1G3EA

Bovine beta-trypsin bound to para-amidino schiff-base copper (ii) chelate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title X-ray crystallographic analyses of complexes between bovine beta-trypsin and Schiff base copper(II) or iron(III) chelates.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3eA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3eA02
2BXUH 4FUJA 4JZ1A 3HPTB 4K1SA 2VGCB 1HJAC 1PQ8A 2RA3A 3GCTG 2OC7A 3MU8A 1J16A 1Y3VA 1O2PA 1GHAG 4D7FA 4X0WU 1MQ6A 3UWIA 3DD2H 1UTQA 4X6NA 1EZQA 5IYTA 3VXEH 1HAYB 1TPAE 5LPEA 4D9QA 1AFQB 3B23B 1DWCH 2R2MB 3Q3XA 3UIRA 1J14A 3SNDA 5BRRE 4XFQA 1UJ1A 5F8ZA 1CHGA 1TMTH 3S9AA 1C5UA 1O3BA 1MMJN 4CRCA 1UK3A 3ZYEA 4OGYA 5JDUB 1EZXC 5F03A 2QYIA 2TGTA 1AVGH 1GBBA 1NTPA 1QL7A 2PKSB 2ZU1A 2ZEBA 1LCYA 1PQ5A 2HNTC 1QJ1B 5G4BA 1ZPZA 3T5FH 3MNCA 4Y71A 3RXPA 2HOBA 1GHZA 2VH6A 2I6QA 2FX4A 3BEFB 5FXLA 6GCHF 1FIWA 2HRVA 1T4VH 1KDQB 2CN0H 2HNTE 2XBWA 3SGBE 4Y11E 3KQCA 1HLTH 4HGCA 1W10U 3V12A 1INCA 1DLKB 1T8OA 3V7TA 4OGXA 1GMHG 1C1VH 1TNHA 4B74A 3ATIA 1KLIH 2VWOA 1OX1A 1D6RA 2P59A 2IPHA 4NZLA 5C1YA 1HGTH 4LXBH 2BDHA 3M35A 2ZFRH 2FXRA 1V2MT 2QY0B 3PLKA 2G4UA 1A4WH 1TQ7B 2FTMA 3T25A 1UHBA 3MH4A 3PMJA 1RGQA 4CRFA 1D3QB 2VU8E 1RIWB 1Z8GA 1O31A 5PTPA 4BAOB 5EU8A 1A0LA 5A0AE 2B8OH 3FZZA 2BQ7B 1FN6A 1TGNA 1XMNB 4A7IB 4ZAEA 4XOJA 2FEQH 3F9HA 4U30A 1G2MA 1SLVB 2H5CA 3EA7A 4DG4A 1V2NT 1O2LA 4AX9H 1LPGB 1NROH 3UREA 2RCEA 2JH5D 4GCHF 3NUMA 1XM1A 1BA8B 2EI6A 5A0CA 4MPXA 4NA9H 4IS5A 3RC5A 2OTVA 5SGAE 3F6UH 4X1RU 1S83A 1EASA 3UY9A 4A1TA 1C1PA 2B9LA 1OWDA 1Q31A 1UK2A 2FIRH 3C27B 3BIVH 1ZOMA 3UWJH 4E7NA 3VB4A 1DANH 4TWWA 3AAVA 5GCHF 2C4FH 3OY6U 2ODQA 1MTSA 2VIDA 1O2NA 4B2AA 1GVZA 3MU5A 1CGIE 1YPGH 5JB9S 2GCTB 1S6FA 2OBOA 1K21H 2UWOA 2FOMB 1J8AA 2ODYB 2F9NA 1MZDA 5FPYA 4KKDA 4AYYB 2H9TH 3BSQA 5EXNA 1O30A 4WXVA 1Z1JA 1OYTH 1ZYOA 2B7DH 2SGPE 1ETSH 1MCVA 1O2OA 5F6MA 1C2FA 3HK6B 1IQKA 3NK8A 1QBVH 2O8UA 1GBFA 4GAWA 4GSOA 4K1TA 1V2VT 1UVTH 3BEUA 4I32A 1AUTC 5DPAA 4FUCA 1WOFA 4KTCA 2VVVA 3ZZ9A 1TGSZ 3F9FA 3U69H 2C90B 1KLJH 2QCYA 1LKBA 4ISIH 5K0HA 1C1UH 3KL6A 3PLPA 1O3GA 3TIUA 2F9BH 1K2I1 3E0NB 2ZF0H 3A7TA 3ZV8A 2PKAB 1NO9H 2DUCA 1ELFA 3S7KB 2QGRA 1K1NA 1V2RT 2WINI 3U98H 5JPMH 3IG6B 5TCCA 1DT2A 2Q6GA 3LC5A 2PR3A 1ZTJA 2BHGA 2GZ8A 3O8CA 1F5LA 1HBTH 4U2WA 3R3GB 1F0RA 5TCAA 1UTPA 3P8GA 3SV2H 3OX7U 1NU9A 3BTGE 2Z9JA 2BQWB 1AZZA 1LMWB 2XWBI 2ZQ2A 3RM2H 4ISNA 1MD7A 2AIQA 2ZDNA 3E3TA 5DP4A 1C2JA 2ZHQH 4AB9A 1EZSC 1DUEA 5HXFA 3T62A 1BUIA 1QL9A 5GJ4B 1OKXA 5DGJA 4R8TB 4INLA 3MU0A 3LH1A 1BTPA 2ALPA 3A7YA 2EEKA 1DUAA 3VEQB 2ZG0H 3Q3YA 4O9VA 1YPHC 3HGNA 4YO9A 4YOJA 1ZSLA 3M3TA 3BTQE 1TONA 3RXJA 1A0JA 1UTOA 1ELEE 3MU1A 2C8XB 1YPHE 3ATKA 4IMZA 6CHAC 3VFEA 1W7GH 2NWNA 1KXAA 1BHXB 1C5LH 4BAKB 3NCLA 1FJSA 1ANDA 1GI2A 2GDEH 1K1OA 1QA7A 2XBVA 2HALA 3PLBA 3RXFA 1K1IA 1TOMH 1O2UA 1TNLA 3EYDA 1AB9C 1BRBE 1C2EA 1C5MD 1OWHA 1IQHA 4AFUA 1GVKB 1K1PA 1Q3XA 2BY6X 3U8OH 2XW9A 1C1MA 1GCTC 2OCVB 1MKXK 1TGBA 4YT7H 2A4QA 2EA3A 1SGIB 1TNJA 2XCNA 3MFJA 3AVZA 4ISOA 2RA0A 2AGGX 3RXOA 2ZHWH 1KXFA 1F0TA 1WSSH 1T7CA 1NPMA 1MU8B 4IN2A 1ZGVA 1RS0A 2W5EA 3QTOH 1SGPE 1ETRH 2Y6TA 1BRAA 3RU4T 4MNWA 3TK9A 4BAHB 4B76A 3FZDA 3TVJB 4IW4E 1GI3A 3VXFH 1D3DB 2Y7ZA 2M5TA 8LPRA 1TAWA 2OXSA 1AKSA 2BD3A 4U01A 2XC4A 1EJAA 5FPTA 2FPZA 2FOAA 1CHOF 3MWIU 4XBCA 4NCYA 3KIDU 2BLQA 1O5GH 1VCWA 2ANMH 4DY7B 1FNIA 1QQUA 2ZTZA 4K8YA 3VB7A 3ZVFA 3M61U 1EAUA 2J2UA 1NESE 2ZCKP 4FUDA 5GCHG 1GBLA 2W26A 3T26A 4YM9A 1W11U 4CRBA 5L6NH 3VB6A 1TPOA 3SJOA 1WAYB 2Z3CA 1YCPM 3LGUA 2HWLB 1HPGA 1O5AB 4ZH8A 2BVXH 1HUTH 1BOQA 4CR9A 2TGAA 5JBTA 3PWCA 1BMLA 1GBTA 4JYVH 1CVWH 1D6WA 1TMBH 1LHEH 1W3CA 1FY1A 1MTNB 1L1GA 1ESTA 2AIPA 3EAJA 2AYWA 2FS9A 1YPEH 2CF9H 3RXSA 3SN8A 2G5NA 1YPKH 3KQDA 1GJCB 4Z6AH 2P8OB 1EB2A 1UCYH 4O3UA 1T8NA 2WPLS 3Q3KA 3L33A 7ESTE 4K60A 1RXPA 2PKSC 3M7TA 4UFGH 1Z1IA 1ELGA 3SJKA 1XXDA 1GDQA 5C5NA 1KSNA 1MUEB 3LONA 1QURH 1TMUH 3BTEE 2BDYA 3CP7A 1GBMA 1HAZB 4X8VH 4H6SB 1KTTB 1C5RA 2C93B 5GPIB 4B71A 4X8TH 1DSTA 2ASUB 2BZAA 3VPKA 2OC0A 3LKWA 3RXHA 2HGTH 2BDBA 1NS3A 5JBAS 3UR9A 3SV6A 3A85A 2BM2A 1TRNA 3GCHB 2XBXA 1SOZA 1HIAA 1TNIA 2CHAB 1IQFA 3ZYDA 2IJOB 2PGBB 3P95A 1ESBA 2F91A 2BVRH 3UNRA 4WXIA 3H7OA 5T3HA 3A7WA 4I33A 2Z9IA 1V3XA 1IHTH 1TA6A 4U32A 1FI8A 3BV9B 1O0DH 4LZ1H 1KXCA 1EAXA 1OYQA 1TLDA 1XKAC 2F9OA 3RMLH 5EODA 3U8TH 5BPEA 2ZFPH 1GGDC 3PYHA 2KAIA 1N8OB 4J2YB 4XBDA 1LPZB 3GICB 5FAHA 3QZRA 1VITG 1SPJA 1G32B 2A4OA 3P8FA 1L1NA 1HDTH 4E7RG 1C5SA 1SGDE 2ZDKA 1QB6A 3P70B 1AQ7A 1GCDA 1O2QA 3QZQA 4Q7YA 2TPIZ 2R0KA 4HI3A 3QGJA 4BTTB 1GJ7B 4B2BA 1FY3A 3LOXA 1O2KA 2OP9A 5C67A 4X1QU 2EC9H 1JXPA 3PM3A 2XWAA 1P05A 1GI4A 1C9TA 1ZMLA 1GJ4H 3A86A 4OS4A 4YESB 1OP0A 1KY9A 1ZZZA 2FTLE 2QXHA 3RP2A 5EQQA 3RXTA 1RTFB 2GCTC 1THRH 3LGYA 4BNRA 2HNTF 2QV1A 1T31A 1HAHH 1QJ6B 5CHAC 2AH4X 1BTZA 5TJXA 1O3NA 2ANWA 4E05H 1ZMJA 2FOFA 3GCNA 4OS1A 2FS8A 1TIOA 3S9CA 2WPHS 5GXPA 1DX5M 3DA9B 3KQEA 2ZHEH 1Z8RA 2Y7XA 2AGEX 5C3NA 4F4OC 5GIBA 2XC0A 3M7UA 1K9OE 1SGYE 3M37A 2W3KA 1B7XB 3W95A 1BMMH 2AMDA 