1G3EA

Bovine beta-trypsin bound to para-amidino schiff-base copper (ii) chelate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title X-ray crystallographic analyses of complexes between bovine beta-trypsin and Schiff base copper(II) or iron(III) chelates.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3eA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3eA02
4THNH 4NG9H 3NKKA 1K28D 3VGCC 2GT7A 4XDEA 4WJG2 1A1RA 1AD8H 2FP7B 1WCZA 3BTQE 2ZFRH 2YOLA 1TNLA 2RA0A 4A5TS 1D6RA 3RXHA 4A1XA 2XTTB 1UTPA 2R0KA 2V3OH 1O30A 3EGKH 2PGQB 2XWBI 3A7YA 2FZZA 5HM2A 3V12A 1TNIA 2M5TA 4B73A 1C1UH 1OS8A 3A87A 2GMTB 4AX9H 3FZZA 1YBWA 5EXLA 1L4ZA 1LPKB 3RC5A 1DE7H 2FODA 1O2KA 2ZPSA 3U8RH 2WYJA 5DP7A 1WU1A 2W7UA 3QTOH 4IC6A 3F9GA 4K1EA 2AH4X 1LKBA 3SJ9A 3UUZA 1NTPA 1MTUA 3SU1A 1BA8B 1V2UT 2ESTE 1EAIA 3GCTG 4Q80A 3LDXH 1ZHMA 2PKAB 4XSKU 2PR3A 4FUFA 1AMHA 3KL6A 4ABDA 2ZTZA 3O8DA 4CREA 3PMHB 1T8OA 1YCPM 1MKXH 1O3FA 1LO6A 2BY5X 1PPGE 3SU6A 3V0XA 3GDVA 1A4WH 1SGPE 3UWJH 5DP5A 2AMDA 3PROA 1CVWH 2FLBH 3B8JA 1G3EA 5C1UA 1LVBA 1KDQB 3GY2A 4K3JA 1UTKA 2OBQA 1G32B 1A3EH 4RKOB 5AHGH 1NFXA 3RXOA 1TNJA 2HPPH 2IN2A 1Y3UA 3MO3A 3GYLB 3A85A 2FTLE 5EG4A 1FMGA 1ZTJA 4FU7A 1BBRE 2ZFTA 2CXVA 3KNXA 1IAUA 4O3TA 1NU9A 3M5LA 1GBBA 3RMOH 3I77A 1S85A 1IQLA 1CQQA 1E37B 2SGPE 1BB0B 2OBOA 3ZVAA 2QF3A 2TGDA 2Z3EA 3UQOA 3F6UH 1J9CH 1VITF 3MYWA 1C1VH 1QY6A 3M3TA 1SFQB 1WTHD 5JBBS 1C1SA 1K1IA 1MUEB 4H4FA 1V2RT 1M9UA 3SUGA 1T32A 4WF8A 1GMCG 4HGCA 2F9OA 1OXGA 1NRPH 1SB1H 3PMJA 4H6TA 1LQEA 1V3XA 2PKSB 1GI1A 1QIXB 1QJ7B 2Z6BD 1F92A 5AF9H 4CRFA 1LHCH 1VR1H 1AZZA 1TMBH 1SVPA 3PLBA 3T28A 4ISNA 3K6ZA 3BIUH 3S9CA 1MTSA 4WVPE 2FOMB 2AMPA 4X8UH 1SOZA 3AASA 1WBGB 3HKIB 5FCRA 2GDEH 3UTUH 3ZVEA 1EAXA 3LKWA 1T8NA 4K69A 2BDGA 2BMGB 1GJ6A 2FEQH 1EP6A 3VGCB 4B2AA 4D7FA 1ZMLA 4JYUH 2R2MB 1EB2A 1GDQA 4E05H 1TGBA 1DVAH 1O3PB 1A5HA 1C1QA 1D3PB 1TX6A 2FOEA 4NIWA 3UNRA 2HOBA 1AWHB 1PQ8A 1QL7A 5IYTA 1DITH 2I6SA 2FS9A 4O9VA 4BOHA 7KMEH 2BD3A 1C5LH 1TABE 2QF0A 4CH8B 4NZLA 8LPRA 1IQFA 2G52A 1HAHH 3AAVA 2GV7A 1FLEE 2ASUB 3AAUA 3MH4A 1ZMJA 1GJAB 1FONA 5F03A 4FUGA 1GMDG 1LMWB 2GVFA 1QA0A 1T8MA 1GHAG 1NT1A 2SFAA 2UWLA 3A80A 2BZAA 2WPIS 1TGNA 1N8OC 3L33A 1S83A 2H9TH 3LT3A 1GHYH 1ACBE 3E16B 2GCHG 2ZG0H 3BSQA 8ESTE 1QB9A 1YM0A 1O36A 5E0GA 2JKHA 2VVCA 3GY6A 4WWYA 3QDZB 1EQ9A 2VH0A 1CHOF 1OPHB 1DLEA 1TONA 3PO1B 1FY3A 1WTGH 1P06A 1BTXA 4A7IB 4MPVA 4DY7B 1HAYB 3OY6U 1NFUA 6LPRA 2H9HA 4OS4A 1RIWC 2VIDA 1TMUH 2PTNA 3QX5H 1GJ5H 2QV1A 1AVWA 3E1XB 2QXIA 1FNIA 5A09A 1QCPA 1OSSA 1GHWH 3SGQE 1S6FA 2BHGA 1ANCA 4WMDA 1MAYA 1O2HA 3STJA 1EJMA 2ANMH 3SORA 3LC5A 3MMGA 1WQSA 4CR9A 7GCHF 1RTFB 3GCOA 4DVAU 2BYAX 1O0DH 5GPIB 1QGFA 3R3GB 1XM1A 4UDWH 1MBQA 1GWAA 1IOEA 4ABIA 1S0RA 3ZZ9A 2SNVA 5C67A 1O5EH 4ABJA 5H4IB 2R9PA 4GHTA 2Z9LA 4FVDA 1N1LA 1TPSA 1ZSLA 1BJVA 3U9AH 1O5FH 2IJOB 4TWWA 2FXRA 3SV6A 1ZRBA 1EZSC 3VB4A 1QHRB 5SGAE 3FANA 1GHBG 1TMTH 4FUBA 1IQMA 2XYAA 1GJ9B 2H1UA 1GI6A 1G30B 2PWXA 5BPEA 3A82A 