2A5IA

Crystal structures of sars coronavirus main peptidase inhibited by an aza-peptide epoxide in the space group c2
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like peptidase
publication title Crystal Structures of the Main Peptidase from the SARS Coronavirus Inhibited by a Substrate-like Aza-peptide Epoxide
pubmed doi rcsb
source organism Sars coronavirus
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2a5iA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a5iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a5iA02
1C1MA 1HJAB 1DXPA 2EI8A 3SNCA 1GL1A 2OP9A 1EAUA 1XVMA 2A4GA 1S84A 2OLGA 1Y3VA 1EAXA 1OWHA 4BNRA 1HAXB 1W11U 5BRRE 5A0CA 1O3AA 1GJAB 1IQGA 3SUEA 2FI3E 3A7ZA 1H4WA 3G01A 4KTCA 1G3BA 1S6FA 3TIUA 2WPHS 1TMUH 1WCZA 3VFEA 3A82A 1V3XA 5G4BA 2O8TA 5TJXA 1C4Y2 1S5SA 3RXDA 3PM3A 3ZZ5A 2AS9A 3A8AA 1DS2E 3GY8A 1W7GH 3UUZA 2BOHB 4X1SU 4CRFA 1E38B 4X2YA 3PLKA 2W7SA 3TK6A 5E2OA 3LJJA 1NO9H 4B73A 3K65B 3M5LA 1D6WA 1PFXC 2BLVA 1HAVB 1D3QB 3TPIZ 4CRDA 2GZ9A 3DUXH 2G81E 1Y3WA 2P8OB 4XDEA 5J4QA 4ZKSU 1FV9A 1FN8A 1O3GA 1BJVA 1ZSLA 1BUIA 2A31A 2J94A 1UJ1A 4X1RU 3AVZA 2GZ7A 1QJ6B 4OS5A 3CS7A 3STJA 3SBKA 5DP9A 1AU8A 1GI3A 1P10A 2YOLA 3L3TA 3P8NA 2GT8A 5CHAC 3V7TA 2ZHDA 4O97A 3SI4H 1TX7A 4VGCB 1P06A 1HAOH 1W13U 2ZEBA 1O33A 1GCTB 1HAGE 4Q80A 5C67A 1JXPA 2WYGA 1V2WT 4KGAA 2QA9E 4NIYA 2J92A 4UDWH 2GT7A 1PYTD 2R3UA 1AD8H 1F0SA 1WTGH 1GJ4H 1D3DB 1A1RA 2D8WA 1MTSA 1P57B 1Y5UT 1GBKA 1D3PB 2PTCE 3HPTB 5JB9S 2IOTA 1PPZA 3TU7H 1P05A 4AOQA 1SGCA 1V2PT 3E3TA 2FODA 1C5TA 5A8YA 3F9EA 1GDUA 4IN1A 1ELAA 1YC0A 3TJUA 1G37A 4A5TS 2ODYB 3HATH 5LPRA 2EA3A 3ZZ6A 3FP7E 2EC9H 1UCYE 1GHVH 1P09A 4TPYA 1GHAF 1DWBH 2G4UA 5HMAA 2XBWA 2BQ7B 5C5OA 2QCYA 3PB1E 1LHCH 3RXPA 5I25A 3W95A 3M3VA 2VH6A 2UWPA 1UTLM 3PROA 1RFNA 5FXLA 1TNIA 1OP2A 1BBRE 2Z3EA 1GHAG 1GDQA 1MBQA 2CV3A 1B7XB 1J9CH 1O3PB 4A1VA 3GISB 4ESTE 1BRAA 4BTTB 4AGJA 1EPTC 1HXEH 1VCWA 2ZP0H 3NZIA 1WSSH 3TITA 4X1NU 3PO1B 4Y8ZA 5DPAA 1TGBA 1INCA 3RMMH 2AEIH 2QF3A 4NWLA 1MTWA 1SGNE 3RMOH 2A4OA 3CP7A 1KXAA 1T8OA 1G32B 1GJ7B 3TGKE 3GYMA 2G8TA 1G3EA 5GXPA 1P9SA 3RXIA 3BIUH 1DM4B 4DY7B 1YPKH 1D4PB 1XM1A 2XCNA 3RXHA 2FOEA 3PMHB 4CREA 1DY9A 1HAVA 2C8YB 1BJUA 2G52A 5C2ZA 1UHBB 4B1TA 4R8TB 4B71A 1TMTH 4ZAEA 4CRCA 3RU4D 1NN6A 5E0GA 4CBNA 1YGCH 1O5FH 1WU1A 3BTQE 4ISLA 1BTPA 3A84A 4AFUA 4A1TA 4IC5A 2Y5GA 4HZHA 3DFJA 1AHTH 3EQ0H 1O3BA 1AKSB 4Y10E 4ZUHA 4CH8B 4TWWA 2FOFA 1ELBA 3GDSA 1QQ4A 1MCTA 2AERH 3KQEA 1XXFA 1ZHMA 3S9AA 2ZCLP 2QXJA 4H42U 1GMHF 2FOMB 1W8BH 5FHTA 1SLUB 3O8BA 1ELFA 3GCTF 3UPEA 1JOUB 1IHTH 1N8OC 1V2QT 4ISNA 3RMLH 3A88A 4CR9A 1NESE 2HOBA 1X7AC 1C1PA 3LGTA 3RM0H 3RXRA 4BAKB 1GMHG 3F6UH 4YLQH 2HVXA 1Y5BT 3M7QA 3B9FH 1ANDA 3MFJA 3GCTG 3RXFA 3R3GB 4GCHF 1EJNA 1CA8B 1GI8B 1FONA 1GJCB 1MD7A 1TBZH 4I8KA 1TPAE 1GMDF 3SU5A 3FP8E 2FXRA 1TE0A 1KXCA 1A5GH 3EBNA 1SLWB 1GJDB 1O0DH 4GCHG 1B0FA 4LXBH 2P3FH 4YT7H 2ZO3H 3P95A 3QLPH 3UREA 1ESAA 2D2DA 5CE1A 5EQQA 1DWCH 1GMDG 3VB5A 3EYDA 1ZYOA 1EZSC 3EAJA 2B0FA 4K8YA 2P59A 4INHA 5F8TA 1ZZZA 5LGOA 4UFGH 1C1SA 2UUFB 4MNXA 4I33A 2GCTB 1OXGA 1TWXB 1ZTKA 1KXFA 4D7GA 1A3EH 1QNJA 5AF9H 4Q7XA 1N6XA 1S6HA 3QWCH 1F92A 1SGRE 3FFGA 2Z9JA 1O5EH 1C5XB 2Y7ZA 4GSOA 4B75A 2SGQE 2TPIZ 3M61U 1O2SA 2FI4E 2BTCE 1ZRKA 1GI9B 2UWLA 1QFKH 4DW2U 4OS1A 1WAYB 1XUFA 3P8FA 1FY1A 1E35B 2Z6BD 1LPKB 4ZH8A 1IQKA 2PSXA 3SUGA 1C5SA 2AIQA 2ZDVH 3BSQA 1OKXA 3NXPA 2BD7A 1AO5A 3LJOA 1TNHA 2ZTZA 4X2VA 3H7OA 3OY5U 2F9UA 2ZPSA 3SU2A 1O5DH 1CBWB 1FMGA 4GHTA 1GI1A 2ZECA 2ZCHP 3PTBA 2F83A 1GHWH 5J4SA 4ZROA 1GCDA 2G00A 4K8BA 3I78A 4BAMB 1EB2A 4WH6A 1AKSA 5GCHF 3SGBE 2J38A 1ZPZA 1RXPA 1L2EA 8KME2 4X8SH 5GWZA 1XKAC 6ESTA 1JIMA 2PGQB 3VGCC 2GD4B 5AFYH 4NIVA 2Q6FA 2RA3A 1T4VH 1P04A 5GCHG 3LKWA 1TFXA 1TONA 1EB1H 3F9HA 1FY8E 2Z9IA 3BEIB 1NRSH 2YNAA 1GI5A 5L6NH 1LKAA 2FOBA 1W0ZU 4FU7A 1SGIB 2QGRA 1C1RA 4ZHAA 3ZZAA 4B74A 1Y5AT 3KL6A 4ABIA 2ODQA 2R9PA 1V2NT 1THRH 1C2GA 2XBVA 1QR3E 4CHAB 2A4RA 1QGFA 4UFDH 3RXAA 1BITA 1MUEB 1BHXB 1UK4A 4AB9A 3HKIB 1C2EA 4BXSA 3S7HB 1FAKH 1TX6A 1LPZB 4FXGH 2ZU5A 4HFPB 1C5NH 4WY3A 1GVLA 1GHXH 3GDUA 1QCPA 1XUGA 4FU9A 1CA0C 1Z8RA 3EGKH 4AX9H 1C5OH 1CHOF 1Q31A 3ZV9A 2ZDMA 1Y3YA 4I8LA 1OYTH 2P16A 5JPMH 1ZGVA 2FZZA 1K28D 1C2HA 4HGCA 3FP6E 3KQDA 2A5IA 1MTVA 4WXIA 4WXVA 3SV9A 1SQOA 4RKJB 1TX8A 1SOTA 1GJ6A 3M36A 1EAWA 3KIDU 1CHOG 1MQ5A 1TAWA 3Q00A 2B8OH 2FLRH 1MQ6A 2I6QA 3MO6A 4NG9H 1SSXA 5DP5A 5EQSA 3BEUA 2HNTE 1DSTA 1KLTA 3RLYH 1VGCB 1GBHA 2PUQH 1P8VC 1TNJA 5F8ZA 4H6TA 3T26A 3M3SA 3BG4B 1GBMA 4WWYA 5C1YA 2BXUH 4D9QA 3FZZA 2Y80A 4XBBA 1DANH 4THNH 4I7YH 2VB0A 2ZWLH 1U6QA 4NCYA 5ETXA 1BBRK 4NGAH 3CENA 1C2FA 1DY8A 1ETTH 1GDNA 1YM0A 4K1EA 1AUJA 1A3BH 2Z94A 1L4ZA 4YT6H 4B2BA 2IN2A 1OWIA 1HV7A 1MKWH 2SNWA 3R0FA 1T31A 4DT7B 2QY0B 5EPYA 3ZZCA 3E0NB 3VB7A 1RTKA 1J14A 3MU1A 1O2ZA 3GY5A 1IQJA 1WQSA 3IG6B 2C3SA 1O36A 4Y6DA 2WPKS 2BY8X 3ATLA 4ZKRU 2HLCA 5C20A 4AFSA 6LPRA 3OYPA 4FUEA 4AG2A 3S9BA 1P2JA 1HAZB 2ZQ1A 2C4FH 5FPTA 5EG4A 5JBTA 4SGAE 1GBCA 1GBDA 2FX4A 4Q7YA 5A09A 9ESTA 1EASA 5EOKA 1UTNA 3L33A 2BOKA 1W14U 