1P04A 3PO1C 1QTFA 3RXCA 2WV5A 1RJXB 3BIUH 2AGIX 1GJBB 4FU7A 3LPRA 1GBIA 4SGAE 5B6OA 4X6PA 1BMNH 2CGAA 1SHHB 1O5CB 4KP0A 1LTOA 1V2PT 1E35B 1V2ST 1QR3E 1CHOG 2ZP0H 3UNSA 1ABIH 1VR1H 3GY6A 4KTSA 1PPBH 4BXWA 3STJA 1PJPA 1O35A 1AGJA 3M36A 3RC4A 1QFKH 2VH0A 2G55A 2AS9A 2F9PA 3UPEA 1MAYA 1H4WA 1DWEH 3NWUA 3TGIE 1GI9B 1P03A 2ULLA 1F2SE 1RD3B 1O3MA 4AORA 1C4V2 1HXEH 1BIOA 3UUZA 3SZNA 1C1RA 4IC5A 1UCYE 1FV9A 1SFQB 1EPTA 1YGCH 2WYJA 4JZIA 3M7QA 3M5NA 4RKOB 3UFAA 4RN6A 1SBWA 3SBKA 1ZRBA 2ZC9H 3UQVA 1GJ8B 3VB5A 2J92A 4UFDH 4ASHA 1HFDA 3URDA 2PHBA 2UUYA 1OOKB 4NFEA 4R0IA 2W7SA 1IQJA 3EQ0H 3NZIA 1RTLA 1JRSA 4MPUA 1MBMA 3TLOA 2WUCA 3ZZ7A 5E8EH 1NC6A 1UVUH 4DVAU 5A8YA 1LQEA 4INKA 5EGMA 4UONA 5EOKA 3P8OA 3L6PA 1V2JT 3KF2A 3A87A 3F1SB 4ABGA 4A1VA 3P6ZB 3SORA 1QBOA 2JETB 5GWZA 2SGFE 4BANB 2PSYA 1YLCA 4BXSA 3TGKE 5AF9H 2ZZUH 1P3EA 3MH6A 1ELCA 1LHDH 1SR5C 2G8TA 3ZVCA 3SO3A 1H9HE 1F92A 1CA8B 1DS2E 2V3OH 3I29A 3SU4A 3UR6A 3B8JA 3RDZA 4TY6A 5T6DA 3FAOA 2NU0E 1GWAA 1AMHA 4Y79A 8KME2 2K1QA 2VWNA 5AFYH 1FAKH 2SNWA 3W94A 1CT4E 3R0FA 2G51A 2CF8H 1FXYA 4WWYA 2GT8A 1IQNA 2P3FH 2ANYA 3SQHE 2FDAA 2O8TA 4I8JA 1QRZA 4LOYH 1SLXB 8ESTE 1P2OA 1KXBA 2BDCA 4ZKSU 3GY2A 4TWYA 4DIHH 1T8LA 4H4FA 4A5TS 3QUMP 1SHYA 5C2ZA 3LU9B 1O2HA 3QX5H 1Y5BT 1KXDA 1QL8A 1P2MA 4B1TA 2ZTYA 4B2CA 3ZV9A 1GI5A 1O3LA 3MO6A 1TGTA 1EQ9A 2AFQB 1EUFA 4UE7H 4Y0ZE 2QXIA 4ZKRU 1TX7A 4JMYA 1PYTC 1WU1A 2ILNA 3ESTA 1JIRA 1UVPA 2ZDVH 9ESTA 1Y3WA 2GMTB 1HAXB 2VIPA 1V2WT 1GI6A 3ITIA 5LGOA 1LVMA 1AVWA 1FY5A 2FI4E 2ZIQH 3B9FH 1W13U 4BOHA 3RXVA 3ZVBA 2A1DB 2H1UA 2ZO3H 3SGAE 4AGJA 1AKSB 1O3EA 5K7RA 3P92A 1FPHH 1GHWH 2P93A 1GBDA 5I25A 1MTWA 1S0RA 1YPLH 2SGEE 2W7UA 1HYLA 1ZSJA 3KQBA 5DO4H 2FO9A 3PV4A 1CBWC 1AIXH 1C2MA 1DDJA 3RMNH 1GBKA 1PQ7A 2WV4A 2FI3E 4H6TA 1GHBF 4ZHAA 4NSYA 3RXKA 2HVXA 1EATA 1TX6A 5EPYA 2G4TA 3FFGA 1C4Y2 2R3YA 1CO7E 1A1RA 2WPJS 3QGNB 1MTNC 2OC8A 2OUAA 4WH8A 2QA9E 4NG9H 4JZFH 1YM0A 1SOTA 3F68H 3MH7A 4A1XA 5HYOA 1S6HA 4ZKNU 3UOUA 2GGVB 4Z0KA 2ZTXA 3EGKH 2BTCE 1DXPA 4PROA 3TJOA 9LPRA 1TRMA 1Z6EA 3H5CB 3K6ZA 4AZ2B 4GPGA 2QF3A 1K1JA 2ZHFH 1B5GH 4INHA 1C5QA 2A45B 1O37A 1NRPH 1IQMA 1UK4A 1C5TA 2A5AA 4XE4A 1BRCE 1ZPCA 4TPIZ 4CHAB 1A61H 1YKTA 3RXDA 2EI7A 3T29A 3BG4C 1GJ9B 3U8RH 1SGCA 1WQVH 2BYAX 3DT0H 4B73A 1ANEA 1BBRH 3A84A 1LVYA 1G3BA 1QB1A 3UTUH 4D7GA 3SGQE 4AN7A 2ZFTA 4FU9A 1C2IA 1WBGB 3RC6A 2Z9LA 1T8MA 2ZQ1A 2GZ9A 5J4SA 5LH8A 2CHAC 1P01A 1W14U 3BTHE 2NU1E 1BQYA 4DJZB 1W0ZU 1V2OT 3LIWA 1MKWH 1HXFH 1C1TA 3HKJB 1ZRKA 3U1JB 1TPSA 3LJJA 3QO6A 5DP9A 4Y7AA 1W2KH 3M5MA 2A7HA 2F83A 4MG3A 1HIAB 1CT0E 1AN1E 4D8NA 1N8OC 1AD8H 1ABJH 1XKBC 1XXFA 1DM4B 5CMXH 3ZZ3A 1TALA 2XRCA 1C1NA 4KELA 3VGCB 3RLYH 4JZDH 4QT8C 2ALVA 3OYPA 2BY5X 2G00A 2V6NA 6GCHG 1UCYK 7KMEH 2P3TB 2STAE 1XUHA 1HRTH 2QXGA 1BB0B 7GCHF 2J34A 2KAIB 1F0SA 1B0EA 1PPEE 3ZZAA 3SV7A 3UQOA 2TGDA 2GDDA 1AI8H 3CS0A 2BY9X 4X8SH 3GY7A 5AFZH 1BTYA 2ZFFH 1SSXA 1P2KA 3A83A 3GCOA 5EG4A 1BTXA 4BTIB 1OP8A 1WCZA 1YF4A 1P9UA 5AVDA 1AO5A 3V3MA 4CBNA 3KN2A 1VCPA 4JK5A 1B0FA 5A2MH 1LVOA 1AE5A 5DP3A 3MOCA 3OSYA 5L2ZH 2RDLA 1HB0B 1H9IE 1C5PA 1NZQH 1BJUA 4A92A 3KEEA 3E91A 3E90B 4O3TA 1DITH 8GCHF 5ETXA 1MZAA 1UVSH 4XBBA 4GCHG 3U9AH 4FUBA 4MLFB 1VJ9U 1DWBH 4ZHLU 2FODA 1GBEA 2J9NA 2G81E 1T32A 2ZPRA 4THNH 2O8MA 5A0BA 1LO6A 3CENA 4NSVA 1OWIA 4I31A 2I6SA 3TJNA 4CREA 4HZHA 2ZECA 5C5OA 5HM9A 5IDKA 2TRMA 1Y3UA 4JCNA 1P02A 3RXEA 3GOVB 1HJ9A 1EP5A 1Y3XA 2ZDLA 1BMAA 4K8BA 5FBIA 4A6LA 4ABAA 3A88A 1GHYH 2AEIH 2BX4A 1A46H 3K6YA 3TNTA 3RXAA 2ZWLH 3OTJE 5HM2A 3A89A 4NZQA 4UDWH 3ELAH 5T6FA 1HAVB 1EJMA 1FZZA 1O3PB 3RXQA 3A8CA 1MU6B 2ZU3A 2VGCC 3ZZ6A 1V2TT 3MU4A 3SI3H 3Q76A 1EX3A 1FPCH 2H5DA 4YLUA 3S69A 1ZLRA 1OPHB 2PTCE 1AFQC 1HAOH 2BLVA 2BY7X 2FLBH 4ZHMU 3RXMA 1DOJA 1EB1H 1GHAF 1IQIA 2VINA 5JYIA 1D3PB 1DICA 3K2UA 2ZDAH 4IN1A 2PGQB 3MHWU 1FAXA 2W3IA 1U6QA 4HTCH 3ZZBA 4BTUB 1AFEH 1GJAB 3UOPA 1V2UT 3OY5U 2BVSH 4MPVA 4K3JA 1O2JA 1EPTB 1NT1A 5DP5A 1FDPA 2OBQA 1OP2A 1SQAA 4GUXA 4MPWA 5DKMA 2UWPA 3E0PB 1QGFA 2UUFB 2WPKS 1BBRE 1JRTA 3JZ2B 3RMOH 4AG1A 1TQ0B 1HV7A 2O8LA 4FXGH 1EZUC 1GDUA 2R9PA 1CA0B 4Y7BA 3HATH 4AFZA 4I8KA 1G3CA 1MD8A 1ARCA 2Y81A 1D3TB 3MO3A 1THSH 3VB3A 1CE5A 1FN8A 2JETC 3ATWA 3A8DA 3T2NA 1ZTKA 1O36A 1P11E 1PPHE 2Y80A 1C1SA 1C2GA 2OD3B 7LPRA 3GYMA 4K1EA 2ZNKH 1JWTA 2GCHF 3ZVGA 1PPGE 1QIXB 4FU8A 3PB1E 2D1JA 3Q77A 3BN9A 1SLUB 4YTAA 1VGCB 1BJVA 1C5YB 1MTUA 2STBE 1OS8A 1RIWC 5DP7A 5FHTA 4Y10E 4JYTA 2FZZA 2GZ7A 3LGVA 1PPFE 2QAAA 1IOEA 4NGAH 4B75A 3GISB 1CU1A 1UTLM 5LPRA 3A7ZA 3ODDA 4DCDA 5EQRA 2F9UA 2UWLA 4WH6A 1C5ZB 1XUGA 4IC6A 4X8UH 1XUIA 2H9HA 3GY8A 2ZDMA 1P2QA 2QIQA 3LT3A 2IN2A 4CRAA 1O2GH 1NRNH 1S5SA 1YYY1 4NIVA 1GJ5H 4F49A 2NU2E 3TJVA 1GI0A 3SU6A 2VIOA 3JZ1B 4YLQH 2VJ1A 4GHQA 4DURA 1F7ZA 3ZZDA 1E0FD 3MNBA 1WYKA 1DFPA 1NFUA 3KGPA 3U1IB 2CXVA 2VVUA 1O2ZA 1SG8B 1AB9B 3RLWH 1SC8U 1OWEA 1TPPA 3MO9A 3BG8A 3TU7H 3MTYA 3A8BA 4KTUA 1O3CA 3RU4E 1GCTB 2VNTA 2LPRA 1S0QA 1N6XA 2GVFA 3ZVEA 2GV7A 4Y8YA 2OC1A 3V13A 1BRUP 1Y5AT 3A8AA 1BTUA 1A2CH 5C20A 3KCGH 1C2KA 1E36B 3M5LA 1W0YH 