1G3EA

Bovine beta-trypsin bound to para-amidino schiff-base copper (ii) chelate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title X-ray crystallographic analyses of complexes between bovine beta-trypsin and Schiff base copper(II) or iron(III) chelates.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3eA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3eA02
4YO9A 2ZPRA 1GJ4H 1TE0A 4ABJA 1A3EH 2OC8A 1O2XA 1NPMA 4WMEA 4A7IB 5E2OA 4F49A 1GI4A 1LPGB 3GDVA 2AMQA 3SJ8A 1TIOA 4A5TS 3SO3A 3GDSA 1GJ6A 1FN6A 1NTPA 4NFFA 2BLVA 5AFZH 1EAUA 4NSVA 1XVMA 4OS4A 1GI3A 1GHAF 1Z6EA 3W94A 1K21H 3TLOA 3RXKA 4KTCA 4MPWA 1AIXH 1P01A 1QBOA 5DP6A 3SV8A 4YOIA 4IS5A 4THNH 3MH7A 4GHTA 3BIVH 4B71A 5LPEA 3SGAE 1P11E 3ZVDA 4Y8YA 2SGAA 5DO4H 1BDAA 1P2MA 1HB0B 1MTSA 1PFXC 3TPIZ 2ZU3A 1O3NA 1EJAA 3STJA 2SNVA 1KXAA 5ETXA 1TGBA 2Y5GA 1C2MA 1GI6A 1O2WA 1ZRBA 1AKSB 2ZZUH 1JOUB 4UDWH 1QQUA 1ZTKA 2FP7B 3ATLA 3O8CA 1HGTH 2Y82A 1ZJKA 4BTUB 1EZSC 1GL0E 1C2KA 1XX9A 2FOHA 5T3HA 2CMYA 4X6OA 1HJAC 3QK1A 3ZVCA 2JH0D 2RA3A 1GJAB 1W8BH 1YKTA 1IAUA 3RMMH 2F91A 3E8LA 3GCHB 2WUBA 1ELCA 2Y7XA 3UR9A 3BTGE 1KDQA 1M9UA 2STBE 4UONA 3ZZ4A 2OCVB 1KLTA 1FONA 3SHCH 2FPZA 5JB9S 1O2ZA 4INLA 3LPRA 2BD4A 1HAYB 1O3LA 3E1XB 1AWHB 4UD9H 3ZVAA 1O31A 1Q3XA 8LPRA 1FI8A 1EZXC 1W10U 1OWDA 1ZSKA 1ZGVA 4MPXA 3RXPA 4VGCC 4ASHA 4CH2B 1P2NA 4DOQA 1LQEA 2ZU2A 5ESBA 3FAOA 1INCA 4ABFA 2WPLS 2OBOA 2G8TA 1C5SA 1C5PA 1T8NA 3OYPA 3PWBA 2BQ7B 3H7OA 5CHAB 1UVOA 3LH3A 1GBTA 1FXYA 3M3VA 2PFEA 5JDUB 1A0JA 3L3TA 1LKAA 1WTGH 1J16A 5GDSH 4Y7BA 2KAIB 1BRBE 3BEFB 4OGYA 5DPAA 2VH6A 1VZQH 3MU0A 2GCTB 5L2YH 2BDCA 1KXBA 4WXVA 2A45B 3U69H 1DANH 1GJ9B 1B0FA 1C5WB 2HPQH 1T4UH 3Q3XA 5C1UA 2JH6D 1LHGH 1ZYOA 3JZ1B 1FAXA 3ZVFA 2FYRA 2STAE 1AMHA 1F0UA 1Y3YA 4YT7H 1W14U 2ZGHA 1C4Y2 1MTNB 1QFKH 3DHKH 3M3TA 1UTPA 2ANKH 3SU2A 2H2ZA 1WUNH 1BBRE 3RXRA 4KGAA 1BMMH 5DKMA 5EXLA 3B23B 2F9VA 2XC0A 1UTOA 4X1RU 1HIAA 3MI4A 1OP2A 1DITH 1GVKB 4RKJB 3NUMA 2EI6A 2NU3E 2ZHWH 2AGIX 1OWHA 2VIWA 1RTKA 3RUOA 6CHAB 3U1IB 1DE7H 1BUIA 1UCYE 3P95A 3A8CA 4Q7ZA 3ZV8A 4Z6AH 3SHAH 4ABGA 1O2NA 4JZFH 3ZV9A 1TPAE 2C8ZB 4UEHH 1F0TA 2ILNA 1ELEE 1G9IE 1Y3VA 3QWCH 3SN8A 3QX5H 2ZCHP 4DCDA 4YESB 1VJ9U 1C1WH 3QZRA 4CRFA 1NZQH 5FX6A 2PW8H 3TU7H 1S81A 2ZIQH 4E06H 3GY2A 5GIBA 2ZDVH 1BRAA 4TPYA 4BTTB 1V2LT 4BNRA 2ZGJA 5DP9A 1DVAH 1SGCA 3FZDA 1OYQA 1TNLA 3ZYDA 3CS7A 2VIQA 1BCUH 1CGJE 3DT0H 1ESBA 3HPTB 3GCOA 1HV7A 3QUMP 1FV9A 3EA7A 3LIWA 3CP7A 3K2UA 1ELTA 2FTMA 2PKSC 3E90B 3TNTA 1G32B 4TY6A 3RC6A 3RXDA 3U8OH 3IWMA 4KTUA 1O3GA 2PSYA 1WQSA 4AYYB 4HI3A 1TWXB 2ANYA 1L0ZA 1O2UA 3BTQE 1DY8A 1SGNE 3EE0B 3DFJA 4ESTE 3E6PH 4ABAA 1F92A 2ZTXA 5EXMA 4FXGH 1XUKA 1F5RA 4Y8ZA 1KXCA 3M5NA 3Q3YA 2FS8A 2TBSA 2YNAA 1WBGB 1EB2A 2BZ6H 4MPVA 2TGPZ 5C1YA 2G5VA 3KL6A 1O3FA 3ATIA 1C1QA 3U8TH 1SSXA 2AMPA 1HDTH 3UNRA 2BD5A 3P8GA 4FUFA 4I33A 1GBJA 1C5OH 1DXWA 1L4DA 1XUHA 1IQGA 3T29A 1BTWA 1N6YA 1SHHB 1GG6C 2R2MB 3LH1A 1SGFA 1ZMJA 1TRYA 2OTVA 3BTEE 4M7GA 3L33A 3HATH 3ZZ3A 2O8MA 4ISOA 3OY5U 1HXFH 1Q31A 2G51A 7GCHG 3SNDA 3SU5A 4GPGA 4AGKA 1AFEH 1V2VT 2ZPQA 2WYJA 5T6GA 8KME2 2DE8A 3ZZDA 1F5LA 3ODDA 1SHYA 4KP0A 2FYQA 3RU4D 3UTUH 3BEIB 1E37B 2FI4E 4IN1A 2ZTYA 3P6ZB 4ZHLU 1XUFA 4Y71A 1AUTC 1DLKB 2QN5T 1TPSA 3LJOA 1YGCH 1O2LA 1ZR0A 2GGVB 1F7ZA 3QO6A 4IMZA 1YF4A 1UTKA 5F8TA 5E8EH 3VPKA 2BLWA 4B76A 4BXSA 5C3NA 1TGNA 1UHBA 1F0SA 2ZCLP 4FUDA 2D26C 1UVSH 1GBLA 1O35A 2VJ1A 4B1TA 1O2KA 3VB5A 5L30H 3KIDU 4NZLA 4K2YA 2ZGBH 1GHZA 5FBIA 4Q2KA 2ZF0H 5HGGA 2OC1A 4B75A 1MU6B 1BTZA 3SUEA 1E35B 1SGFG 2V6NA 5J4SA 2GMTC 2H5CA 2ODQA 3ZZAA 4BTIB 4MPUA 1NN6A 2F9UA 2R0LA 3LOXA 4MTBA 1FY3A 1HJ8A 5GCHG 1A5IA 2Q6FA 1C5TA 1GDUA 4BAHB 1LVBA 5ABWA 3QTVH 1ZOMA 2Y5FA 2ZDNA 1SLXB 1W13U 1KLIH 4QT8C 1DLEA 3RXOA 3DFLA 3SORA 1GJBB 4DIHH 1C4V2 2ODYB 3V13A 1A0LA 3GICB 4ISNA 3TK5A 2BX4A 1VJAU 1C2LA 2VWNA 5C5OA 3SV6A 1C5QA 1J8AA 4VGCB 2AFQB 2PKAB 1ELDE 2BQWB 5DP3A 1BMNH 2SFAA 1W7XH 1AZ8A 1GMCG 3RC4A 2H1UA 3IG6B 4CRBA 3FVFB 2ASUB 4JZEH 1DWCH 1OS8A 5C1XA 3T62A 1DWDH 3LC5A 1YLDA 1CBWB 5A0AE 1V2PT 2FESH 3OSYA 3W95A 1SPJA 3ZZ6A 1P57B 1Z8RA 1NM6A 4BAOB 2BLOA 4U30A 4JZ1A 1AVWA 4I32A 1IQLA 1BJVA 4B2BA 1ANDA 1JBUH 4WMDA 1AE5A 2JETB 2BMGB 3Q3KA 2NU1E 4JK6A 3V3MA 1NRSH 1S82A 2ZHFH 3Q77A 1K1PA 1OWJA 4AORA 3D65E 4GCHF 5L6NH 5EG4A 2Y7ZA 3TJVA 2J4IA 5EU8A 1D3PB 1DWEH 2BYAX 3SJOA 1QJ1B 5A8YA 4ABDA 1C5ZB 3AW1A 2WPHS 5TCAA 1QJ6B 2ZU1A 2VVCA 3F9GA 3VXEH 1RFNA 3A82A 4AX9H 1FIZA 4NWKA 4BAKB 3P70B 1SGQE 4IC5A 2ESTE 3LGVA 3BTME 3VB3A 4D76A 1MUEB 4AGJA 2EEKA 4ISLA 3B8JA 3RC5A 2XBYA 1C2DA 2BD7A 1L1NA 2A4QA 2BX3A 2FX4A 2J34A 4ZHMU 4IN2A 1O5BB 4AFSA 1MTWA 2FOBA 1TPPA 2GVFA 3R3GB 1O3HA 2FIRH 2F9OA 2QY0B 3PMAB 2BDHA 1ZZZA 5K7RA 1AI8H 1O3OA 1LQDB 2WPMS 3EDXB 3EAJA 3ODFA 1SR5C 1S0QA 1PJPA 1S83A 2B5TB 1SQAA 3UPEA 2W26A 2Y81A 3SJ9A 4BXWA 5BPEA 1DSUA 2B8OH 1LKBA 3A7WA 3C27B 2FWWA 3LONA 6GCHG 5DJ7A 4X8UH 1O3JA 2VU8E 5JBTA 2J94A 2C93B 1E36B 1NY22 1T8OA 2F9BH 5LPFA 1DUEA 1NS3A 2Z9GA 4MDSA 1ZSLA 3SU3A 1GHXH 4A1TA 1JWTA 4XOJA 1CU1A 5T6FA 1O3CA 3A7VA 1Y5UT 1WYKA 