2H9EH 4X6NA 3OX7U 4FUIA 1YBWA 1AWHB 5JYIA 1O2MA 1QJ7B 4FUJA 6CHAC 1GHZA 2XWBI 3RXBA 1OWJA 2XTTB 3QZQA 3MNSA 7GCHF 1GHYH 2AH4X 1RIWB 2GVFA 1PPHE 3VXFH 4K3JA 5DJ7A 1SBWA 4E7NA 1MTNC 2FPZA 1W0YH 3RU4E 2BM2A 5A0BA 2DE9A 4WH8A 1TYNA 5HM9A 8ESTE 3QTOH 1RJXB 2Z3CA 2BVXH 2W5EA 7GCHG 5T6GA 4DIHH 1HJAC 2XYAA 1A2CH 2AGEX 1W7XH 5IYTA 1HB0B 1O30A 1P3CA 1O31A 1K1JA 3MMGA 2Y5FA 4X6OA 2FYQA 1BMNH 3RXVA 4BAQB 4AN7A 2F9VA 2A32A 1SGEE 4ABBA 3TNSA 2ZGBH 5GJ4B 1XVOA 1PQ5A 3HGNA 3U8TH 1P2MA 5L2ZH 1OPHB 2ZF0H 1OYQA 1H1BA 4NIWA 3V12A 3TK9A 1P0SH 3MH6A 1HGTH 1NM6A 3SJ8A 2TGAA 3K6YA 1H9IE 3EE0B 3LC3A 2B9LA 2ULLA 4I8HA 5DP7A 1GHBF 2OQUA 5TCAA 1DPOA 1A7SA 2ZU4A 1BQYA 2A0QB 2O9QA 1A0LA 2W7UA 5L2YH 1QHRB 2EI7A 1D6RA 3UNRA 2Z9GA 4YLUA 2P8OC 1HAIH 3SU4A 3VEQB 2ZFFH 5ESTE 1KY9A 2Y5HA 2GV6A 1GPZA 1GHBG 1UTMA 1JIRA 3SGQE 2HALA 1Z6JH 3M5NA 1S85A 1V2UT 3T25A 3E90B 1EZXC 1V6DA 2FX6A 3QZRA 4NSYA 4NA9H 1IQNA 1SLVB 4WF8A 2WYJA 2ZGXH 1HLTH 2LIZA 5EXMA 3DA9B 2ZZUH 1OP0A 3HGPA 4FU8A 1EJAA 4AYYB 4JZFH 5DK1A 1DITH 2SGFE 4VGCC 1QB9A 1A0HB 1GCTC 2FIRH 2LPRA 3GCHB 2GX4A 3KHVA 2SGAA 1AZ8A 1C5YB 5F6MA 3PMBB 2BDGA 1LHGH 1ZMLA 2TGTA 1BTHH 1LMWB 2Z9LA 4Y11E 1KSNA 1KLJH 4INKA 3SW2B 1CT4E 7KMEH 3E91A 3PV4A 1Y3XA 4Y8XA 1FZZA 1SGDE 3BTHE 1O2KA 1YCPK 3LOXA 1SPJA 2PW8H 3UFAA 3Q3KA 1O5BB 1DE7H 2VVCA 3D65E 4XOJA 4D9RA 3QTVH 2BLWA 4YZUA 3ESTA 2WINI 3NK8A 2R0LA 1F5LA 1ETSH 1HDTH 4CRAA 2AFQB 2PGBB 5CHAB 3GY2A 4AFZA 1VITG 3ZVCA 4CH2B 1C9PA 1GGDB 1CU1A 2ZPQA 1IQHA 1XUIA 2B5TB 3NUMA 4XE4A 2JKHA 1LVOA 4UFEH 2Y7XA 1O2JA 1O3CA 3SJOA 4PROA 3EA7A 2PTNA 2H5CA 4U32A 3KNXA 1MCVA 4O3TA 3MHWU 1XMNB 2VIDA 3SJ9A 3UNSA 1HAHH 4YM9A 2O8MA 1ORFA 1V2TT 3PO1C 2ALVA 2PV9B 3RXOA 4IC6A 3BTKE 5AVDA 3KEEA 5H4IB 2CHAB 2OQ5A 2BHGA 1MH0A 3SQEE 1Z1IA 2J9NA 1SFQB 3MU0A 3O8CA 1FJSA 1H8IH 1P2OA 1C5PA 4JMYA 1QBOA 3M5OA 3FZDA 3ATMA 1AE5A 2A4QA 1ABIH 4H6SB 3GY3A 1MKXH 1GI2A 1QA7A 3LH1A 1T8LA 2BDHA 2BQ6B 2CF8H 1GI7B 1UCYH 1QURH 7LPRA 2HNTF 1KTSB 2BZAA 4MPVA 5EU8A 5GDSH 2ZHEH 1PYTC 4OGYA 1TMBH 1UVSH 2FWWA 2Q6DA 1BRCE 1SG8B 3N7OA 1CO7E 1CGIE 4K1SA 3CS0A 3BTEE 2VVUA 5B6OA 1ZMJA 1O5AB 2HNTC 3M5MA 2QIQA 1K1OA 1EPTB 2WUBA 1CGHA 1W12U 1ZHPA 1ZLRA 2JETB 2ZFQH 5T6FA 1DICA 2OC0A 4SGBE 3GY4A 4FVDA 3S69A 3T28A 3ZV8A 4A6LA 1LVBA 1MAXA 3F68H 1C1UH 2AGIX 3PLPA 2M5TA 3UR9A 4B2CA 4DGJA 2P3UB 4TY6A 3TK5A 4BOHA 4GPGA 1TA6A 3I29A 3OY6U 1SQTA 4GAWA 1O2NA 4NFFA 3GDVA 1NT1A 1TGTA 4M7GA 1Z7KA 1NTPA 3IWMA 3NPSA 1BB0B 2XWAA 1ACBE 1MMJN 1B0EA 1SLXB 3P92A 4MNYA 1GJ9B 4O3UA 1L1JA 3SV8A 1WOFA 3M7TA 1AFEH 1F5RA 3VB4A 2SGEE 3RXSA 1FLEE 2V3HH 1SGFA 1RGQA 2Q1JA 2H9TH 1EQ9A 2FP7B 1QBNA 5EQRA 3RM2H 4JK6A 1GL0E 5DP4A 1JRTA 3A86A 2G5NA 1NU7B 3LC5A 4I8JA 1UTQA 4MPWA 1YP9A 1C1WH 1EOLA 3P6ZB 3SNBA 4DURA 1TBQH 1QTFA 1NRQH 3LGYA 2QYIA 4X2WA 1LVMA 3DHKH 3M35A 4NSVA 3VPKA 3PYHA 3U69H 1GI4A 2QN5T 4B2AA 3D23A 2NU0E 2STAE 1GG6B 1C1NA 5JBBS 2RDLA 2TGDA 1C2MA 1P2IA 1OS8A 4ZXXH 2A45B 3ZZ3A 1O3NA 2BDYA 4UFFH 1N8OB 5HYOA 1NPMA 5A8XA 2Q6GA 1KLIH 4MLFB 2WPIS 1E34B 2BD5A 2VGCB 3ATIA 3SV7A 1GJBB 1AFQB 2ZHWH 3BTME 4X0WU 1TRMA 2A7CA 3KQBA 1DDJA 1TRNA 2TBSA 1C9TA 4ZHMU 2Y82A 2ANWA 2ZFRH 4X6MA 4DOQA 3RC6A 1MZDA 2XXLA 4LK4A 1ZPBA 4ZKNU 1SB1H 1FXYA 2FMJA 1WUNH 2JH0D 2PHBA 2W26A 3MO3A 4BXWA 3LU9B 3LPRA 3T62A 2NU3E 5DP8A 3DFLA 2OUAA 1A46H 3MH7A 4RKOB 1J15A 2TGPZ 3U98H 1O2GH 1P01A 2XRCA 4AG1A 3A7TA 1THSH 3C27B 3LT3A 4ABGA 1F5KU 3K2UA 2J2UA 2UUKB 3BTFE 3OSYA 2ILNA 2UUJB 2OC7A 1G30B 4CRGA 3EA8A 4KTSA 1FQ3A 1HCGA 1N6YA 4ABHA 1GJ8B 3NKKA 1Z8IB 4UEHH 1CBWC 3ZZDA 2VNTA 5FX5A 3GYLB 1NRNH 1UHBA 2GMTB 1O3JA 1K1MA 1FDPA 2VIPA 4ABEA 1ETRH 4LOYH 3ZZ7A 1G9IE 1TBRH 1H8DH 2FYRA 3BTTE 2THFB 3FVFB 3AW0A 1QA0A 4OS7A 1C2KA 1ESBA 4OGXA 2H2ZA 1ABJH 3SNEA 3A7YA 2AMPA 3Q3YA 2NU2E 1SMFE 1ANCA 1BDAA 5EXLA 1ZJDA 2NWNA 1IAUA 3QUMP 3TH3H 1C2JA 1LHFH 2H9HA 2FTMA 2ZA5A 3UOPA 2BQWB 3SU1A 1K9OE 3E6PH 1G36A 2VWNA 2F3CE 2V6NA 3PWCA 1PPGE 1O2YA 1ARCA 2OBOA 3Q76A 2A5AA 3A8CA 1WTHD 3P8GA 1W10U 1BHXF 1DFPA 3RXJA 1GBIA 2BB4A 2BD4A 4WVPE 2BY6X 1J17T 3VB3A 1GBJA 1AI8H 4TYDA 3UNQA 2EEKA 1DLKB 4CHAC 4FUCA 1AB9B 4X1PU 1MBMA 2BD2A 1QB6A 1LKBA 2ALPA 3RXEA 2D1JA 3A87A 3GOVB 1GI6A 2PKAB 5DP3A 1NS3A 1XX9A 5GIBA 1TQ0B 2J34A 4XBDA 3ZZBA 2AIPA 2ZGHA 3KGPA 4JZ1A 2FOCA 1C1TA 4ABAA 1PQ8A 1AVGH 1K1IA 3BTGE 1T4UH 1NRPH 4ZHLU 1ZHRA 1ZPCA 3OTJE 1S83A 1DSUA 1QL8A 2ZCKP 1K21H 1MTUA 1P02A 1PPEE 2O8WA 3UQVA 1TOMH 2ZDNA 3IITA 1WV7H 2CJIA 2VWLA 1OOKB 3PTNA 3BN9A 3GCNA 3MNBA 3O8DA 1YPGH 2ZG0H 1BA8B 1O3FA 4OS6A 2ZU1A 4YO9A 1P12E 2YNBA 4X8VH 1SC8U 1HBTH 1K1LA 3LGUA 4MG3A 2ANYA 3AASA 2WPMS 1EP5A 4DCDA 4MQAA 3K6ZA 3T2NA 1DX5M 7ESTE 2QXHA 4AZ2B 2DUCA 1P03A 1UVOA 2C8WB 4WMFA 1DOJA 2JH6D 4AGKA 3A85A 2PFEA 1MU6B 1KXBA 4ZXYH 3HK6B 1EZQA 2BD3A 2BZ6H 2OC8A 3SUFA 1HAYB 4O03A 1YPHE 5BPEA 3T29A 3UIRA 1C4V2 3LGIA 4E06H 1EXFA 4YOJA 1KDQB 2ZGCA 4LZ1H 1FAXA 2VIVA 1FPCH 1XUJA 3MNCA 5T3HA 4K69A 1TABE 2QXIA 1L1GA 3BF6H 4D8NA 4BAHB 3ZVFA 4IN2A 2VU8E 2H5DA 1TLDA 4Y7BA 2C8ZB 5HM2A 3RUOA 1AE8H 8GCHF 3RC4A 3MWIU 4E7RG 1IOEA 1NRRH 2VWMA 1TGCA 1VZQH 1P3EA 2R2WU 2QV1A 4AYVB 1TNLA 4K60A 