3SNCA 1IAUA 1O2MA 3D62A 1WTHD 1SGQE 3SU3A 3T27A 3T28A 1RFNA 1ZHPA 2A7CA 1MTVA 2XCFA 4WMEA 1QB9A 1IQEA 2TBSA 1O2XA 2FLRH 2Z6BD 3AASA 3BEIB 2GKVE 1CGHA 1SMFE 1WUNH 1WV7H 5C1UA 2JKHA 2H2ZA 4Y8ZA 2ZGBH 2GTBA 3SU5A 2QF0A 1HNEE 2WUBA 2PWXA 2BOKA 1DE7H 1TFXA 1HAVA 2ZA5A 1E38B 5EPNA 4UEHH 1HCGA 2FOBA 1AWHB 1TBRH 1AE8H 4ZKOU 5FCRA 2VWLA 1O3AA 1SGNE 3FVFB 1D9IA 4YOGA 4ABHA 1P10A 2J95A 1GI7B 2SGAA 2ZU5A 1TNKA 4D9RA 3ATMA 2H6MA 5C1XA 1A3BH 2YOLA 1DPOA 2A2QH 3SI4H 4CH8B 5AHGH 4I8GA 2QXJA 1H9LB 4ZXXH 5A8XA 2BDIA 3DFLA 2VWMA 3SJ8A 3M3VA 1L2EA 2OLGA 1JOUB 1ESAA 3DHKH 1A5HA 2BLWA 1SB1H 2AERH 1QNJA 4NIYA 3FP6E 4Q2KA 4Q80A 1ANBA 1O34A 1QRWA 1OSSA 2BD9A 1GI1A 1J17T 2WYGA 2DE9A 1TABE 2A32A 1SI5H 4X6OA 1UO6A 3TGJE 1TWXB 4CBOA 1G3EA 2BDGA 2AMPA 2JH0D 5F8XA 2DE8A 1O5EH 2ODPA 3LJOA 1P57B 4MDSA 3TJUA 3I78A 1BCUH 4X2XA 4FVBA 2A5IA 4AB8A 4X6MA 2XBYA 3VGCC 4CR5A 1Z7KA 2ZFSA 5T6GA 1F5KU 1FQ3A 1O2WA 4ABBA 1PPZA 1YCPH 5EXMA 3E16B 3BTWE 2FOHA 3SU2A 4WF8A 1C4U2 2ZPQA 5EXLA 4RKJB 2HPPH 2P95A 1AZ8A 1DVAH 4M7GA 3P8NA 5FPSA 1C5VA 2JH6D 2OINA 1O2YA 1TE0A 2QC2A 3WY8A 2BLOA 2GCHG 1QHRB 3A7XA 1L0ZA 2NU4E 2O8WA 1PFXC 3BTTE 2BXTH 4ABIA 2NU3E 1UMAH 1P12E 3TITA 2FOEA 4DT7B 1BBRK 4ZXYH 2A4GA 2ZGJA 3M5OA 1BDAA 2P3UB 4I8HA 1AY6H 1K28D 1C9PA 3S0NA 1W7XH 1KTSB 1O2SA 1C5WB 1G3DA 1W12U 1Y3YA 3QTVH 4AFQA 4TYDA 1AHTH 4X1NU 4UFFH 4ISHH 1QJ7B 2FI5E 2O9QA 4MTBA 4ZUHA 3KNXA 1MKWK 3ZZCA 2VIQA 1Y8TA 1E37B 3GY5A 1GGDB 4JK6A 6LPRA 1EP6A 4X2YA 1NN6A 1O3DA 1O2IA 4OS5A 4VGCB 3RXIA 1SGFG 3ODFA 2BD2A 4FVDA 3LH3A 2BMGB 1P3CA 4NIXA 1O3KA 1DLEA 4H42U 1G2LA 2B0FA 1C5NH 1MBQA 2Y82A 1GG6B 4K69A 1OWJA 3SOSA 4AOQA 5J4QA 2P94A 1GHVH 3O8RA 1EJNA 1S81A 3MI4A 1QBNA 3GDVA 1C2DA 2THFB 3SQEE 2VIVA 2PW8H 3TNSA 2ZGCA 4YOIA 1UTNA 1VZQH 4WMDA 3A81A 4GLYA 1BT7A 1QY6A 4ABDA 1GL1A 3CS7A 1O3OA 4I8LA 2PUQH 5E0JA 1O39A 4ISLA 3PWBA 5CHAB 2ZI2H 3SHCH 3LC3A 1DSUA 5FBEA 2A4RA 1ETTH 1AU8A 1ARBA 1D4PB 3BTKE 2BX3A 5H4IB 1EAWA 1TX8A 2PLXA 1A3EH 3GDUA 3H7TA 4X2WA 2C8ZB 2P8OC 3OU0A 2TIOA 1S82A 1O3FA 3QDZB 1P8VC 3SV8A 1O32A 1EPTC 1IHSH 2R3UA 4IGDA 2A5KA 2TGPZ 2ZU2A 1YBWA 3PO1B 4MQAA 3S7HB 1DXWA 1C5OH 1P2IA 2FX6A 3SUDA 1NM6A 5EW2H 1JBUH 1VITH 1WQSA 1PQAA 2BD8A 1DY9A 5HGGA 2GX4A 1GMDF 1CSOE 1CA0C 1NRQH 2C3SA 1LVBA 2B5TB 4WMFA 1MAXA 5LPFA 3IWMA 1XUJA 3E6PH 1O2TA 1ID5H 1BTHH 1GHXH 1XUKA 1P0SH 3M3SA 4FUGA 1E34B 3BTFE 3RU4D 1FY8E 3GCHC 2ANKH 1NFYA 1T4UH 1KLTA 3EE0B 4Y0YE 3LGTA 4J1YA 3RUOA 4MVNA 3Q00A 4DOQA 1HAGE 1ACBE 1HJAB 1VGCC 4O03A 2PV9B 1UTJA 2LNCA 1HAIH 4WY3A 1KXEA 4TY7A 4ZROA 1DY8A 2VIWA 4JYUH 1LHFH 1LDTT 4JZEH 1C2LA 1H8IH 2UUJB 3NKKA 2FP7B 3PMBB 2CV3A 3K65B 2D26C 1TYNA 2ZGHA 1ELVA 2A2XH 1QCPA 2BD5A 2Y5GA 3L3TA 2C8WB 4IBLH 2FYRA 5ESBA 4NFFA 1BTWA 2OQUA 1Y59T 5CE1A 1KDQA 1O2RA 2ZPSA 3SNAA 3SU1A 2PFEA 4UD9H 2ESTE 2J38A 1LHGH 3LGIA 1VCQA 2A31A 2IOTA 4AG2A 1CQQA 2Z94A 1J15A 1NRSH 3I77A 1VITF 4XDEA 4Y76A 3SNBA 4HFPB 1C2HA 1MH0A 1P2NA 2BD4A 2Z3EA 1ELTA 1WTGH 2SGDE 2Y5FA 2BDAA 1TB6H 3AAUA 1Q2WA 2GV6A 2SFAA 1TA2A 1Z8JB 5E2PA 3ENSB 3LGWA 4AYVB 1RRKA 4K2YA 2Y5HA 4NA8A 2V0BA 3ZZ5A 1W8BH 4YZUA 3QLPH 2FESH 3BF6H 1RTKA 1O3JA 2BB4A 4CRDA 1V2LT 3PMHB 1QRXA 3F9EA 3D23A 2OQ5A 2P16A 4DIIH 1P2JA 3D65E 1A5GH 1DWDH 1NFWA 2RG3A 1QA0A 2GP9B 3IITA 1O3HA 1AWFH 3NPSA 3SUEA 2FYQA 3ATLA 3TH2H 3V0XA 5I46H 4IMQA 2D2DA 2ZFQH 3P17H 1THPB 5L2YH 1KIGH 1XVOA 3EA9A 4OS6A 1GMCF 1V6DA 3A82A 3GY3A 2FWWA 1GBCA 1C5XB 1XVMA 3SW2B 4CRGA 2YNAA 1FONA 1GL0E 3QN7A 3S9BA 1K22H 1XX9A 2D8WA 2R2WU 1GJ6A 4SGBE 2CJIA 1A5IA 1S85A 3N7OA 4D76A 3A80A 2FMJA 1NFXA 1VJAU 3G01A 2ZCLP 1ZGIA 2G5VA 1K1LA 1OWKA 1SGTA 1X7AC 1S84A 5JB8S 1SQTA 1AVXA 2XNIA 1XUFA 4GVUA 2G52A 4YT6H 3O8DA 4OS2A 4NWLA 1EXFA 2Z9KA 1LQDB 3EA8A 2BZ6H 4NA7A 4ABFA 5E2OA 4X1PU 1NY22 5A8ZA 1SQOA 1YPMH 5F8TA 4X2VA 1KYNA 3TH3H 1GHBG 2PTNA 3GCTF 1SGRE 3SU0A 1CBWB 1O38A 2AMQA 3TPIZ 3MH5A 3SJ9A 1TNGA 2HPQH 1QQ4A 3E8LA 1A0HB 2PKAA 2FM2A 2J4IA 4OS7A 4TPYA 2PSXA 1G9IE 2H9EH 2J94A 4NWKA 4UFEH 3TH4H 1J9CH 1N6YA 2F3CE 1LKAA 1SGEE 2BOHB 1GJDB 1ZTLA 3GDSA 1JMOH 1Y5UT 5DP8A 2BY8X 1F5RA 1ORFA 2V35A 1P06A 1P9SA 3TK5A 4WVPE 1YLDA 4FUEA 1FIZA 3TK6A 4K5ZA 4ABEA 4X1SU 3PTBA 1FUJA 1UTKA 3URCA 2EI8A 1Z8IB 5DJ7A 4DGJA 1UVOA 1C1OA 3FANA 1PYTD 2GT7A 4O97A 1OXGA 5DK1A 1BITA 1GMDG 1GPZA 1H1BA 1GBJA 5EW1H 1MKXH 1SGFA 1L1JA 3HGPA 3QWCH 1F0UA 5DG6A 3PTNA 3BTME 3PMAB 4E06H 3RXLA 1SVPA 4BAMB 1GMHF 3RM0H 1ZJKA 4FUFA 1TGCA 3GY4A 2BQ6B 3BG4B 2WPMS 3HK3B 1M9UA 1CT2E 4MNXA 4GHTA 4Q7ZA 1P09A 3BTDE 1CGJE 1L4ZA 3SV9A 1G30B 1HJ8A 5JBCS 3ZZ4A 3NXPA 1EAIA 3SUFA 2F9VA 2ZCHP 3C1KA 2SNVA 1O2VA 1TRYA 3A7VA 3KHVA 4LZ4B 2Z9GA 2A7JA 3DUXH 3RXGA 2CMYA 3MNSA 1TBZH 1ZHMA 2Q6FA 1A7SA 1AUJA 4Y6DA 1JIMA 4FUIA 3E1XB 3FP8E 4LK4A 3QK1A 1O5FH 5E0HA 2FOGA 1IQGA 3MNXA 4I7YH 1LHCH 4FUHA 6ESTA 5HMAA 6CHAB 1NU7B 2C8YB 4Q7XA 2GD4B 4VGCC 5ABWA 1LPKB 2Z3DA 3RXBA 4ZMAH 1Z6JH 5L30H 1EOLA 3K9XB 1UHBB 2ZHDA 3SHAH 3ZVDA 1GBAA 3O8BA 7GCHG 2GMTC 1ANCA 1SFIA 3GYLB 1FLEE 3RMMH 2XTTB 1GG6C 1UTMA 2A0QB 3AW0A 4AFSA 1NRRH 4WJG2 4AGKA 1PPCE 4KGAA 2Q6DA 4Y8XA 3STIA 2XXLA 1YC0A 2ZGXH 3RXUA 2ZKSA 1C1QA 5EQSA 1YCPK 2BD7A 1BHXF 2UUKB 1GBHA 2FOCA 5DP6A 2PUXB 4ESTE 2VB0A 1O3IA 3HKIB 1SL3A 1FY4A 1G36A 3D49H 1O5BB 5FCKA 1YPJH 1V2KT 2Q1JA 1H8DH 1MQ5A 1ZHRA 1TBQH 3RXRA 3SNEA 1ZJDA 1K1MA 2R0LA 2Z7FE 3ZZ8A 2WPIS 4ABJA 4BAQB 4RSPA 3SJIA 1N1LA 1ZMNA 8GCHG 1ELBA 1IQLA 3MMGA 1G37A 1GI8B 1EKBB 1GMCG 1O5DH 1ZPBA 1C1WH 2HLCA 3PROA 5E0GA 2SGQE 2ZU4A 3DFJA 1GDNA 1V2QT 3ZVAA 4CH2B 3UNQA 2YNBA 1Z71A 3SUGA 1ZR0A 1ELAA 4CHAC 2QN5T 5ESTE 1SLWB 4MNYA 5JBBS 1ELDE 5FX6A 5A09A 4NIWA 1BZXE 1FMGA 3MYWA 1MCTA 4DW2U 2XYAA 3AW1A 1YP9A 2V3HH 3EDXB 3FP7E 3LDXH 4MNVA 1ZSKA 1L4DA 5GDSH 3F9GA 1O33A 1EOJA 1TOCB 5FX5A 2VVCA 1GVLA 2XC5A 1HAPH 4XSKU