2ZDAH 5GWZA 1ZRKA 1VCQA 2W7UA 1CHOF 4FU9A 3UOPA 4IBLH 5FCKA 1DUAA 4U32A 3SUFA 4AOQA 4INKA 1QRZA 1CSOE 2IN2A 1O3BA 3MMGA 4X0WU 2BD2A 1Y5BT 1K9OE 3LDXH 1THPB 2ZQ1A 1JMOH 4PROA 3T27A 3RM2H 1K1OA 3JZ2B 3BN9A 3K6YA 1MTVA 8GCHG 1TNIA 4A6LA 3VXFH 5E0HA 4O97A 5FCRA 5FPYA 3TK9A 1D3QB 3A85A 1O5DH 1SGYE 2QAAA 3NXPA 1A61H 1P05A 4I7YH 3BSQA 3VB7A 4CREA 1CT4E 1GBHA 1EZQA 3QLPH 2R2WU 4UE7H 1EOLA 1RIWC 1KXEA 3F68H 2FI5E 1XKBC 3M35A 4BAQB 1YPMH 4FVDA 3A87A 1SLUB 3MHWU 2FDAA 1DS2E 4WY3A 4Y8XA 1C1TA 1C1OA 3RXEA 3EA9A 3LKWA 1TX6A 3MWIU 1Z1JA 5DGJA 2Z9JA 1G3CA 2AS9A 1SFQB 1XMNB 2XW9A 2LNCA 2OINA 1C1VH 3GCTF 3GOVB 3SNAA 2GV7A 2Z6BD 1S84A 3SU1A 1DWBH 1QGFA 3EA8A 1UO6A 4Y11E 1EATA 3O8RA 1W0YH 1QTFA 3DA9B 1T32A 1KDQB 3TJOA 2GCHF 1OWKA 2M5TA 1HPGA 2GV6A 1NFXA 2XYAA 2HNTC 1C5RA 2CV3A 1G2LA 4JYVH 3HKIB 1FPCH 1GHVH 2VWLA 1DICA 2FI3E 2FX6A 4Y7AA 5C67A 1OYTH 3RXLA 1AQ7A 5JBAS 4D8NA 1EJNA 5C5NA 4Y0YE 1T8LA 4MNWA 1P2KA 1T7CA 5JYIA 2SNWA 3GISB 5JBCS 1D3DB 1ELVA 1PYTC 3FP7E 1BHXB 1KTSB 4X1PU 2JH5D 4K69A 2CF9H 3WY8A 2BHGA 2WPIS 1CE5A 4ZH8A 4Y76A 2VWMA 1H9LB 2CHAB 3NZIA 4CRDA 2O8UA 3P17H 4RN6A 1O2VA 5FPSA 1GMHF 3QZQA 4NSYA 4X8SH 5LH8A 3ZYEA 1L1GA 2Z7FE 2VINA 1AU8A 1CQQA 1BTUA 4O3UA 5C2ZA 3MFJA 3CENA 2ZFFH 2P3FH 1O5EH 3RLWH 4YLQH 1JIMA 4NIVA 1NFUA 2RCEA 2VIDA 1AVGH 2P8OB 1VR1H 3MNBA 1DT2A 1IQEA 2CN0H 2BXUH 3CS0A 3A86A 2OUAA 1YCPM 2J95A 1DSTA 3PTBA 2G55A 3M37A 3A83A 4XE4A 1IQFA 1ZPCA 3BIUH 3RXGA 1K1LA 2ZDLA 3SGQE 1C1UH 1CGHA 2Z9KA 5E0GA 3GY5A 1SGPE 1O33A 3KN2A 2D8WA 3MNXA 2BY6X 1FDPA 2BD3A 2FXRA 3RXJA 3S9AA 2ZGXH 3BV9B 1C2EA 1HIAB 4XSKU 2QF0A 3E91A 1BRUP 1UTMA 4FUGA 4X2VA 1V2QT 1AKSA 1ZGIA 5AVDA 4K8BA 5HM2A 4B2AA 1C9PA 1S5SA 5EQSA 3RXSA 3SUDA 1TX7A 1AFQB 2FLBH 2PV9B 5DP8A 3U98H 1C2FA 1GBAA 3MNSA 2BB4A 3SU0A 4ZKOU 2ZDMA 2O9QA 1SOTA 1C2GA 3GDUA 1ORFA 3GY3A 1YM0A 1YCPK 1ABJH 1MAXA 3LGUA 2H9HA 1ZTJA 3BG4B 2OBQA 1CO7E 3ELAH 3K65B 3LJJA 2F3CE 2BD9A 2EA3A 3MNCA 2J9NA 3EGKH 3TJUA 2XCNA 1KTTB 3RXCA 3IITA 3ZZ9A 1C4U2 2B7DH 1DDJA 1O2JA 1P2JA 2EI7A 1MMJN 4NA8A 3GYMA 3PMHB 1EAWA 3NK8A 2ZU5A 3PMBB 4ZXXH 1J9CH 1AWFH 1TBRH 3PV4A 1PQ8A 3BG8A 1WSSH 3UNSA 3TGKE 1W7GH 5LGOA 2QGRA 4MVNA 1HAVA 2HVXA 2BOKA 5DG6A 4CRAA 1P3EA 4U2WA 1GMDG 3LGWA 3SBKA 1MH0A 2AH4X 3MO9A 1GBFA 3SJIA 1DXPA 4UFDH 4X6MA 4DJZB 1O39A 1O36A 5FBEA 1HJ9A 3S69A 2ZFQH 3BTWE 1P2QA 2V3OH 3D62A 4DVAU 1XXDA 1YPHE 1GJCB 1G2MA 2KAIA 1GWAA 4NIXA 2AGGX 4DGJA 3S9CA 5EGMA 2GD4B 2H6MA 1GGDB 5HM9A 2D1JA 1QL7A 3P8OA 5FPTA 3SU6A 1OSSA 1TGSZ 4KTSA 3PLKA 5AF9H 3S9BA 2P3UB 2EC9H 1B5GH 1W11U 2VIPA 3ATKA 2LPRA 3MU4A 4DY7B 1YPLH 2QC2A 1MCVA 1NU7B 1TYNA 2K1QA 1ZTLA 1FIWA 1MKWK 4FUEA 3BF6H 3OY6U 3RXAA 2QIQA 1FAKH 3OTJE 1AE8H 2ANMH 4X1NU 7ESTE 3GY4A 5DP4A 1CA8B 1ELAA 1GJ5H 3F1SB 3M7UA 2AIQA 3M36A 3UFAA 1AO5A 1PYTD 2ZU4A 4BAMB 2AMDA 2OLGA 3RXVA 4NWLA 1HRTH 2W3KA 3M5LA 1HAOH 1Z8GA 4DW2U 1QRXA 3A8DA 3UOUA 1EAIA 1UHBB 2BY8X 2VGCC 3N7OA 2FZZA 3BTTE 1GBIA 4WWYA 1P2IA 1AZZA 1TMTH 1C2IA 4A1VA 1HUTH 1D6RA 1QL9A 1YPEH 3SJKA 1TGCA 3TH2H 2GP9B 4ISIH 1BTXA 2GZ7A 2PWXA 1LHFH 2XCFA 9ESTA 5HMAA 4ABHA 4D9QA 4WF8A 2ZCKP 1QB1A 1V2UT 3E0PB 2BDBA 4X6NA 1NC6A 1IQIA 1VITF 5JB8S 1BHXF 4CHAC 1O38A 3M7QA 1YPHC 1OX1A 2UUYA 4X8VH 4NIWA 2WUCA 2Y80A 2BY9X 2GX4A 1EPTA 2ZI2H 2NU4E 3A81A 1O2SA 2FOGA 1O3PB 1O2TA 2XC4A 1EX3A 1AB9C 1J14A 5HXFA 1NRRH 2ZGCA 5A8XA 1KIGH 3KHVA 4BOHA 5IYTA 1QB6A 1HJAB 2UWPA 3PO1C 3O8BA 4OS1A 3ZZ8A 4K1SA 5JPMH 3ATWA 3U9AH 1UK2A 1AN1E 1P0SH 4GUXA 1UTJA 2RDLA 4R8TB 2FS9A 3NPSA 1F5KU 4YLUA 1DFPA 1YCPH 1GBCA 1SBWA 1KY9A 2A4OA 3HGPA 4MLFB 1WAYB 1A7SA 2BVSH 3P8NA 1O5CB 1ID5H 2HPPH 1DY9A 1H1BA 3NKKA 1GDNA 1MTUA 2DE9A 1Y3XA 2BD8A 3RXMA 1S85A 1WOFA 1EXFA 1N8OC 2GT7A 3EQ0H 1Z8IB 1HCGA 1SL3A 1QQ4A 3AASA 3ZVEA 2A7CA 9LPRA 2A31A 1BMLA 5IDKA 3A7TA 1YBWA 1GBBA 4XDEA 1ANBA 1KXDA 1QJ7B 1FUJA 1W0ZU 2OXSA 2UUJB 1CA0C 1ANCA 1NROH 1ZHMA 1ETRH 2PLXA 3A8BA 4K5ZA 3HK6B 1ARCA 1QBNA 2AEIH 1V2JT 3SV2H 1HXEH 4ZMAH 1GI9B 1CT2E 4YOJA 2HALA 1MQ5A 1C5MD 3ZZ5A 2HGTH 1TGTA 4MNYA 1EP5A 2V35A 2QXJA 2VVUA 1EJMA 4TYDA 1P9UA 1BTHH 4FUIA 4Q7XA 1Y3WA 1NRQH 4YM9A 4FU8A 1A5GH 1IQJA 1C9TA 2F83A 1FY8E 1P06A 2XWAA 1GBKA 3STIA 2XXLA 1PQ7A 1TFXA 3KF2A 4ZKNU 1W3CA 2CXVA 1LVMA 2PTCE 1P03A 3RXBA 1SC8U 7GCHF 1FMGA 1FY4A 1OP8A 4CBOA 1TPOA 1E38B 2YNBA 4HZHA 1O2GH 1A5HA 1SQTA 3LGIA 2ZG0H 3T5FH 2ODPA 1EKBB 4GAWA 4CRGA 2SGEE 2C3SA 5BRRE 1HAIH 1P10A 3RXIA 1UVTH 1ETTH 4K3JA 4A1XA 1QA0A 4OGXA 4FU7A 3KQEA 1O3EA 1MCTA 4JZDH 3KQDA 4JZIA 2BVRH 3R0FA 3QN7A 2XNIA 1LMWB 1ACBE 3A89A 2A2QH 1DM4B 1P02A 1C1RA 1TNJA 2QF3A 2R3YA 3Q00A 1QRWA 1O30A 2PR3A 3V7TA 2WV5A 1BITA 1ZJDA 2PHBA 3I78A 1UTNA 2A7JA 1GHAG 2G00A 1K1NA 4NCYA 1LPZB 1IOEA 1TAWA 3HKJB 2H9EH 5GCHF 4E7NA 1HNEE 1PPZA 5TCCA 1A4WH 4NGAH 1BTPA 1S6HA 5DP7A 1UK3A 3TH3H 1O5GH 2VH0A 2SGQE 1NRNH 1F2SE 1VGCC 3F9EA 1MTNC 1JIRA 3MU8A 4FUHA 3PYHA 3SI3H 1PPFE 2PKSB 1GHYH 2C8WB 2ZP0H 2G5NA 1VCWA 2BXTH 1ZMNA 4Y10E 1KSNA 4YTAA 1YP9A 4X6PA 1QURH 1FY5A 1PPHE 2ZFTA 1LHDH 1V2TT 1ZMLA 1FNIA 1GMCF 1EUFA 1TLDA 2I6QA 1H8DH 3QGJA 2I6SA 1C1NA 4X2YA 2ZQ2A 3P8FA 3M7TA 3VB4A 