4Y0ZE 1UTQA 1C5MD 2EC9H 1THPB 1LPGB 5A8ZA 1V2TT 3I78A 4HI3A 2BQ7B 1L1GA 2A45B 1QA7A 2VVVA 1TX7A 1ELCA 2BDCA 2FOFA 2OP9A 3D62A 1YCPK 1AHTH 3ESTA 5EQQA 1P02A 2O8WA 2Z7FE 4FUEA 4ZAEA 1FPCH 1ZTKA 1FAKH 1FY5A 3AVZA 5FPYA 2ZNKH 4QT8C 3U1JB 1HJ8A 4ISIH 2RCEA 4WY3A 1GMCF 1XUIA 4A1VA 3SNEA 4I8JA 3JZ1B 4ISLA 3PWCA 3UWIA 2XBVA 2XC5A 4CRCA 1C2MA 1KLJH 5DGJA 3IITA 1QRZA 1PPFE 4CRBA 3A8AA 2QXJA 1B5GH 1L4DA 1VJAU 4KTCA 1NRQH 3A7WA 3LGVA 1CGHA 1RD3B 5DP6A 4SGAE 1AKSA 1MH0A 3E0NB 3RXTA 1SGCA 5A8YA 1IHTH 3U69H 4BTUB 2XRCA 3MO6A 5FPSA 1C5QA 1GBHA 2F9UA 4INKA 4DW2U 1K2I1 3P92A 3A86A 1A5GH 1THSH 1BTHH 1IQEA 5ESTE 1ESTA 4X0WU 1FDPA 5LH8A 1K22H 1BDAA 3RLWH 2ZCHP 2HPQH 3UIRA 2R0LA 4MPUA 1EZQA 1JWTA 2BD8A 1DWBH 2VIOA 2ZTYA 2JETC 3D65E 4CRDA 1F7ZA 1U6QA 3TK9A 1OKXA 3U8OH 1FJSA 4FUJA 1OWJA 2ZCKP 3KHVA 3RU4E 2OQ5A 1QJ1B 4ABFA 4JZDH 2VWOA 3ZZ8A 1F2SE 1S5SA 2H5CA 3SGAE 2P16A 4JCNA 2P93A 1YPGH 1TE0A 1D3DB 1XUFA 5EW1H 3FP7E 3S9AA 2NU3E 2ANYA 3GY7A 2PW8H 1RIWB 4ZMAH 1GMDF 2QY0B 1FY4A 1HAIH 4D8NA 3RXLA 1GCTC 3BN9A 4K8BA 2FOGA 1ELDE 2ODYB 3M3VA 4BTIB 1B0FA 2FS8A 1ZPZA 1HCGA 4AOQA 1RXPA 3E3TA 2YNAA 3ENSB 2FX6A 4K1SA 3W95A 3SZNA 1CBWB 1NPMA 4ABGA 1YKTA 1AIXH 2B0FA 3B9FH 5DP4A 2WPMS 1AB9B 3A81A 5JB8S 3MU8A 1AFQB 3P8OA 4GHQA 1DSUA 4F4OC 1FI8A 3ZZ4A 3ZZBA 1KXFA 3DFJA 2WUBA 3MU5A 1TGCA 2H6MA 4YO9A 4ZKSU 2P3TB 1TOCB 3H7OA 1W12U 1V2OT 2CGAA 2FYQA 1CGIE 2ZDMA 3M3SA 1XXFA 5A8XA 4YTAA 3RXCA 2FM2A 4NWLA 1FIZA 3BTME 1NN6A 1RGQA 2VB0A 1P3CA 1Q2WA 1HAPH 3Q3XA 2WPHS 1PQ5A 1O2GH 1VITG 2KAIB 4FU9A 1HAOH 1SLWB 4X8TH 1GGDC 1OP8A 2C8YB 2STBE 2FI4E 4ZHLU 2ZDVH 3KCGH 1FUJA 3MTYA 1AE5A 1O38A 1W0ZU 2ANKH 3SU4A 1Y5UT 3UOPA 4I8GA 2XC0A 1QB6A 3RXAA 1GI7B 4KKDA 1BQYA 1HAVB 1C5WB 1HAZB 3TNTA 1LHEH 1O3IA 1LVYA 2PHBA 3W94A 5L2YH 3S69A 1YYY1 4E7RG 1CSOE 4MNYA 1DY9A 4XOJA 1OWEA 3SJKA 4GSOA 1NC6A 1W7GH 2P59A 4LXBH 2BD7A 2JH6D 1BOQA 1GBEA 1C9PA 4NIVA 1P2OA 5CHAB 2EI6A 3M7UA 1SSXA 2GX4A 1GJ7B 1UO6A 1UVUH 2AIPA 4NFEA 1HGTH 1C2JA 3UFAA 1NRNH 4YZUA 2Y81A 2F9NA 3A88A 1WUNH 2PKSC 2FO9A 7LPRA 2ZDAH 4GLYA 5A2MH 1FY1A 1K1OA 2GZ9A 2OUAA 3A83A 3E91A 5DP3A 2BTCE 4Q7ZA 2FOBA 4NA9H 4OS6A 1VCWA 4WH6A 2CF8H 1GBAA 2ZPRA 1QB1A 1AVGH 1GJ4H 1S6HA 1O3CA 1TWXB 2JETB 1YLDA 1KYNA 1W8BH 1TPAE 2R2WU 1V2ST 1ELTA 1WAYB 2Y5GA 2HALA 1ABJH 4NCYA 1G36A 5A0BA 1ZPCA 4AGKA 1JRTA 3TIUA 1D4PB 1KXAA 5EXNA 1C2IA 3ZZ3A 1SMFE 1O31A 2NU0E 3BTGE 3KQBA 5HXFA 1E0FD 4AORA 1VCPA 1K9OE 2ZQ2A 5DKMA 1FY8E 2WUCA 1GI2A 1YPKH 4INLA 3RXSA 1C1TA 1QJ6B 2EI7A 1ELEE 4YT6H 1A2CH 1ZMNA 1CT4E 1ZZZA 1CHOG 1GCTB 3V3MA 4UE7H 5EU8A 1W13U 3DHKH 2ZFPH 1A61H 1UTNA 4IN2A 3GICB 2AERH 4TWYA 1K1JA 1OP0A 1Y3YA 3KN2A 3M35A 1ZGIA 1UVSH 3KEEA 3SU5A 2WINI 3M61U 1EX3A 4O03A 3O8RA 4MTBA 4BAQB 3RMMH 4Y8XA 4Y10E 1QTFA 2ZTXA 2Q6GA 1TPOA 3S7HB 2UWPA 2HLCA 4A92A 2ZHFH 2A2XH 7GCHG 1DWDH 4LZ4B 4FUDA 1RRKA 1A0LA 3TJNA 4HTCH 2F91A 2A4GA 4MQAA 4AYVB 1OWHA 4ZHAA 3NUMA 5C2ZA 3ZZ6A 4CH2B 3PO1C 1UTOA 4B71A 1G3BA 1QRXA 1ZJDA 1GGDB 3SJOA 1J8AA 3MH5A 2QXHA 4AN7A 