chains in the Genus database with same CATH superfamily
2BXUH 4FUJA 4JZ1A 3HPTB 4K1SA 2VGCB 1HJAC 1PQ8A 2RA3A 3GCTG 2OC7A 3MU8A 1J16A 1Y3VA 1O2PA 1GHAG 4D7FA 4X0WU 1MQ6A 3UWIA 3DD2H 1UTQA 4X6NA 1EZQA 5IYTA 3VXEH 1HAYB 1TPAE 5LPEA 4D9QA 1AFQB 3B23B 1DWCH 2R2MB 3Q3XA 3UIRA 1J14A 3SNDA 5BRRE 4XFQA 1UJ1A 3F2HA 5F8ZA 1CHGA 1TMTH 3S9AA 1C5UA 1O3BA 1MMJN 4CRCA 1UK3A 3ZYEA 4OGYA 5JDUB 1EZXC 5F03A 2QYIA 2TGTA 1AVGH 1GBBA 1NTPA 1QL7A 2PKSB 2ZU1A 2ZEBA 1LCYA 1PQ5A 2HNTC 1QJ1B 5G4BA 1ZPZA 3T5FH 3MNCA 4Y71A 3RXPA 2HOBA 1GHZA 2VH6A 2I6QA 2FX4A 3BEFB 1E1QD 5FXLA 6GCHF 1FIWA 2HRVA 1T4VH 1KDQB 2CN0H 2HNTE 2XBWA 3SGBE 4Y11E 3KQCA 1HLTH 4HGCA 1W10U 2F4LA 3V12A 1INCA 1DLKB 1T8OA 3V7TA 4OGXA 1GMHG 1C1VH 1TNHA 4B74A 3ATIA 1KLIH 2VWOA 1OX1A 4M9FA 1D6RA 2P59A 2IPHA 3DCLA 4NZLA 5C1YA 1HGTH 4LXBH 2BDHA 3M35A 2ZFRH 2FXRA 1V2MT 2QY0B 3PLKA 2G4UA 1A4WH 1TQ7B 2FTMA 3T25A 1UHBA 5C94A 3MH4A 3PMJA 1RGQA 4CRFA 1D3QB 2VU8E 1RIWB 1Z8GA 1O31A 5PTPA 4BAOB 5EU8A 1A0LA 5A0AE 2B8OH 3FZZA 2BQ7B 1FN6A 1TGNA 1XMNB 4A7IB 4ZAEA 4XOJA 2FEQH 3F9HA 4U30A 1G2MA 1SLVB 2V7QD 2H5CA 3EA7A 4DG4A 1V2NT 1O2LA 4AX9H 1LPGB 1NROH 3UREA 2RCEA 2JH5D 4GCHF 3NUMA 1XM1A 1BA8B 2EI6A 2RFKC 5A0CA 4MPXA 4NA9H 4IS5A 3RC5A 2OTVA 5SGAE 3F6UH 4X1RU 1S83A 1EASA 3UY9A 4A1TA 1C1PA 2B9LA 1OWDA 1Q31A 1UK2A 2FIRH 3C27B 3BIVH 2IJD1 1ZOMA 3UWJH 4E7NA 3VB4A 1DANH 4TWWA 3AAVA 5GCHF 2C4FH 3OY6U 2ODQA 1MTSA 2VIDA 1O2NA 4B2AA 1GVZA 3MU5A 1CGIE 1YPGH 5JB9S 2GCTB 1S6FA 2OBOA 3PRBA 1K21H 2UWOA 4HG6A 2FOMB 1J8AA 2ODYB 2F9NA 1MZDA 5FPYA 4KKDA 4AYYB 2W6ID 2H9TH 3BSQA 5EXNA 1O30A 4WXVA 1Z1JA 1OYTH 1ZYOA 2B7DH 2SGPE 1ETSH 1MCVA 1O2OA 5F6MA 1C2FA 3HK6B 1IQKA 3NK8A 1QBVH 3PRDA 2O8UA 1GBFA 4GAWA 4GSOA 4K1TA 1V2VT 1UVTH 3BEUA 4I32A 1AUTC 5DPAA 4FUCA 1WOFA 4I86A 4KTCA 2VVVA 3ZZ9A 1TGSZ 3F9FA 3U69H 2C90B 1KLJH 2QCYA 1LKBA 4ISIH 5K0HA 1C1UH 3KL6A 3PLPA 1O3GA 3TIUA 2F9BH 1K2I1 3E0NB 2ZF0H 3A7TA 3ZV8A 2PKAB 1NO9H 2DUCA 1ELFA 3S7KB 2QGRA 1K1NA 1V2RT 2WINI 3U98H 5JPMH 3IG6B 5TCCA 1DT2A 2Q6GA 3LC5A 2PR3A 1ZTJA 2BHGA 2GZ8A 3O8CA 1F5LA 1HBTH 4U2WA 3R3GB 1F0RA 5TCAA 1UTPA 3P8GA 3SV2H 3OX7U 1NU9A 3BTGE 2Z9JA 2BQWB 1AZZA 1LMWB 2XWBI 2ZQ2A 3RM2H 4ISNA 1MD7A 2AIQA 2ZDNA 3E3TA 5DP4A 1C2JA 2ZHQH 4AB9A 1EZSC 1DUEA 5HXFA 3T62A 1BUIA 1QL9A 5GJ4B 2XOKD 1OKXA 5DGJA 4R8TB 4INLA 3MU0A 3LH1A 1BTPA 2ALPA 3A7YA 2EEKA 1DUAA 3VEQB 2ZG0H 3Q3YA 4O9VA 1YPHC 3HGNA 5FL7D 4YO9A 4YOJA 1ZSLA 3M3TA 3F0OA 3BTQE 1TONA 3RXJA 5IK2D 1A0JA 1UTOA 1ELEE 3MU1A 2C8XB 2GJGA 3UB0A 5DSFA 4Z1MD 1YPHE 3ATKA 4IMZA 6CHAC 3VFEA 1W7GH 2NWNA 1KXAA 1BHXB 1C5LH 4BAKB 3NCLA 1FJSA 1ANDA 1GI2A 1E79D 2GDEH 1K1OA 1QA7A 2XBVA 2HALA 3PLBA 3RXFA 1K1IA 1TOMH 1O2UA 1TNLA 3EYDA 1AB9C 1BRBE 1C2EA 1C5MD 1OWHA 1IQHA 4AFUA 1GVKB 1K1PA 1Q3XA 2BY6X 3U8OH 2XW9A 1C1MA 1GCTC 2OCVB 1MKXK 1TGBA 4YT7H 2A4QA 2EA3A 1SGIB 1TNJA 2XCNA 3MFJA 3AVZA 4ISOA 2RA0A 2AGGX 3RXOA 2KCAA 2ZHWH 1KXFA 2M2AA 1F0TA 1WSSH 1T7CA 1NPMA 1MU8B 4IN2A 1ZGVA 1RS0A 2W5EA 3QTOH 1SGPE 1ETRH 2Y6TA 1BRAA 3RU4T 4MNWA 3TK9A 4BAHB 4B76A 4ACBA 2CK3D 3FZDA 3TVJB 4IW4E 1GI3A 3VXFH 1D3DB 2Y7ZA 2M5TA 8LPRA 1TAWA 2OXSA 1AKSA 2BD3A 4U01A 5KGOA 2XC4A 1EJAA 5FPTA 2FPZA 2FOAA 1CHOF 3MWIU 4XBCA 4NCYA 3KIDU 2BLQA 1O5GH 1VCWA 2ANMH 5C0TA 4DY7B 1FNIA 1QQUA 2ZTZA 4K8YA 3VB7A 3ZVFA 3M61U 1EAUA 2J2UA 1NESE 2ZCKP 4FUDA 5GCHG 1GBLA 2W26A 3T26A 4YM9A 1W11U 4CRBA 5L6NH 3VB6A 1TPOA 3SJOA 1WAYB 2Z3CA 1YCPM 3LGUA 3OE7D 2HWLB 1HPGA 1O5AB 4ZH8A 2BVXH 1HUTH 5HIZA 1BOQA 4CR9A 3EE7A 2TGAA 3DSOA 5JBTA 3PWCA 1BMLA 1GBTA 4JYVH 3FOAA 1CVWH 1D6WA 1TMBH 1LHEH 3OAAD 1W3CA 1FY1A 1MTNB 1L1GA 1ESTA 2AIPA 3EAJA 2AYWA 2FS9A 2XNDD 1YPEH 2CF9H 3RXSA 3SN8A 2G5NA 1YPKH 3KQDA 1GJCB 4Z6AH 2P8OB 1EB2A 1UCYH 2F43B 4O3UA 1T8NA 2WPLS 3Q3KA 1W0KD 3L33A 7ESTE 2J97A 5B6LA 4K60A 1RXPA 2PKSC 3M7TA 2V3MA 4UFGH 1Z1IA 3W1EA 1ELGA 3SJKA 1XXDA 1GDQA 5C5NA 1KSNA 1MUEB 3LONA 1QURH 1TMUH 3BTEE 3OEHD 2BDYA 3CP7A 1GBMA 1HAZB 4X8VH 4H6SB 1KTTB 1C5RA 2C93B 5GPIB 4B71A 4X8TH 1DSTA 1E1RD 2ASUB 2BZAA 3VPKA 2OC0A 3LKWA 3RXHA 2HGTH 2BDBA 1NS3A 5JBAS 3UR9A 3SV6A 3A85A 2BM2A 1QZ8A 1OHHD 1TRNA 3GCHB 2XBXA 4FOUC 1SOZA 1HIAA 1TNIA 2CHAB 1IQFA 3ZYDA 2IJOB 2PGBB 3P95A 1ESBA 2F91A 2BVRH 3UNRA 4WXIA 3H7OA 5T3HA 3A7WA 4I33A 4TT3D 2Z9IA 1V3XA 1IHTH 1TA6A 4U32A 5KECA 1FI8A 3BV9B 1O0DH 4LZ1H 1KXCA 1EAXA 1OYQA 1TLDA 1XKAC 2F9OA 3RMLH 5EODA 3U8TH 5BPEA 2ZFPH 1GGDC 3PYHA 2KAIA 1N8OB 4J2YB 4XBDA 2WHXA 