1UK4A 3OU0A 5G4BA 1T4VH 1W12U 4ZKRU 2QCYA 4JK5A 1GMHG 1MQ6A 1V2ST 2WPKS 2CF8H 3PTNA 2ZO3H 1GHBF 2ZFRH 1TOCB 2ANWA 2GZ8A 1SB1H 1ZHPA 4OS6A 3SZNA 1EB1H 3URDA 2VVVA 5EW1H 1YPJH 1GI2A 4WJG2 1ELFA 2IOTA 3RXFA 1GG6B 5EW2H 1QIXB 7LPRA 2FLRH 5JBBS 3TGJE 2FOCA 2ZTZA 5I25A 1AGJA 4I8KA 3K6ZA 1RJXB 1TQ0B 2BDAA 1GJ7B 2Z3CA 1T31A 1EPTC 2Y5HA 1O2PA 1MKXK 4A92A 3PLPA 1MZDA 4TWWA 3VB6A 5H4IB 1ZHRA 1BZXE 1MZAA 5DP5A 1C5YB 1LHEH 3RXUA 3UR6A 1D6WA 2QXIA 3B9FH 3A7XA 4JYTA 4WH6A 5FXLA 1DPOA 4X2WA 1O5FH 3SV9A 4ZXYH 2HLCA 1AUJA 2SGPE 1AHTH 2FOFA 4I8JA 1C2JA 3MO3A 4AB9A 1GBMA 2HWLB 3K9XB 4Y6DA 3Q76A 1BMAA 2F9NA 2BDGA 1SI5H 3RU4E 3SW2B 4Y79A 1UJ1A 1GVLA 2GMTB 1VITH 2FO9A 1TMBH 2A5IA 1K1MA 3D49H 6GCHF 2UWLA 1S6FA 1IQNA 4UFEH 3F9HA 1C5NH 2O8TA 3E3TA 3KCGH 2A4RA 3ZZCA 4B73A 5ESTE 1N8OB 1Q2WA 2O8LA 2VB0A 1G30B 4MQAA 1NFWA 4JCNA 1JRTA 1Y8TA 5K0HA 4D9RA 2H5DA 1IQMA 4AG2A 3BTHE 2ZECA 3PB1E 4NFEA 4O3TA 1WTHD 2BVXH 1C5VA 1V2MT 1LDTT 4X1SU 2R0KA 3RM0H 4K1EA 1CA0B 1IQHA 4ZROA 2PUXB 2QYIA 1NO9H 2WYGA 1B7XB 2FMJA 3TIUA 4AG1A 4ZHAA 3MH5A 5FX5A 1H9HE 1OOKB 4NIYA 5AHGH 4U01A 1HAGE 4OS2A 5C20A 1A0HB 4XBDA 3RP2A 8GCHF 1AVXA 4H6SB 3UWIA 2QV1A 3AW0A 2AIPA 3M5MA 3NWUA 2VIOA 1PQ5A 1E0FD 1OXGA 4XFQA 3UQVA 4B74A 4GLYA 4AFQA 1HFDA 2FOMB 2OP9A 4KELA 4AZ2B 1ZSJA 1O3IA 3AAUA 1SLVB 3LU9B 2W7SA 4TPIZ 2P16A 3SOSA 4UFGH 3UIRA 4IGDA 2ULLA 2J38A 4AFZA 4FUJA 3RXHA 3RDZA 2RA0A 5FAHA 1HAVB 1FPHH 2R3UA 4CR5A 2QXHA 5GPIB 1TOMH 1XVOA 3RU4T 1RGQA 1V2WT 4YZUA 3UQOA 3HK3B 3ZZ7A 2J2UA 1UVPA 1MBMA 3O8DA 4K60A 3M61U 4CH8B 1CBWC 4FVBA 4TY7A 4K8YA 1O3MA 1HLTH 1DX5M 4KKDA 2R9PA 4BANB 1QBVH 1SGEE 5LPRA 1O2OA 2VWOA 5A09A 3RMOH 5EQQA 3SNCA 2JETC 4HTCH 2A5KA 4NG9H 3MO6A 2BQ6B 5EXNA 2NWNA 4IC6A 4Y0ZE 1P2OA 4X1QU 1PPGE 2FM2A 1SLWB 4J1YA 4J2YB 1IQKA 1FZZA 3DD2H 1TNHA 1TABE 2GTBA 3ZVBA 3GCNA 4MNXA 1O3AA 1VGCB 1MKXH 3NCLA 3I29A 1SQOA 1NRPH 1TA6A 1VITG 1NESE 7KMEH 1N1LA 3QDZB 3DUXH 3H7TA 3PM3A 3EYDA 2WINI 1LPKB 5CE1A 4F4OC 2G81E 3RLYH 1J15A 1UTLM 1MU8B 1OP0A 3FZZA 3LGYA 5J4QA 3FP8E 6ESTA 2OC0A 4AFUA 5GJ4B 1IHTH 2B0FA 3P92A 1GCDA 2QXGA 1BRCE 2XBXA 1A3BH 1O34A 2P3TB 1SGDE 4NA7A 1P3CA 1HAHH 2G4UA 1H4WA 1PQAA 1CHGA 2VNTA 2D2DA 1SVPA 1Z7KA 1EOJA 3VFEA 8ESTE 3MOCA 4DIIH 2TRMA 1NT1A 1TRNA 1H8IH 2TGDA 1KXFA 4CRCA 3MYWA 5GXPA 1HAXB 4H4FA 1WQVH 1V3XA 2A5AA 4H42U 1ZLRA 1ZPZA 2FOEA 2Q6GA 2XWBI 2A1DB 2BM2A 4ABEA 3KQBA 1GVZA 3MU1A 3V0XA 1VCPA 3ZZBA 4H6TA 1O2QA 1RIWB 3QGNB 4MG3A 2OC7A 1C5XB 1K1JA 1Z8JB 5FHTA 4OS5A 3A8AA 1GBDA 3SQEE 1TNGA 1NFYA 2SGDE 2IPHA 2NU0E 1KLJH 1HBTH 1EPTB 3SGBE 2ZKSA 3BTFE 5L2ZH 1Y5AT 2CGAA 2FTLE 3ATMA 4IMQA 4LZ4B 5PTPA 1RTFB 2Q6DA 1D4PB 1BJUA 1EAXA 2AERH 5A8ZA 3GY7A 3L6PA 3BTKE 3D23A 1O2HA 1SMFE 3VGCC 2ZC9H 1BT7A 2Z3DA 2BZAA 2P95A 2F9PA 1HAZB 4NZQA 3MU5A 2A2XH 1SFIA 2ZFSA 4E05H 1H9IE 4XBCA 1B0EA 2B9LA 2BY7X 5T6DA 3A7ZA 1GDQA 2Z9LA 4DT7B 3TVJB 1GJDB 1K22H 3PROA 3A80A 4JMYA 1D9IA 1QL8A 1MBQA 3MTYA 4NA9H 1PPCE 2BTCE 4GCHG 2PUQH 1TBZH 1GCTC 1FY1A 1SGRE 1OKXA 1LVOA 2G52A 3T26A 1C1PA 1O2RA 2GDEH 1YC0A 3KEEA 1XM1A 2TGTA 1T8MA 1BA8B 2AGEX 1ESTA 1FQ3A 1N6XA 3AVZA 4RSPA 3OX7U 4UFFH 4WXIA 2UUFB 1L2EA 1BBRK 1C2HA 3GY8A 1EP6A 2IJOB 1JXPA 4D7FA 1SGTA 3SV7A 1GMDF 2P94A 2BDIA 2HOBA 1ABIH 1TNKA 1A46H 1P04A 3T25A 2BDYA 2BOHB 1QHRB 1V2NT 4WH8A 4XBBA 5F8ZA 2Z3EA 3PLBA 1WV7H 1TQ7B 1TB6H 2VIVA 1YLCA 3RMLH 2ZHEH 2JKHA 3T2NA 1XUJA 1FN8A 1MD7A 3BEUA 2ZNKH 3SNEA 3FANA 3LC3A 2O8WA 5EOKA 2RG3A 1UCYK 1PPEE 1XXFA 1V2RT 1TONA 4X2XA 1D3TB 2A7HA 1LTOA 1HAPH 4TWYA 4I8LA 2ZFPH 1O3KA 3UY9A 2G4TA 2V0BA 2NU2E 1TBQH 1G3EA 1O32A 1THRH 5EPYA 2W3IA 1EASA 2GT8A 2UUKB 2FOAA 3TJNA 4DURA 4O03A 1RS0A 2Y6TA 4SGBE 1YPGH 4K1TA 3UWJH 1XUGA 2ZHDA 1ANEA 1A1RA 1P8VC 1S0RA 2Z9IA 3PMJA 1THSH 3KQCA 1Y59T 3G01A 3M5OA 4AN7A 1L1JA 5HYOA 2XTTB 3ESTA 1L4ZA 2P59A 3BTDE 1CHOG 1KYNA 1G36A 2Z94A 3SI4H 1LO6A 2GKVE 2WV4A 4R0IA 2CHAC 2P93A 3UNQA 1BIOA 2ALPA 1NU9A 4GVUA 2QA9E 1UTQA 1ESAA 1O2MA 2FEQH 4X8TH 3GYLB 1GHWH 1TALA 3GCHC 1FLEE 2PTNA 1RTLA 1U6QA 3GY6A 1C1SA 3MH4A 1G37A 4INHA 4JYUH 3SUGA 1DOJA 4ABBA 2J92A 5TJXA 1OWIA 4IW4E 1GHBG 2DUCA 2P8OC 1EZUC 1O2IA 2C4FH 1MKWH 2OQ5A 1Z71A 2A4GA 2Q1JA 3F6UH 2GZ9A 2XC5A 1IHSH 3SU4A 1GJ8B 1FJSA 1AD8H 3TGIE 1TMUH 4MNVA 4GSOA 3QTOH 4O9VA 2H9TH 4Z0KA 1SOZA 3URCA 1W2KH 1ARBA 1JRSA 1QA7A 3S7KB 5E0JA 1AY6H 1RRKA 5CHAC 2PKAA 1YYY1 3A84A 4Q7YA 3AAVA 3KNXA 1G3DA 1O5AB 3LT3A 1CVWH 1G3BA 3S7HB 2TPIZ 1XUIA 2TGAA 1E34B 5EPNA 1GI0A 2GCTC 1C1MA 1O37A 1SG8B 4LZ1H 1AFQC 5A0CA 3GCTG 6LPRA 4RKOB 4ISHH 5A0BA 2SGFE 3T28A 4FUCA 2CJIA 1Z6JH 1O2YA 1ELBA 2GCHG 1O0DH 4FUBA 3UUZA 2THFB 3BG4C 3M3SA 3C1KA 1C5UA 1UVUH 1Z1IA 5AFYH 4SGAE 1K1IA 2A32A 1QCPA 1C5LH 1LCYA 4Q80A 5F03A 3S0NA 4I8HA 4OS7A 3ENSB 1GBEA 5EODA 5B6OA 3RXQA 1F0RA 2V3HH 3E0NB 1OWEA 2GDDA 5SGAE 1UMAH 3U8RH 2BY5X 1ETSH 1QB9A 2C90B 2UWOA 3FFGA 3ZVGA 1X7AC 2A0QB 1BQYA 1QR3E 4AB8A 4HGCA 5F6MA 1QY6A 1BBRH 1QNJA 5CMXH 2C8YB 2ZDKA 1BTYA 2XRCA 2XBVA 4ABIA 3TNSA 1GI7B 1SGIB 2AYWA 1EQ9A 2OQUA 1WU1A 1K2I1 6CHAC 3H5CB 1P09A 2ZWLH 2HNTE 1CT0E 2ZEBA 1K28D 4CBNA 2FODA 2ZPSA 3I77A 2VGCB 3A88A 3A7YA 3PWCA 2PGQB 4ZKSU 4LOYH 3RMNH 4D7GA 1YPKH 3TH4H 1LHCH 2ZA5A 4YOGA 2BLQA 5A2MH 4YT6H 3VGCB 4DG4A 1UCYH 2PGBB 1PPBH 2HNTF 3FP6E 1V6DA 1RD3B 1J17T 4E7RG 2XBWA 1Y3UA 3TK6A 1RXPA 1WCZA 4LXBH 1GPZA 1GGDC 1BB0B 2EI8A 1XKAC 1HYLA 2HRVA 1MAYA 5E2PA 2ZHQH 1P12E 3F9FA 2ALVA 5F8XA 1MD8A 3UREA 1ELGA 1ZPBA 3ITIA 1LVYA 1V2KT 4GHQA 3LGTA 3KGPA 3E16B 1GCTB 4CHAB 4ZAEA 3TITA 1O3DA 2TIOA 4WMFA 1CGIE 4I8GA 5I46H 3HGNA 5EQRA 4AYVB 2W5EA 1OPHB 5DK1A 1BOQA 1GI5A 1GL1A 1GI8B 3U1JB 1P9SA 2OD3B 4HFPB 1TA2A 3MH6A 1AB9B 2YOLA 4CR9A 4ZUHA 4LK4A 1TRMA 1V2OT 3SNBA 1GI1A 2PSXA 3SQHE 3VEQB 2C8XB 1A2CH 4B2CA 3RXTA 3PO1B 4I31A 2WPJS 1TX8A 3V12A 4WVPE
