1SA 4F49A 1GHZA 1K1OA 1RJXB 1C2GA 1EP5A 3MU5A 3NXPA 4B76A 3RXQA 1KXBA 1KLIH 1JXPA 1GBFA 1MU6B 3T27A 2WPKS 4X8UH 1GBIA 2NU4E 1DY9A 3BG8A 1P05A 1QHRB 1BB0B 2FS8A 2ODPA 2ULLA 1V2MT 3DA9B 4IN2A 2Y82A 1SLXB 1TA6A 2EA3A 1ZHPA 1F7ZA 3LC3A 4JK5A 2Y7XA 1QL9A 1TOMH 2R9PA 1O35A 2SGDE 1BRCE 2HOBA 3E6PH 1YYY1 1XMNB 1H4WA 1C2FA 4X1RU 4WWYA 1BMNH 2VNTA 3ZVEA 2V35A 2ZFRH 3A7ZA 3A83A 2AGIX 2TIOA 3F1SB 2B8OH 2FZZA 1XUIA 4RKOB 1SPJA 1RTLA 1UCYK 1D6WA 3ZVBA 3OX7U 1YPEH 1C4V2 1L1NA 1SHHB 1YPHE 1Z8GA 1C9PA 3ZVAA 2ZC9H 2J4IA 1THPB 3LGUA 4BXWA 4LZ1H 3RXPA 5EW2H 5LPEA 3O8CA 5EPNA 5I25A 1TIOA 5GCHG 1P04A 2CF9H 2QYIA 1PPBH 1UTMA 1ANCA 2B5TB 4B71A 4OS5A 3M5OA 4YM9A 3KIDU 3A7WA 3SUGA 2AMDA 1GI8B 2R0LA 4BAQB 4ABEA 3ATMA 1GHAG 2BZ6H 3OYPA 1ZSLA 5GJ4B 3CS0A 1TNJA 1ACBE 3RDZA 2P59A 2SGEE 2WPLS 2BVRH 6ESTA 2HLCA 3D62A 2JKHA 4A1XA 3GCTF 4GSOA 1AFQC 2GX4A 4IN1A 3TH3H 2PFEA 2GD4B 1GBMA 1XVMA 2BDCA 1GJ4H 1E34B 5L6NH 5F6MA 3ZV9A 2NU1E 1INCA 1O2KA 2O8TA 3I78A 1UTJA 3EDXB 4J1YA 2ZU2A 2ODQA 2PSYA 4X2YA 3RXKA 4D9QA 1ZSJA 2XCNA 2D1JA 4IMZA 3RXRA 1OWDA 1YPMH 3KQEA 1F0TA 1N1LA 2FOBA 3QZRA 4UD9H 1BBRH 4YLQH 3DHKH 4JMYA 1AN1E 4AFQA 1HAZB 1MTSA 3BSQA 5A8ZA 1LDTT 4Q7YA 5LGOA 1P2OA 1FPHH 3PLPA 1A0LA 4ZKOU 1OWKA 1PQ8A 2QY0B 1MCTA 4CRDA 1PPGE 5FPTA 2OC8A 4YOJA 3BN9A 1Q2WA 2ANKH 3P8OA 2OXSA 3FZZA 1P8VC 1WAYB 1H9LB 1A5HA 2GDDA 2W7SA 5EXNA 4UFDH 3LGVA 3P92A 5GWZA 1F5RA 5C5NA 1Y3VA 4WF8A 1TBRH 4X6OA 1A7SA 1ARBA 2C90B 1TQ0B 5DP4A 2NU2E 2R3YA 2ZHWH 1HNEE 3QGNB 2BVSH 2QXJA 1MTUA 3F9GA 1TGTA 1ESAA 2BY5X 1SGYE 3AW1A 3JZ1B 3C1KA 3L33A 3OY5U 4K1TA 3U8RH 3A81A 2STAE 3QX5H 4Y7BA 3KN2A 1HAVB 3MNBA 2ZWLH 2RCEA 1GJCB 1TGNA 3BG4C 3MFJA 1K9OE 1HAHH 1V2JT 4ZMAH 5C67A 3QO6A 3M5NA 1SGFG 1C4Y2 1TMTH 1GL0E 2P93A 3PTNA 4E7RG 7ESTE 2BD2A 3FZDA 1EZSC 4GCHG 3V3MA 2FOAA 1GJ7B 2A2QH 1HXFH 4CH8B 1UHBB 1K1PA 