1GBBA 1BOQA 3RXMA 3SU3A 1TRYA 1L0ZA 4MPUA 1O32A 4DIIH 3UOUA 3V3MA 8GCHG 3ZVAA 4J2YB 5FCRA 2HPQH 3RXGA 1GI0A 4D76A 5AFZH 1GBAA 3MOCA 2GCHF 2PSYA 4IS5A 2V35A 3S7KB 1LPGB 1CVWH 1A0JA 2Y81A 2PKSB 4GVUA 1GMCF 4K1TA 3QGJA 1THPB 1Y3UA 2BDAA 3RXTA 3SO3A 5FBEA 2VH0A 1S81A 2FTLE 2GCHG 4NZQA 2A2QH 1GBLA 2ZDLA 3RU4T 4Y7AA 5DP6A 2VINA 2ZI2H 4NIXA 1O35A 2WUCA 2LNCA 2GTBA 1GMCG 4MNWA 1VCQA 1BTUA 3TJVA 1TNGA 3SI3H 1UVTH 1N1LA 1OSSA 2R2MB 4JYTA 2FLBH 5EXNA 4X2XA 4JZIA 3TH2H 1RTFB 2PKAA 3A8DA 1W3CA 1TPSA 1O3OA 3MNXA 1QL9A 2R0KA 1D3TB 1CE5A 1K2I1 5ESBA 1FY3A 1ANEA 4R0IA 4IW4E 5EGMA 3ZYEA 3U8OH 5I46H 2GDEH 4X1QU 2K1QA 2OXSA 2V3OH 1SGYE 1WQVH 3A7VA 1XUKA 3A7WA 2OCVB 4JK5A 4Q7ZA 2BX3A 4ABDA 1XKBC 1P2NA 1P11E 1YKTA 3RXKA 4ZMAH 1RD3B 5A8ZA 1O2TA 3E1XB 1CGJE 3DT0H 3ZVEA 1MTNB 2ZDKA 2BDIA 4GLYA 1ANBA 4RSPA 4ABFA 1KXEA 1QRWA 3NWUA 1UTKA 2CN0H 3SNDA 4CRBA 3W94A 1SGPE 3D49H 4ISIH 1JMOH 3ENSB 2H6MA 3OU0A 4KKDA 1QBVH 1KYNA 4A92A 2G4TA 2XC0A 3PLBA 5AHGH 2RCEA 1YPLH 1O2IA 1NFYA 1NC6A 4U30A 5C5NA 1IQEA 1KDQA 1ZR0A 2BXTH 3SUDA 1YPMH 1GJ5H 2ZU3A 1DT2A 4Q2KA 1V2JT 3AAVA 1O2RA 3RLWH 2J4IA 3VB6A 2ZFPH 4OS4A 5JDUB 1UTJA 3PMAB 4K5ZA 2UUYA 3GCHC 1HUTH 2STBE 1OX1A 4E05H 4ISHH 3ELAH 1S0QA 1FIWA 1OWEA 3AAUA 4Z6AH 4YESB 2F9NA 2GKVE 3RC5A 2CMYA 4FUBA 1C4U2 2Y6TA 4YOGA 1SGFG 3Q77A 1J16A 2B7DH 1W2KH 4WMEA 2BD8A 2VVVA 1EATA 2XNIA 4FUDA 1F2SE 5FX6A 4BAOB 2A1DB 1BMLA 3ZZ4A 4HTCH 2O8LA 1VITF 2IJOB 3SV6A 3HK3B 1QIXB 2F9OA 1GGDC 2DE8A 1O39A 3MU8A 3ZZ8A 1C2DA 2SGDE 1SFIA 1A5IA 2QXGA 1F0TA 2QAAA 2FI5E 2F9BH 1IQFA 2A7JA 3DD2H 2BDCA 2BVSH 4GHQA 5FAHA 4AB8A 5FPYA 2Z7FE 1FI8A 2XC5A 4IMZA 1C5VA 1PJPA 5LPFA 1O2PA 3QGNB 2FDAA 2GZ8A 4MNVA 2ZDAH 1O2WA 2ZC9H 3LIWA 1L1NA 1O3MA 2AYWA 1Y8TA 2CHAC 5C3NA 3RP2A 5PTPA 2KAIB 2OD3B 5LH8A 1O38A 2FS8A 1M9UA 2CXVA 1ZRBA 1UVPA 4ABJA 5JBCS 2ANKH 3SN8A 3RDZA 2RG3A 2XC4A 1UTPA 1ZSJA 2ZFTA 3S0NA 2FESH 1TOCB 1Z71A 3ZVGA 3SU6A 1Z6EA 4WMDA 1CT2E 4Y8YA 3KN2A 2WV5A 2XCFA 1VCPA 1S82A 1PPCE 1QY6A 4U01A 1CHGA 3GY6A 3ODFA 5L30H 1A4WH 1SHYA 1C5UA 1HJ9A 1GVKB 4TPIZ 5TCCA 2BMGB 1Q3XA 3ZVDA 1VR1H 3EDXB 1P2KA 2RA0A 2Z9KA 3S9CA 3D62A 3MI4A 4BTIB 4MDSA 1WYKA 3LONA 1CSOE 1HRTH 1HNEE 1ZGIA 2JETC 1ELVA 3L6PA 3LH3A 1ZJKA 4KELA 5EW1H 2CF9H 1C1QA 3BTDE 2P93A 5DKMA 3AW1A 4A1XA 2GV7A 4BANB 1LQDB 3QO6A 4Y0YE 3UWIA 2G55A 1O2OA 2BY7X 3LGVA 1BBRH 3MTYA 1DWEH 3QDZB 3F1SB 1PPFE 3SORA 1MKWK 3B23B 1YPHC 1C5ZB 2J95A 2FOHA 3TVJB 1YF4A 5ABWA 1HXFH 2BVRH 2OTVA 1MZAA 1HAPH 3SOSA 3LDXH 4BTUB 2ODPA 4MPXA 3ATKA 2F9PA 2PLXA 1FUJA 1H9HE 1O37A 2FO9A 2BLOA 1SHHB 1AGJA 2SGPE 1P9UA 4F49A 1TA2A 3M37A 1O3DA 1O3HA 1SQAA 4Y76A 8LPRA 4J1YA 4F4OC 1UVUH 1C5MD 1VJ9U 1G2MA 2ZIQH 1AMHA 1QRXA 2ZU2A 1VJAU 1BTWA 1S0RA 3UQOA 9LPRA 3GY7A 2C8XB 3SQHE 2P3TB 1BT7A 4KP0A 2BYAX 2GDDA 1PPBH 1UMAH 3SGAE 1O2XA 1WBGB 1GG6C 1YLDA 1T7CA 1DXWA 3BIVH 2FOGA 1A5HA 1LTOA 3URDA 3HKJB 1ZMNA 3LGWA 5FPSA 3RXLA 3KQCA 3U1JB 2P95A 3QK1A 2TRMA 3A80A 2WPLS 2UWOA 1O3EA 2A7HA 2VGCC 2QC2A 1V2MT 1LQEA 1AFQC 1AVXA 3BG8A 1HIAB 3ZVBA 3SHAH 3A7XA 3T5FH 1AY6H 1SR5C 2WV4A 3STIA 4FUHA 1AVWA 1HPGA 1TPPA 2GP9B 3MH4A 3VXEH 3O8RA 4Z0KA 2ZTXA 3BTWE 2GCTC 1TALA 2PWXA 1FY5A 2KAIA 2VIWA 1O2HA 1DVAH 3URCA 1AQ7A 1RTLA 1UTOA 3ITIA 5C1UA 1GBTA 1ZSKA 2C93B 4DJZB 1AZZA 1TNKA 3KF2A 1YYY1 1JWTA 3I77A 3MYWA 1DUAA 2IPHA 4D7FA 4JYUH 4JCNA 1T32A 1SL3A 1SI5H 1YPEH 5DO4H 5DG6A 1FNIA 3F9GA 4IGDA 2FM2A 2JH5D 1FIZA 1EAIA 4RN6A 1NY22 4YOIA 5LPEA 4QT8C 3A83A 1MD8A 4XBCA 2VJ1A 3SJIA 1E37B 2ZGJA 1IQIA 2GMTC 1ZOMA 2XW9A 4JYVH 1UK3A 4Y0ZE 4KTUA 4I32A 3SZNA 2AGGX 2OC1A 1FN6A 1K1NA 3WY8A 2BDBA 4INLA 3UR6A 3RMNH 3A81A 4CR5A 2BLQA 1O5CB 1F0UA 1EPTA 5CMXH 1G2LA 3E16B 6GCHF 1EZUC 5A2MH 5IDKA 4FUGA 3A89A 4O9VA 4I8GA 1EUFA 1C5LH 1KIGH 3FANA 4NFEA 1LHDH 2I6SA 4UE7H 5JBAS 2ASUB 1IQLA 2FOAA 1JRSA 3TJNA 1QJ1B 2VWOA 1LVYA 4K2YA 1ELEE 5HGGA 1OWKA 1T8MA 3P17H 6GCHG 1SGQE 4Y71A 4U2WA 1C5QA 3BV9B 3JZ2B 4IBLH 1ELTA 3ZZ9A 1E0FD 1ELDE 4Y79A 2A2XH 1AB9C 1BZXE 1G3DA 1TIOA 4A7IB 3T27A 3JZ1B 3M7UA 4H4FA 4TY7A 1C1OA 3P8OA 5HXFA 1EX3A 4NZLA 2WPJS 1BMMH 3EA9A 5JB8S 5T6DA 1FPHH 1QRZA 1EJMA 1Z8GA 3PMJA 1DLEA 4DG4A 4FVBA 1SGTA 1TPOA 1MU8B 1V2LT 1K1PA 1XXDA 1ARBA 1YCPH 3RXQA 5E0HA 3RXCA 1NFWA 2K7XA 1LCYA 1NU9A 3E8LA 3U8RH 3BEFB 4AFQA 1FY4A 5GPIB 3A8BA 4I31A 4JZDH 2ZKSA 1V2RT 3U1IB 4GUXA 4IMQA 1MAYA 1XUHA 4UD9H 4X8TH 3VGCB 1DUEA 4CBOA 3ZYDA 1VITH 1NROH 2G51A 4ZKOU 1HIAA 3NCLA 1ZTJA 1EKBB 1H9LB 1NZQH 1BCUH 1BTYA 1SVPA 2ZNKH 1LDTT 5E0JA 1RS0A 1YLCA 1V2VT 1J8AA 3SNAA 3TLOA 3MH5A 3SV2H 3H7TA 2OINA 3TNTA 1O5GH 1YPJH 1IQMA 1BMAA 1C5RA 1TGNA 3PWBA 2C90B 5E2PA 1JBUH 1Y59T 2ZQ2A 1O3IA 2EI6A 1GBEA 1VGCC 1PQAA 4ISOA 3MU4A 2HGTH 1BRUP 1E36B 3QX5H 3B8JA 3BG4C 5K0HA 1TQ7B 3QN7A 5EODA 3GCOA 1V2OT 3MU5A 2ZHFH 1YCPM 2HPPH 2VIOA 1O3LA 4DVAU 2HWLB 2ZFSA 4XSKU 1KTTB 1KXDA 3M3TA 1ELCA 2BY9X 1CA0B 1MKXK 2NU4E 1C1VH 2QF0A 4HI3A 2SNVA 3H5CB 2H1UA 1O2QA 1SOZA 1BTZA 2F91A 4XFQA 2BX4A 3UY9A 1AUTC 1L4DA 1UCYK 1BTXA 5FCKA 5A0AE 5EW2H 5DGJA 1RRKA 2ZPRA 1HYLA 1G3CA 2BY5X 1O3KA 2G5VA 4X8UH 1A61H 1O34A 2D26C 1ID5H 3KCGH 4B76A 3FAOA 5SGAE 1C2LA 2V0BA 2ANMH 