chains in the Genus database with same CATH superfamily
4YO9A 2ZPRA 5GNDA 1GJ4H 1TE0A 4ABJA 1A3EH 2OC8A 1O2XA 1NPMA 4WMEA 4A7IB 5E2OA 4F49A 1GI4A 1LPGB 3GDVA 2AMQA 2IJD1 1TIOA 3SJ8A 4A5TS 3SO3A 3GDSA 1GJ6A 1FN6A 1NTPA 4NFFA 2BLVA 5AFZH 1EAUA 4NSVA 1XVMA 4OS4A 1GI3A 1GHAF 1Z6EA 3W94A 1K21H 2J97A 3TLOA 3RXKA 4KTCA 4MPWA 1AIXH 1P01A 1QBOA 5DP6A 3SV8A 4YOIA 4IS5A 4THNH 3MH7A 5CDFE 4GHTA 3BIVH 4B71A 5LPEA 3SGAE 1P11E 3ZVDA 4Y8YA 2SGAA 5DO4H 1BDAA 1P2MA 1HB0B 1MTSA 1PFXC 4XRNA 3TPIZ 2ZU3A 1O3NA 1EJAA 3STJA 2SNVA 1KXAA 5ETXA 1TGBA 2Y5GA 1C2MA 1GI6A 1O2WA 1ZRBA 1AKSB 2ZZUH 1JOUB 4UDWH 1QQUA 1ZTKA 2FP7B 3OTPA 3ATLA 3O8CA 1HGTH 2Y82A 1ZJKA 4BTUB 3KQ5A 1EZSC 1GL0E 1C2KA 1XX9A 2FOHA 5T3HA 2CMYA 4X6OA 1HJAC 3QK1A 3ZVCA 2JH0D 2RA3A 1GJAB 1W8BH 1YKTA 1IAUA 3RMMH 2F91A 3E8LA 3GCHB 2WUBA 1ELCA 3UAIC 2Y7XA 3UR9A 3BTGE 2YMSD 1KDQA 1M9UA 2STBE 4UONA 3ZZ4A 2OCVB 1KLTA 1FONA 3SHCH 2FPZA 5JB9S 1O2ZA 4INLA 3LPRA 2BD4A 1HAYB 1O3LA 3E1XB 3ZIAD 1AWHB 4UD9H 3ZVAA 1O31A 1Q3XA 8LPRA 1FI8A 1EZXC 1W10U 1OWDA 1ZSKA 2QF4A 1ZGVA 4MPXA 3RXPA 4VGCC 4ASHA 4CH2B 1P2NA 4DOQA 1LQEA 2ZU2A 5ESBA 3FAOA 1INCA 4ABFA 2WPLS 2OBOA 2G8TA 1C5SA 1C5PA 1T8NA 3OYPA 3PWBA 2BQ7B 3H7OA 5CHAB 1UVOA 3LH3A 1GBTA 1FXYA 3M3VA 2PFEA 5JDUB 1A0JA 3L3TA 4I86A 1LKAA 5T1VA 1WTGH 1J16A 5GDSH 4Y7BA 2KAIB 1BRBE 3BEFB 4OGYA 5DPAA 2VH6A 1VZQH 3MU0A 2GCTB 5L2YH 2BDCA 1KXBA 4WXVA 2A45B 3U69H 1DANH 1GJ9B 1B0FA 1C5WB 2HPQH 1T4UH 2YMSB 3Q3XA 5C1UA 2JH6D 1LHGH 1ZYOA 1MABB 1S6LA 3JZ1B 1FAXA 3ZVFA 2FYRA 2STAE 1AMHA 1F0UA 1Y3YA 4YT7H 1W14U 2ZGHA 1C4Y2 1MTNB 1QFKH 3DHKH 3M3TA 1UTPA 2ANKH 3SU2A 2H2ZA 1WUNH 1BBRE 3RXRA 4KGAA 1BMMH 5DKMA 5EXLA 3B23B 2F9VA 2XC0A 1UTOA 4X1RU 1HIAA 3MI4A 1OP2A 1DITH 1GVKB 4RKJB 3NUMA 2EI6A 2NU3E 2ZHWH 2AGIX 1OWHA 2VIWA 1RTKA 3RUOA 6CHAB 3U1IB 1DE7H 1BUIA 1UCYE 3P95A 3A8CA 4Q7ZA 3ZV8A 4Z6AH 3SHAH 4ABGA 1O2NA 4JZFH 3ZV9A 1TPAE 2C8ZB 4UEHH 1F0TA 2ILNA 1ELEE 1G9IE 1Y3VA 4ACBA 3QWCH 3SN8A 3QX5H 2ZCHP 4DCDA 4YESB 1VJ9U 1C1WH 3QZRA 4CRFA 1NZQH 5FX6A 2PW8H 3TU7H 1S81A 2ZIQH 4E06H 3GY2A 5GIBA 2ZDVH 1BRAA 4TPYA 1SKYE 1V2LT 4BNRA 2ZGJA 4BTTB 5DP9A 1DVAH 1SGCA 3FZDA 1OYQA 1TNLA 4P02A 3ZYDA 3CS7A 2VIQA 1BCUH 1CGJE 3DT0H 1ESBA 3HPTB 3GCOA 1HV7A 2HLDD 3QUMP 1FV9A 3EA7A 3LIWA 3CP7A 3K2UA 1ELTA 2KZ4A 2FTMA 2PKSC 3E90B 3TNTA 1G32B 4TY6A 3RC6A 3RXDA 3U8OH 3IWMA 4KTUA 1O3GA 2PSYA 1WQSA 4AYYB 4HI3A 1TWXB 4AC9A 2ANYA 1L0ZA 1O2UA 3BTQE 1DY8A 1SGNE 3EE0B 3DFJA 4ESTE 3E6PH 4ABAA 1F92A 2ZTXA 5EXMA 4FXGH 1XUKA 1F5RA 4Y8ZA 1KXCA 3M5NA 3Q3YA 2FS8A 2TBSA 2YNAA 1WBGB 1EB2A 2BZ6H 4MPVA 2TGPZ 5C1YA 2G5VA 3KL6A 1O3FA 1YLNA 3ATIA 1C1QA 3U8TH 1SSXA 2AMPA 1HDTH 3UNRA 2BD5A 3P8GA 4FUFA 4I33A 1GBJA 1C5OH 1DXWA 1L4DA 1XUHA 1IQGA 2KM0A 3T29A 1BTWA 1N6YA 1SHHB 1GG6C 2R2MB 3LH1A 1SGFA 1ZMJA 1TRYA 2OTVA 3BTEE 2AHME 4M7GA 3L33A 3HATH 3ZZ3A 2O8MA 4ISOA 3OY5U 1HXFH 1Q31A 2G51A 7GCHG 3SNDA 3SU5A 4GPGA 4AGKA 1AFEH 1V2VT 2ZPQA 2WYJA 5T6GA 8KME2 2DE8A 3ZZDA 1F5LA 3ODDA 1SHYA 4KP0A 2FYQA 3RU4D 3UTUH 3BEIB 1E37B 2FI4E 4IN1A 2ZTYA 3P6ZB 4ZHLU 1XUFA 4Y71A 1AUTC 1DLKB 2QN5T 3F2HA 1TPSA 3LJOA 1EFRD 1YGCH 4FETA 1O2LA 1ZR0A 2GGVB 1F7ZA 3QO6A 2RFKC 2KCYA 1YF4A 1UTKA 4IMZA 5F8TA 5E8EH 3VPKA 2BLWA 4B76A 4BXSA 5C3NA 1TGNA 1UHBA 1F0SA 2ZCLP 4FUDA 2D26C 1UVSH 1GBLA 1O35A 2VJ1A 4B1TA 1O2KA 3VB5A 5L30H 3KIDU 4NZLA 4K2YA 2ZGBH 1GHZA 5FBIA 4Q2KA 2ZF0H 5HGGA 2OC1A 4B75A 1MU6B 1BTZA 3SUEA 1E35B 1SGFG 2V6NA 5J4SA 2GMTC 2H5CA 2ODQA 3ZZAA 4BTIB 4MPUA 1NN6A 2F9UA 2R0LA 3LOXA 4MTBA 1FY3A 1HJ8A 5C17A 2WPDD 1A5IA 2Q6FA 5GCHG 1C5TA 1GDUA 4BAHB 5C0UA 1LVBA 5ABWA 3QTVH 1ZOMA 2Y5FA 2ZDNA 1SLXB 1W13U 1KLIH 4QT8C 1DLEA 3RXOA 3DFLA 3SORA 1GJBB 4DIHH 1C4V2 2ODYB 5HIYA 3V13A 5EIYA 1A0LA 3GICB 4ISNA 3TK5A 2BX4A 1VJAU 1C2LA 2VWNA 5C5OA 3SV6A 1C5QA 1J8AA 4VGCB 4B6FA 2AFQB 2PKAB 1ELDE 2BQWB 5DP3A 1BMNH 2SFAA 1W7XH 1AZ8A 1GMCG 3RC4A 2H1UA 3IG6B 4CRBA 3FVFB 5DN6D 2ASUB 4JZEH 1DWCH 1OS8A 5C1XA 3T62A 1DWDH 3LC5A 1YLDA 1CBWB 5A0AE 1V2PT 2FESH 3OSYA 3W95A 1SPJA 3ZZ6A 1P57B 1Z8RA 1NM6A 4BAOB 2BLOA 4U30A 4JZ1A 1AVWA 2F43B 4I32A 1IQLA 1BJVA 4B2BA 5B6LA 1ANDA 1JBUH 4WMDA 3KYGA 1AE5A 2JETB 2BMGB 3Q3KA 2WSSD 2NU1E 4JK6A 3V3MA 1NRSH 1S82A 2ZHFH 3Q77A 5F53A 1K1PA 1OWJA 4AORA 3D65E 4GCHF 5C94A 5L6NH 5EG4A 2Y7ZA 3TJVA 2J4IA 5EU8A 1D3PB 1DWEH 2BYAX 3SJOA 1QJ1B 5A8YA 4ABDA 3F2GA 1C5ZB 3AW1A 2WPHS 5TCAA 1QJ6B 2ZU1A 2VVCA 3F9GA 3VXEH 1RFNA 3A82A 4AX9H 1FIZA 4NWKA 