3ODDA 5CE1A 3IWMA 4GAWA 2ANWA 1O2LA 3TGIE 5LPFA 1UVPA 4XBCA 6CHAB 1MTVA 1T4UH 1O2RA 1ANBA 1HLTH 4X2XA 3GDUA 4DG4A 1O37A 1O34A 1S82A 2A5KA 4K60A 1YPLH 4NSVA 1JIRA 3H5CB 1HXFH 1BIOA 1C9TA 2FOAA 4X6OA 5DPAA 9LPRA 3LONA 1CE5A 1O2ZA 2TIOA 3ATLA 4OS2A 1V2KT 2J4IA 3RDZA 4I7YH 1AFEH 2ZC9H 3K9XB 1VGCC 1Z7KA 5B6OA 1EAWA 2W26A 1ZHPA 2ZHWH 4MNVA 2OINA 2ZU3A 1EASA 1P01A 1QBOA 1ZSJA 2ALVA 1PYTD 2GV6A 1BRCE 1P10A 5C5NA 5JB9S 3BTTE 4O97A 2RDLA 1Y3XA 1FN6A 1W2KH 3ITIA 5JPMH 4AB8A 1IQGA 2BQ6B 1QL9A 2QA9E 3SO3A 2OC0A 3D49H 1S84A 1C5SA 1O3HA 1TLDA 1C2HA 2RA3A 5AVDA 3RMLH 3V13A 1EZUC 4Y6DA 1Y5BT 2FI3E 4DIIH 1P2MA 3RC4A 2GCTB 3T27A 4D9RA 2ZHDA 5FX6A 2ZGXH 1FQ3A 1GDUA 1GJBB 1LKAA 1SPJA 1YF4A 1G37A 2FTMA 4JMYA 5K0HA 5HGGA 3TH3H 2OQUA 1EAUA 3RXJA 3VB7A 2C8WB 3QGNB 4HFPB 4JYTA 2CV3A 3P6ZB 4NIYA 2PGBB 3KQEA 2VU8E 1MTNC 4ABHA 1THRH 1TRMA 4FU8A 4SGBE 4X1RU 1GVKB 2B9LA 4B2CA 2GGVB 1FZZA 4ISHH 4X1NU 2GD4B 1LHDH 1QFKH 1Z8IB 1TRNA 1UCYK 1GHXH 1LHFH 2WPJS 2XNIA 5FAHA 2C8XB 3TK6A 3LC3A 1K1MA 1PYTC 3F1SB 1MQ5A 3T29A 1HXEH 3GDSA 3OYPA 1ZOMA 1C5RA 1EPTA 2ZQ1A 1IQJA 5L6NH 1DUAA 1RTKA 1CGJE 1HAXB 1GMHF 3FAOA 2PTCE 4YOGA 2VWNA 5GIBA 1TNHA 4IC5A 1UTLM 1QBVH 3SV8A 1C1WH 5E2PA 2ZU5A 3CP7A 2QXGA 1N6XA 1EOJA 2F3CE 1GI3A 2FLRH 3HATH 3SBKA 2P3UB 1ELBA 3SUFA 4VGCC 1P04A 2BVSH 1GJDB 1SGNE 2HNTC 4Z0KA 1SLUB 3MH7A 5E2OA 4Q2KA 1GBTA 2SGAA 5FPTA 4E7NA 1O3MA 4FUCA 1KXDA 4INHA 1RJXB 1RS0A 1ZJKA 1AGJA 3FFGA 3VB3A 4R0IA 1DOJA 2AEIH 3P8NA 3TJVA 1GBFA 1V2WT 3TJUA 5F6MA 4RSPA 3KQDA 2PUXB 3VXFH 2J38A 8GCHG 1O3EA 2A4QA 1LVMA 1TX8A 2C3SA 4A6LA 1MU8B 4YOIA 4UFEH 2QCYA 4MPXA 3KQCA 3SNDA 3GCHC 1OYQA 2H2ZA 2OD3B 1SOTA 3SHCH 1A0JA 1CBWC 4MPWA 3EA9A 3PLKA 2FIRH 1O35A 2BDAA 4YESB 4AGJA 1AB9C 3CS7A 1HPGA 4AZ2B 1AFQC 4NA7A 2ODQA 1HB0B 3OY5U 3T2NA 2G8TA 3FP6E 1VGCB 4DJZB 1XUJA 2BM2A 1KSNA 1UK3A 3UQVA 2GP9B 2DE9A 3A8BA 2TGAA 3T62A 3A8DA 3EYDA 3FP8E 4FVBA 3T5FH 5F8ZA 5G4BA 3SV2H 1QBNA 1F0RA 2VIWA 2DE8A 2Q6DA 1Z1JA 3OTJE 3VB6A 4BAKB 3O8BA 3LU9B 1P3EA 4MDSA 4TPYA 1CHGA 2O8UA 3S0NA 4ASHA 4JK6A 5E8EH 3MU0A 1F5KU 1VZQH 4GPGA 1C5VA 2A0QB 3N7OA 3NZIA 3CENA 4AFUA 2SGQE 1P2NA 1EPTB 1Y3VA 4ZXYH 1DXWA 1XX9A 1MMJN 4B74A 1IHSH 1C5TA 2AIQA 1SBWA 3SJ8A 4BXWA 2VH6A 3KGPA 3ZYEA 3RXIA 2ZO3H 1SI5H 1JRSA 2P8OB 3PMBB 3RXQA 2WPKS 2BB4A 1WYKA 1MTNB 1WQVH 2G55A 3DA9B 3TPIZ 1PJPA 3SU2A 1INCA 3ZZ5A 3LGWA 1V2VT 1JBUH 4WH8A 3C27B 2V35A 4IGDA 3MNSA 1YCPH 1FXYA 3K6YA 3BEUA 1P8VC 5BRRE 1TGSZ 5CHAC 1FN8A 3M7TA 1Z1IA 4YLQH 1NU7B 3BTKE 2F9PA 2VIVA 1HIAA 3P8GA 2QAAA 8KME2 4NGAH 3EA7A 4IMZA 1OP2A 4JZEH 1ELVA 1KXEA 1HDTH 1OWKA 2FMJA 2JH5D 1Y59T 2R3YA 2ZGCA 1QR3E 4TYDA 3ZVGA 4BNRA 2Z9KA 4DIHH 3GY8A 2BY6X 3HGNA 4Z6AH 2R3UA 2ZPQA 4FUIA 1O5BB 1KXCA 2B8OH 1UVOA 1ABIH 3OSYA 1O5DH 1P0SH 3I29A 2O8LA 4VGCB 1AY6H 4YOJA 1ELAA 1ELFA 3FVFB 4OS1A 2VVUA 3QO6A 5C1YA 1ZHRA 2TGTA 2H9EH 1SQOA 2ZGBH 4K8YA 1SGFG 2ZDNA 3JZ2B 1BMMH 1G2LA 1JIMA 1WV7H 1AZ8A 1T4VH 1SLVB 2ZWLH 1P9UA 1YPEH 5T6GA 1HFDA 1FIWA 1Y5AT 4CRGA 4ABAA 3TVJB 1DS2E 5ABWA 