4WJG2 4UONA 2W3IA 1O2UA 2TIOA 1BIOA 1D9IA 1NFXA 1EOJA 3F9FA 3U9AH 2NU1E 1AIXH 2XBYA 4ASHA 2ZTYA 4OS2A 2PR3A 3V0XA 2PKSC 4MVNA 3ATWA 1BRBE 1DWDH 4TWYA 1O2LA 5EPNA 3TJOA 4NWKA 1ZTLA 1QL7A 1HJ8A 2ESTE 1GVZA 2SFAA 1ESTA 2FS9A 1GWAA 1TB6H 4X6PA 1RIWC 3RXUA 1LHEH 2A5KA 4AORA 2OBQA 1QQUA 1TGSZ 4FUFA 3TGIE 5K7RA 3ODDA 3P70B 3SJKA 2FEQH 1CQQA 5E8EH 3UTUH 2P94A 2CGAA 1OP8A 1AN1E 5F8XA 1AWFH 2BD9A 1C2IA 1IHSH 1V2ST 4YTAA 1Z8JB 2HRVA 5C1XA 1PQ7A 2PUXB 4MTBA 1UK2A 3SU0A 1P2QA 1F0RA 2R3YA 3Q3XA 1O2VA 1EP6A 3K9XB 2GGVB 3C1KA 1CT0E 1NFUA 2VIQA 3TGJE 4JZEH 3GICB 3E0PB 2W3KA 4NA8A 1ELGA 1Z1JA 2Z3DA 3UWJH 2AMQA 3MO9A 1B5GH 3TH4H 2ZHQH 1HFDA 3V13A 2O8UA 6CHAB 3SHCH 5FBIA 2AMDA 1LO6A 1OWDA 4LZ4B 1T8NA 1V2KT 2XBXA 1K22H 5F03A 1Q2WA 1GBFA 4NA7A 1QB1A 1C5WB 1F7ZA 1UO6A
chains in the Genus database with same CATH superfamily
1C1MA 1HJAB 1DXPA 2EI8A 3SNCA 1GL1A 2OP9A 1EAUA 1XVMA 2A4GA 1S84A 2OLGA 1Y3VA 1EAXA 1OWHA 4BNRA 1HAXB 1W11U 5BRRE 5A0CA 1O3AA 1GJAB 1IQGA 3SUEA 2FI3E 3A7ZA 1H4WA 3G01A 4KTCA 1G3BA 1S6FA 3TIUA 2WPHS 1TMUH 1WCZA 3VFEA 3A82A 1V3XA 5G4BA 2O8TA 5TJXA 1C4Y2 1S5SA 3F2HA 3RXDA 3PM3A 3ZZ5A 2AS9A 3A8AA 1DS2E 3GY8A 1W7GH 3UUZA 2BOHB 4X1SU 4CRFA 3UAIC 1E38B 4X2YA 3PLKA 2W7SA 3TK6A 5E2OA 2YMSB 3LJJA 1NO9H 4B73A 3K65B 3M5LA 1D6WA 1PFXC 2BLVA 1HAVB 1D3QB 3TPIZ 4CRDA 2GZ9A 3DUXH 2G81E 1Y3WA 2P8OB 4YXWD 4XDEA 5J4QA 4ZKSU 1FV9A 1FN8A 4ACAA 1O3GA 1BJVA 1ZSLA 1BUIA 2A31A 2J94A 1UJ1A 4X1RU 3AVZA 2GZ7A 1QJ6B 4OS5A 3CS7A 3STJA 3SBKA 4Z1MD 5DP9A 1AU8A 1GI3A 1P10A 2V3MA 2YOLA 3L3TA 2KCOA 3FN8A 3P8NA 2GT8A 5CHAC 3V7TA 2ZHDA 3FOAA 3EE7A 4O97A 3SI4H 1TX7A 3F2FA 4VGCB 1P06A 1HAOH 1W13U 2ZEBA 1O33A 1GCTB 1HAGE 4Q80A 5C67A 1JXPA 2WYGA 1V2WT 4KGAA 2QA9E 3W1EA 4NIYA 2J92A 4UDWH 2GT7A 1PYTD 2R3UA 1AD8H 1F0SA 1WTGH 1GJ4H 1D3DB 1A1RA 2D8WA 1MTSA 1P57B 1Y5UT 1GBKA 1D3PB 2PTCE 3HPTB 2EQNA 5JB9S 2IOTA 1PPZA 3TU7H 1P05A 4AOQA 1SGCA 1W0KD 1V2PT 3E3TA 2FODA 1C5TA 4TSFD 5A8YA 3F9EA 1GDUA 4IN1A 1ELAA 1YC0A 3TJUA 1G37A 4A5TS 2ODYB 3HATH 5LPRA 2EA3A 3ZZ6A 3FP7E 2EC9H 1UCYE 1GHVH 1P09A 4TPYA 1GHAF 1DWBH 2G4UA 5HMAA 2XBWA 2BQ7B 5C5OA 2QCYA 3PB1E 1LHCH 3RXPA 5I25A 3W95A 3M3VA 2VH6A 2UWPA 1UTLM 3PROA 4P00A 1RFNA 5FXLA 1TNIA 1OP2A 1BBRE 2Z3EA 1GHAG 1GDQA 1MBQA 2CV3A 1B7XB 1J9CH 1O3PB 4A1VA 3GISB 4ESTE 1BRAA 4BTTB 4AGJA 1EPTC 1HXEH 1VCWA 2ZP0H 3NZIA 1WSSH 3FO8D 2PP6A 3TITA 4X1NU 3PO1B 4Y8ZA 5DPAA 1TGBA 1INCA 3RMMH 2AEIH 2QF3A 4NWLA 2KX4A 1MTWA 1SGNE 3RMOH 2A4OA 3CP7A 1KXAA 1T8OA 1G32B 1GJ7B 3TGKE 3GYMA 2G8TA 2RFKC 1G3EA 5GXPA 1P9SA 3RXIA 3BIUH 2HVYB 1DM4B 4DY7B 1YPKH 5B6LA 1D4PB 1XM1A 2XCNA 3RXHA 2FOEA 3PMHB 4CREA 3H09A 1DY9A 5HIYA 1HAVA 2C8YB 1BJUA 2G52A 5C2ZA 1UHBB 4B1TA 2KCYA 4R8TB 4B71A 1KMHB 1TMTH 4ZAEA 4CRCA 3RU4D 1NN6A 5E0GA 4CBNA 1YGCH 1O5FH 1WU1A 3BTQE 4ISLA 1BTPA 3A84A 4AFUA 4A1TA 4B6FA 4IC5A 2Y5GA 4HZHA 3DFJA 1AHTH 3EQ0H 1O3BA 1AKSB 4Y10E 4ZUHA 4CH8B 4TWWA 2FOFA 1ELBA 3GDSA 1QQ4A 1MCTA 2AERH 3KQEA 1XXFA 5HIZA 1ZHMA 3S9AA 2ZCLP 2QXJA 4H42U 1GMHF 2FOMB 3KQ5A 1W8BH 5FHTA 1SLUB 3O8BA 1ELFA 3GCTF 3UPEA 1JOUB 3DSOA 1IHTH 1N8OC 1H8HD 1V2QT 4ISNA 3RMLH 3A88A 1QZ8A 1NESE 2HOBA 1X7AC 1C1PA 3LGTA 4CR9A 3RM0H 3RXRA 4BAKB 1GMHG 3F6UH 4YLQH 2HVXA 1Y5BT 3M7QA 3B9FH 1ANDA 3MFJA 3GCTG 3RXFA 3R3GB 4GCHF 1EJNA 1CA8B 3NRLA 1GI8B 1FONA 1GJCB 1MD7A 1TBZH 4I8KA 1TPAE 1GMDF 3SU5A 3FP8E 2FXRA 1TE0A 1KXCA 1A5GH 3EBNA 1SLWB 1GJDB 1O0DH 4GCHG 1B0FA 4LXBH 2P3FH 4YT7H 2ZO3H 3P95A 3QLPH 3UREA 2KCAA 1ESAA 2D2DA 5CE1A 5EQQA 1DWCH 1GMDG 3VB5A 3EYDA 1ZYOA 1EZSC 3EAJA 2B0FA 1EFRD 4K8YA 2P59A 4INHA 5F8TA 1ZZZA 1E1RD 5LGOA 4UFGH 1C1SA 2UUFB 4MNXA 4I33A 2GCTB 1OXGA 1TWXB 2L74A 1ZTKA 1KXFA 5EJZA 4D7GA 1A3EH 1QNJA 5AF9H 4Q7XA 1N6XA 1S6HA 3QWCH 1F92A 1SGRE 3FFGA 2Z9JA 1O5EH 1C5XB 2Y7ZA 4GSOA 4B75A 2SGQE 2TPIZ 3M61U 1O2SA 2FI4E 5CDFE 2BTCE 1ZRKA 1GI9B 2UWLA 1QFKH 4DW2U 4OS1A 1WAYB 3F3BA 1XUFA 3P8FA 1FY1A 1E35B 2Z6BD 1LPKB 4ZH8A 1IQKA 2PSXA 3SUGA 1C5SA 2AIQA 2ZDVH 3BSQA 1OKXA 3NXPA 2BD7A 1AO5A 3LJOA 1TNHA 2ZTZA 4X2VA 3H7OA 3OY5U 2F9UA 2ZPSA 3SU2A 1O5DH 1CBWB 1FMGA 4GHTA 1GI1A 2ZECA 2ZCHP 3PTBA 2F83A 1GHWH 5J4SA 4ZROA 1GCDA 2G00A 2K8IA 3WW7A 4K8BA 3I78A 4BAMB 1YLNA 1EB2A 4WH6A 1AKSA 5GCHF 3SGBE 2J38A 5KGOA 1ZPZA 1RXPA 1L2EA 8KME2 4X8SH 5GWZA 1XKAC 6ESTA 1JIMA 2PGQB 3VGCC 2GD4B 5AFYH 4NIVA 2Q6FA 2RA3A 1T4VH 1P04A 5GCHG 3LKWA 4ZCNA 1TFXA 1TONA 1EB1H 3F9HA 1FY8E 2Z9IA 3BEIB 1NRSH 2YNAA 1GI5A 5L6NH 1LKAA 2FOBA 1W0ZU 4FU7A 1SGIB 2QGRA 1C1RA 4ZHAA 3ZZAA 3DCLA 4B74A 1Y5AT 1UW7A 3KL6A 4ABIA 2ODQA 3SZEA 2R9PA 1V2NT 1THRH 1C2GA 2XBVA 1QR3E 4CHAB 2A4RA 1QGFA 4UFDH 3RXAA 1H8ED 1BITA 1MUEB 1BHXB 1UK4A 4AB9A 3HKIB 1C2EA 4BXSA 3S7HB 1FAKH 1TX6A 1LPZB 4FXGH 2ZU5A 4HFPB 1C5NH 4WY3A 1GVLA 1GHXH 3GDUA 1QCPA 1XUGA 4FU9A 1CA0C 1Z8RA 3EGKH 4AX9H 1C5OH 1CHOF 1Q31A 3ZV9A 2ZDMA 1Y3YA 4I8LA 1OYTH 2P16A 5JPMH 4Q63A 1ZGVA 2FZZA 1K28D 1C2HA 4HGCA 3FP6E 3KQDA 2A5IA 4RT1A 1MTVA 4WXIA 4WXVA 3SV9A 1SQOA 4RKJB 1TX8A 1BMFD 1SOTA 1GJ6A 3M36A 1EAWA 3KIDU 1CHOG 1MQ5A 1TAWA 3Q00A 2B8OH 2FLRH 1MQ6A 2I6QA 3MO6A 4NG9H 1SSXA 5DP5A 5EQSA 2AHME 3BEUA 2HNTE 1DSTA 