4BAKB 3P70B 1SGQE 4IC5A 2ESTE 3LGVA 3BTME 1OHHD 3VB3A 4D76A 1MUEB 4AGJA 2EEKA 4ISLA 3B8JA 3RC5A 2XBYA 1C2DA 2BD7A 1L1NA 2A4QA 2BX3A 2FX4A 2J34A 4ZHMU 4IN2A 1O5BB 2XNDD 4AFSA 1MTWA 2FOBA 1TPPA 2GVFA 2V7QD 3PV5A 3R3GB 1O3HA 2FIRH 2F9OA 2QY0B 3PMAB 2BDHA 1ZZZA 5K7RA 1AI8H 1O3OA 1LQDB 2WPMS 3EDXB 3EAJA 3ODFA 2KCPA 1SR5C 1S0QA 1PJPA 1S83A 2B5TB 1KMHB 1SQAA 3UPEA 2W26A 2Y81A 3SJ9A 4BXWA 5BPEA 1DSUA 2B8OH 1LKBA 3A7WA 3C27B 2FWWA 3LONA 6GCHG 5DJ7A 4X8UH 1O3JA 2VU8E 5JBTA 2J94A 2C93B 2W6ID 1E36B 1NY22 1T8OA 2F9BH 5LPFA 1DUEA 1NS3A 2Z9GA 4MDSA 1ZSLA 3SU3A 1GHXH 4A1TA 1JWTA 4XOJA 1CU1A 3F3BA 5T6FA 1O3CA 4ACAA 2J98A 3A7VA 1Y5UT 1WYKA 2ZDAH 5GWZA 1ZRKA 1VCQA 2W7UA 1CHOF 4FU9A 3UOPA 2GJGA 4IBLH 5FCKA 1DUAA 4U32A 4M9FA 3SUFA 4AOQA 4INKA 1QRZA 1CSOE 2IN2A 1O3BA 3MMGA 4X0WU 2BD2A 1Y5BT 1E79D 1K9OE 3LDXH 1THPB 2ZQ1A 1JMOH 4PROA 3T27A 3RM2H 2KCAA 1K1OA 3JZ2B 3BN9A 3K6YA 1MTVA 8GCHG 1TNIA 4A6LA 3VXFH 5E0HA 4O97A 5FCRA 5FPYA 3TK9A 1D3QB 3A85A 1O5DH 1SGYE 2QAAA 3NXPA 1A61H 1P05A 4I7YH 3BSQA 3VB7A 4CREA 1CT4E 1GBHA 1EZQA 3QLPH 2R2WU 4UE7H 1EOLA 1RIWC 1KXEA 3F68H 2FI5E 1XKBC 3M35A 4BAQB 1YPMH 4FVDA 4P00A 3A87A 1SLUB 3MHWU 2FDAA 1DS2E 4WY3A 4Y8XA 1C1TA 1C1OA 3RXEA 3EA9A 3LKWA 1TX6A 3MWIU 1Z1JA 5DGJA 1UW7A 2Z9JA 2W6JD 1G3CA 2AS9A 1SFQB 1XMNB 4TT3D 2XW9A 2LNCA 2OINA 3UB0A 1C1VH 3GCTF 3GOVB 3SNAA 2GV7A 2QF5A 2Z6BD 1S84A 3SU1A 1DWBH 1QGFA 3EA8A 1UO6A 4Y11E 1WDIA 1EATA 3O8RA 1W0YH 1QTFA 3DA9B 1T32A 1KDQB 3TJOA 2GCHF 4DT4A 1OWKA 2M5TA 1HPGA 2GV6A 1SQRA 1NFXA 2KR7A 2XYAA 2HNTC 1C5RA 2CV3A 1G2LA 4JYVH 3HKIB 3N7EA 1FPCH 1GHVH 2VWLA 1DICA 2FI3E 2FX6A 4Y7AA 5C67A 1OYTH 3RXLA 1AQ7A 5JBAS 4D8NA 1EJNA 5C5NA 4Y0YE 1T8LA 4MNWA 1P2KA 2JDID 1T7CA 5JYIA 2SNWA 3GISB 5JBCS 3DCLA 1D3DB 1ELVA 1PYTC 3FP7E 1BHXB 1KTSB 4X1PU 2JH5D 4K69A 2CF9H 3WY8A 2BHGA 2WPIS 1CE5A 4ZH8A 4Y76A 2VWMA 1H9LB 4RT0A 2CHAB 3NZIA 4CRDA 2O8UA 3P17H 4RN6A 1O2VA 5FPSA 1GMHF 3QZQA 4NSYA 4X8SH 5LH8A 3ZYEA 1L1GA 2Z7FE 2VINA 1AU8A 1CQQA 1BTUA 4O3UA 5C2ZA 5EJ1A 3MFJA 3CENA 2ZFFH 2EQNA 2P3FH 1O5EH 3RLWH 4YLQH 1JIMA 3F0PA 4NIVA 1NFUA 2RCEA 2LELA 2VIDA 1AVGH 2P8OB 1VR1H 3MNBA 1DT2A 1IQEA 2CN0H 2BXUH 3H09A 3CS0A 3A86A 2OUAA 1YCPM 2J95A 5EJLA 1DSTA 3PTBA 2G55A 3M37A 3A83A 4XE4A 1IQFA 5DSFA 1ZPCA 3BIUH 3RXGA 1K1LA 2ZDLA 3SGQE 1C1UH 1CGHA 2Z9KA 5E0GA 3GY5A 1SGPE 1O33A 3KN2A 2D8WA 3MNXA 2BY6X 1FDPA 2BD3A 2FXRA 3RXJA 3S9AA 2ZGXH 3BV9B 1C2EA 1HIAB 4XSKU 2QF0A 3E91A 1BRUP 1UTMA 4FUGA 4X2VA 1V2QT 1AKSA 1ZGIA 3FKSD 5AVDA 4K8BA 5HM2A 4B2AA 1C9PA 1S5SA 5EQSA 3RXSA 3SUDA 1TX7A 1AFQB 2FLBH 2PV9B 5DP8A 3U98H 1C2FA 1GBAA 3MNSA 2BB4A 3SU0A 4ZKOU 2ZDMA 2O9QA 1SOTA 1C2GA 3GDUA 1ORFA 3GY3A 1YM0A 1YCPK 1ABJH 1MAXA 3LGUA 2OK5A 2H9HA 1ZTJA 3BG4B 2OBQA 1CO7E 3ELAH 3K65B 3LJJA 2F3CE 2BD9A 3OEED 2EA3A 4YXWD 3MNCA 2J9NA 3EGKH 3TJUA 2XCNA 1KTTB 2QE7D 3RXCA 3IITA 3ZZ9A 1C4U2 2B7DH 1DDJA 1O2JA 1P2JA 2EI7A 1MMJN 4NA8A 3GYMA 3PMHB 1EAWA 3NK8A 2ZU5A 3PMBB 2KCOA 4ZXXH 1J9CH 1AWFH 1TBRH 3PV4A 1PQ8A 3BG8A 1WSSH 3UNSA 3TGKE 1W7GH 5LGOA 2QGRA 4MVNA 1HAVA 2HVXA 2BOKA 5DG6A 4CRAA 1P3EA 3PRDA 1GMDG 1H8HD 4U2WA 3LGWA 3SBKA 1MH0A 2AH4X 3MO9A 1GBFA 3SJIA 1DXPA 4UFDH 4X6MA 4DJZB 1O39A 1O36A 5FBEA 1HJ9A 3S69A 2ZFQH 3BTWE 1P2QA 2V3OH 3D62A 4DVAU 1XXDA 1YPHE 1GJCB 3VG8A 1G2MA 2KAIA 1GWAA 4NIXA 2AGGX 4DGJA 3S9CA 5EGMA 2GD4B 2H6MA 1GGDB 5HM9A 2D1JA 1QL7A 3P8OA 2RDEA 5FPTA 3SU6A 1OSSA 1TGSZ 4KTSA 3PLKA 5AF9H 3S9BA 2P3UB 4RI0A 2EC9H 1B5GH 1W11U 2VIPA 3ATKA 2LPRA 3MU4A 4DY7B 1YPLH 2QC2A 1MCVA 1NU7B 1TYNA 2K1QA 1ZTLA 1FIWA 1MKWK 4FUEA 3BF6H 3OY6U 3RXAA 2QIQA 1FAKH 3OTJE 1AE8H 2ANMH 4X1NU 7ESTE 3GY4A 5DP4A 1CA8B 1ELAA 1GJ5H 3F1SB 3M7UA 2AIQA 3M36A 3UFAA 1NBME 1AO5A 1K0HA 1PYTD 2ZU4A 4BAMB 2AMDA 2OLGA 3RXVA 4NWLA 1HRTH 2W3KA 3M5LA 1HAOH 1Z8GA 4DW2U 1BMFD 1QRXA 3A8DA 3UOUA 1EAIA 1UHBB 2BY8X 2VGCC 2KFWA 3N7OA 2FZZA 3BTTE 1GBIA 4WWYA 1P2IA 3F2FA 1AZZA 1TMTH 1C2IA 4A1VA 1HUTH 1D6RA 1QL9A 1YPEH 3SJKA 1TGCA 3TH2H 2GP9B 4ISIH 1BTXA 2GZ7A 2PWXA 1LHFH 2XCFA 9ESTA 5HMAA 4ABHA 3PRBA 4D9QA 4WF8A 2ZCKP 1QB1A 1V2UT 3E0PB 2BDBA 4X6NA 1NC6A 1IQIA 1VITF 5JB8S 1BHXF 4CHAC 1O38A 3M7QA 1YPHC 1OX1A 2UUYA 4X8VH 4NIWA 2WUCA 2Y80A 2BY9X 2GX4A 1EPTA 2ZI2H 2NU4E 3A81A 1O2SA 2FOGA 1O3PB 1O2TA 2XC4A 1EX3A 3WWFA 1AB9C 1J14A 5HXFA 1NRRH 2ZGCA 5A8XA 1KIGH 3KHVA 4BOHA 5IYTA 3F0OA 1QB6A 1HJAB 2UWPA 3PO1C 3O8BA 4OS1A 3ZZ8A 4K1SA 3SYJA 5JPMH 3ATWA 3U9AH 1UK2A 1AN1E 1P0SH 3SZEA 4GUXA 1UTJA 2RDLA 4R8TB 2FS9A 3NPSA 1F5KU 4YLUA 1DFPA 1YCPH 1GBCA 3DSOA 1SBWA 5IK2D 3WWBA 1KY9A 2A4OA 3HGPA 4MLFB 1WAYB 1A7SA 2BVSH 3P8NA 1O5CB 1ID5H 2HPPH 1DY9A 1H1BA 3NKKA 1GDNA 1MTUA 2DE9A 1Y3XA 5HKKD 2BD8A 3RXMA 1S85A 1WOFA 1EXFA 1N8OC 2GT7A 3EQ0H 1Z8IB 1HCGA 1SL3A 1QQ4A 3AASA 3ZVEA 2A7CA 9LPRA 2A31A 1BMLA 2M2AA 5IDKA 3A7TA 1YBWA 1GBBA 4XDEA 1ANBA 1KXDA 1QJ7B 4F48B 1FUJA 1W0ZU 2OXSA 2UUJB 1CA0C 1ANCA 1NROH 1ZHMA 1ETRH 2PLXA 3A8BA 4K5ZA 3HK6B 1ARCA 1QBNA 2AEIH 1V2JT 5EJZA 3SV2H 1HXEH 4ZMAH 1GI9B 1VKYA 1CT2E 4YOJA 2HALA 2J5UA 1MQ5A 1C5MD 3ZZ5A 2HGTH 1TGTA 4MNYA 1EP5A 2V35A 2QXJA 2VVUA 1EJMA 4TYDA 1P9UA 1BTHH 