2A4OA 3A7XA 2W5EA 4ABGA 1V2UT 1SVPA 1AUTC 1SMFE 4DIHH 2H9EH 1E36B 2G8TA 3RU4D 3VB7A 1AE8H 2VH0A 2VWOA 2C8XB 1GDNA 1O34A 4FUJA 3BTDE 1ANBA 1KIGH 3ATKA 2XNIA 3D23A 1K22H 2BY8X 1IHSH 1C1VH 4TY7A 3BEFB 2H9HA 4UE7H 2BX4A 3ZYDA 3MU8A 2FPZA 3F6UH 3MTYA 1C5LH 5ABWA 2WYJA 4Z0KA 4ABDA 3E1XB 4FU9A 5L2ZH 1UVTH 5FAHA 1XX9A 4AX9H 5ESTE 4AYVB 4NSVA 2ZTZA 2FMJA 1HFDA 2ZDNA 3SOSA 2PV9B 3RMMH 4RKJB 3UOUA 3SHAH 4NA8A 1JWTA 2P16A 1JIMA 1GBHA 2C8WB 3LJOA 2ZU3A 4AGKA 1GHAF 4XOJA 1UTLM 4JZ1A 1O3JA 1ZRKA 4NIWA 4UDWH 2LIZA 2KAIA 3BIVH 1EZXC 1GI6A 3LH3A 2OTVA 4UFFH 4ZKNU 1O0DH 1QIXB 5HMAA 2HNTE 1NESE 1O2QA 3P8NA 1C5UA 3KHVA 1FUJA 4DVAU 1AWHB 4JZIA 5JBCS 3GDSA 1ELBA 2GKVE 4Q7XA 1CGIE 2TRMA 2C8ZB 1PPFE 1S83A 2BY9X 1FQ3A 2THFB 2O8WA 1GGDC 4U01A 5E0GA 1ZTJA 4Q80A 5C1XA 4JK6A 1TNHA 2FXRA 2J94A 3I29A 1G30B 2BVXH 1Z8IB 1EKBB 1BBRK 1O38A 1P02A 5F8XA 1JMOH 3HKJB 3V13A 1V3XA 1THRH 5EODA 3S69A 4OS6A 4ZUHA 1HAVA 4AYYB 2XC4A 1HJ8A 5GDSH 1HIAA 3ZYEA 1DLEA 2ANYA 3S9BA 2C3SA 2QF0A 1FV9A 8LPRA 1C1PA 1ID5H 2ZU1A 4CH2B 1LO6A 2F9VA 1G37A 4ISLA 1ZRBA 2ZCHP 4FU8A 4JYUH 4TY6A 3KQDA 1UTKA 2RDLA 2KAIB 1AWFH 2BXTH 3SW2B 1DE7H 4I8JA 3DFLA 4O3TA 3SGQE 2ZDKA 1LPGB 3K2UA 2D8WA 3P8FA 2A4QA 1LHDH 4CR9A 4YESB 2Z3CA 1MU8B 1GVKB 3UR9A 1ZGIA 4ZKSU 1NRQH 3RXTA 1RS0A 2ZHQH 3H7OA 3Q3KA 5EQQA 5HM9A 1W0YH 1GGDB 1QGFA 5K7RA 2AERH 1B5GH 4WXIA 1K28D 1DT2A 3VXFH 1UVPA 2AMPA 1MTVA 4VGCB 2P94A 1SGIB 2GZ8A 1LHCH 1FAKH 2QXIA 1O2YA 4UFEH 2Z6BD 1CHGA 2J34A 3RC6A 1ABJH 1K2I1 1P57B 1HXEH 3OTJE 4AOQA 4NZQA 1LVBA 4TPIZ 3MO6A 1BJVA 1O3IA 6GCHG 3M61U 3ZVGA 1A61H 2ZQ2A 3ZZ7A 3LJJA 1A3EH 3MOCA 1BTYA 5G4BA 1TBQH 5H4IB 5B6OA 2GMTC 2BDBA 1C5WB 1QNJA 2Y5HA 1EPTA 5AHGH 3E91A 3MMGA 4LOYH 3E0PB 1EASA 2WV4A 2FI3E 3PO1C 3PYHA 3TJOA 1ZHMA 3FP8E 2BQWB 3BTQE 1O5GH 3TH4H 1L4ZA 3SV9A 5C1UA 3MYWA 2A5AA 1SGTA 1C5PA 1PYTC 5L2YH 3CENA 