1QURH 1K1NA 2H5DA 1DLKB 1N6YA 1ETTH 3VXEH 5GDSH 4IS5A 3BTEE 2OC7A 4AG2A 2ZFQH 2Z3CA 2J2UA 4BAOB 4OS7A 1TBQH 3EA8A 3GCHB 5C1XA 1MKWK 4DURA 1C2GA 1UTJA 4X1SU 4K5ZA 2UWOA 2XBXA 3DD2H 3HKJB 5FBIA 3BG8A 1XMNB 1ARBA 1IQHA 1QL8A 2WYGA 1UJ1A 3NWUA 2BQWB 4IN1A 3SW2B 4XFQA 1P05A 3HK3B 3QUMP 1L2EA 1P9SA 1G9IE 4KELA 3HK6B 2A2QH 2BXTH 2Y5HA 3MOCA 3STIA 3SI3H 2FWWA 3M37A 3KF2A 3MH6A 1PPBH 2CHAB 1ELGA 1GBJA 3A7TA 1HAGE 1TYNA 4OGYA 2BVXH 2Z9GA 2ULLA 2TPIZ 3BTWE 4WXIA 4X2VA 3Q00A 2W5EA 1MAXA 4D9QA 1ZRKA 8GCHF 1C2LA 3LIWA 2HWLB 1NZQH 3ZYDA 4Q7XA 3SNCA 6GCHF 3ODFA 3TNSA 1BHXF 1PPCE 2FX4A 3URDA 3EE0B 2IOTA 1V2JT 3Q3YA 2K1QA 3C1KA 1T7CA 1SG8B 3ATKA 1KY9A 1AKSB 1Z8JB 2Q1JA 3MI4A 2VIPA 1F0SA 1F5RA 6CHAC 4LK4A 1O2MA 4XBBA 2CF9H 2VIQA 1BMNH 1JXPA 4I32A 2BD2A 5CMXH 5DP8A 2UUYA 3UNQA 4F49A 3QTVH 1C1RA 2A4RA 2SGFE 2ODPA 1UTMA 1P2KA 3M36A 5T6DA 3RXGA 1HYLA 1GBCA 5C3NA 1B0EA 1NM6A 1LDTT 1TNGA 4I31A 4NFFA 2ZU1A 1DUEA 2EA3A 1KLTA 5DO4H 1Z8RA 1SHHB 1DDJA 3MU1A 5DG6A 2PKAA 1BMAA 1DXPA 1NFWA 3ATWA 1TIOA 4Y79A 1OYTH 1C4U2 1O3LA 1ORFA 2ZHEH 1EJNA 2VGCB 1NFYA 3U1IB 1K1LA 1O39A 1H8IH 1CT0E 1F0UA 2LPRA 1SQTA 3P8FA 2BLVA 3RP2A 4ABBA 1C1PA 1V2MT 2A7HA 3SUEA 4K1TA 3LOXA 4X1PU 2Y7XA 3PV4A 2Y5FA 3SNAA 5C5OA 1IQKA 2TRMA 3PM3A 4OGXA 5K7RA 1K21H 4O3UA 1GI0A 1MD8A 2GCTC 3LGUA 2QN5T 1BMLA 2A5AA 3AW0A 1GMHG 1Q31A 2ZCLP 4D7GA 5LPEA 1D3TB 2HNTE 3Q77A 4AFSA 3KIDU 1GBDA 1AUTC 1BCUH 5JBAS 1ETRH 1K1PA 1VCQA 1EOLA 3ZZ7A 2EI8A 4LOYH 4ESTE 4AG1A 4X6PA 5AFZH 3URCA 1ZLRA 3TH2H 1HRTH 3LPRA 1C5UA 5JBTA 1BRUP 5ESBA 2PSYA 1XKAC 1SQAA 1C5PA 2FOCA 1MCVA 1OWIA 3GYMA 3VEQB 2GTBA 2UUJB 4FXGH 1AO5A 3A84A 3SGBE 4CBNA 1H9HE 3E0PB 4DCDA 2CJIA 1AE8H 1AN1E 4YLUA 1RFNA 1C2FA 2ZF0H 3ZVCA 4OS5A 1GBIA 3MNXA 2TBSA 1ANDA 1V2LT 4YM9A 2J95A 3VPKA 2B7DH 1DT2A 2W3IA 3UR6A 1TPPA 1BZXE 4CR5A 3BIVH 1JMOH 1TA6A 2VJ1A 3BV9B 1ANEA 4GCHG 1O2JA 3ZZCA 5F8TA 1XUHA 1GI4A 2Y82A 4PROA 1O32A 4NSYA 1GJCB 2UUKB 1MTWA 5PTPA 1E36B 1HJAB 3RM0H 1MD7A 1MKXK 1O3KA 1J14A 1O2PA 1Z6JH 4Y7BA 5TCAA 4DGJA 2GT8A 3SV7A 3OU0A 1GHVH 1NRRH 2V0BA 4TY7A 1DFPA 1GDNA 1EB1H 3TH4H 1O2OA 2D26C 2XBYA 3E90B 2RG3A 2SGDE 2D1JA 4HZHA 1W14U 2OTVA 1GHZA 1J17T 1XKBC 3CS0A 2XCNA 1BRAA 3GOVB 5JBCS 2FYRA 1ID5H 4UONA 2Z9JA 2ZU2A 5GXPA 1TAWA 1XVOA 2D2DA 1NROH 4Y11E 4X2WA 3LGTA 3UR9A 1ESBA 2BY7X 1QQ4A 4H42U 2AGGX 1J15A 3QWCH 1E34B 1O2NA 1AUJA 4AFZA 2HRVA 3T25A 1MZAA 5DK1A 5EGMA 2OLGA 1P03A 3S9BA 1GG6B 4NIXA 2OXSA 3MU4A 4H6SB 1O3JA 1UVTH 3ZV8A 5FCKA 4I33A 4AFQA 1C4Y2 4B75A 1RTLA 1TOMH 3U98H 4NZQA 1EUFA 3ZV9A 1A7SA 4ZXXH 4Q7YA 1WSSH 1O2SA 2O9QA 3GY5A 2QIQA 2PFEA 2WPLS 1EKBB 3BF6H 3U8TH 1PFXC 2AGIX 4CHAB 1YPHC 1B7XB 4X1QU 2VINA 4AB9A 3A7ZA 1O2VA 4XBDA 4Y71A 3EQ0H 4LZ1H 1GBMA 3RMNH 3RXRA 3SI4H 2AMQA 5GCHG 4UFDH 1NESE 4XE4A 1BITA 1SGQE 3PTNA 1EPTC 3SNBA 2C93B 2P3FH 5TJXA 2BLOA 2JH0D 1S81A 3LGYA 3NCLA 2BY8X 3EDXB 3P17H 1P11E 3LH3A 1F0TA 1DX5M 1L1NA 3B23B 3Q3KA 4R8TB 1AQ7A 2QGRA 1UK4A 5EQRA 3DFLA 3RXUA 2ZFSA 2P8OC 1BTUA 3IG6B 2NU4E 1BUIA 5F8XA 