1LPZB 3GICB 5FAHA 3QZRA 1VITG 1SPJA 1G32B 2A4OA 3P8FA 1L1NA 1HDTH 4E7RG 1C5SA 1SGDE 2ZDKA 1QB6A 3P70B 1AQ7A 1GCDA 1O2QA 3QZQA 4Q7YA 2TPIZ 2R0KA 4HI3A 3QGJA 4BTTB 1GJ7B 4B2BA 1FY3A 3LOXA 1O2KA 1H8HD 2OP9A 5C67A 4X1QU 2EC9H 1JXPA 3PM3A 2XWAA 1P05A 1GI4A 1C9TA 1ZMLA 1GJ4H 3A86A 4OS4A 4YESB 1OP0A 1KY9A 1ZZZA 5EJZA 2FTLE 2QXHA 2PP6A 3RP2A 5EQQA 3RXTA 1RTFB 2GCTC 1THRH 3LGYA 4BNRA 2HNTF 2QV1A 3F2GA 2IPQX 1T31A 1HAHH 1QJ6B 5CHAC 2AH4X 1BTZA 5TJXA 1O3NA 2ANWA 4E05H 1ZMJA 2FOFA 3GCNA 4OS1A 4YXWD 2FS8A 3WWFA 1TIOA 3S9CA 2WPHS 5GXPA 1DX5M 3DA9B 3KQEA 2ZHEH 1Z8RA 2Y7XA 2AGEX 5C3NA 4F4OC 5GIBA 2XC0A 3M7UA 4RI0A 1K9OE 1SGYE 3M37A 2W3KA 1B7XB 3W95A 1BMMH 2AMDA 1P04A 3PO1C 1QTFA 3RXCA 2WV5A 1RJXB 3BIUH 2AGIX 1GJBB 4FU7A 3LPRA 1GBIA 4SGAE 5B6OA 4X6PA 1BMNH 2CGAA 1SHHB 1O5CB 4KP0A 1LTOA 1V2PT 1E35B 1V2ST 1QR3E 1CHOG 2ZP0H 3UNSA 4OM9A 1ABIH 1VR1H 3GY6A 4KTSA 1PPBH 4BXWA 3STJA 1PJPA 1O35A 1AGJA 3M36A 3RC4A 1QFKH 2VH0A 2G55A 2AS9A 2F9PA 3UPEA 1MAYA 1H4WA 1DWEH 3NWUA 3TGIE 1GI9B 1P03A 2ULLA 1F2SE 1RD3B 1O3MA 3H09A 4AORA 1C4V2 1HXEH 1BIOA 3UUZA 3SZNA 4ASUD 1C1RA 4IC5A 1UCYE 1FV9A 1SFQB 1EPTA 1YGCH 2WYJA 3N7EA 4JZIA 3M7QA 3M5NA 4RKOB 3UFAA 4RN6A 1SBWA 3SBKA 1ZRBA 2ZC9H 3UQVA 1GJ8B 3VB5A 2J92A 4UFDH 4ASHA 1HFDA 3URDA 2PHBA 2UUYA 1OOKB 4NFEA 4R0IA 2W7SA 1IQJA 3EQ0H 3NZIA 1RTLA 1JRSA 4MPUA 1MBMA 3TLOA 2WUCA 3ZZ7A 5E8EH 1NC6A 1UVUH 4DVAU 5A8YA 2KM0A 1LQEA 4INKA 5EGMA 4UONA 2QF4A 3P8OA 5EOKA 3L6PA 1V2JT 3KF2A 3A87A 3F1SB 4ABGA 4A1VA 3P6ZB 3SORA 1QBOA 2JETB 4FETA 5GWZA 2SGFE 4BANB 2PSYA 1YLCA 4BXSA 3TGKE 5AF9H 2ZZUH 1P3EA 3MH6A 1ELCA 1LHDH 1SR5C 2G8TA 3ZVCA 3SO3A 1H9HE 5T1VA 1F92A 1CA8B 1DS2E 2V3OH 3I29A 3SU4A 3UR6A 3B8JA 3RDZA 4TY6A 5T6DA 3FAOA 2NU0E 1GWAA 1AMHA 4Y79A 8KME2 2K1QA 2VWNA 4XD7D 5AFYH 1FAKH 2SNWA 3KYGA 3W94A 1CT4E 3R0FA 2G51A 2CF8H 5KEDA 1FXYA 4WWYA 2GT8A 1IQNA 2P3FH 2ANYA 3SQHE 2FDAA 2KFWA 2O8TA 4I8JA 1QRZA 4LOYH 1SLXB 8ESTE 1P2OA 1KXBA 2BDCA 4ZKSU 3GY2A 4TWYA 4DIHH 1T8LA 4H4FA 4A5TS 3QUMP 4P02A 1SHYA 5C2ZA 3LU9B 1O2HA 3QX5H 1Y5BT 1KXDA 1QL8A 1P2MA 4B1TA 2ZTYA 4B2CA 3ZV9A 1GI5A 1O3LA 3MO6A 1TGTA 1EQ9A 2AFQB 1EUFA 4UE7H 4Y0ZE 2QXIA 4ZKRU 1TX7A 4JMYA 1PYTC 1WU1A 2ILNA 3ESTA 1JIRA 1UVPA 2ZDVH 9ESTA 1Y3WA 2GMTB 1HAXB 2VIPA 1V2WT 1GI6A 3ITIA 5LGOA 1LVMA 1AVWA 1FY5A 2FI4E 2ZIQH 3B9FH 1W13U 4BOHA 3RXVA 5DN6D 3ZVBA 2A1DB 2H1UA 2ZO3H 3SGAE 4AGJA 1AKSB 1O3EA 5K7RA 3P92A 1FPHH 1GHWH 2P93A 1GBDA 5I25A 1MTWA 3KQ5A 1S0RA 1YPLH 2SGEE 2W7UA 1HYLA 1ZSJA 3KQBA 5DO4H 2FO9A 3PV4A 1CBWC 1AIXH 1C2MA 1DDJA 3RMNH 4B6EA 1GBKA 1PQ7A 2WV4A 2FI3E 4H6TA 1GHBF 4ZHAA 4NSYA 3RXKA 2HVXA 1EATA 1TX6A 5EPYA 2G4TA 3FFGA 1C4Y2 2R3YA 2KR7A 1CO7E 1A1RA 2WPJS 3QGNB 1MTNC 2OC8A 2OUAA 4WH8A 2QA9E 4NG9H 4JZFH 1YM0A 1SOTA 3F68H 3MH7A 4A1XA 5HYOA 1S6HA 4ZKNU 3UOUA 2GGVB 1SKYE 4Z0KA 2ZTXA 3EGKH 2BTCE 1DXPA 4PROA 3TJOA 9LPRA 2J5UA 1TRMA 1Z6EA 3H5CB 3K6ZA 4AZ2B 3VG8A 4GPGA 2QF3A 1K1JA 2ZHFH 3FO8D 1B5GH 4INHA 1C5QA 2A45B 4XRNA 1O37A 1NRPH 1IQMA 1UK4A 1C5TA 2A5AA 4XE4A 1BRCE 1ZPCA 4TPIZ 4CHAB 1A61H 1YKTA 3RXDA 2EI7A 3T29A 3BG4C 1GJ9B 3U8RH 1SGCA 1WQVH 2BYAX 3DT0H 4B73A 1ANEA 1BBRH 3A84A 1LVYA 1G3BA 1QB1A 3UTUH 4D7GA 3SGQE 4AN7A 2ZFTA 4FU9A 1C2IA 1WBGB 3RC6A 2Z9LA 1T8MA 2ZQ1A 2GZ9A 5J4SA 5LH8A 2CHAC 1P01A 1W14U 1WDIA 3BTHE 2NU1E 1BQYA 3NRLA 2OK5A 4DJZB 1W0ZU 1V2OT 3LIWA 1MKWH 1HXFH 1C1TA 3HKJB 1ZRKA 3U1JB 1TPSA 3LJJA 3QO6A 5DP9A 4Y7AA 1W2KH 3M5MA 2A7HA 2F83A 4MG3A 1HIAB 1CT0E 1AN1E 4D8NA 1N8OC 1AD8H 1ABJH 1XKBC 1XXFA 1DM4B 5CMXH 3ZZ3A 1TALA 2XRCA 1C1NA 4KELA 3VGCB 2YMSC 3RLYH 4JZDH 4QT8C 2ALVA 3OYPA 2BY5X 2G00A 2V6NA 3WWBA 6GCHG 1UCYK 7KMEH 2P3TB 2STAE 1XUHA 1HRTH 2QXGA 1BB0B 7GCHF 2J34A 2KAIB 1F0SA 1B0EA 1PPEE 3ZZAA 3SV7A 3UQOA 2TGDA 2GDDA 1AI8H 3CS0A 2BY9X 4X8SH 3GY7A 3CNRA 5AFZH 1BTYA 2ZFFH 1SSXA 1P2KA 3A83A 3GCOA 5EG4A 1BTXA 4BTIB 1OP8A 1WCZA 1YF4A 1BMFD 1P9UA 5AVDA 1AO5A 3V3MA 4CBNA 3KN2A 1VCPA 4JK5A 1B0FA 5A2MH 1LVOA 1AE5A 5DP3A 3MOCA 3OSYA 5L2ZH 2RDLA 1HB0B 1H9IE 1C5PA 1NZQH 1BJUA 4A92A 3KEEA 3E91A 3E90B 4O3TA 1DITH 8GCHF 5ETXA 1MZAA 1UVSH 4XBBA 4GCHG 3U9AH 4FUBA 4MLFB 1VJ9U 1DWBH 4ZHLU 2FODA 1GBEA 2J9NA 2G81E 1T32A 2RDEA 2ZPRA 4THNH 2O8MA 5A0BA 1LO6A 3CENA 4NSVA 1OWIA 4I31A 2I6SA 3TJNA 4CREA 4HZHA 2ZECA 5C5OA 5HM9A 5IDKA 2TRMA 1Y3UA 4JCNA 1P02A 3RXEA 3GOVB 1HJ9A 1EP5A 1Y3XA 2ZDLA 1BMAA 4K8BA 5FBIA 4A6LA 4ABAA 3A88A 1GHYH 2AEIH 2BX4A 1A46H 3K6YA 3TNTA 3RXAA 2ZWLH 3OTJE 5HM2A 3A89A 4NZQA 4UDWH 3FN8A 3ELAH 5T6FA 1HAVB 1EJMA 1FZZA 1O3PB 3RXQA 3A8CA 1MU6B 2ZU3A 2VGCC 3ZZ6A 1V2TT 3MU4A 3SI3H 1NBME 3Q76A 1EX3A 1FPCH 2H5DA 4YLUA 3N7DA 3S69A 1ZLRA 1OPHB 2PTCE 1AFQC 1HAOH 2BLVA 2BY7X 2FLBH 4ZHMU 3RXMA 1DOJA 1EB1H 1GHAF 1IQIA 2VINA 5JYIA 1D3PB 1DICA 3K2UA 2ZDAH 4IN1A 2PGQB 3MHWU 1FAXA 2W3IA 1U6QA 4HTCH 3ZZBA 4BTUB 1AFEH 1GJAB 3UOPA 1V2UT 3OY5U 2BVSH 4MPVA 4K3JA 1O2JA 1EPTB 1NT1A 5DP5A 1FDPA 2OBQA 1OP2A 1SQAA 4GUXA 4MPWA 5DKMA 2UWPA 3E0PB 1QGFA 2UUFB 2WPKS 1BBRE 1JRTA 3JZ2B 3RMOH 4AG1A 1TQ0B 1HV7A 2JJ2D 2O8LA 4FXGH 1EZUC 1GDUA 2R9PA 1CA0B 4Y7BA 3HATH 4AFZA 4I8KA 1G3CA 1MD8A 1ARCA 