1KLTA 3RLYH 1VGCB 1GBHA 2PUQH 1P8VC 1TNJA 5F8ZA 4H6TA 3T26A 3M3SA 3BG4B 1GBMA 4WWYA 5C1YA 2BXUH 4D9QA 3FZZA 2Y80A 4XBBA 1DANH 1E79D 4THNH 2VB0A 4I7YH 2ZWLH 1U6QA 4NCYA 5ETXA 1BBRK 4NGAH 3CENA 1C2FA 1DY8A 3WWFA 1ETTH 1GDNA 1YM0A 4K1EA 1AUJA 1A3BH 2Z94A 1L4ZA 4YT6H 4B2BA 2IN2A 1OWIA 1HV7A 1MKWH 2SNWA 3R0FA 1T31A 4DT7B 2QY0B 5EPYA 3ZZCA 3E0NB 3VB7A 1RTKA 1J14A 3MU1A 1O2ZA 3GY5A 1IQJA 1WQSA 3IG6B 2C3SA 1O36A 4Y6DA 2WPKS 2BY8X 3ATLA 4ZKRU 2HLCA 5C20A 4AFSA 6LPRA 3OYPA 4FUEA 4AG2A 3S9BA 1P2JA 1HAZB 2ZQ1A 2C4FH 5FPTA 5EG4A 5JBTA 4SGAE 1GBCA 1GBDA 2FX4A 4Q7YA 5A09A 9ESTA 1EASA 2F4LA 5EOKA 1UTNA 3L33A 2BOKA 1W14U 2H9EH 4X6NA 3OX7U 4FUIA 1YBWA 1AWHB 5JYIA 1E1QD 1O2MA 1QJ7B 4FUJA 6CHAC 1GHZA 2XWBI 5IK2D 3RXBA 1OWJA 2XTTB 3QZQA 3MNSA 7GCHF 1GHYH 2AH4X 1RIWB 2GVFA 1PPHE 3VXFH 4K3JA 1WXRA 2LELA 5DJ7A 1SBWA 4E7NA 1MTNC 2FPZA 1W0YH 3RU4E 2V7QD 5FL7D 2BM2A 5A0BA 2DE9A 4WH8A 1TYNA 5HM9A 8ESTE 3QTOH 1RJXB 2Z3CA 2BVXH 2W5EA 2WZQA 5T6GA 7GCHG 4DIHH 1HJAC 2XYAA 1A2CH 2AGEX 1W7XH 5IYTA 1HB0B 1O30A 1P3CA 1O31A 1K1JA 3MMGA 2Y5FA 4X6OA 2FYQA 1BMNH 3RXVA 4BAQB 2JIZD 4AN7A 2F9VA 2A32A 1SGEE 4ABBA 3TNSA 2ZGBH 5GJ4B 1XVOA 1PQ5A 3HGNA 3U8TH 1P2MA 5L2ZH 1OPHB 2ZF0H 1OYQA 1H1BA 4NIWA 3V12A 3TK9A 1P0SH 3MH6A 1HGTH 1NM6A 3SJ8A 2TGAA 3K6YA 2JJ1D 1H9IE 3EE0B 3LC3A 2B9LA 2ULLA 2YMSC 4I8HA 2KCPA 5DP7A 1GHBF 2OQUA 5TCAA 1DPOA 1A7SA 2ZU4A 1BQYA 2A0QB 1WDIA 1A0LA 2O9QA 2W7UA 5L2YH 1QHRB 2EI7A 1D6RA 3UNRA 2Z9GA 4YLUA 2P8OC 1HAIH 3SU4A 3VEQB 2ZFFH 5ESTE 1KY9A 2Y5HA 2GV6A 1GPZA 1GHBG 1UTMA 2WSSD 1JIRA 3SGQE 2HALA 1Z6JH 3M5NA 1S85A 1V2UT 3T25A 3E90B 1EZXC 1V6DA 2FX6A 3QZRA 4NSYA 4NA9H 1IQNA 1SLVB 4WF8A 2WYJA 2ZGXH 1HLTH 2LIZA 5EXMA 3DA9B 2ZZUH 1OP0A 3HGPA 4FU8A 1EJAA 4AYYB 4JZFH 5DK1A 1DITH 2SGFE 4VGCC 1QB9A 1A0HB 1GCTC 2FIRH 2LPRA 3GCHB 2GX4A 3KHVA 2SGAA 1AZ8A 1C5YB 5F6MA 3PMBB 2BDGA 1LHGH 1ZMLA 2TGTA 1BTHH 1LMWB 2Z9LA 4Y11E 1KSNA 1KLJH 4INKA 3SW2B 1CT4E 4B6EA 7KMEH 3E91A 3PV4A 1Y3XA 4Y8XA 1FZZA 1SGDE 3BTHE 1O2KA 1YCPK 3LOXA 1SPJA 2PW8H 3UFAA 3Q3KA 1O5BB 1DE7H 2VVCA 3D65E 4XOJA 4D9RA 2IPQX 3QTVH 2BLWA 4YZUA 3ESTA 2WINI 1SQRA 3NK8A 2R0LA 1F5LA 1ETSH 1HDTH 4CRAA 2AFQB 2PGBB 5CHAB 3GY2A 4AFZA 2K0QA 1VITG 3ZVCA 4CH2B 1C9PA 1GGDB 1CU1A 2ZPQA 1IQHA 1XUIA 3AK5A 2B5TB 3NUMA 4XE4A 2JKHA 1LVOA 4UFEH 2Y7XA 1O2JA 1O3CA 3SJOA 4PROA 1K0HA 3EA7A 2PTNA 2H5CA 4U32A 3KNXA 1MCVA 4O3TA 3MHWU 1XMNB 2VIDA 3SJ9A 3UNSA 1HAHH 4YM9A 2O8MA 1ORFA 1V2TT 3PO1C 2ALVA 2PV9B 3RXOA 4IC6A 3BTKE 5AVDA 3KEEA 5H4IB 2CHAB 2OQ5A 2BHGA 1MH0A 3SQEE 1Z1IA 2J9NA 1SFQB 2LP6A 3MU0A 3O8CA 1FJSA 1H8IH 1P2OA 1C5PA 4JMYA 1QBOA 3M5OA 3FZDA 3ATMA 1AE5A 2A4QA 1ABIH 4H6SB 1SKYE 3GY3A 1MKXH 1GI2A 1QA7A 3LH1A 1T8LA 2BDHA 2BQ6B 2CF8H 1GI7B 1UCYH 1QURH 7LPRA 2HNTF 1KTSB 2BZAA 4MPVA 5EU8A 5GDSH 2ZHEH 1PYTC 4OGYA 1TMBH 1UVSH 2FWWA 2Q6DA 1BRCE 1SG8B 3N7OA 3UB0A 1CO7E 1CGIE 4K1SA 3CS0A 3BTEE 2VVUA 4XD7D 5B6OA 1ZMJA 1O5AB 2HNTC 3M5MA 2QIQA 1K1OA 1EPTB 2WUBA 1CGHA 1W12U 1ZHPA 1ZLRA 2JETB 2ZFQH 5T6FA 1DICA 2OC0A 4SGBE 5EIYA 3GY4A 3PRDA 4FVDA 3S69A 3T28A 3ZV8A 4A6LA 1LVBA 1MAXA 3F68H 1C1UH 2AGIX 3PLPA 2M5TA 3ZIAD 3UR9A 4B2CA 4DGJA 2P3UB 4M9FA 4TY6A 3TK5A 4BOHA 4FETA 5EJLA 4GPGA 1TA6A 3FKSD 3I29A 3OY6U 1SQTA 4GAWA 4HG6A 1O2NA 2KZ4A 4NFFA 3GDVA 1NT1A 1TGTA 4M7GA 1Z7KA 1NTPA 3IWMA 3OEED 3NPSA 1BB0B 3OEHD 2XWAA 1ACBE 1MMJN 1B0EA 1SLXB 3P92A 4MNYA 1GJ9B 4O3UA 1L1JA 3SV8A 1WOFA 2KFWA 3M7TA 1AFEH 1F5RA 1VKYA 3VB4A 2SGEE 3RXSA 1FLEE 2V3HH 1SGFA 1RGQA 2Q1JA 2H9TH 1EQ9A 2FP7B 1QBNA 5EQRA 3RM2H 4JK6A 1GL0E 5DP4A 1JRTA 3A86A 1NU7B 2G5NA 3LC5A 4I8JA 1UTQA 4MPWA 1YP9A 1C1WH 1EOLA 3P6ZB 3SNBA 4DURA 1TBQH 1QTFA 1NRQH 3LGYA 2QYIA 4X2WA 3KYGA 1LVMA 3DHKH 3M35A 4NSVA 3VPKA 3PYHA 3U69H 1GI4A 2QN5T 4B2AA 3D23A 2NU0E 2STAE 1GG6B 1C1NA 5JBBS 2RDLA 2TGDA 1C2MA 1P2IA 1OS8A 4ZXXH 2A45B 3ZZ3A 1O3NA 2BDYA 4UFFH 1N8OB 5HYOA 1NPMA 5A8XA 2J5UA 2Q6GA 1KLIH 4MLFB 2WPIS 1E34B 2BD5A 2VGCB 3ATIA 3SV7A 1GJBB 1AFQB 2ZHWH 3BTME 4X0WU 1TRMA 2A7CA 3KQBA 1DDJA 1TRNA 2TBSA 1C9TA 4ZHMU 2Y82A 2ANWA 2ZFRH 4X6MA 4DOQA 3RC6A 1MZDA 2XXLA 4LK4A 1ZPBA 4ZKNU 1SB1H 1FXYA 2FMJA 1WUNH 2JH0D 2PHBA 5KEDA 2W26A 3MO3A 4RT0A 4BXWA 3LU9B 3LPRA 3T62A 2NU3E 5DP8A 3DFLA 2OUAA 5CHBA 1A46H 3MH7A 4RKOB 1J15A 2TGPZ 3U98H 1O2GH 3WWBA 1P01A 2XRCA 4AG1A 3A7TA 1THSH 3C27B 3LT3A 4ABGA 1F5KU 3K2UA 2J2UA 2UUKB 3BTFE 3OSYA 2ILNA 2UUJB 2OC7A 1G30B 4CRGA 3EA8A 4KTSA 1FQ3A 1HCGA 1N6YA 4ABHA 1GJ8B 3NKKA 1Z8IB 4UEHH 1CBWC 3OTPA 3ZZDA 2VNTA 5FX5A 3GYLB 3F2GA 1NRNH 1UHBA 2GMTB 1O3JA 1K1MA 1FDPA 2VIPA 4ABEA 1ETRH 4LOYH 3ZZ7A 1G9IE 1TBRH 1H8DH 2FYRA 3BTTE 2WV9A 2QE7D 2THFB 3FVFB 3AW0A 1QA0A 4OS7A 1C2KA 1ESBA 4OGXA 2H2ZA 1ABJH 3SNEA 3A7YA 2AMPA 3Q3YA 2NU2E 1SMFE 1ANCA 1BDAA 5EXLA 1ZJDA 2NWNA 1IAUA 3QUMP 3TH3H 1C2JA 1LHFH 2H9HA 2FTMA 2ZA5A 3UOPA 2BQWB 3SU1A 1K9OE 3E6PH 1G36A 2VWNA 2F3CE 2V6NA 3PWCA 1PPGE 1O2YA 1ARCA 2OBOA 3Q76A 2A5AA 3A8CA 1WTHD 3P8GA 1W10U 1BHXF 1DFPA 3RXJA 1GBIA 2BB4A 2BD4A 4WVPE 2BY6X 1J17T 3VB3A 1GBJA 1AI8H 4TYDA 3UNQA 2EEKA 1DLKB 4CHAC 4FUCA 1AB9B 4X1PU 1MBMA 2BD2A 1QB6A 1LKBA 2ALPA 3F0PA 3RXEA 2D1JA 3A87A 