1V6DA 5EODA 1H9LB 4TPIZ 2BOHB 3RXDA 1GJ8B 4X6MA 2BDYA 5T6FA 2XW9A 3SU3A 1S0QA 3Q76A 4X8SH 1XXDA 3M5MA 1ZPBA 4DOQA 2I6QA 3QN7A 4MG3A 2A7CA 2A5IA 4ZKOU 2G00A 3LH1A 1C5ZB 4IBLH 1C2DA 1KIGH 1TB6H 1P2JA 3ZVFA 2BX4A 5IDKA 1ZSKA 1AU8A 2ZP0H 2G51A 1DICA 1O2XA 1G3DA 3MO9A 1BT7A 1PQAA 1MU6B 1TA2A 1V2QT 3BTHE 3F9EA 3RM2H 5TCCA 3LJJA 2VNTA 4A1TA 3WY8A 4DT7B 1Y8TA 4B2BA 4Y7AA 3LJOA 3E8LA 5DP9A 3UY9A 1UCYH 3ZVBA 1UK2A 3K65B 4E06H 3ELAH 5LPRA 5C20A 3A89A 1LTOA 3MNCA 2AYWA 1W0YH 4D76A 3TK5A 4MVNA 1D9IA 4ZHMU 1LQDB 2STAE 2W7SA 2NWNA 3BEIB 1KTSB 1BTWA 5FBEA 2HVXA 2PV9B 1P57B 3RXVA 2B5TB 3ZZDA 1EATA 2AGEX 1QRWA 1C5YB 1P12E 3BTFE 1Z6EA 3RUOA 3SUDA 2XWAA 2ZFFH 1SGEE 4KTUA 2GZ8A 3UOUA 2ZIQH 5JDUB 3NK8A 4JZFH 4BAHB 1DANH 4Y76A 1C1NA 1H8DH 2AS9A 1PQ7A 1TFXA 1HJ9A 2BDHA 2OC8A 6GCHG 1O3OA 4Y8ZA 3DUXH 4GCHF 1D3QB 3LGIA 3ATMA 3SU0A 3TGKE 3A7XA 2ZA5A 2AFQB 2J34A 4KP0A 1H1BA 4JZ1A 3TGJE 1O2IA 2VWMA 4X8VH 1G2MA 1OOKB 1BTZA 4B76A 3TJOA 3ZZAA 3UREA 3BEFB 1TBZH 1CA0C 2CHAC 3GCTF 1O5CB 1C1OA 2C8ZB 2ZZUH 1YC0A 4I8KA 4BTTB 4WMEA 1EJAA 1TALA 4IW4E 1GI8B 1O3GA 4BAMB 1NS3A 3V7TA 2A1DB 3NXPA 1HBTH 4X2YA 1W11U 2O8TA 4MNXA 5J4QA 2J94A 3PB1E 2Y80A 2Z3DA 3MFJA 2NU2E 3BG4C 2PSXA 3M5OA 3OX7U 1ESAA 2DUCA 4AYYB 1C2KA 1GI9B 1QNJA 5E0HA 5A0AE 3RXFA 2F9BH 3A7VA 2ZI2H 5AFYH 1CU1A 4I8LA 3UPEA 1H9IE 2FDAA 2Z9IA 9ESTA 1MBMA 2HGTH 3PLPA 1TRYA 5EQSA 1SGIB 3FZDA 4UD9H 2SNWA 5L2ZH 1YPJH 1DWCH 2FOHA 3SQEE 2BD4A 2GKVE 3R0FA 1LPZB 3F9FA 1NO9H 4ABEA 1CA8B 3AW1A 1WOFA 2IPHA 3GY4A 2CMYA 2GDDA 1GVLA 4U30A 4JYVH 2ZU4A 1YLCA 5ETXA 3RXPA 5JYIA 2BD5A 1FPHH 1HUTH 2P94A 3H7TA 4WMFA 1TQ7B 2XC4A 2A31A 1CT2E 5HM9A 1A46H 1SGRE 5A0CA 4BANB 2O8MA 1GPZA 3MHWU 3RLYH 1FV9A 5GCHF 3HGPA 5FHTA 2BX3A 3QK1A 3SQHE 3UNSA 1GI5A 1BHXB 2VGCC 4KTSA 3M5NA 1O5GH 1AVXA 3GCNA 1T8LA 4U2WA 2ZGJA 2ILNA 1EP5A 1DWEH 2A4OA 1BTPA 1W7XH 1DSTA 1GCDA 4UFFH 1UCYE 3K2UA 1ZYOA 1O3AA 3P70B 2KAIA 4CBOA 4JK5A 1GL0E 2A32A 1C5OH 5HMAA 3QLPH 1PPEE 4Y8YA 6ESTA 5E0JA 1F5LA 1UMAH 5T3HA 1SGFA 5EPYA 2WV5A 1JOUB 4ZKRU 3SV9A 3MNBA 3RC6A 3RU4T 4RKJB 1KTTB 3F9HA 2ALPA 1HAVA 3F68H 1VJ9U 1V2PT 4CRAA 3RXBA 1N8OB 4I8HA 1P2QA 4BXSA 1LHGH 3QGJA 1V2NT 2XCFA 2G4UA 3SN8A 2VWLA 1O2QA 4Y0YE 1C5XB 1GBKA 2G5VA 4RN6A 1HV7A 2WV4A 3L6PA 1EXFA 1E35B 3TU7H 2BZ6H 1GL1A 2CN0H 4ZH8A 3PWBA 3TLOA 5J4SA 4NA8A 1IQNA 1O3DA 1DY8A 1OX1A 1AWFH 2ZEBA 4J2YB 2TGPZ 3TITA 1D6WA 1J16A 1O33A 1O5AB 4UEHH 3VFEA 1BTYA 1QQUA 1AI8H 1O3NA 4NWKA 4ZKNU 7ESTE 5EOKA 1MCTA 1GBLA 2V6NA 1A0HB 2ZKSA 1C1MA 1NRSH 2ZDKA 2SGEE 4ZROA 1GHAF 3SOSA 2V3HH 2GMTC 1SGTA 1CA0B 2XXLA 4WXVA 5EW2H 3QZRA 2QC2A 2PLXA 2YNBA 3RXKA 1O3BA 1C5NH 1HJAC 2BY9X 1UHBA 1IQIA 1MKWH 2GCHF 2D8WA 4KGAA 4GVUA 2BDIA 2FPZA 2Y6TA 1TGTA 3P95A 3GISB 1TBRH 2G5NA 1YPHE 2F83A 1SGDE 3PTBA 2J9NA 2QYIA 1SHYA 1DM4B 4IMQA 3HPTB 1W3CA 1P2IA 1OWDA 2W3KA 2OC1A 1CO7E 2UUFB 3BG4B 2P95A 5LGOA 1ETSH 1BRBE 2C4FH 4K2YA 3PMAB 1HIAB 5GWZA 3EAJA 3RXEA 1O2TA 3NPSA 1SFIA 3QZQA 1SGYE 5FX5A 3ZVDA 1FAXA 2ZDLA 4U32A 2OCVB 2A7JA 2C90B 2LNCA 