2Y81A 1D3TB 3MO3A 1THSH 3VB3A 1CE5A 1FN8A 2JETC 3ATWA 3A8DA 3T2NA 1ZTKA 2QE7D 1O36A 1P11E 1PPHE 2Y80A 1C1SA 1C2GA 2OD3B 7LPRA 3GYMA 4K1EA 2ZNKH 1JWTA 2GCHF 3ZVGA 1PPGE 1QIXB 4AC9A 4FU8A 3PB1E 2D1JA 3Q77A 3BN9A 1SLUB 4YTAA 1VGCB 2EY4C 1BJVA 1C5YB 1MTUA 2STBE 1OS8A 1RIWC 5DP7A 5FHTA 4Y10E 4JYTA 2FZZA 2GZ7A 5EJLA 3LGVA 1PPFE 2QAAA 1IOEA 3DSGA 4NGAH 4B75A 3GISB 1CU1A 1UTLM 5LPRA 3A7ZA 3ODDA 4DCDA 5EQRA 2F9UA 2UWLA 4WH6A 1C5ZB 1XUGA 2J98B 4IC6A 4X8UH 1XUIA 2H9HA 3GY8A 2ZDMA 1P2QA 2QIQA 3LT3A 2IN2A 4CRAA 1O2GH 1NRNH 1S5SA 3N99A 1YYY1 1H8ED 3OTPA 4NIVA 1GJ5H 4F49A 2NU2E 3TJVA 1GI0A 3SU6A 2VIOA 2EQNA 3JZ1B 4YLQH 2VJ1A 4GHQA 4DURA 1F7ZA 5EIYA 3ZZDA 1E0FD 3MNBA 1WYKA 1DFPA 1NFUA 3KGPA 3U1IB 2CXVA 2VVUA 1O2ZA 1SG8B 1AB9B 3RLWH 1SC8U 1OWEA 1TPPA 3MO9A 3BG8A 3TU7H 3MTYA 3A8BA 4KTUA 1O3CA 3RU4E 1GCTB 2VNTA 2LPRA 2JJ1D 1S0QA 1N6XA 2GVFA 3ZVEA 2GV7A 4Y8YA 2OC1A 3V13A 1BRUP 1Y5AT 3A8AA 1BTUA 1A2CH 5C20A 3KCGH 1C2KA 1E36B 3M5LA 1W0YH 3SNCA 1IAUA 1O2MA 3D62A 1WTHD 1SGQE 3SU3A 3T27A 3T28A 1RFNA 1ZHPA 2A7CA 1MTVA 2XCFA 4WMEA 1QB9A 1IQEA 2TBSA 1O2XA 2FLRH 2Z6BD 3AASA 3BEIB 2GKVE 1CGHA 1SMFE 1WUNH 1WV7H 5C1UA 2JKHA 2H2ZA 4Y8ZA 2ZGBH 2GTBA 3SU5A 2QF0A 1HNEE 2WUBA 2PWXA 2BOKA 1K0HA 1DE7H 1TFXA 3F3BA 1HAVA 2ZA5A 1E38B 5EPNA 4UEHH 1HCGA 2FOBA 1AWHB 1TBRH 1AE8H 2VBCA 4ZKOU 5FCRA 2VWLA 1O3AA 1SGNE 3FVFB 1D9IA 4YOGA 4ABHA 1P10A 2J95A 1GI7B 2SGAA 2YMSD 2ZU5A 4P00A 1TNKA 4D9RA 3ATMA 2H6MA 5C1XA 1A3BH 2YOLA 5CHBA 1DPOA 2A2QH 3SI4H 4CH8B 5AHGH 4I8GA 2QXJA 2HVYB 1H9LB 4ZXXH 5A8XA 2BDIA 5EJ1A 3DFLA 2VWMA 3SJ8A 3M3VA 1L2EA 2OLGA 1JOUB 1ESAA 3DHKH 1A5HA 2BLWA 1SB1H 2AERH 1QNJA 4NIYA 3FP6E 4Q2KA 2QF5A 4Q80A 5HIYA 1ANBA 1O34A 1QRWA 1OSSA 2BD9A 1GI1A 1J17T 2WYGA 2DE9A 1TABE 2A32A 1SI5H 4X6OA 3OFND 2KCOA 1UO6A 3TGJE 1TWXB 4CBOA 1G3EA 2BDGA 4DT4A 2AMPA 2JH0D 5F8XA 1KMHB 2DE8A 1O5EH 2ODPA 3LJOA 1P57B 3PV5A 4MDSA 3TJUA 3I78A 1BCUH 4X2XA 4FVBA 2A5IA 4AB8A 4X6MA 2XBYA 3VGCC 4CR5A 1Z7KA 2ZFSA 5T6GA 1F5KU 1FQ3A 1O2WA 4ABBA 1PPZA 1YCPH 5EXMA 3E16B 3BTWE 2FOHA 3SU2A 4WF8A 1C4U2 2ZPQA 5EXLA 4RKJB 2HPPH 2P95A 1AZ8A 1DVAH 4M7GA 3UAIC 3P8NA 5FPSA 1C5VA 2JH6D 2OINA 1O2YA 1TE0A 2QC2A 3WY8A 2J98A 2BLOA 2GCHG 1QHRB 1YLNA 3A7XA 1L0ZA 2NU4E 2O8WA 1NBMD 1PFXC 3BTTE 2BXTH 4ABIA 2KCPA 2NU3E 1UMAH 1P12E 3TITA 2FOEA 4DT7B 1BBRK 4ZXYH 2A4GA 2ZGJA 3M5OA 1BDAA 2P3UB 3SZEA 4I8HA 1AY6H 1K28D 1C9PA 3S0NA 1W7XH 1KTSB 1O2SA 1C5WB 1G3DA 3FKSD 1W12U 1Y3YA 3QTVH 4AFQA 4TYDA 1AHTH 4X1NU 4UFFH 4ISHH 1QJ7B 2FI5E 2O9QA 4MTBA 4ZUHA 3KNXA 2W6JD 1MKWK 3ZZCA 2VIQA 1Y8TA 1E37B 3GY5A 1GGDB 4JK6A 1EFRD 6LPRA 1EP6A 4X2YA 1NN6A 1O3DA 1O2IA 4OS5A 4VGCB 3RXIA 1SGFG 3ODFA 2BD2A 4FVDA 3LH3A 2BMGB 1P3CA 4NIXA 1O3KA 1DLEA 3SYJA 2LELA 4H42U 1G2LA 2B0FA 1C5NH 1MBQA 2Y82A 1GG6B 4K69A 1OWJA 3SOSA 4AOQA 5J4QA 2P94A 1GHVH 3O8RA 1EJNA 1S81A 3MI4A 1QBNA 3GDVA 1C2DA 2THFB 3SQEE 2VIVA 2PW8H 3TNSA 2ZGCA 4YOIA 1UTNA 1VZQH 2JDID 4WMDA 3A81A 4GLYA 1BT7A 1QY6A 4ABDA 1GL1A 3CS7A 1O3OA 4I8LA 2PUQH 5E0JA 1O39A 2K8IA 4ISLA 3PWBA 5CHAB 2ZI2H 4B6FA 3SHCH 2WSSD 3LC3A 1DSUA 5FBEA 2A4RA 2HLDD 1ETTH 1AU8A 1ARBA 1D4PB 3BTKE 2BX3A 5H4IB 1EAWA 1TX8A 2PLXA 1A3EH 3GDUA 3H7TA 4X2WA 2C8ZB 2P8OC 3OU0A 2TIOA 1S82A 1O3FA 3QDZB 1P8VC 3SV8A 1O32A 1EPTC 1IHSH 2R3UA 4IGDA 2A5KA 2TGPZ 2ZU2A 1YBWA 3PO1B 4MQAA 3S7HB 1DXWA 1C5OH 1P2IA 2FX6A 3SUDA 1NM6A 5EW2H 1JBUH 1VITH 1WQSA 4TSFD 1PQAA 3WW7A 2BD8A 1DY9A 5HGGA 2GX4A 1GMDF 1CSOE 1CA0C 1NRQH 1YWUA 2C3SA 1SQRA 1LVBA 2B5TB 4WMFA 1MAXA 5LPFA 1MABB 3IWMA 1XUJA 3E6PH 1O2TA 1ID5H 1BTHH 1GHXH 1XUKA 1P0SH 3M3SA 4FUGA 1E34B 3BTFE 3RU4D 1FY8E 3GCHC 2ANKH 1NFYA 1T4UH 1KLTA 3EE0B 4Y0YE 3LGTA 4J1YA 3RUOA 4MVNA 3Q00A 4DOQA 1HAGE 1ACBE 1HJAB 1VGCC 4O03A 2PV9B 1UTJA 2LNCA 1HAIH 4WY3A 1KXEA 4TY7A 4ZROA 1DY8A 2VIWA 1W0JD 4JYUH 1LHFH 1LDTT 4JZEH 1C2LA 1H8IH 2UUJB 3NKKA 2FP7B 3PMBB 2CV3A 3K65B 2D26C 1TYNA 2ZGHA 1ELVA 2A2XH 1QCPA 2BD5A 2Y5GA 3L3TA 5C17A 2C8WB 4IBLH 2FYRA 5ESBA 4NFFA 1BTWA 2OQUA 3U28C 1Y59T 5CE1A 1KDQA 1O2RA 2ZPSA 3SNAA 3SU1A 2PFEA 4UD9H 2ESTE 2J38A 1LHGH 3LGIA 5GNDA 1VCQA 2A31A 2IOTA 4AG2A 1CQQA 2Z94A 1J15A 1NRSH 3I77A 1VITF 4XDEA 3PV2A 4ACAA 3KYFA 4Y76A 3SNBA 4HFPB 1C2HA 1MH0A 1P2NA 2BD4A 2Z3EA 1ELTA 1WTGH 2SGDE 2Y5FA 2BDAA 5C0UA 1TB6H 3AAUA 1Q2WA 2GV6A 2SFAA 1TA2A 1Z8JB 5F53A 5E2PA 3ENSB 3LGWA 4AYVB 1RRKA 4K2YA 1UW7A 2Y5HA 4NA8A 4RT1A 2V0BA 4ZCNA 3ZZ5A 2KZ4A 1W8BH 4YZUA 3QLPH 2FESH 3BF6H 1RTKA 1O3JA 2BB4A 4CRDA 1V2LT 2KCYA 3PMHB 1QRXA 3F9EA 3D23A 2OQ5A 2P16A 4DIIH 1P2JA 3D65E 1S6LA 1A5GH 1COWD 1DWDH 1NFWA 4F55A 2RG3A 1QA0A 2GP9B 3IITA 1O3HA 1AWFH 3NPSA 3SUEA 2FYQA 3ATLA 3TH2H 3V0XA 5I46H 4IMQA 2D2DA 2ZFQH 3P17H 1THPB 5L2YH 3OEED 1KIGH 1XVOA 3EA9A 4OS6A 1GMCF 1V6DA 3A82A 3GY3A 2FWWA 1GBCA 1C5XB 1XVMA 3SW2B 4CRGA 2YNAA 1FONA 1GL0E 3QN7A 3S9BA 1K22H 2LP6A 1XX9A 2D8WA 2R2WU 1GJ6A 4SGBE 2CJIA 1A5IA 1S85A 3N7OA 4D76A 3A80A 2FMJA 1NFXA 1VJAU 3G01A 2ZCLP 5HKKD 1ZGIA 2G5VA 1K1LA 1OWKA 1SGTA 3ZIAD 1X7AC 1S84A 5JB8S 1SQTA 1AVXA 2XNIA 1XUFA 4GVUA 2G52A 4YT6H 3O8DA 4OS2A 4NWLA 1EXFA 2Z9KA 1LQDB 3EA8A 2BZ6H 4NA7A 4ABFA 