5C0TA 3GOVB 1GI6A 2PKAB 5DP3A 1NS3A 1XX9A 5GIBA 1TQ0B 2J34A 4XBDA 3ZZBA 2AIPA 2ZGHA 3KGPA 4JZ1A 2FOCA 1C1TA 4ABAA 1PQ8A 1AVGH 1K1IA 3BTGE 1T4UH 1NRPH 4ZHLU 1ZHRA 1ZPCA 3OTJE 1S83A 1DSUA 1QL8A 2ZCKP 1K21H 1MTUA 1P02A 1PPEE 2O8WA 3UQVA 1NBMD 1TOMH 2ZDNA 3IITA 1WV7H 2CJIA 2VWLA 1OOKB 3PTNA 3BN9A 3GCNA 3MNBA 3O8DA 1YPGH 2ZG0H 1BA8B 1O3FA 4OS6A 2ZU1A 4YO9A 1P12E 2YNBA 4X8VH 1SC8U 1HBTH 1K1LA 3LGUA 4MG3A 2ANYA 3AASA 2WPMS 1EP5A 4DCDA 4MQAA 3K6ZA 3T2NA 1DX5M 7ESTE 2QXHA 4AZ2B 2DUCA 1P03A 1UVOA 2C8WB 4WMFA 1DOJA 2JH6D 4AGKA 3A85A 2PFEA 1MU6B 1KXBA 4ZXYH 3HK6B 1EZQA 2BD3A 5DSFA 2BZ6H 2OC8A 3SUFA 1HAYB 4O03A 1YPHE 5BPEA 3T29A 3UIRA 1C4V2 3LGIA 4E06H 1EXFA 4YOJA 1KDQB 2ZGCA 4LZ1H 1FAXA 2VIVA 1FPCH 1XUJA 3MNCA 5T3HA 4K69A 1TABE 2QXIA 1L1GA 3BF6H 3DSPA 4D8NA 4BAHB 3ZVFA 4IN2A 2VU8E 5C17A 2H5DA 1TLDA 4Y7BA 2C8ZB 5HM2A 3RUOA 1AE8H 8GCHF 3RC4A 3MWIU 4E7RG 1IOEA 1NRRH 2VWMA 1TGCA 1VZQH 1P3EA 2R2WU 2QV1A 4AYVB 1TNLA 4K60A 1GBBA 1BOQA 3RXMA 3SU3A 1TRYA 1L0ZA 4MPUA 1O32A 4DIIH 3UOUA 3V3MA 8GCHG 3ZVAA 4J2YB 5FCRA 2HPQH 3RXGA 1GI0A 4D76A 5AFZH 1GBAA 3MOCA 2GCHF 2PSYA 4IS5A 2V35A 3S7KB 1LPGB 1CVWH 1A0JA 2Y81A 2PKSB 4GVUA 1GMCF 4K1TA 5EJ1A 3QGJA 1THPB 1Y3UA 2BDAA 3RXTA 3SO3A 5FBEA 2VH0A 1S81A 2FTLE 2GCHG 4NZQA 3MQKC 2A2QH 1GBLA 2ZDLA 3RU4T 2XOKD 4Y7AA 5DP6A 2VINA 2ZI2H 4NIXA 1O35A 2WUCA 2LNCA 2GTBA 1GMCG 4MNWA 1VCQA 1BTUA 3TJVA 1TNGA 3SI3H 1UVTH 3GS9A 1N1LA 1OSSA 2R2MB 4JYTA 2FLBH 5EXNA 4X2XA 4JZIA 3TH2H 1RTFB 2PKAA 3A8DA 1W3CA 1TPSA 1O3OA 3MNXA 1QL9A 3PRBA 2R0KA 1D3TB 1CE5A 1K2I1 5ESBA 1FY3A 1ANEA 4R0IA 4IW4E 5EGMA 3ZYEA 3U8OH 5I46H 2GDEH 4X1QU 2K1QA 2OXSA 2V3OH 1SGYE 1WQVH 3A7VA 1XUKA 2KR7A 3A7WA 2OCVB 2QF4A 4JK5A 4Q7ZA 2BX3A 4ABDA 1XKBC 1P2NA 1P11E 1YKTA 3RXKA 4ZMAH 1RD3B 5A8ZA 1O2TA 3E1XB 1CGJE 3DT0H 3ZVEA 1MTNB 2ZDKA 2L6OA 2BDIA 4GLYA 1ANBA 4RSPA 4ABFA 1KXEA 1QRWA 3NWUA 1UTKA 2CN0H 3SNDA 4CRBA 4FOUC 3W94A 1SGPE 3D49H 4ISIH 1JMOH 3ENSB 2H6MA 3OU0A 4KKDA 1QBVH 1KYNA 4A92A 2G4TA 1YWUA 2XC0A 2HLDD 3N7DA 2WPDD 3PLBA 5AHGH 4ASUD 2RCEA 1YPLH 3F0OA 1O2IA 1NFYA 1NC6A 4U30A 5C5NA 1IQEA 1KDQA 1ZR0A 2BXTH 3SUDA 1YPMH 1GJ5H 2ZU3A 1DT2A 4Q2KA 1V2JT 3AAVA 1O2RA 3RLWH 2JDID 2J4IA 3VB6A 2ZFPH 4OS4A 5JDUB 1UTJA 1W0JD 3PMAB 4K5ZA 2UUYA 3GCHC 1HUTH 2STBE 1OX1A 4E05H 4ISHH 3ELAH 1S0QA 1FIWA 1OWEA 3AAUA 3DSGA 4Z6AH 4YESB 2EY4C 2F9NA 2GKVE 3RC5A 2CMYA 4FUBA 1C4U2 5C0UA 2Y6TA 3OAAD 4YOGA 1SGFG 3Q77A 1J16A 2B7DH 1W2KH 4WMEA 2BD8A 2VVVA 1EATA 2XNIA 4FUDA 1F2SE 5FX6A 4BAOB 2A1DB 2RDEA 1BMLA 3ZZ4A 4HTCH 2O8LA 1VITF 2IJOB 3SV6A 3HK3B 1QIXB 2F9OA 1GGDC 2DE8A 1O39A 3MU8A 2VBCA 3ZZ8A 1C2DA 2SGDE 1SFIA 1A5IA 2QXGA 1F0TA 2QAAA 2FI5E 2F9BH 5F53A 1IQFA 2A7JA 3DD2H 2BDCA 2BVSH 4GHQA 4ACBA 5FAHA 4AB8A 5FPYA 2Z7FE 1FI8A 2XC5A 4IMZA 1C5VA 1PJPA 5LPFA 1O2PA 3QGNB 2FDAA 2GZ8A 4MNVA 2ZDAH 1O2WA 2ZC9H 3LIWA 1L1NA 1O3MA 2AYWA 1Y8TA 2CHAC 5C3NA 3RP2A 3PV2A 5PTPA 2KAIB 2OD3B 5LH8A 1O38A 2FS8A 1M9UA 2CXVA 1ZRBA 1UVPA 4ABJA 5JBCS 2ANKH 3SN8A 3RDZA 2RG3A 2XC4A 1UTPA 1ZSJA 2ZFTA 1S6LA 3S0NA 2FESH 1TOCB 1Z71A 3ZVGA 3SU6A 1Z6EA 4WMDA 1CT2E 4Y8YA 2KM0A 2WV5A 2XCFA 3KN2A 1VCPA 1S82A 1PPCE 1QY6A 4U01A 1CHGA 3GY6A 3ODFA 5L30H 1A4WH 1SHYA 2M2AA 1C5UA 1HJ9A 4OM9A 1GVKB 4TPIZ 4AC9A 5TCCA 2BMGB 1Q3XA 3ZVDA 1VR1H 3EDXB 1P2KA 2RA0A 2Z9KA 3S9CA 3D62A 3MI4A 4BTIB 4MDSA 1WYKA 3LONA 1CSOE 1HRTH 1HNEE 1ZGIA 2JETC 1ELVA 3L6PA 3LH3A 1ZJKA 4KELA 5EW1H 2CF9H 1C1QA 3BTDE 2P93A 5DKMA 3AW1A 4A1XA 2GV7A 4BANB 1LQDB 3QO6A 3U28C 4Y0YE 3UWIA 2G55A 1NBME 1O2OA 2BY7X 3LGVA 1BBRH 3MTYA 1DWEH 4RI0A 3QDZB 3F1SB 1PPFE 3SORA 1MKWK 3B23B 1YPHC 1C5ZB 2J95A 2FOHA 3TVJB 1YF4A 5ABWA 1HXFH 2BVRH 2OTVA 1MZAA 1HAPH 3SOSA 3LDXH 2GJGA 4BTUB 2ODPA 4MPXA 3ATKA 2F9PA 2PLXA 1FUJA 1H9HE 1O37A 2FO9A 3OFND 2BLOA 1SHHB 1AGJA 2SGPE 1P9UA 4F49A 2QF5A 1TA2A 3M37A 1O3DA 1O3HA 1SQAA 4Y76A 8LPRA 4J1YA 3PV5A 4F4OC 1UVUH 1C5MD 1VJ9U 1G2MA 2ZIQH 1AMHA 1QRXA 2ZU2A 1VJAU 1BTWA 2CK3D 1S0RA 4DT4A 3N7EA 3UQOA 9LPRA 3GY7A 2C8XB 3SQHE 4F55A 2P3TB 1BT7A 4KP0A 2BYAX 2GDDA 1PPBH 1UMAH 3SGAE 1O2XA 2JJ2D 1WBGB 1GG6C 1YLDA 1T7CA 1DXWA 3BIVH 2FOGA 1A5HA 1LTOA 3CNRA 3HKJB 3URDA 1ZMNA 3LGWA 5FPSA 3RXLA 3KQCA 3U1JB 2P95A 3QK1A 2TRMA 3A80A 2WPLS 2UWOA 1O3EA 5DN6D 2A7HA 2VGCC 2QC2A 1V2MT 1LQEA 1AFQC 1AVXA 3BG8A 1HIAB 3ZVBA 3SHAH 3A7XA 3T5FH 1AY6H 1SR5C 2WV4A 4F48B 3STIA 2IJD1 4FUHA 1AVWA 1HPGA 1TPPA 2GP9B 3MH4A 3VXEH 3O8RA 4Z0KA 2ZTXA 3BTWE 2GCTC 1TALA 2PWXA 1FY5A 2KAIA 2VIWA 1O2HA 3SYJA 1DVAH 3URCA 1AQ7A 1RTLA 1UTOA 2W6ID 3ITIA 5C1UA 1GBTA 1ZSKA 2C93B 2W6JD 4DJZB 1AZZA 1TNKA 3KF2A 1YYY1 1JWTA 3I77A 3MYWA 1DUAA 2IPHA 4D7FA 4JYUH 4JCNA 1T32A 1SL3A 1SI5H 1YPEH 5DO4H 5DG6A 1FNIA 3F9GA 4IGDA 2FM2A 2JH5D 1FIZA 1EAIA 4RN6A 1NY22 4YOIA 5LPEA 4QT8C 3A83A 1MD8A 4XBCA 2VJ1A 3SJIA 5T1VA 1E37B 2ZGJA 1IQIA 2GMTC 1ZOMA 2XW9A 4JYVH 1UK3A 4Y0ZE 1MABB 4KTUA 4I32A 3SZNA 2AGGX 2OC1A 1FN6A 1K1NA 3WY8A 2BDBA 4INLA 5C94A 3UR6A 3RMNH 3A81A 4CR5A 2BLQA 1O5CB 1F0UA 1EPTA 5CMXH 1G2LA 3E16B 6GCHF 1EZUC 5A2MH 5IDKA 4FUGA 3A89A 4O9VA 4Q4LA 4I8GA 1EUFA 1C5LH 1KIGH 3FANA 4NFEA 1COWD 1LHDH 2I6SA 4UE7H 5JBAS 