1XUGA 1YPMH 2F9VA 2THFB 4B1TA 4ISOA 1T31A 4J1YA 2FESH 1H4WA 1EZXC 2Y7ZA 1BBRK 2NU1E 1A5IA 1LVOA 3SJIA 3MWIU 1YP9A 2J92A 3RXMA 1O2UA 1GG6C 1YGCH 1Y3WA 1MZDA 1L0ZA 1SC8U 3ATIA 5I25A 1O2YA 1W10U 2ZHQH 1PPHE 1TNKA 4MLFB 2G4TA 3M7QA 1G3CA 1X7AC 2FI5E 3G01A 1KXBA 2BD9A 1Q3XA 2GZ7A 2HNTF 2BLQA 3S7KB 1P09A 3GY3A 4UFGH 2BLWA 1BBRH 1ARCA 1GVZA 4CHAC 1HNEE 1Z8GA 4GUXA 1SR5C 4TY6A 4U01A 3SHAH 3T26A 5L30H 2BVRH 1ZTLA 1GHBF 2ZGHA 3A8CA 1DPOA 4FUHA 1Z71A 5DJ7A 1LCYA 1XVMA 3L3TA 1SLXB 4JZIA 1C4V2 1O2WA 2Z94A 2ZECA 3D23A 4YT7H 5I46H 1A3BH 1KDQA 5GJ4B 3PYHA 5HYOA 1E38B 2PUQH 2EEKA 1BJUA 1PPZA 1ZGVA 5EXMA 3VB5A 3DT0H 4MNWA 1C2EA 2XBWA 1L1JA 1NY22 3E6PH 1SL3A 2BDBA 2BXUH 5EPNA 1UHBB 1KLIH 3BTDE 2BOKA 1ZR0A 2Q6FA 5FXLA 2G81E 3O8CA 1VITH 4X6NA 4ZUHA 3RU4D 1XUKA 4M7GA 1TQ0B 1MQ6A
chains in the Genus database with same CATH superfamily
4THNH 4NG9H 3NKKA 1K28D 3VGCC 2GT7A 4XDEA 4WJG2 1A1RA 1AD8H 1YLNA 2FP7B 1WCZA 3BTQE 2ZFRH 2YOLA 1TNLA 2RA0A 4A5TS 1D6RA 3RXHA 4A1XA 2XTTB 1UTPA 2R0KA 2V3OH 1O30A 3EGKH 2PGQB 2XWBI 1SQRA 3A7YA 2YMSC 2FZZA 5HM2A 3V12A 1TNIA 2M5TA 2XOKD 4B73A 1C1UH 1OS8A 2LELA 3A87A 2GMTB 4AX9H 3FZZA 1YBWA 5EXLA 1L4ZA 1LPKB 3RC5A 4ASUD 5C94A 4XRNA 1DE7H 2FODA 2JJ2D 1O2KA 2ZPSA 3DCLA 2WYJA 3U8RH 5DP7A 1WU1A 2W7UA 3QTOH 4IC6A 3F9GA 4K1EA 2AH4X 1LKBA 3SJ9A 3UUZA 1NTPA 1MTUA 3SU1A 1BA8B 1V2UT 2ESTE 1EAIA 3GCTG 4Q80A 3LDXH 1ZHMA 2PKAB 4TT3D 4XSKU 2PR3A 1KMHB 4FUFA 3WWBA 1AMHA 3KL6A 4ABDA 1WXRA 2ZTZA 3O8DA 4CREA 3PMHB 1T8OA 1YCPM 1MKXH 1O3FA 1LO6A 1FX0B 1PPGE 2BY5X 3SU6A 3V0XA 3GDVA 1A4WH 1SGPE 3UWJH 5DP5A 2AMDA 3PROA 1CVWH 2FLBH 3B8JA 1G3EA 5C1UA 1LVBA 1KDQB 3GY2A 4K3JA 1UTKA 2OBQA 1G32B 1E1RD 1A3EH 4RKOB 5AHGH 1NFXA 3RXOA 3DSPA 1TNJA 2HPPH 2IN2A 3OE7D 1Y3UA 3MO3A 3GYLB 3A85A 2FTLE 5EG4A 1FMGA 1ZTJA 4FU7A 1BBRE 2ZFTA 2CXVA 3KNXA 1IAUA 4O3TA 1NU9A 3M5LA 1GBBA 3RMOH 4RT0A 3I77A 1S85A 1IQLA 1CQQA 1E37B 2SGPE 1BB0B 2OBOA 3ZVAA 2QF3A 2TGDA 2Z3EA 3UQOA 3F6UH 1J9CH 1VITF 3MYWA 1C1VH 1QY6A 3M3TA 3FN8A 1SFQB 1WTHD 5JBBS 1C1SA 1K1IA 1MUEB 4H4FA 1V2RT 1M9UA 3SUGA 1T32A 4WF8A 1GMCG 4HGCA 2F9OA 1OXGA 5KEDA 1NRPH 1SB1H 3PMJA 4H6TA 1LQEA 1V3XA 2PKSB 1GI1A 1QIXB 1QJ7B 2Z6BD 1F92A 5AF9H 4CRFA 1LHCH 1VR1H 1AZZA 1TMBH 1SVPA 2J97A 3PLBA 3N7EA 3T28A 4ISNA 2AHME 3K6ZA 3MQKC 3BIUH 3S9CA 1MTSA 4WVPE 2FOMB 2AMPA 4X8UH 1SOZA 3AASA 1WBGB 3HKIB 5FCRA 2GDEH 3UTUH 3ZVEA 1EAXA 3LKWA 1T8NA 4K69A 2BDGA 2BMGB 1GJ6A 2FEQH 1EP6A 3VGCB 4B2AA 4D7FA 5T1VA 1ZMLA 4JYUH 2R2MB 1EB2A 1GDQA 4E05H 1TGBA 1DVAH 1O3PB 1A5HA 1C1QA 1D3PB 1TX6A 2FOEA 4NIWA 3UNRA 2HOBA 1AWHB 1PQ8A 1QL7A 5IYTA 1DITH 2I6SA 2FS9A 4O9VA 4BOHA 7KMEH 2BD3A 1C5LH 5C0UA 1TABE 2QF0A 4CH8B 4NZLA 8LPRA 1IQFA 2G52A 1HAHH 3AAVA 2GV7A 1FLEE 2ASUB 3AAUA 3MH4A 1ZMJA 1GJAB 1FONA 5F03A 4FUGA 1GMDG 1LMWB 2GVFA 1QA0A 1T8MA 1GHAG 1NT1A 2SFAA 2UWLA 3A80A 2BZAA 2WPIS 1TGNA 1N8OC 3L33A 1S83A 2H9TH 3LT3A 1GHYH 3FOAA 1ACBE 3E16B 2GCHG 2ZG0H 3BSQA 8ESTE 1QB9A 1YM0A 1O36A 5E0GA 2KR7A 2JKHA 2VVCA 3GY6A 3OEED 4WWYA 