4FUIA 4Q7XA 1Y3WA 1NRQH 4YM9A 4FU8A 1A5GH 1IQJA 1C9TA 2PP6A 2F83A 1FY8E 1E1RD 1P06A 2XWAA 4Q4LA 2F4LA 1GBKA 3STIA 2XXLA 1PQ7A 1TFXA 3KF2A 4ZKNU 1W3CA 2CXVA 1LVMA 2PTCE 1P03A 3RXBA 1SC8U 7GCHF 2WZQA 1FMGA 1FY4A 1OP8A 4CBOA 1TPOA 3FN8A 1E38B 2YNBA 4HZHA 1O2GH 1A5HA 1SQTA 2IPQX 3LGIA 4TSFD 2ZG0H 3T5FH 2ODPA 1EKBB 4GAWA 4CRGA 2SGEE 2C3SA 5BRRE 2CK3D 1HAIH 1P10A 2KX4A 3RXIA 1UVTH 1ETTH 4K3JA 4A1XA 1QA0A 4OGXA 5KECA 4FU7A 3KQEA 1O3EA 1MCTA 4JZDH 3KQDA 4JZIA 2WV9A 2BVRH 3R0FA 3QN7A 2XNIA 1LMWB 1ACBE 3A89A 3GS9A 2A2QH 1DM4B 1P02A 1C1RA 1TNJA 2QF3A 2R3YA 3Q00A 1QRWA 1O30A 2PR3A 3V7TA 2WV5A 1BITA 1ZJDA 5HIZA 2PHBA 3I78A 1UTNA 2A7JA 1GHAG 2G00A 1K1NA 4NCYA 1LPZB 1IOEA 1TAWA 1QZ8A 2H9EH 3HKJB 5GCHF 4E7NA 1HNEE 1PPZA 5TCCA 5KGOA 1A4WH 4NGAH 1BTPA 1S6HA 5DP7A 1UK3A 3TH3H 1O5GH 2VH0A 2SGQE 1NRNH 1F2SE 1VGCC 3F9EA 1MTNC 1JIRA 3MU8A 4FUHA 3PYHA 3SI3H 1PPFE 5C0TA 2PKSB 1GHYH 2C8WB 2ZP0H 2G5NA 1VCWA 2BXTH 1ZMNA 4Y10E 1KSNA 4YTAA 4FOUC 1YP9A 4X6PA 1QURH 1FY5A 1PPHE 2ZFTA 1LHDH 1V2TT 1ZMLA 1FNIA 1GMCF 1EUFA 2EY4C 1TLDA 2I6QA 1COWD 1H8DH 3QGJA 2I6SA 1C1NA 3OE7D 4X2YA 2ZQ2A 3P8FA 3M7TA 3VB4A 1UK4A 3OU0A 5G4BA 1T4VH 1W12U 4ZKRU 2QCYA 4JK5A 1GMHG 1MQ6A 1V2ST 2WPKS 2CF8H 3PTNA 2ZO3H 1GHBF 2ZFRH 1TOCB 2ANWA 2GZ8A 1SB1H 1ZHPA 4OS6A 3SZNA 1EB1H 3URDA 3WW7A 1YY3A 2VVVA 5EW1H 1YPJH 1GI2A 4WJG2 1ELFA 2IOTA 3RXFA 1GG6B 5EW2H 1QIXB 7LPRA 3AK5A 2FLRH 5JBBS 3TGJE 2FOCA 2ZTZA 2JJ2D 5I25A 1AGJA 4I8KA 3K6ZA 1RJXB 1TQ0B 2BDAA 1GJ7B 2Z3CA 1T31A 1EPTC 2Y5HA 1O2PA 1MKXK 4A92A 3PLPA 1MZDA 4TWWA 3VB6A 5H4IB 1ZHRA 1BZXE 2L6OA 4Z1MD 1MZAA 5DP5A 1C5YB 1LHEH 3RXUA 3UR6A 1D6WA 2QXIA 3B9FH 3A7XA 4JYTA 4WH6A 5FXLA 1DPOA 4OM9A 4X2WA 1O5FH 3SV9A 4ZXYH 2HLCA 1AUJA 2SGPE 1AHTH 2FOFA 4I8JA 1C2JA 3MO3A 4AB9A 1GBMA 2HWLB 3K9XB 4Y6DA 3Q76A 3CNRA 1BMAA 2F9NA 2BDGA 1SI5H 3RU4E 3SW2B 4Y79A 1UJ1A 1GVLA 2GMTB 1VITH 2FO9A 1TMBH 2A5IA 2LP6A 1K1MA 3D49H 3FOAA 6GCHF 2UWLA 1S6FA 1IQNA 4UFEH 3F9HA 1C5NH 2O8TA 3E3TA 3KCGH 2A4RA 3ZZCA 1H8ED 4B73A 5ESTE 1N8OB 1Q2WA 2O8LA 2VB0A 1G30B 4MQAA 4RT1A 1NFWA 4JCNA 1JRTA 1Y8TA 5K0HA 4D9RA 2H5DA 1IQMA 4AG2A 3BTHE 2ZECA 3PB1E 4NFEA 4O3TA 1WTHD 2BVXH 1C5VA 1V2MT 1LDTT 4X1SU 2R0KA 3RM0H 4K1EA 1CA0B 5CHBA 1IQHA 4ZROA 2PUXB 2QYIA 1NO9H 2WYGA 1B7XB 2FMJA 2JJ1D 3TIUA 4AG1A 4ZHAA 3FO8D 3MH5A 5FX5A 1H9HE 1OOKB 4NIYA 5AHGH 4U01A 1HAGE 4OS2A 5C20A 1A0HB 4XBDA 3RP2A 8GCHF 1AVXA 4H6SB 3UWIA 2QV1A 3AW0A 2AIPA 3M5MA 3NWUA 2VIOA 1PQ5A 1E0FD 1OXGA 4XFQA 3UQVA 4B74A 4GLYA 4AFQA 1HFDA 2FOMB 2OP9A 4KELA 4AZ2B 1ZSJA 1O3IA 3AAUA 1SLVB 3LU9B 4XD7D 2W7SA 4TPIZ 2P16A 3SOSA 4UFGH 3UIRA 4IGDA 2ULLA 2J38A 4AFZA 4FUJA 3RXHA 3RDZA 2RA0A 5FAHA 1HAVB 3OFND 1FPHH 2R3UA 4CR5A 2QXHA 5GPIB 2XOKD 1TOMH 1XVOA 3EE7A 3RU4T 1RGQA 1V2WT 4YZUA 3UQOA 3HK3B 3ZZ7A 3DSGA 2J2UA 1UVPA 1MBMA 3O8DA 1WXRA 4K60A 3M61U 4CH8B 1CBWC 4FVBA 4TY7A 4K8YA 1O3MA 1HLTH 1DX5M 4KKDA 2R9PA 4BANB 1QBVH 1SGEE 5LPRA 1O2OA 2VWOA 2V3MA 3RMOH 5EQQA 5A09A 3SNCA 2JETC 4HTCH 2A5KA 4NG9H 3MO6A 2BQ6B 5EXNA 2NWNA 4IC6A 4Y0ZE 1P2OA 4X1QU 1PPGE 2FM2A 1SLWB 4J1YA 4J2YB 1IQKA 1FZZA 3DD2H 1TNHA 1TABE 2GTBA 3ZVBA 3GCNA 4MNXA 1O3AA 1VGCB 1MKXH 3NCLA 3I29A 1SQOA 1NRPH 1TA6A 1VITG 1NESE 7KMEH 1N1LA 3QDZB 3DUXH 3H7TA 3PM3A 3EYDA 2WINI 1LPKB 5CE1A 4F4OC 2G81E 3RLYH 1J15A 1UTLM 1MU8B 1OP0A 3FZZA 3LGYA 5J4QA 3FP8E 6ESTA 2OC0A 4AFUA 4F55A 5GJ4B 2HVYB 1IHTH 2B0FA 3P92A 1GCDA 2QXGA 1BRCE 2XBXA 1A3BH 1O34A 2P3TB 1SGDE 4NA7A 1P3CA 1HAHH 2G4UA 1H4WA 1PQAA 1CHGA 2VNTA 2D2DA 1SVPA 1Z7KA 1EOJA 3VFEA 8ESTE 3MOCA 4DIIH 2TRMA 1NT1A 1TRNA 1H8IH 2TGDA 1KXFA 4CRCA 3MYWA 5GXPA 1HAXB 4H4FA 1WQVH 1V3XA 4B6EA 2A5AA 4H42U 1ZLRA 1ZPZA 2FOEA 2Q6GA 2XWBI 2A1DB 2BM2A 4ABEA 3KQBA 1GVZA 3MU1A 3V0XA 1VCPA 3ZZBA 4H6TA 1O2QA 1RIWB 3QGNB 4MG3A 2OC7A 1C5XB 1K1JA 1Z8JB 5FHTA 4OS5A 3A8AA 1GBDA 3SQEE 1TNGA 1NFYA 2SGDE 3U28C 2IPHA 2NU0E 1KLJH 1HBTH 1EPTB 3SGBE 2ZKSA 3BTFE 5L2ZH 1Y5AT 2CGAA 2FTLE 3N7DA 3ATMA 4IMQA 4LZ4B 5PTPA 1RTFB 2Q6DA 1D4PB 1BJUA 1EAXA 2AERH 5A8ZA 3GY7A 2L74A 3L6PA 3BTKE 3D23A 1O2HA 1SMFE 3VGCC 2ZC9H 1BT7A 2Z3DA 2BZAA 2P95A 2F9PA 1HAZB 4ZCNA 4NZQA 3MU5A 2A2XH 1SFIA 2ZFSA 4E05H 1H9IE 4XBCA 1B0EA 2B9LA 2BY7X 5T6DA 3A7ZA 1GDQA 2Z9LA 4DT7B 3TVJB 1GJDB 1K22H 3OEHD 3A80A 3PROA 4JMYA 1D9IA 1QL8A 1MBQA 3MTYA 4NA9H 1PPCE 2BTCE 4GCHG 2PUQH 1TBZH 1GCTC 1FY1A 1SGRE 1OKXA 1LVOA 2G52A 3T26A 1C1PA 1O2RA 2GDEH 1YC0A 3KEEA 3OAAD 1XM1A 2TGTA 3PV2A 1T8MA 1BA8B 2AGEX 1ESTA 1FQ3A 1N6XA 3AVZA 4RSPA 3OX7U 4UFFH 4WXIA 2UUFB 1L2EA 1BBRK 1C2HA 3GY8A 1EP6A 2IJOB 1JXPA 4D7FA 1SGTA 3SV7A 1GMDF 2P94A 2BDIA 2HOBA 1ABIH 1TNKA 1A46H 1P04A 3T25A 2BDYA 2BOHB 1QHRB 1V2NT 4WH8A 4XBBA 5F8ZA 2Z3EA 3PLBA 1WV7H 1TQ7B 1TB6H 2VIVA 1YLCA 3RMLH 2ZHEH 2JKHA 3T2NA 1XUJA 1FN8A 1MD7A 3BEUA 2ZNKH 3SNEA 3FANA 3LC3A 2O8WA 5EOKA 2RG3A 1UCYK 1PPEE 1XXFA 1V2RT 1TONA 4X2XA 1D3TB 2A7HA 1LTOA 1HAPH 4TWYA 4I8LA 2ZFPH 1O3KA 3UY9A 2G4TA 2V0BA 2NU2E 1TBQH 1G3EA 1O32A 1THRH 5EPYA 2W3IA 1EASA 2GT8A 2UUKB 2FOAA 3TJNA 4DURA 4O03A 1RS0A 2Y6TA 4SGBE 1YPGH 4K1TA 3UWJH 1XUGA 2ZHDA 1ANEA 1A1RA 1P8VC 1S0RA 2Z9IA 3PMJA 1THSH 