3GS9A 5E2OA 4X1PU 1NY22 5A8ZA 1SQOA 1WXRA 1YPMH 5F8TA 4X2VA 1KYNA 3TH3H 1GHBG 2PTNA 3GCTF 1SGRE 3SU0A 1CBWB 1O38A 2AMQA 3TPIZ 3MH5A 3SJ9A 1TNGA 2HPQH 1QQ4A 3E8LA 1A0HB 2PKAA 2FM2A 2J4IA 4OS7A 4TPYA 2PSXA 1G9IE 2H9EH 2J94A 4NWKA 4UFEH 3TH4H 1J9CH 1N6YA 2F3CE 1LKAA 1SGEE 2BOHB 1GJDB 1ZTLA 3GDSA 1JMOH 1Y5UT 5DP8A 2BY8X 1F5RA 1ORFA 2V35A 1P06A 1P9SA 3TK5A 4WVPE 1YLDA 4FUEA 1FIZA 3TK6A 4K5ZA 4ABEA 4X1SU 3PTBA 1FUJA 1UTKA 3URCA 2EI8A 1Z8IB 5DJ7A 4DGJA 1UVOA 1C1OA 3FANA 1PYTD 2GT7A 4O97A 1OXGA 2K0QA 5DK1A 1BITA 1GMDG 1GPZA 1H1BA 1GBJA 5EW1H 1MKXH 4RT0A 1SGFA 1L1JA 3HGPA 3QWCH 1F0UA 5DG6A 3PTNA 3BTME 1FX0B 3PMAB 4E06H 3RXLA 1SVPA 4BAMB 1GMHF 3RM0H 1ZJKA 4FUFA 3F0PA 1TGCA 3GY4A 2BQ6B 1VKYA 3BG4B 2WPMS 3HK3B 1M9UA 1CT2E 4MNXA 4GHTA 4Q7ZA 1P09A 3BTDE 1CGJE 1L4ZA 3SV9A 1G30B 1HJ8A 5JBCS 3ZZ4A 3NXPA 1EAIA 3SUFA 2F9VA 2ZCHP 3C1KA 2SNVA 1O2VA 1TRYA 3A7VA 3KHVA 4LZ4B 2Z9GA 2A7JA 3DUXH 3RXGA 2CMYA 3MNSA 1TBZH 1ZHMA 3F2FA 4Q4LA 2WPDD 5CDFE 2Q6FA 1A7SA 1AUJA 4Y6DA 1YY3A 1JIMA 4FUIA 3E1XB 3FP8E 4LK4A 3QK1A 1O5FH 5E0HA 2FOGA 1IQGA 3MNXA 4I7YH 1LHCH 4FUHA 4F48B 5HMAA 6ESTA 6CHAB 1NU7B 2C8YB 4Q7XA 2GD4B 4VGCC 5ABWA 1LPKB 2Z3DA 3RXBA 4ZMAH 1Z6JH 5L30H 1EOLA 3K9XB 1UHBB 2ZHDA 3SHAH 3ZVDA 1GBAA 3O8BA 7GCHG 2GMTC 2YMSB 1ANCA 1SFIA 3GYLB 1FLEE 3RMMH 2XTTB 1GG6C 1UTMA 2A0QB 3AW0A 2L74A 4AFSA 1NRRH 4WJG2 4AGKA 1PPCE 4KGAA 2WV9A 2Q6DA 4Y8XA 3STIA 2XXLA 1YC0A 2ZGXH 3RXUA 2ZKSA 1C1QA 5EQSA 1YCPK 2BD7A 2WZQA 1BHXF 2UUKB 4Q63A 1GBHA 2FOCA 5DP6A 2PUXB 4ESTE 2VB0A 1O3IA 2JIZD 3HKIB 3DSPA 1SL3A 1FY4A 2KX4A 1G36A 3D49H 1O5BB 5FCKA 1YPJH 1V2KT 2Q1JA 1H8DH 1MQ5A 1ZHRA 1TBQH 3RXRA 3SNEA 1ZJDA 1K1MA 2R0LA 2Z7FE 3ZZ8A 2WPIS 4ABJA 4BAQB 4RSPA 3SJIA 1N1LA 1ZMNA 8GCHG 1ELBA 1IQLA 3MMGA 1G37A 1GI8B 1EKBB 1GMCG 1O5DH 1ZPBA 2AHME 1C1WH 2HLCA 3PROA 5E0GA 2SGQE 2ZU4A 3DFJA 1GDNA 1V2QT 3ZVAA 3MQKC 4CH2B 3UNQA 2YNBA 1Z71A 2L6OA 3SUGA 1ZR0A 1ELAA 4CHAC 2QN5T 5ESTE 1SLWB 4MNYA 5JBBS 1ELDE 5FX6A 5A09A 4NIWA 1BZXE 1FMGA 3MYWA 1MCTA 4DW2U 2XYAA 3AW1A 1YP9A 2V3HH 3EDXB 3FP7E 3LDXH 4MNVA 1ZSKA 1L4DA 5GDSH 3F9GA 1O33A 1EOJA 1TOCB 5FX5A 2VVCA 1GVLA 3AK5A 2XC5A 1HAPH 4XSKU
chains in the Genus database with same CATH topology
2BXUH 4FUJA 4JZ1A 3HPTB 4K1SA 2VGCB 1HJAC 1PQ8A 2RA3A 3GCTG 2OC7A 3MU8A 1J16A 1Y3VA 1O2PA 1GHAG 4D7FA 4X0WU 1MQ6A 3UWIA 3DD2H 1UTQA 4X6NA 1EZQA 5IYTA 3VXEH 1HAYB 1TPAE 5LPEA 4D9QA 1AFQB 3B23B 1DWCH 2R2MB 3Q3XA 3UIRA 1J14A 3SNDA 5BRRE 4XFQA 1UJ1A 5F8ZA 1CHGA 1TMTH 3S9AA 1C5UA 1O3BA 1MMJN 4CRCA 1UK3A 3ZYEA 4OGYA 5JDUB 1EZXC 5F03A 2QYIA 2TGTA 1AVGH 1GBBA 1NTPA 1QL7A 2PKSB 2ZU1A 2ZEBA 1LCYA 1PQ5A 2HNTC 1QJ1B 5G4BA 1ZPZA 3T5FH 3MNCA 4Y71A 3RXPA 2HOBA 1GHZA 2VH6A 2I6QA 2FX4A 3BEFB 5FXLA 6GCHF 1FIWA 2HRVA 1T4VH 1KDQB 2CN0H 2HNTE 2XBWA 3SGBE 4Y11E 3KQCA 1HLTH 4HGCA 1W10U 3V12A 1INCA 1DLKB 1T8OA 3V7TA 4OGXA 1GMHG 1C1VH 1TNHA 4B74A 3ATIA 1KLIH 2VWOA 1OX1A 1D6RA 2P59A 2IPHA 4NZLA 5C1YA 1HGTH 4LXBH 2BDHA 3M35A 2ZFRH 2FXRA 1V2MT 2QY0B 3PLKA 2G4UA 1A4WH 1TQ7B 2FTMA 3T25A 1UHBA 3MH4A 3PMJA 1RGQA 4CRFA 1D3QB 2VU8E 1RIWB 1Z8GA 1O31A 5PTPA 4BAOB 5EU8A 1A0LA 5A0AE 2B8OH 3FZZA 2BQ7B 1FN6A 1TGNA 1XMNB 4A7IB 4ZAEA 4XOJA 2FEQH 3F9HA 4U30A 1G2MA 1SLVB 2H5CA 3EA7A 4DG4A 1V2NT 1O2LA 4AX9H 1LPGB 1NROH 3UREA 2RCEA 2JH5D 4GCHF 3NUMA 1XM1A 1BA8B 2EI6A 5A0CA 4MPXA 4NA9H 4IS5A 3RC5A 2OTVA 5SGAE 3F6UH 4X1RU 1S83A 1EASA 3UY9A 4A1TA 1C1PA 2B9LA 1OWDA 1Q31A 1UK2A 2FIRH 3C27B 3BIVH 1ZOMA 3UWJH 4E7NA 3VB4A 1DANH 4TWWA 3AAVA 5GCHF 2C4FH 3OY6U 2ODQA 1MTSA 2VIDA 1O2NA 4B2AA 1GVZA 3MU5A 1CGIE 1YPGH 5JB9S 2GCTB 1S6FA 2OBOA 1K21H 2UWOA 2FOMB 1J8AA 2ODYB 2F9NA 1MZDA 5FPYA 4KKDA 4AYYB 2H9TH 3BSQA 5EXNA 1O30A 4WXVA 1Z1JA 1OYTH 1ZYOA 2B7DH 2SGPE 1ETSH 1MCVA 1O2OA 5F6MA 1C2FA 3HK6B 1IQKA 3NK8A 1QBVH 2O8UA 1GBFA 4GAWA 4GSOA 4K1TA 1V2VT 1UVTH 3BEUA 4I32A 1AUTC 5DPAA 4FUCA 1WOFA 4KTCA 2VVVA 3ZZ9A 1TGSZ 3F9FA 3U69H 2C90B 1KLJH 2QCYA 1LKBA 4ISIH 5K0HA 1C1UH 3KL6A 3PLPA 1O3GA 3TIUA 2F9BH 1K2I1 3E0NB 2ZF0H 3A7TA 3ZV8A 2PKAB 1NO9H 2DUCA 1ELFA 3S7KB 2QGRA 1K1NA 1V2RT 2WINI 3U98H 5JPMH 3IG6B 5TCCA 1DT2A 2Q6GA 3LC5A 2PR3A 1ZTJA 2BHGA 2GZ8A 3O8CA 1F5LA 1HBTH 4U2WA 3R3GB 1F0RA 5TCAA 1UTPA 3P8GA 3SV2H 3OX7U 1NU9A 3BTGE 2Z9JA 2BQWB 1AZZA 1LMWB 2XWBI 2ZQ2A 3RM2H 4ISNA 1MD7A 2AIQA 2ZDNA 3E3TA 5DP4A 1C2JA 2ZHQH 4AB9A 1EZSC 1DUEA 5HXFA 3T62A 1BUIA 1QL9A 5GJ4B 1OKXA 5DGJA 4R8TB 4INLA 3MU0A 3LH1A 1BTPA 2ALPA 3A7YA 2EEKA 1DUAA 3VEQB 2ZG0H 3Q3YA 4O9VA 1YPHC 3HGNA 4YO9A 4YOJA 1ZSLA 3M3TA 3BTQE 1TONA 3RXJA 1A0JA 1UTOA 1ELEE 3MU1A 2C8XB 1YPHE 3ATKA 4IMZA 6CHAC 3VFEA 1W7GH 2NWNA 1KXAA 1BHXB 1C5LH 4BAKB 3NCLA 1FJSA 1ANDA 1GI2A 2GDEH 1K1OA 1QA7A 2XBVA 2HALA 3PLBA 3RXFA 1K1IA 1TOMH 1O2UA 1TNLA 3EYDA 1AB9C 1BRBE 1C2EA 1C5MD 1OWHA 1IQHA 4AFUA 1GVKB 1K1PA 1Q3XA 2BY6X 3U8OH 2XW9A 1C1MA 1GCTC 2OCVB 1MKXK 1TGBA 4YT7H 2A4QA 2EA3A 1SGIB 1TNJA 2XCNA 3MFJA 3AVZA 4ISOA 2RA0A 2AGGX 3RXOA 2ZHWH 1KXFA 1F0TA 1WSSH 1T7CA 1NPMA 1MU8B 4IN2A 1ZGVA 1RS0A 2W5EA 3QTOH 1SGPE 1ETRH 2Y6TA 1BRAA 3RU4T 4MNWA 3TK9A 4BAHB 4B76A 3FZDA 3TVJB 4IW4E 1GI3A 3VXFH 