3QDZB 1EQ9A 2VH0A 1CHOF 1OPHB 1DLEA 1TONA 3PO1B 1FY3A 1WTGH 1P06A 1BTXA 4A7IB 1SKYE 4MPVA 4DY7B 1HAYB 3OY6U 1NFUA 6LPRA 2H9HA 4OS4A 1RIWC 2VIDA 1TMUH 2PTNA 3QX5H 1GJ5H 2QV1A 1AVWA 3E1XB 2QXIA 5HIZA 1FNIA 5A09A 1QCPA 4RI0A 1OSSA 1GHWH 3SGQE 1S6FA 2BHGA 1ANCA 4WMDA 1MAYA 1O2HA 3STJA 1EJMA 2ANMH 3SORA 3LC5A 3MMGA 1WQSA 3PRDA 4CR9A 7GCHF 1RTFB 3GCOA 4DVAU 2BYAX 1O0DH 5GPIB 1QGFA 3R3GB 1XM1A 4UDWH 3OFND 1MBQA 1GWAA 1IOEA 4ABIA 1S0RA 3ZZ9A 2SNVA 5C67A 1O5EH 4ABJA 5H4IB 2R9PA 4GHTA 3WWFA 2Z9LA 4FVDA 1N1LA 1TPSA 1ZSLA 1BJVA 3U9AH 1O5FH 2IJOB 4TWWA 2FXRA 3SV6A 1ZRBA 1EZSC 3VB4A 1QHRB 5SGAE 3FANA 1GHBG 1TMTH 4FUBA 1IQMA 2XYAA 1GJ9B 2H1UA 1GI6A 1G30B 2PWXA 5BPEA 3A82A 3F3BA 4Y0ZE 1UTQA 1C5MD 2EC9H 1THPB 1LPGB 5A8ZA 1V2TT 3I78A 4HI3A 3EE7A 2BQ7B 1L1GA 2A45B 1QA7A 2VVVA 5DN6D 1TX7A 1ELCA 2BDCA 2FOFA 2OP9A 3D62A 1YCPK 1AHTH 3ESTA 5EQQA 1P02A 2O8WA 2Z7FE 4FUEA 4ZAEA 1FPCH 1ZTKA 1FAKH 1FY5A 3AVZA 5FPYA 2ZNKH 4QT8C 3U1JB 1HJ8A 4ISIH 2RCEA 4WY3A 1GMCF 1XUIA 4A1VA 3SNEA 4FETA 4I8JA 3JZ1B 4ISLA 3PWCA 3UWIA 2XBVA 2XC5A 4CRCA 1C2MA 1KLJH 5DGJA 3IITA 1QRZA 4ACAA 1PPFE 4CRBA 3A8AA 2QXJA 1B5GH 1L4DA 1VJAU 2F43B 4KTCA 1NRQH 3A7WA 3LGVA 1CGHA 1RD3B 5DP6A 4AC9A 4SGAE 1AKSA 1MH0A 3E0NB 3RXTA 1SGCA 5A8YA 1IHTH 3U69H 4BTUB 2XRCA 3MO6A 5FPSA 1C5QA 1GBHA 2F9UA 4INKA 4DW2U 1K2I1 3P92A 3A86A 1A5GH 1THSH 1BTHH 1IQEA 5ESTE 1ESTA 4X0WU 1FDPA 5LH8A 1K22H 1BDAA 3RLWH 2ZCHP 2HPQH 3UIRA 2R0LA 4MPUA 1EZQA 1JWTA 2BD8A 1DWBH 2VIOA 2ZTYA 2JETC 3D65E 4CRDA 1F7ZA 1U6QA 3TK9A 1OKXA 3U8OH 1FJSA 4FUJA 1OWJA 2ZCKP 1NBME 3KHVA 3RU4E 2OQ5A 1QJ1B 4ABFA 4JZDH 2VWOA 3ZZ8A 1F2SE 1S5SA 2H5CA 3SGAE 2P16A 4JCNA 2P93A 1YWUA 1YPGH 1TE0A 1D3DB 1XUFA 5EW1H 3FP7E 3S9AA 2NU3E 5C17A 2ANYA 3GY7A 2PW8H 1RIWB 4ZMAH 1GMDF 2QY0B 1FY4A 1HAIH 4D8NA 3RXLA 1GCTC 3BN9A 4K8BA 2FOGA 1ELDE 2ODYB 3M3VA 4BTIB 1B0FA 2FS8A 1ZPZA 3OEHD 1HCGA 4AOQA 1RXPA 3E3TA 2YNAA 3ENSB 2FX6A 4K1SA 3W95A 3SZNA 1CBWB 1NPMA 4ABGA 1YKTA 1AIXH 2B0FA 3B9FH 5DP4A 2WPMS 1AB9B 3A81A 5JB8S 3MU8A 1AFQB 3P8OA 4GHQA 1DSUA 4F4OC 1FI8A 3ZZ4A 3ZZBA 1KXFA 3DFJA 2WUBA 3MU5A 1TGCA 2H6MA 4YO9A 4ZKSU 2P3TB 1TOCB 3H7OA 1W12U 1V2OT 2CGAA 2JJ1D 2FYQA 1CGIE 2ZDMA 3M3SA 2L6OA 1XXFA 5A8XA 4YTAA 3RXCA 2FM2A 4NWLA 1FIZA 3BTME 1NN6A 1RGQA 2VB0A 1P3CA 1Q2WA 1HAPH 3Q3XA 2WPHS 1PQ5A 1O2GH 1VITG 2KAIB 4FU9A 1HAOH 1SLWB 4X8TH 1GGDC 1OP8A 2C8YB 2STBE 2FI4E 4ZHLU 2ZDVH 3KCGH 1FUJA 3MTYA 1AE5A 1O38A 1W0ZU 2ANKH 4P00A 3SU4A 1Y5UT 3UOPA 4I8GA 2XC0A 1QB6A 5F53A 3RXAA 1GI7B 4KKDA 1BQYA 1HAVB 1C5WB 1HAZB 3TNTA 1LHEH 1O3IA 1LVYA 4B6FA 2PHBA 3W94A 5L2YH 3S69A 1YYY1 4E7RG 1CSOE 4MNYA 1DY9A 4XOJA 1OWEA 3SJKA 4GSOA 1NC6A 1W7GH 2P59A 4LXBH 2BD7A 2JH6D 1BOQA 1GBEA 1C9PA 4NIVA 1P2OA 5CHAB 2EI6A 3M7UA 1SSXA 2GX4A 1GJ7B 1UO6A 1UVUH 2AIPA 4NFEA 1HGTH 1C2JA 3UFAA 1NRNH 4YZUA 2Y81A 2F9NA 3A88A 1WUNH 2PKSC 2FO9A 7LPRA 2ZDAH 4GLYA 3VG8A 5A2MH 1FY1A 2KM0A 1K1OA 2GZ9A 2OUAA 3A83A 3E91A 5DP3A 2BTCE 4Q7ZA 1E1QD 2FOBA 4NA9H 4OS6A 1VCWA 4WH6A 2CF8H 1GBAA 2ZPRA 