3KQCA 1Y59T 3G01A 3M5OA 4AN7A 1L1JA 5HYOA 2XTTB 3ESTA 1L4ZA 2P59A 3BTDE 1CHOG 1KYNA 1G36A 2Z94A 3SI4H 1LO6A 2GKVE 2WV4A 4R0IA 2CHAC 2P93A 3UNQA 1BIOA 2ALPA 1NU9A 4GVUA 1FX0B 2QA9E 1UTQA 1ESAA 1O2MA 2FEQH 5KEDA 4X8TH 3GYLB 1GHWH 1TALA 3GCHC 1FLEE 2PTNA 1RTLA 1U6QA 3GY6A 1C1SA 3MH4A 1G37A 2JIZD 4INHA 4JYUH 3SUGA 1DOJA 4ABBA 2J92A 5TJXA 1OWIA 4IW4E 1GHBG 2DUCA 1E1QD 2P8OC 1EZUC 1W0JD 1O2IA 2C4FH 1MKWH 2OQ5A 1Z71A 2A4GA 2Q1JA 3F6UH 2GZ9A 2XC5A 1IHSH 3SU4A 1GJ8B 1FJSA 1AD8H 3TGIE 1TMUH 2J98B 4GSOA 4MNVA 3W1EA 3QTOH 4O9VA 2H9TH 4Z0KA 1SOZA 3URCA 1W2KH 1ARBA 1JRSA 1QA7A 3S7KB 5E0JA 1AY6H 1RRKA 1YWUA 5FL7D 5CHAC 2PKAA 1YYY1 3A84A 4Q7YA 3AAVA 3KNXA 1G3DA 1O5AB 3LT3A 1CVWH 1G3BA 3S7HB 2TPIZ 1XUIA 2TGAA 1E34B 5EPNA 1GI0A 2GCTC 1C1MA 1O37A 1SG8B 4LZ1H 1AFQC 5A0CA 3GCTG 2K0QA 6LPRA 2VBCA 3NRLA 4RKOB 4ISHH 1W0KD 5A0BA 2SGFE 3T28A 3KYFA 4FUCA 2YMSC 2CJIA 1Z6JH 1O2YA 1ELBA 2GCHG 1O0DH 4FUBA 3UUZA 2THFB 3BG4C 3M3SA 3C1KA 1C5UA 1UVUH 1Z1IA 5AFYH 4SGAE 1K1IA 2A32A 1QCPA 1C5LH 1LCYA 4Q80A 5F03A 4Q63A 3S0NA 4I8HA 4OS7A 3ENSB 1GBEA 5EODA 5B6OA 3RXQA 1F0RA 2V3HH 3MQKC 3E0NB 1OWEA 2GDDA 5SGAE 1UMAH 3U8RH 2BY5X 1ETSH 1QB9A 2C90B 2UWOA 3FFGA 3ZVGA 1X7AC 2A0QB 2K8IA 1BQYA 1QR3E 4AB8A 4HGCA 5F6MA 1QY6A 1BBRH 1QNJA 5CMXH 2C8YB 3N99A 2ZDKA 1BTYA 2XRCA 2XBVA 4ABIA 3TNSA 1GI7B 1SGIB 2AYWA 1EQ9A 2OQUA 1WU1A 1K2I1 6CHAC 3H5CB 1P09A 2ZWLH 2HNTE 1CT0E 2ZEBA 1K28D 4CBNA 2FODA 2ZPSA 3I77A 2VGCB 3A88A 3A7YA 4HG6A 4ASUD 3PWCA 2PGQB 4ZKSU 4LOYH 3DSPA 3RMNH 4D7GA 1YPKH 3TH4H 1LHCH 2ZA5A 4YOGA 2BLQA 5A2MH 4YT6H 3VGCB 4DG4A 1UCYH 2PGBB 1PPBH 2HNTF 3FP6E 1V6DA 1RD3B 1J17T 4E7RG 2XBWA 1Y3UA 3TK6A 1RXPA 1NBMD 1WCZA 4LXBH 1GPZA 1GGDC 1BB0B 2EI8A 1XKAC 1HYLA 2HRVA 1MAYA 5E2PA 2ZHQH 1P12E 3F9FA 2ALVA 5F8XA 1MD8A 3UREA 1ELGA 1ZPBA 3ITIA 1LVYA 1V2KT 4GHQA 3LGTA 3KGPA 3E16B 1GCTB 4CHAB 4ZAEA 3TITA 1O3DA 2TIOA 4WMFA 1CGIE 4I8GA 5I46H 3HGNA 2WHXA 5EQRA 4AYVB 2W5EA 1OPHB 5DK1A 1BOQA 1GI5A 1GL1A 1GI8B 3U1JB 1P9SA 2OD3B 4HFPB 1TA2A 3MH6A 1AB9B 2YOLA 4CR9A 4ZUHA 4LK4A 1TRMA 1V2OT 3SNBA 1GI1A 2PSXA 3SQHE 3VEQB 2C8XB 1A2CH 4B2CA 3RXTA 3PO1B 4I31A 2WPJS 1TX8A 3V12A 4WVPE
chains in the Genus database with same CATH topology
4YO9A 2ZPRA 1GJ4H 1TE0A 4ABJA 1A3EH 2OC8A 1O2XA 1NPMA 4WMEA 4A7IB 5E2OA 4F49A 1GI4A 1LPGB 3GDVA 2AMQA 3SJ8A 1TIOA 4A5TS 3SO3A 3GDSA 1GJ6A 1FN6A 1NTPA 4NFFA 2BLVA 5AFZH 1EAUA 4NSVA 1XVMA 4OS4A 1GI3A 1GHAF 1Z6EA 3W94A 1K21H 3TLOA 3RXKA 4KTCA 4MPWA 1AIXH 1P01A 1QBOA 5DP6A 3SV8A 4YOIA 4IS5A 4THNH 3MH7A 4GHTA 3BIVH 4B71A 5LPEA 3SGAE 1P11E 3ZVDA 4Y8YA 2SGAA 5DO4H 1BDAA 1P2MA 1HB0B 1MTSA 1PFXC 3TPIZ 2ZU3A 1O3NA 1EJAA 3STJA 2SNVA 1KXAA 5ETXA 1TGBA 2Y5GA 1C2MA 1GI6A 1O2WA 1ZRBA 1AKSB 2ZZUH 1JOUB 4UDWH 1QQUA 1ZTKA 2FP7B 3ATLA 3O8CA 1HGTH 2Y82A 1ZJKA 4BTUB 1EZSC 1GL0E 1C2KA 1XX9A 2FOHA 5T3HA 2CMYA 4X6OA 1HJAC 3QK1A 3ZVCA 2JH0D 2RA3A 1GJAB 1W8BH 1YKTA 1IAUA 3RMMH 2F91A 3E8LA 3GCHB 2WUBA 1ELCA 2Y7XA 3UR9A 3BTGE 1KDQA 1M9UA 2STBE 4UONA 3ZZ4A 2OCVB 1KLTA 1FONA 3SHCH 2FPZA 5JB9S 1O2ZA 4INLA 3LPRA 2BD4A 1HAYB 1O3LA 3E1XB 1AWHB 4UD9H 3ZVAA 1O31A 1Q3XA 8LPRA 1FI8A 1EZXC 1W10U 1OWDA 1ZSKA 1ZGVA 4MPXA 3RXPA 4VGCC 4ASHA 4CH2B 1P2NA 4DOQA 1LQEA 2ZU2A 5ESBA 3FAOA 1INCA 4ABFA 2WPLS 2OBOA 2G8TA 1C5SA 1C5PA 1T8NA 3OYPA 3PWBA 2BQ7B 3H7OA 5CHAB 1UVOA 3LH3A 1GBTA 1FXYA 3M3VA 2PFEA 5JDUB 1A0JA 3L3TA 1LKAA 1WTGH 1J16A 5GDSH 4Y7BA 2KAIB 1BRBE 3BEFB 4OGYA 5DPAA 2VH6A 1VZQH 3MU0A 2GCTB 5L2YH 2BDCA 1KXBA 4WXVA 2A45B 3U69H 1DANH 1GJ9B 1B0FA 1C5WB 2HPQH 1T4UH 3Q3XA 5C1UA 2JH6D 1LHGH 1ZYOA 3JZ1B 1FAXA 3ZVFA 2FYRA 2STAE 1AMHA 1F0UA 1Y3YA 4YT7H 1W14U 2ZGHA 1C4Y2 1MTNB 1QFKH 3DHKH 3M3TA 1UTPA 2ANKH 3SU2A 2H2ZA 1WUNH 1BBRE 3RXRA 4KGAA 1BMMH 5DKMA 5EXLA 3B23B 2F9VA 2XC0A 1UTOA 4X1RU 1HIAA 3MI4A 1OP2A 1DITH 1GVKB 4RKJB 3NUMA 2EI6A 2NU3E 2ZHWH 2AGIX 1OWHA 2VIWA 1RTKA 3RUOA 6CHAB 3U1IB 1DE7H 1BUIA 1UCYE 3P95A 3A8CA 4Q7ZA 3ZV8A 4Z6AH 3SHAH 4ABGA 1O2NA 4JZFH 3ZV9A 1TPAE 2C8ZB 4UEHH 1F0TA 2ILNA 1ELEE 1G9IE 1Y3VA 3QWCH 3SN8A 3QX5H 2ZCHP 4DCDA 4YESB 1VJ9U 1C1WH 3QZRA 4CRFA 1NZQH 5FX6A 2PW8H 3TU7H 1S81A 2ZIQH 4E06H 3GY2A 5GIBA 2ZDVH 1BRAA 4TPYA 4BTTB 1V2LT 4BNRA 2ZGJA 5DP9A 1DVAH 1SGCA 3FZDA 1OYQA 1TNLA 3ZYDA 3CS7A 2VIQA 1BCUH 1CGJE 3DT0H 1ESBA 3HPTB 3GCOA 1HV7A 3QUMP 1FV9A 3EA7A 3LIWA 3CP7A 3K2UA 1ELTA 2FTMA 2PKSC 3E90B 3TNTA 1G32B 4TY6A 3RC6A 3RXDA 3U8OH 3IWMA 4KTUA 1O3GA 2PSYA 1WQSA 4AYYB 4HI3A 1TWXB 2ANYA 1L0ZA 1O2UA 3BTQE 1DY8A 1SGNE 3EE0B 3DFJA 4ESTE 3E6PH 4ABAA 1F92A 2ZTXA 5EXMA 4FXGH 1XUKA 1F5RA 4Y8ZA 1KXCA 3M5NA 3Q3YA 2FS8A 2TBSA 2YNAA 1WBGB 1EB2A 2BZ6H 4MPVA 2TGPZ 5C1YA 2G5VA 3KL6A 1O3FA 3ATIA 1C1QA 3U8TH 1SSXA 2AMPA 1HDTH 3UNRA 2BD5A 3P8GA 4FUFA 4I33A 1GBJA 1C5OH 1DXWA 1L4DA 1XUHA 1IQGA 3T29A 1BTWA 1N6YA 1SHHB 1GG6C 2R2MB 3LH1A 1SGFA 1ZMJA 1TRYA 2OTVA 3BTEE 4M7GA 3L33A 3HATH 3ZZ3A 2O8MA 4ISOA 3OY5U 1HXFH 1Q31A 2G51A 7GCHG 3SNDA 3SU5A 4GPGA 4AGKA 1AFEH 1V2VT 2ZPQA 2WYJA 5T6GA 8KME2 2DE8A 3ZZDA 1F5LA 3ODDA 1SHYA 4KP0A 2FYQA 3RU4D 3UTUH 3BEIB 1E37B 2FI4E 4IN1A 2ZTYA 3P6ZB 4ZHLU 1XUFA 4Y71A 1AUTC 