3U8TH 1UTPA 1K21H 1YPLH 1YCPM 2SGQE 1GBAA 3A8DA 3BTWE 1WBGB 2SGFE 3R3GB 4JCNA 3EA9A 2BOKA 1BZXE 1ZMNA 2GGVB 2TGDA 2FEQH 1C5ZB 4MNVA 5A8XA 3DFJA 4ISHH 2FESH 1OWHA 1YC0A 1C1SA 4D8NA 5IDKA 3TJVA 1LVOA 1FXYA 2ESTE 6CHAC 2FTMA 3RLYH 3S0NA 2Z94A 3TH2H 4Y8ZA 1NRPH 3P95A 2ZTXA 1TMUH 4U2WA 2PTCE 3A86A 4TPYA 1MD7A 1TPPA 2SGAA 1LKAA 2GT7A 2BY7X 2ZECA 1IQHA 1ETRH 1GBTA 8KME2 4WH8A 3AVZA 4D76A 1GPZA 2G4TA 1LCYA 4DT7B 4KKDA 1C2LA 1UMAH 1C5NH 1T32A 4OGXA 3MNCA 2ZQ1A 4O03A 4FUGA 2OC7A 1XXDA 1AQ7A 5FX6A 4B2BA 4NZLA 1THSH 3BF6H 4FUIA 5F03A 3SU6A 3ZVFA 1TPAE 1A5GH 2XYAA 1QL7A 2P8OB 5F8ZA 3PV4A 2BZAA 3TITA 5DKMA 2ZPRA 3NPSA 5CMXH 1RGQA 1VJAU 3V7TA 1KYNA 1D6RA 1HAIH 1QRXA 2WINI 2IN2A 1ZZZA 1LHEH 1PJPA 5A2MH 1C2MA 1NZQH 1ELTA 4X0WU 2C8YB 2PSXA 2LNCA 2ASUB 3L6PA 2K7XA 2YNBA 2GT8A 3K65B 4AORA 3SU0A 4AZ2B 1V6DA 2CHAC 2WPHS 1QB6A 2G4UA 3ESTA 1YP9A 4NCYA 4O3UA 1V2QT 2JH5D 4DY7B 2EI6A 4BAMB 1P2IA 2TPIZ 2FX6A 1NN6A 4RN6A 1GHXH 1MZAA 1DANH 4I31A 3NZIA 3GCTG 2ZP0H 1QTFA 1XKBC 4AFUA 1UVOA 1NY22 2RG3A 2Q6FA 3S9CA 3EQ0H 3RXGA 3NKKA 4DURA 1J15A 1WCZA 1C5OH 1G36A 3ZZDA 5A0BA 3UQVA 1BHXF 1TONA 1GWAA 2FLBH 2W3IA 3ODDA 4KTSA 5IYTA 1OYTH 1O2LA 5LPFA 1CBWC 1RIWB 2HPQH 2XBVA 1W7XH 5FPSA 1QQUA 3PB1E 1SR5C 4B1TA 1DFPA 5DJ7A 1C5VA 3CP7A 3TGIE 4VGCC 2XWAA 3GY2A 2RA3A 2B7DH 4HGCA 1OOKB 5DP7A 1W14U 3UPEA 2XTTB 1CT2E 1ZPBA 2BMGB 3RXIA 4BAOB 3RC4A 3BTGE 1QA0A 4O97A 1GHVH 1BTXA 3TGJE 4XE4A 3CS7A 2ZGHA 1BTHH 2TGTA 4MDSA 1MKWH 4NIYA 3LIWA 2ZDVH 3LH1A 1WTHD 3A82A 3S9AA 2OD3B 1C1MA 4Y76A 1VITG 2SGPE 4ISNA 4A6LA 1A2CH 4TWWA 2D2DA 3M7TA 4DW2U 1O31A 1BIOA 1O37A 1LVMA 1Z6JH 3GY6A 3KL6A 1C5YB 1G2MA 4MNXA 1EXFA 1KDQA 1XM1A 1ZMJA 2DE8A 4K1EA 3O8DA 1D4PB 3SHCH 1AZ8A 1HJAB 1ELCA 1ELGA 2ZGCA 2P3FH 1GI7B 2B9LA 1XUKA 1D3DB 3GCNA 5SGAE 3STIA 4LZ4B 3VFEA 4A7IB 1TA2A 2ZCKP 2BHGA 1T31A 2Z3EA 1AKSA 