2ASUB 4XRNA 1IQLA 2FOAA 1JRSA 3TJNA 1QJ1B 2VWOA 1LVYA 4K2YA 1ELEE 5HGGA 1OWKA 1T8MA 3P17H 6GCHG 1SGQE 4Y71A 4U2WA 1C5QA 3BV9B 3JZ2B 4IBLH 2WHXA 2OK5A 1ELTA 3ZZ9A 4I86A 1E0FD 1ELDE 4Y79A 5GNDA 2A2XH 1AB9C 1BZXE 1G3DA 1TIOA 4A7IB 3T27A 3JZ1B 3M7UA 4H4FA 4TY7A 1C1OA 3P8OA 5HXFA 1EX3A 4NZLA 2WPJS 1BMMH 3EA9A 5JB8S 5T6DA 1FPHH 1QRZA 1EJMA 1Z8GA 3PMJA 1DLEA 4DG4A 4FVBA 1SGTA 5HKKD 1TPOA 1MU8B 1V2LT 1K1PA 1XXDA 1ARBA 1YCPH 3RXQA 5E0HA 3RXCA 1NFWA 2K7XA 1LCYA 1NU9A 3E8LA 3U8RH 3BEFB 4AFQA 1FY4A 2F43B 5GPIB 3A8BA 4I31A 4JZDH 2ZKSA 1V2RT 3U1IB 4GUXA 2J98B 4IMQA 1MAYA 1XUHA 4UD9H 4X8TH 3VGCB 1DUEA 4CBOA 3ZYDA 1VITH 1NROH 2G51A 4ZKOU 1HIAA 3NCLA 1ZTJA 1EKBB 1H9LB 1NZQH 1BCUH 1BTYA 1SVPA 2ZNKH 1LDTT 4TT3D 5E0JA 1RS0A 1YLCA 1V2VT 3KYFA 1J8AA 3SNAA 3TLOA 3MH5A 3SV2H 3H7TA 2OINA 3TNTA 1O5GH 1YPJH 1IQMA 1BMAA 1C5RA 1TGNA 3PWBA 2C90B 5E2PA 1JBUH 1Y59T 2ZQ2A 1O3IA 2EI6A 1GBEA 1VGCC 1PQAA 4ISOA 3MU4A 1YY3A 2HGTH 1BRUP 1E36B 2XNDD 3B8JA 3QX5H 3BG4C 5K0HA 1TQ7B 3QN7A 5EODA 3GCOA 1V2OT 3MU5A 2ZHFH 1YCPM 1OHHD 2HPPH 2VIOA 1O3LA 4DVAU 2HWLB 2ZFSA 4XSKU 1KTTB 1KXDA 3M3TA 1ELCA 2BY9X 1CA0B 1MKXK 2NU4E 1C1VH 2QF0A 4HI3A 2SNVA 3H5CB 2H1UA 1O2QA 1SOZA 1BTZA 2F91A 4XFQA 2BX4A 3UY9A 1AUTC 1L4DA 1UCYK 1BTXA 5FCKA 5A0AE 5EW2H 5DGJA 1RRKA 2ZPRA 1HYLA 1G3CA 2BY5X 1O3KA 2G5VA 4X8UH 1A61H 1O34A 2D26C 1ID5H 3KCGH 5KECA 4B76A 3FAOA 5SGAE 1C2LA 2V0BA 2ANMH 4WJG2 4UONA 2W3IA 1O2UA 2TIOA 1BIOA 1D9IA 1NFXA 1EOJA 3F9FA 3U9AH 2NU1E 1AIXH 2XBYA 4ASHA 2ZTYA 4OS2A 2PR3A 3V0XA 2PKSC 4MVNA 3ATWA 1BRBE 1DWDH 4TWYA 1O2LA 5EPNA 3TJOA 4NWKA 1ZTLA 1QL7A 1FX0B 1HJ8A 2ESTE 1GVZA 2SFAA 1ESTA 2J97A 2FS9A 1GWAA 3OE7D 1TB6H 4X6PA 1RIWC 3RXUA 1LHEH 2A5KA 4AORA 2OBQA 1QQUA 1TGSZ 2YMSD 4FUFA 3TGIE 5K7RA 3ODDA 3P70B 3SJKA 2FEQH 1CQQA 5E8EH 3UTUH 2P94A 2CGAA 1OP8A 1AN1E 5F8XA 1AWFH 2BD9A 1C2IA 1IHSH 1V2ST 4YTAA 3VG8A 1Z8JB 2HRVA 5C1XA 1PQ7A 2PUXB 4MTBA 1UK2A 3SU0A 1P2QA 1F0RA 2R3YA 3Q3XA 1O2VA 1EP6A 3K9XB 2GGVB 3C1KA 1CT0E 1NFUA 2VIQA 2J98A 3TGJE 4JZEH 3GICB 3E0PB 2W3KA 4NA8A 1ELGA 1Z1JA 4P02A 2Z3DA 3UWJH 2AMQA 3MO9A 1B5GH 3TH4H 2ZHQH 1HFDA 3V13A 2O8UA 6CHAB 3SHCH 5FBIA 2AMDA 1LO6A 1OWDA 4LZ4B 1T8NA 1V2KT 3N99A 2XBXA 1K22H 5F03A 1Q2WA 1GBFA 4NA7A 1QB1A 1C5WB 1F7ZA 1UO6A
chains in the Genus database with same CATH topology
1C1MA 1HJAB 1DXPA 2EI8A 3SNCA 1GL1A 2OP9A 1EAUA 1XVMA 2A4GA 1S84A 2OLGA 1Y3VA 1EAXA 1OWHA 4BNRA 1HAXB 1W11U 5BRRE 5A0CA 1O3AA 1GJAB 1IQGA 3SUEA 2FI3E 3A7ZA 1H4WA 3G01A 4KTCA 1G3BA 1S6FA 3TIUA 2WPHS 1TMUH 1WCZA 3VFEA 3A82A 1V3XA 5G4BA 2O8TA 5TJXA 1C4Y2 1S5SA 3RXDA 3PM3A 3ZZ5A 2AS9A 3A8AA 1DS2E 3GY8A 1W7GH 3UUZA 2BOHB 4X1SU 4CRFA 1E38B 4X2YA 3PLKA 2W7SA 3TK6A 5E2OA 3LJJA 1NO9H 4B73A 3K65B 3M5LA 1D6WA 1PFXC 2BLVA 1HAVB 1D3QB 3TPIZ 4CRDA 2GZ9A 3DUXH 2G81E 1Y3WA 2P8OB 4XDEA 5J4QA 4ZKSU 1FV9A 1FN8A 1O3GA 1BJVA 1ZSLA 1BUIA 2A31A 2J94A 1UJ1A 4X1RU 3AVZA 2GZ7A 1QJ6B 4OS5A 3CS7A 3STJA 3SBKA 5DP9A 1AU8A 1GI3A 1P10A 2YOLA 3L3TA 3P8NA 2GT8A 5CHAC 3V7TA 2ZHDA 4O97A 3SI4H 1TX7A 4VGCB 1P06A 1HAOH 1W13U 2ZEBA 1O33A 1GCTB 1HAGE 4Q80A 5C67A 1JXPA 2WYGA 1V2WT 4KGAA 2QA9E 4NIYA 2J92A 4UDWH 2GT7A 1PYTD 2R3UA 1AD8H 1F0SA 1WTGH 1GJ4H 1D3DB 1A1RA 2D8WA 1MTSA 1P57B 1Y5UT 1GBKA 1D3PB 2PTCE 3HPTB 5JB9S 2IOTA 1PPZA 3TU7H 1P05A 4AOQA 1SGCA 1V2PT 3E3TA 2FODA 1C5TA 5A8YA 3F9EA 1GDUA 4IN1A 1ELAA 1YC0A 3TJUA 1G37A 4A5TS 2ODYB 3HATH 5LPRA 2EA3A 3ZZ6A 3FP7E 2EC9H 1UCYE 1GHVH 1P09A 4TPYA 1GHAF 1DWBH 2G4UA 5HMAA 2XBWA 2BQ7B 5C5OA 2QCYA 3PB1E 1LHCH 3RXPA 5I25A 3W95A 3M3VA 2VH6A 2UWPA 1UTLM 3PROA 1RFNA 5FXLA 1TNIA 1OP2A 1BBRE 2Z3EA 1GHAG 1GDQA 1MBQA 2CV3A 1B7XB 1J9CH 1O3PB 4A1VA 3GISB 4ESTE 1BRAA 4BTTB 4AGJA 1EPTC 1HXEH 1VCWA 2ZP0H 3NZIA 1WSSH 3TITA 4X1NU 3PO1B 4Y8ZA 5DPAA 1TGBA 1INCA 3RMMH 2AEIH 2QF3A 4NWLA 1MTWA 1SGNE 3RMOH 2A4OA 3CP7A 1KXAA 1T8OA 1G32B 1GJ7B 3TGKE 3GYMA 2G8TA 1G3EA 5GXPA 1P9SA 3RXIA 3BIUH 1DM4B 4DY7B 1YPKH 1D4PB 1XM1A 2XCNA 3RXHA 2FOEA 3PMHB 4CREA 1DY9A 1HAVA 2C8YB 1BJUA 2G52A 5C2ZA 1UHBB 4B1TA 4R8TB 4B71A 1TMTH 4ZAEA 4CRCA 3RU4D 1NN6A 5E0GA 4CBNA 1YGCH 1O5FH 1WU1A 3BTQE 4ISLA 1BTPA 3A84A 4AFUA 4A1TA 4IC5A 2Y5GA 4HZHA 3DFJA 1AHTH 3EQ0H 1O3BA 1AKSB 4Y10E 4ZUHA 4CH8B 4TWWA 2FOFA 1ELBA 3GDSA 1QQ4A 1MCTA 2AERH 3KQEA 1XXFA 1ZHMA 3S9AA 2ZCLP 2QXJA 4H42U 1GMHF 2FOMB 1W8BH 5FHTA 1SLUB 3O8BA 1ELFA 3GCTF 3UPEA 1JOUB 1IHTH 1N8OC 1V2QT 4ISNA 3RMLH 3A88A 4CR9A 1NESE 2HOBA 1X7AC 1C1PA 3LGTA 3RM0H 3RXRA 4BAKB 1GMHG 3F6UH 4YLQH 2HVXA 1Y5BT 3M7QA 3B9FH 1ANDA 3MFJA 3GCTG 3RXFA 3R3GB 4GCHF 1EJNA 1CA8B 1GI8B 1FONA 1GJCB 1MD7A 1TBZH 4I8KA 1TPAE 1GMDF 3SU5A 3FP8E 2FXRA 1TE0A 1KXCA 1A5GH 3EBNA 1SLWB 1GJDB 1O0DH 4GCHG 1B0FA 4LXBH 2P3FH 4YT7H 2ZO3H 3P95A 3QLPH 3UREA 1ESAA 2D2DA 5CE1A 5EQQA 1DWCH 1GMDG 3VB5A 3EYDA 1ZYOA 1EZSC 3EAJA 2B0FA 4K8YA 2P59A 4INHA 5F8TA 1ZZZA 5LGOA 4UFGH 1C1SA 2UUFB 4MNXA 4I33A 2GCTB 1OXGA 1TWXB 1ZTKA 1KXFA 4D7GA 1A3EH 1QNJA 5AF9H 4Q7XA 1N6XA 1S6HA 3QWCH 1F92A 1SGRE 3FFGA 2Z9JA 1O5EH 1C5XB 2Y7ZA 4GSOA 4B75A 2SGQE 2TPIZ 3M61U 1O2SA 2FI4E 2BTCE 1ZRKA 1GI9B 2UWLA 1QFKH 4DW2U 4OS1A 1WAYB 1XUFA 3P8FA 1FY1A 