1D3DB 2Y7ZA 2M5TA 8LPRA 1TAWA 2OXSA 1AKSA 2BD3A 4U01A 2XC4A 1EJAA 5FPTA 2FPZA 2FOAA 1CHOF 3MWIU 4XBCA 4NCYA 3KIDU 2BLQA 1O5GH 1VCWA 2ANMH 4DY7B 1FNIA 1QQUA 2ZTZA 4K8YA 3VB7A 3ZVFA 3M61U 1EAUA 2J2UA 1NESE 2ZCKP 4FUDA 5GCHG 1GBLA 2W26A 3T26A 4YM9A 1W11U 4CRBA 5L6NH 3VB6A 1TPOA 3SJOA 1WAYB 2Z3CA 1YCPM 3LGUA 2HWLB 1HPGA 1O5AB 4ZH8A 2BVXH 1HUTH 1BOQA 4CR9A 2TGAA 5JBTA 3PWCA 1BMLA 1GBTA 4JYVH 1CVWH 1D6WA 1TMBH 1LHEH 1W3CA 1FY1A 1MTNB 1L1GA 1ESTA 2AIPA 3EAJA 2AYWA 2FS9A 1YPEH 2CF9H 3RXSA 3SN8A 2G5NA 1YPKH 3KQDA 1GJCB 4Z6AH 2P8OB 1EB2A 1UCYH 4O3UA 1T8NA 2WPLS 3Q3KA 3L33A 7ESTE 4K60A 1RXPA 2PKSC 3M7TA 4UFGH 1Z1IA 1ELGA 3SJKA 1XXDA 1GDQA 5C5NA 1KSNA 1MUEB 3LONA 1QURH 1TMUH 3BTEE 2BDYA 3CP7A 1GBMA 1HAZB 4X8VH 4H6SB 1KTTB 1C5RA 2C93B 5GPIB 4B71A 4X8TH 1DSTA 2ASUB 2BZAA 3VPKA 2OC0A 3LKWA 3RXHA 2HGTH 2BDBA 1NS3A 5JBAS 3UR9A 3SV6A 3A85A 2BM2A 1TRNA 3GCHB 2XBXA 1SOZA 1HIAA 1TNIA 2CHAB 1IQFA 3ZYDA 2IJOB 2PGBB 3P95A 1ESBA 2F91A 2BVRH 3UNRA 4WXIA 3H7OA 5T3HA 3A7WA 4I33A 2Z9IA 1V3XA 1IHTH 1TA6A 4U32A 1FI8A 3BV9B 1O0DH 4LZ1H 1KXCA 1EAXA 1OYQA 1TLDA 1XKAC 2F9OA 3RMLH 5EODA 3U8TH 5BPEA 2ZFPH 1GGDC 3PYHA 2KAIA 1N8OB 4J2YB 4XBDA 1LPZB 3GICB 5FAHA 3QZRA 1VITG 1SPJA 1G32B 2A4OA 3P8FA 1L1NA 1HDTH 4E7RG 1C5SA 1SGDE 2ZDKA 1QB6A 3P70B 1AQ7A 1GCDA 1O2QA 3QZQA 4Q7YA 2TPIZ 2R0KA 4HI3A 3QGJA 4BTTB 1GJ7B 4B2BA 1FY3A 3LOXA 1O2KA 2OP9A 5C67A 4X1QU 2EC9H 1JXPA 3PM3A 2XWAA 1P05A 1GI4A 1C9TA 1ZMLA 1GJ4H 3A86A 4OS4A 4YESB 1OP0A 1KY9A 1ZZZA 2FTLE 2QXHA 3RP2A 5EQQA 3RXTA 1RTFB 2GCTC 1THRH 3LGYA 4BNRA 2HNTF 2QV1A 1T31A 1HAHH 1QJ6B 5CHAC 2AH4X 1BTZA 5TJXA 1O3NA 2ANWA 4E05H 1ZMJA 2FOFA 3GCNA 4OS1A 2FS8A 1TIOA 3S9CA 2WPHS 5GXPA 1DX5M 3DA9B 3KQEA 2ZHEH 1Z8RA 2Y7XA 2AGEX 5C3NA 4F4OC 5GIBA 2XC0A 3M7UA 1K9OE 1SGYE 3M37A 2W3KA 1B7XB 3W95A 1BMMH 2AMDA 1P04A 3PO1C 1QTFA 3RXCA 2WV5A 1RJXB 3BIUH 2AGIX 1GJBB 4FU7A 3LPRA 1GBIA 4SGAE 5B6OA 4X6PA 1BMNH 2CGAA 1SHHB 1O5CB 4KP0A 1LTOA 1V2PT 1E35B 1V2ST 1QR3E 1CHOG 2ZP0H 3UNSA 1ABIH 1VR1H 3GY6A 4KTSA 1PPBH 4BXWA 3STJA 1PJPA 1O35A 1AGJA 3M36A 3RC4A 1QFKH 2VH0A 2G55A 2AS9A 2F9PA 3UPEA 1MAYA 1H4WA 1DWEH 3NWUA 3TGIE 1GI9B 1P03A 2ULLA 1F2SE 1RD3B 1O3MA 4AORA 1C4V2 1HXEH 1BIOA 3UUZA 3SZNA 1C1RA 4IC5A 1UCYE 1FV9A 1SFQB 1EPTA 1YGCH 2WYJA 4JZIA 3M7QA 3M5NA 4RKOB 3UFAA 4RN6A 1SBWA 3SBKA 1ZRBA 2ZC9H 3UQVA 1GJ8B 3VB5A 2J92A 4UFDH 4ASHA 1HFDA 3URDA 2PHBA 2UUYA 1OOKB 4NFEA 4R0IA 2W7SA 1IQJA 3EQ0H 3NZIA 1RTLA 1JRSA 4MPUA 1MBMA 3TLOA 2WUCA 3ZZ7A 5E8EH 1NC6A 1UVUH 4DVAU 5A8YA 1LQEA 4INKA 5EGMA 4UONA 5EOKA 3P8OA 3L6PA 1V2JT 3KF2A 3A87A 3F1SB 4ABGA 4A1VA 3P6ZB 3SORA 1QBOA 2JETB 5GWZA 2SGFE 4BANB 2PSYA 1YLCA 4BXSA 3TGKE 5AF9H 2ZZUH 1P3EA 3MH6A 1ELCA 1LHDH 1SR5C 2G8TA 3ZVCA 3SO3A 1H9HE 1F92A 1CA8B 1DS2E 2V3OH 3I29A 3SU4A 3UR6A 3B8JA 3RDZA 4TY6A 5T6DA 3FAOA 2NU0E 1GWAA 1AMHA 4Y79A 8KME2 2K1QA 2VWNA 5AFYH 1FAKH 2SNWA 3W94A 1CT4E 3R0FA 2G51A 2CF8H 1FXYA 4WWYA 2GT8A 1IQNA 2P3FH 2ANYA 3SQHE 2FDAA 2O8TA 4I8JA 1QRZA 4LOYH 1SLXB 8ESTE 1P2OA 1KXBA 2BDCA 4ZKSU 3GY2A 4TWYA 4DIHH 1T8LA 4H4FA 4A5TS 3QUMP 1SHYA 5C2ZA 3LU9B 1O2HA 3QX5H 1Y5BT 1KXDA 1QL8A 1P2MA 4B1TA 2ZTYA 4B2CA 3ZV9A 1GI5A 1O3LA 3MO6A 1TGTA 1EQ9A 2AFQB 1EUFA 4UE7H 4Y0ZE 2QXIA 4ZKRU 1TX7A 4JMYA 1PYTC 1WU1A 2ILNA 3ESTA 1JIRA 1UVPA 2ZDVH 9ESTA 1Y3WA 2GMTB 1HAXB 2VIPA 1V2WT 1GI6A 3ITIA 5LGOA 1LVMA 1AVWA 1FY5A 2FI4E 2ZIQH 3B9FH 1W13U 4BOHA 3RXVA 3ZVBA 2A1DB 2H1UA 2ZO3H 3SGAE 4AGJA 1AKSB 1O3EA 5K7RA 3P92A 1FPHH 1GHWH 2P93A 1GBDA 5I25A 1MTWA 1S0RA 1YPLH 2SGEE 2W7UA 1HYLA 1ZSJA 3KQBA 5DO4H 2FO9A 3PV4A 1CBWC 1AIXH 1C2MA 1DDJA 3RMNH 1GBKA 1PQ7A 2WV4A 2FI3E 4H6TA 1GHBF 4ZHAA 4NSYA 3RXKA 2HVXA 1EATA 1TX6A 5EPYA 2G4TA 3FFGA 1C4Y2 2R3YA 1CO7E 1A1RA 2WPJS 3QGNB 1MTNC 2OC8A 2OUAA 4WH8A 2QA9E 4NG9H 4JZFH 1YM0A 1SOTA 3F68H 3MH7A 4A1XA 5HYOA 1S6HA 4ZKNU 3UOUA 2GGVB 4Z0KA 2ZTXA 3EGKH 2BTCE 1DXPA 4PROA 3TJOA 9LPRA 1TRMA 1Z6EA 3H5CB 3K6ZA 4AZ2B 4GPGA 2QF3A 1K1JA 2ZHFH 1B5GH 4INHA 1C5QA 2A45B 1O37A 1NRPH 1IQMA 1UK4A 1C5TA 2A5AA 4XE4A 1BRCE 1ZPCA 4TPIZ 4CHAB 1A61H 1YKTA 3RXDA 2EI7A 3T29A 3BG4C 1GJ9B 3U8RH 1SGCA 1WQVH 2BYAX 3DT0H 4B73A 1ANEA 1BBRH 3A84A 1LVYA 1G3BA 1QB1A 3UTUH 4D7GA 3SGQE 4AN7A 2ZFTA 4FU9A 1C2IA 1WBGB 3RC6A 2Z9LA 1T8MA 2ZQ1A 2GZ9A 5J4SA 5LH8A 2CHAC 1P01A 1W14U 3BTHE 2NU1E 1BQYA 4DJZB 1W0ZU 1V2OT 3LIWA 1MKWH 1HXFH 1C1TA 3HKJB 1ZRKA 3U1JB 1TPSA 3LJJA 3QO6A 5DP9A 4Y7AA 1W2KH 3M5MA 2A7HA 2F83A 4MG3A 1HIAB 1CT0E 1AN1E 4D8NA 1N8OC 1AD8H 1ABJH 1XKBC 1XXFA 1DM4B 5CMXH 3ZZ3A 1TALA 2XRCA 1C1NA 4KELA 3VGCB 3RLYH 4JZDH 4QT8C 2ALVA 3OYPA 2BY5X 2G00A 2V6NA 6GCHG 1UCYK 7KMEH 2P3TB 2STAE 1XUHA 1HRTH 2QXGA 1BB0B 7GCHF 2J34A 2KAIB 1F0SA 1B0EA 1PPEE 3ZZAA 3SV7A 3UQOA 2TGDA 2GDDA 1AI8H 3CS0A 2BY9X 4X8SH 3GY7A 5AFZH 1BTYA 2ZFFH 1SSXA 1P2KA 3A83A 3GCOA 5EG4A 1BTXA 4BTIB 1OP8A 1WCZA 1YF4A 1P9UA 5AVDA 1AO5A 3V3MA 4CBNA 3KN2A 1VCPA 4JK5A 1B0FA 5A2MH 1LVOA 1AE5A 5DP3A 3MOCA 3OSYA 5L2ZH 2RDLA 1HB0B 1H9IE 1C5PA 1NZQH 1BJUA 4A92A 3KEEA 3E91A 3E90B 4O3TA 1DITH 8GCHF 5ETXA 1MZAA 1UVSH 4XBBA 4GCHG 3U9AH 4FUBA 4MLFB 1VJ9U 1DWBH 4ZHLU 2FODA