1DLKB 2QN5T 1TPSA 3LJOA 1YGCH 1O2LA 1ZR0A 2GGVB 1F7ZA 3QO6A 4IMZA 1YF4A 1UTKA 5F8TA 5E8EH 3VPKA 2BLWA 4B76A 4BXSA 5C3NA 1TGNA 1UHBA 1F0SA 2ZCLP 4FUDA 2D26C 1UVSH 1GBLA 1O35A 2VJ1A 4B1TA 1O2KA 3VB5A 5L30H 3KIDU 4NZLA 4K2YA 2ZGBH 1GHZA 5FBIA 4Q2KA 2ZF0H 5HGGA 2OC1A 4B75A 1MU6B 1BTZA 3SUEA 1E35B 1SGFG 2V6NA 5J4SA 2GMTC 2H5CA 2ODQA 3ZZAA 4BTIB 4MPUA 1NN6A 2F9UA 2R0LA 3LOXA 4MTBA 1FY3A 1HJ8A 5GCHG 1A5IA 2Q6FA 1C5TA 1GDUA 4BAHB 1LVBA 5ABWA 3QTVH 1ZOMA 2Y5FA 2ZDNA 1SLXB 1W13U 1KLIH 4QT8C 1DLEA 3RXOA 3DFLA 3SORA 1GJBB 4DIHH 1C4V2 2ODYB 3V13A 1A0LA 3GICB 4ISNA 3TK5A 2BX4A 1VJAU 1C2LA 2VWNA 5C5OA 3SV6A 1C5QA 1J8AA 4VGCB 2AFQB 2PKAB 1ELDE 2BQWB 5DP3A 1BMNH 2SFAA 1W7XH 1AZ8A 1GMCG 3RC4A 2H1UA 3IG6B 4CRBA 3FVFB 2ASUB 4JZEH 1DWCH 1OS8A 5C1XA 3T62A 1DWDH 3LC5A 1YLDA 1CBWB 5A0AE 1V2PT 2FESH 3OSYA 3W95A 1SPJA 3ZZ6A 1P57B 1Z8RA 1NM6A 4BAOB 2BLOA 4U30A 4JZ1A 1AVWA 4I32A 1IQLA 1BJVA 4B2BA 1ANDA 1JBUH 4WMDA 1AE5A 2JETB 2BMGB 3Q3KA 2NU1E 4JK6A 3V3MA 1NRSH 1S82A 2ZHFH 3Q77A 1K1PA 1OWJA 4AORA 3D65E 4GCHF 5L6NH 5EG4A 2Y7ZA 3TJVA 2J4IA 5EU8A 1D3PB 1DWEH 2BYAX 3SJOA 1QJ1B 5A8YA 4ABDA 1C5ZB 3AW1A 2WPHS 5TCAA 1QJ6B 2ZU1A 2VVCA 3F9GA 3VXEH 1RFNA 3A82A 4AX9H 1FIZA 4NWKA 4BAKB 3P70B 1SGQE 4IC5A 2ESTE 3LGVA 3BTME 3VB3A 4D76A 1MUEB 4AGJA 2EEKA 4ISLA 3B8JA 3RC5A 2XBYA 1C2DA 2BD7A 1L1NA 2A4QA 2BX3A 2FX4A 2J34A 4ZHMU 4IN2A 1O5BB 4AFSA 1MTWA 2FOBA 1TPPA 2GVFA 3R3GB 1O3HA 2FIRH 2F9OA 2QY0B 3PMAB 2BDHA 1ZZZA 5K7RA 1AI8H 1O3OA 1LQDB 2WPMS 3EDXB 3EAJA 3ODFA 1SR5C 1S0QA 1PJPA 1S83A 2B5TB 1SQAA 3UPEA 2W26A 2Y81A 3SJ9A 4BXWA 5BPEA 1DSUA 2B8OH 1LKBA 3A7WA 3C27B 2FWWA 3LONA 6GCHG 5DJ7A 4X8UH 1O3JA 2VU8E 5JBTA 2J94A 2C93B 1E36B 1NY22 1T8OA 2F9BH 5LPFA 1DUEA 1NS3A 2Z9GA 4MDSA 1ZSLA 3SU3A 1GHXH 4A1TA 1JWTA 4XOJA 1CU1A 5T6FA 1O3CA 3A7VA 1Y5UT 1WYKA 2ZDAH 5GWZA 1ZRKA 1VCQA 2W7UA 1CHOF 4FU9A 3UOPA 4IBLH 5FCKA 1DUAA 4U32A 3SUFA 4AOQA 4INKA 1QRZA 1CSOE 2IN2A 1O3BA 3MMGA 4X0WU 2BD2A 1Y5BT 1K9OE 3LDXH 1THPB 2ZQ1A 1JMOH 4PROA 3T27A 3RM2H 1K1OA 3JZ2B 3BN9A 3K6YA 1MTVA 8GCHG 1TNIA 4A6LA 3VXFH 5E0HA 4O97A 5FCRA 5FPYA 3TK9A 1D3QB 3A85A 1O5DH 1SGYE 2QAAA 3NXPA 1A61H 1P05A 4I7YH 3BSQA 3VB7A 4CREA 1CT4E 1GBHA 1EZQA 3QLPH 2R2WU 4UE7H 1EOLA 1RIWC 1KXEA 3F68H 2FI5E 1XKBC 3M35A 4BAQB 1YPMH 4FVDA 3A87A 1SLUB 3MHWU 2FDAA 1DS2E 4WY3A 4Y8XA 1C1TA 1C1OA 3RXEA 3EA9A 3LKWA 1TX6A 3MWIU 1Z1JA 5DGJA 2Z9JA 1G3CA 2AS9A 1SFQB 1XMNB 2XW9A 2LNCA 2OINA 1C1VH 3GCTF 3GOVB 3SNAA 2GV7A 2Z6BD 1S84A 3SU1A 1DWBH 1QGFA 3EA8A 1UO6A 4Y11E 1EATA 3O8RA 1W0YH 1QTFA 3DA9B 1T32A 1KDQB 3TJOA 2GCHF 1OWKA 2M5TA 1HPGA 2GV6A 1NFXA 2XYAA 2HNTC 1C5RA 2CV3A 1G2LA 4JYVH 3HKIB 1FPCH 1GHVH 2VWLA 1DICA 2FI3E 2FX6A 4Y7AA 5C67A 1OYTH 3RXLA 1AQ7A 5JBAS 4D8NA 1EJNA 5C5NA 4Y0YE 1T8LA 4MNWA 1P2KA 1T7CA 5JYIA 2SNWA 3GISB 5JBCS 1D3DB 1ELVA 1PYTC 3FP7E 1BHXB 1KTSB 4X1PU 2JH5D 4K69A 2CF9H 3WY8A 2BHGA 2WPIS 1CE5A 4ZH8A 4Y76A 2VWMA 1H9LB 2CHAB 3NZIA 4CRDA 2O8UA 3P17H 4RN6A 1O2VA 5FPSA 1GMHF 3QZQA 4NSYA 4X8SH 5LH8A 3ZYEA 1L1GA 2Z7FE 2VINA 1AU8A 1CQQA 1BTUA 4O3UA 5C2ZA 3MFJA 3CENA 2ZFFH 2P3FH 1O5EH 3RLWH 4YLQH 1JIMA 4NIVA 1NFUA 2RCEA 2VIDA 1AVGH 2P8OB 1VR1H 3MNBA 1DT2A 1IQEA 2CN0H 2BXUH 3CS0A 3A86A 2OUAA 1YCPM 2J95A 1DSTA 3PTBA 2G55A 3M37A 3A83A 4XE4A 1IQFA 1ZPCA 3BIUH 3RXGA 1K1LA 2ZDLA 3SGQE 1C1UH 1CGHA 2Z9KA 5E0GA 3GY5A 1SGPE 1O33A 3KN2A 2D8WA 3MNXA 2BY6X 1FDPA 2BD3A 2FXRA 3RXJA 3S9AA 2ZGXH 3BV9B 1C2EA 1HIAB 4XSKU 2QF0A 3E91A 1BRUP 1UTMA 4FUGA 4X2VA 1V2QT 1AKSA 1ZGIA 5AVDA 4K8BA 5HM2A 4B2AA 1C9PA 1S5SA 5EQSA 3RXSA 3SUDA 1TX7A 1AFQB 2FLBH 2PV9B 5DP8A 3U98H 1C2FA 1GBAA 3MNSA 2BB4A 3SU0A 4ZKOU 2ZDMA 2O9QA 1SOTA 1C2GA 3GDUA 1ORFA 3GY3A 1YM0A 1YCPK 1ABJH 1MAXA 3LGUA 2H9HA 1ZTJA 3BG4B 2OBQA 1CO7E 3ELAH 3K65B 3LJJA 2F3CE 2BD9A 2EA3A 3MNCA 2J9NA 3EGKH 3TJUA 2XCNA 1KTTB 3RXCA 3IITA 3ZZ9A 1C4U2 2B7DH 1DDJA 1O2JA 1P2JA 2EI7A 1MMJN 4NA8A 3GYMA 3PMHB 1EAWA 3NK8A 2ZU5A 3PMBB 4ZXXH 1J9CH 1AWFH 1TBRH 3PV4A 1PQ8A 3BG8A 1WSSH 3UNSA 3TGKE 1W7GH 5LGOA 2QGRA 4MVNA 1HAVA 2HVXA 2BOKA 5DG6A 4CRAA 1P3EA 4U2WA 1GMDG 3LGWA 3SBKA 1MH0A 2AH4X 3MO9A 1GBFA 3SJIA 1DXPA 4UFDH 4X6MA 4DJZB 1O39A 1O36A 5FBEA 1HJ9A 3S69A 2ZFQH 3BTWE 1P2QA 2V3OH 3D62A 4DVAU 1XXDA 1YPHE 1GJCB 1G2MA 2KAIA 1GWAA 4NIXA 2AGGX 4DGJA 3S9CA 5EGMA 2GD4B 2H6MA 1GGDB 5HM9A 2D1JA 1QL7A 3P8OA 5FPTA 3SU6A 1OSSA 1TGSZ 4KTSA 3PLKA 5AF9H 3S9BA 2P3UB 2EC9H 1B5GH 1W11U 2VIPA 3ATKA 2LPRA 3MU4A 4DY7B 1YPLH 2QC2A 1MCVA 1NU7B 1TYNA 2K1QA 1ZTLA 1FIWA 1MKWK 4FUEA 3BF6H 3OY6U 3RXAA 2QIQA 1FAKH 3OTJE 1AE8H 2ANMH 4X1NU 7ESTE 3GY4A 5DP4A 1CA8B 1ELAA 1GJ5H 3F1SB 3M7UA 2AIQA 3M36A 3UFAA 1AO5A 1PYTD 2ZU4A 4BAMB 2AMDA 2OLGA 3RXVA 4NWLA 1HRTH 2W3KA 3M5LA 1HAOH 1Z8GA 4DW2U 1QRXA 3A8DA 3UOUA 1EAIA 1UHBB 2BY8X 2VGCC 3N7OA 2FZZA 3BTTE 1GBIA 4WWYA 1P2IA 1AZZA 1TMTH 1C2IA 4A1VA 1HUTH 1D6RA 1QL9A 1YPEH 3SJKA 1TGCA 3TH2H 2GP9B 4ISIH 1BTXA 2GZ7A 2PWXA 1LHFH 2XCFA 9ESTA 5HMAA 4ABHA 4D9QA 4WF8A 2ZCKP 1QB1A 1V2UT 3E0PB 2BDBA 4X6NA 1NC6A 1IQIA 1VITF 5JB8S 1BHXF 4CHAC 1O38A 3M7QA 1YPHC 1OX1A 2UUYA 4X8VH 4NIWA 2WUCA 2Y80A 2BY9X 2GX4A 1EPTA