1E35B 2Z6BD 1LPKB 4ZH8A 1IQKA 2PSXA 3SUGA 1C5SA 2AIQA 2ZDVH 3BSQA 1OKXA 3NXPA 2BD7A 1AO5A 3LJOA 1TNHA 2ZTZA 4X2VA 3H7OA 3OY5U 2F9UA 2ZPSA 3SU2A 1O5DH 1CBWB 1FMGA 4GHTA 1GI1A 2ZECA 2ZCHP 3PTBA 2F83A 1GHWH 5J4SA 4ZROA 1GCDA 2G00A 4K8BA 3I78A 4BAMB 1EB2A 4WH6A 1AKSA 5GCHF 3SGBE 2J38A 1ZPZA 1RXPA 1L2EA 8KME2 4X8SH 5GWZA 1XKAC 6ESTA 1JIMA 2PGQB 3VGCC 2GD4B 5AFYH 4NIVA 2Q6FA 2RA3A 1T4VH 1P04A 5GCHG 3LKWA 1TFXA 1TONA 1EB1H 3F9HA 1FY8E 2Z9IA 3BEIB 1NRSH 2YNAA 1GI5A 5L6NH 1LKAA 2FOBA 1W0ZU 4FU7A 1SGIB 2QGRA 1C1RA 4ZHAA 3ZZAA 4B74A 1Y5AT 3KL6A 4ABIA 2ODQA 2R9PA 1V2NT 1THRH 1C2GA 2XBVA 1QR3E 4CHAB 2A4RA 1QGFA 4UFDH 3RXAA 1BITA 1MUEB 1BHXB 1UK4A 4AB9A 3HKIB 1C2EA 4BXSA 3S7HB 1FAKH 1TX6A 1LPZB 4FXGH 2ZU5A 4HFPB 1C5NH 4WY3A 1GVLA 1GHXH 3GDUA 1QCPA 1XUGA 4FU9A 1CA0C 1Z8RA 3EGKH 4AX9H 1C5OH 1CHOF 1Q31A 3ZV9A 2ZDMA 1Y3YA 4I8LA 1OYTH 2P16A 5JPMH 1ZGVA 2FZZA 1K28D 1C2HA 4HGCA 3FP6E 3KQDA 2A5IA 1MTVA 4WXIA 4WXVA 3SV9A 1SQOA 4RKJB 1TX8A 1SOTA 1GJ6A 3M36A 1EAWA 3KIDU 1CHOG 1MQ5A 1TAWA 3Q00A 2B8OH 2FLRH 1MQ6A 2I6QA 3MO6A 4NG9H 1SSXA 5DP5A 5EQSA 3BEUA 2HNTE 1DSTA 1KLTA 3RLYH 1VGCB 1GBHA 2PUQH 1P8VC 1TNJA 5F8ZA 4H6TA 3T26A 3M3SA 3BG4B 1GBMA 4WWYA 5C1YA 2BXUH 4D9QA 3FZZA 2Y80A 4XBBA 1DANH 4THNH 4I7YH 2VB0A 2ZWLH 1U6QA 4NCYA 5ETXA 1BBRK 4NGAH 3CENA 1C2FA 1DY8A 1ETTH 1GDNA 1YM0A 4K1EA 1AUJA 1A3BH 2Z94A 1L4ZA 4YT6H 4B2BA 2IN2A 1OWIA 1HV7A 1MKWH 2SNWA 3R0FA 1T31A 4DT7B 2QY0B 5EPYA 3ZZCA 3E0NB 3VB7A 1RTKA 1J14A 3MU1A 1O2ZA 3GY5A 1IQJA 1WQSA 3IG6B 2C3SA 1O36A 4Y6DA 2WPKS 2BY8X 3ATLA 4ZKRU 2HLCA 5C20A 4AFSA 6LPRA 3OYPA 4FUEA 4AG2A 3S9BA 1P2JA 1HAZB 2ZQ1A 2C4FH 5FPTA 5EG4A 5JBTA 4SGAE 1GBCA 1GBDA 2FX4A 4Q7YA 5A09A 9ESTA 1EASA 5EOKA 1UTNA 3L33A 2BOKA 1W14U 2H9EH 4X6NA 3OX7U 4FUIA 1YBWA 1AWHB 5JYIA 1O2MA 1QJ7B 4FUJA 6CHAC 1GHZA 2XWBI 3RXBA 1OWJA 2XTTB 3QZQA 3MNSA 7GCHF 1GHYH 2AH4X 1RIWB 2GVFA 1PPHE 3VXFH 4K3JA 5DJ7A 1SBWA 4E7NA 1MTNC 2FPZA 1W0YH 3RU4E 2BM2A 5A0BA 2DE9A 4WH8A 1TYNA 5HM9A 8ESTE 3QTOH 1RJXB 2Z3CA 2BVXH 2W5EA 7GCHG 5T6GA 4DIHH 1HJAC 2XYAA 1A2CH 2AGEX 1W7XH 5IYTA 1HB0B 1O30A 1P3CA 1O31A 1K1JA 3MMGA 2Y5FA 4X6OA 2FYQA 1BMNH 3RXVA 4BAQB 4AN7A 2F9VA 2A32A 1SGEE 4ABBA 3TNSA 2ZGBH 5GJ4B 1XVOA 1PQ5A 3HGNA 3U8TH 1P2MA 5L2ZH 1OPHB 2ZF0H 1OYQA 1H1BA 4NIWA 3V12A 3TK9A 1P0SH 3MH6A 1HGTH 1NM6A 3SJ8A 2TGAA 3K6YA 1H9IE 3EE0B 3LC3A 2B9LA 2ULLA 4I8HA 5DP7A 1GHBF 2OQUA 5TCAA 1DPOA 1A7SA 2ZU4A 1BQYA 2A0QB 2O9QA 1A0LA 2W7UA 5L2YH 1QHRB 2EI7A 1D6RA 3UNRA 2Z9GA 4YLUA 2P8OC 1HAIH 3SU4A 3VEQB 2ZFFH 5ESTE 1KY9A 2Y5HA 2GV6A 1GPZA 1GHBG 1UTMA 1JIRA 3SGQE 2HALA 1Z6JH 3M5NA 1S85A 1V2UT 3T25A 3E90B 1EZXC 1V6DA 2FX6A 3QZRA 4NSYA 4NA9H 1IQNA 1SLVB 4WF8A 2WYJA 2ZGXH 1HLTH 2LIZA 5EXMA 3DA9B 2ZZUH 1OP0A 3HGPA 4FU8A 1EJAA 4AYYB 4JZFH 5DK1A 1DITH 2SGFE 4VGCC 1QB9A 1A0HB 1GCTC 2FIRH 2LPRA 3GCHB 2GX4A 3KHVA 2SGAA 1AZ8A 1C5YB 5F6MA 3PMBB 2BDGA 1LHGH 1ZMLA 2TGTA 1BTHH 1LMWB 2Z9LA 4Y11E 1KSNA 1KLJH 4INKA 3SW2B 1CT4E 7KMEH 3E91A 3PV4A 1Y3XA 4Y8XA 1FZZA 1SGDE 3BTHE 1O2KA 1YCPK 3LOXA 1SPJA 2PW8H 3UFAA 3Q3KA 1O5BB 1DE7H 2VVCA 3D65E 4XOJA 4D9RA 3QTVH 2BLWA 4YZUA 3ESTA 2WINI 3NK8A 2R0LA 1F5LA 1ETSH 1HDTH 4CRAA 2AFQB 2PGBB 5CHAB 3GY2A 4AFZA 1VITG 3ZVCA 4CH2B 1C9PA 1GGDB 1CU1A 2ZPQA 1IQHA 1XUIA 2B5TB 3NUMA 4XE4A 2JKHA 1LVOA 4UFEH 2Y7XA 1O2JA 1O3CA 3SJOA 4PROA 3EA7A 2PTNA 2H5CA 4U32A 3KNXA 1MCVA 4O3TA 3MHWU 1XMNB 2VIDA 3SJ9A 3UNSA 1HAHH 4YM9A 2O8MA 1ORFA 1V2TT 3PO1C 2ALVA 2PV9B 3RXOA 4IC6A 3BTKE 5AVDA 3KEEA 5H4IB 2CHAB 2OQ5A 2BHGA 1MH0A 3SQEE 1Z1IA 2J9NA 1SFQB 3MU0A 3O8CA 1FJSA 1H8IH 1P2OA 1C5PA 4JMYA 1QBOA 3M5OA 3FZDA 3ATMA 1AE5A 2A4QA 1ABIH 4H6SB 3GY3A 1MKXH 1GI2A 1QA7A 3LH1A 1T8LA 2BDHA 2BQ6B 2CF8H 1GI7B 1UCYH 1QURH 7LPRA 2HNTF 1KTSB 2BZAA 4MPVA 5EU8A 5GDSH 2ZHEH 1PYTC 4OGYA 1TMBH 1UVSH 2FWWA 2Q6DA 1BRCE 1SG8B 3N7OA 1CO7E 1CGIE 4K1SA 3CS0A 3BTEE 2VVUA 5B6OA 1ZMJA 1O5AB 2HNTC 3M5MA 2QIQA 1K1OA 1EPTB 2WUBA 1CGHA 1W12U 1ZHPA 1ZLRA 2JETB 2ZFQH 5T6FA 1DICA 2OC0A 4SGBE 3GY4A 4FVDA 3S69A 3T28A 3ZV8A 4A6LA 1LVBA 1MAXA 3F68H 1C1UH 2AGIX 3PLPA 2M5TA 3UR9A 4B2CA 4DGJA 2P3UB 4TY6A 3TK5A 4BOHA 4GPGA 1TA6A 3I29A 3OY6U 1SQTA 4GAWA 1O2NA 4NFFA 3GDVA 1NT1A 1TGTA 4M7GA 1Z7KA 1NTPA 3IWMA 3NPSA 1BB0B 2XWAA 1ACBE 1MMJN 1B0EA 1SLXB 3P92A 4MNYA 1GJ9B 4O3UA 1L1JA 3SV8A 1WOFA 3M7TA 1AFEH 1F5RA 3VB4A 2SGEE 3RXSA 1FLEE 2V3HH 1SGFA 1RGQA 2Q1JA 2H9TH 1EQ9A 2FP7B 1QBNA 5EQRA 3RM2H 4JK6A 1GL0E 5DP4A 1JRTA 3A86A 2G5NA 1NU7B 3LC5A 4I8JA 1UTQA 4MPWA 1YP9A 1C1WH 1EOLA 3P6ZB 3SNBA 4DURA 1TBQH 1QTFA 1NRQH 3LGYA 2QYIA 4X2WA 1LVMA 3DHKH 3M35A 4NSVA 3VPKA 3PYHA 3U69H 1GI4A 2QN5T 4B2AA 3D23A 2NU0E 2STAE 1GG6B 1C1NA 5JBBS 2RDLA 2TGDA 1C2MA 1P2IA 1OS8A 4ZXXH 2A45B 3ZZ3A 1O3NA 2BDYA 4UFFH 1N8OB 5HYOA 1NPMA 5A8XA 2Q6GA 1KLIH 4MLFB 2WPIS 1E34B 2BD5A 2VGCB 3ATIA 3SV7A 1GJBB 1AFQB 2ZHWH 3BTME 4X0WU 1TRMA 2A7CA 3KQBA 1DDJA 1TRNA 2TBSA 1C9TA 4ZHMU 2Y82A 2ANWA 2ZFRH 4X6MA 4DOQA 3RC6A 1MZDA 2XXLA 4LK4A 1ZPBA 4ZKNU 1SB1H 1FXYA 2FMJA 1WUNH 2JH0D 2PHBA 2W26A 3MO3A 4BXWA 3LU9B 3LPRA 3T62A 2NU3E 5DP8A 3DFLA 2OUAA 1A46H 3MH7A 4RKOB 1J15A 2TGPZ 3U98H 1O2GH 1P01A