2OQUA 4IMQA 3NCLA 1WQSA 2PR3A 3SV2H 2PTNA 3P8GA 1S0RA 1W3CA 4M7GA 2PUQH 2OC0A 4BAHB 1ZYOA 1ZTLA 3SNDA 1Z1JA 4WH6A 1GHBF 1GMDF 1O2RA 1B0EA 1XXFA 1DWEH 1F0SA 1SSXA 4OS4A 3RC5A 4FVDA 5CE1A 3GY4A 1VR1H 3G01A 2ZTYA 4ZXYH 4ZKRU 1NM6A 1RIWC 1Y5BT 2WPMS 2ZGBH 5TJXA 1SQTA 1S6HA 5EW1H 3SNEA 5HM2A 5HGGA 2V3HH 1FIWA 3MWIU 3GDUA 3MU0A 4XBCA 4XBDA 2AFQB 1OPHB 3O8RA 1O2PA 2TGPZ 2ZG0H 3RXCA 1S0QA 1UTNA 5DP9A 1S85A 2FYQA 2WPIS 3ZZ3A 3STJA 1FY3A 4MLFB 1EATA 5DP6A 1MKWK 2D26C 3ZZ5A 1GMDG 1RTKA 3U8OH 4WMEA 4AB9A 4LXBH 1Z7KA 2Z9JA 1EAIA 1CSOE 3RXLA 4H4FA 1C2KA 1OKXA 1OP8A 4NWKA 3SQHE 5T6DA 1S6FA 3EAJA 1YLCA 2VB0A 2TGAA 2CHAB 3UY9A 3KF2A 4I7YH 4ZHAA 3O8BA 1TPSA 3P70B 5C20A 1LHGH 4U32A 4CRCA 1B0FA 1GJ8B 1O3LA 3T29A 3F9FA 2W26A 3E3TA 1O2HA 1P2QA 1VCWA 2HVXA 1P9UA 3QN7A 5A8YA 1P2JA 1ZSKA 3D49H 1SGEE 1SFQB 2P8OC 3AASA 1C2DA 4AG1A 3S7KB 1YPGH 2Z9LA 3QDZB 1BMMH 4B2AA 5JPMH 1CA0B 4HZHA 4INLA 4X8SH 1S81A 4X8TH 1P03A 5HXFA 1IOEA 1TAWA 2ZFPH 1CGHA 5JBAS 5FX5A 2GVFA 3W95A 4WVPE 3FVFB 2H5CA 1DUEA 3E16B 5EXMA 3GISB 7LPRA 2AIPA 1NFXA 2BD9A 5EPYA 1O3OA 4KELA 2I6QA 4GPGA 2VIDA 3UWJH 1EOJA 1CQQA 1GBKA 4OGYA 1FDPA 3GY7A 4I32A 1HDTH 7KMEH 1O36A 5PTPA 3ATIA 1SHYA 1TABE 4K2YA 4FUHA 1GJ9B 3TJUA 1RTFB 1SGFA 2BDHA 1NU7B 3EYDA 1A3BH 1C2IA 1XUFA 2XRCA 2BD5A 3R0FA 3MNXA 1P9SA 1LPZB 3UNRA 1GCTB 4AN7A 4MVNA 3ATWA 1SI5H 1SQAA 1NC6A 2FP7B 2PKAB 4E06H 2ZIQH 4DG4A 1MCVA 1TNGA 1PPHE 3MNSA 4NIVA 3ZZ9A 2OC1A 1AVGH 1YM0A 5JB9S 5JB8S 4MPUA 1HAOH 1PPCE 1O3MA 1UVSH 1H1BA 4GHTA 2OBQA 4K69A 3RM0H 2JETC 2NU3E 2PLXA 1NPMA 4YT6H 2ZU5A 1GMHF 1VZQH 2R3UA 4KP0A 4CRGA 1M9UA 1N6YA 5EGMA 4ZHLU 2BD4A 3ZVCA 3LU9B 4CRFA 1BHXB 1GVZA 1O3FA 1SOTA 2ANWA 3P17H 3I77A 1KXFA 2QXGA 1EAWA 5DG6A 1C4U2 3Q76A 1TALA 4WXVA 1SBWA 1VJ9U 4X2WA 2A4RA 3A84A 1KXDA 2Y80A 1HAPH 2G52A 1T4UH 1AY6H 3TIUA 3UWIA 4Y11E 1TMBH 1QA7A