1QB1A 3PRBA 1AVGH 1GJ4H 4ACBA 1S6HA 1O3CA 1TWXB 2JETB 1YLDA 1KYNA 1W8BH 1TPAE 2R2WU 1V2ST 1ELTA 1WAYB 2Y5GA 2HALA 1ABJH 4NCYA 1G36A 5A0BA 2W6ID 1ZPCA 4AGKA 1JRTA 3TIUA 1D4PB 1KXAA 5EXNA 1C2IA 3ZZ3A 1SMFE 1O31A 2NU0E 3BTGE 3KQBA 5HXFA 1E0FD 4AORA 1VCPA 1K9OE 2ZQ2A 5DKMA 1FY8E 2WUCA 5KECA 1GI2A 1YPKH 4INLA 3RXSA 1C1TA 1QJ6B 4I86A 2EI7A 1ELEE 4YT6H 1A2CH 1ZMNA 1CT4E 1ZZZA 1CHOG 1GCTB 3V3MA 4UE7H 5EU8A 1W13U 3DHKH 2ZFPH 1A61H 1UTNA 3NRLA 4IN2A 2KCPA 3GICB 2AERH 4TWYA 1K1JA 1OP0A 1Y3YA 3KN2A 3M35A 1ZGIA 2WSSD 1UVSH 3KEEA 4HG6A 3SU5A 2WINI 3M61U 1EX3A 4O03A 3O8RA 4MTBA 4BAQB 3RMMH 4Y8XA 4Y10E 1QTFA 3UAIC 2ZTXA 2Q6GA 1TPOA 3S7HB 2UWPA 2HLCA 4A92A 2ZHFH 2A2XH 7GCHG 1DWDH 4LZ4B 4FUDA 1RRKA 2HLDD 1A0LA 3TJNA 4HTCH 2F91A 2A4GA 4MQAA 4AYVB 1OWHA 4ZHAA 3NUMA 5C2ZA 3ZZ6A 4CH2B 3PO1C 1UTOA 4B71A 1G3BA 1QRXA 1ZJDA 1GGDB 3SJOA 1J8AA 3MH5A 2QXHA 4AN7A 3ODDA 5CE1A 3IWMA 4RT1A 4GAWA 2ANWA 1O2LA 3TGIE 5LPFA 1UVPA 4XBCA 6CHAB 1MTVA 1T4UH 1O2RA 1ANBA 1HLTH 4X2XA 3GDUA 4DG4A 1O37A 1EFRD 2A5KA 1O34A 1S82A 4K60A 1YPLH 4NSVA 1JIRA 3H5CB 1HXFH 3CNRA 1BIOA 1C9TA 2FOAA 4X6OA 5DPAA 9LPRA 3LONA 1CE5A 4F55A 1O2ZA 2TIOA 3ATLA 4OS2A 1V2KT 2J4IA 3RDZA 4I7YH 1AFEH 2ZC9H 3K9XB 1VGCC 1Z7KA 5B6OA 1EAWA 2W26A 1ZHPA 2ZHWH 4MNVA 2OINA 2ZU3A 1EASA 1P01A 1QBOA 1ZSJA 2ALVA 1PYTD 2GV6A 1BRCE 1P10A 5C5NA 5JB9S 3W1EA 3BTTE 4F48B 4O97A 2RDLA 3GS9A 1Y3XA 1FN6A 1W2KH 5EJZA 3ITIA 5JPMH 4AB8A 1IQGA 2BQ6B 1QL9A 2QA9E 3SO3A 2LP6A 2OC0A 3D49H 1S84A 1C5SA 3KYFA 1O3HA 1TLDA 1C2HA 2RA3A 5AVDA 3RMLH 3V13A 5KGOA 1EZUC 4Y6DA 1Y5BT 2FI3E 4DIIH 1P2MA 3RC4A 2GCTB 3T27A 4D9RA 2ZHDA 5FX6A 2ZGXH 3KYGA 1FQ3A 1GDUA 1GJBB 1QZ8A 1LKAA 1SPJA 1YF4A 1G37A 2FTMA 4JMYA 5K0HA 5HGGA 3TH3H 2OQUA 1EAUA 3RXJA 3VB7A 5B6LA 2C8WB 3QGNB 4HFPB 4JYTA 2CV3A 3P6ZB 4NIYA 2PGBB 3KQEA 2VU8E 1MTNC 4ABHA 1THRH 1TRMA 4FU8A 4SGBE 4X1RU 1GVKB 2B9LA 4B2CA 2GGVB 2V7QD 1FZZA 4ISHH 4X1NU 2GD4B 4YXWD 1LHDH 1QFKH 1Z8IB 1TRNA 1UCYK 1GHXH 1LHFH 2WPJS 2XNIA 5FAHA 2C8XB 4DT4A 3TK6A 3LC3A 1K1MA 1PYTC 3F1SB 1MQ5A 3T29A 1HXEH 3GDSA 3OYPA 1ZOMA 1C5RA 1EPTA 2ZQ1A 1IQJA 5L6NH 1DUAA 1RTKA 1CGJE 1HAXB 1GMHF 3FAOA 1BMFD 2PTCE 4YOGA 2VWNA 5GIBA 1TNHA 4IC5A 1UTLM 1QBVH 3SV8A 1C1WH 5E2PA 2ZU5A 3CP7A 2QXGA 1N6XA 1EOJA 3FKSD 2F3CE 1GI3A 2FLRH 3HATH 3SBKA 2P3UB 1ELBA 3SUFA 4VGCC 1P04A 2BVSH 1GJDB 1SGNE 2HNTC 4Z0KA 1SLUB 3MH7A 5E2OA 4Q2KA 1GBTA 2SGAA 5FPTA 4E7NA 1O3MA 4FUCA 1KXDA 1W0JD 4INHA 1RJXB 1RS0A 1ZJKA 1AGJA 3FFGA 3VB3A 4R0IA 1DOJA 2AEIH 3P8NA 3TJVA 1GBFA 1V2WT 3TJUA 5F6MA 4RSPA 3KQDA 3DSGA 2PUXB 3VXFH 2J38A 2V3MA 8GCHG 1O3EA 2A4QA 2F4LA 1LVMA 1TX8A 2C3SA 4A6LA 1MU8B 4YOIA 4UFEH 2QCYA 4MPXA 3KQCA 3SNDA 3GCHC 1OYQA 2H2ZA 2OD3B 1SOTA 2IJD1 3SHCH 1A0JA 1CBWC 4MPWA 3EA9A 3PLKA 2FIRH 1O35A 2BDAA 4YESB 4AGJA 1AB9C 3CS7A 1HPGA 4AZ2B 1AFQC 4NA7A 2ODQA 1HB0B 2JDID 3OY5U 3T2NA 2G8TA 3FP6E 1VGCB 4DJZB 1XUJA 2BM2A 1KSNA 1UK3A 3UQVA 2GP9B 2DE9A 3A8BA 2TGAA 3T62A 3A8DA 3EYDA 3FP8E 4FVBA 3T5FH 5F8ZA 5G4BA 3SV2H 1QBNA 1F0RA 2VIWA 2DE8A 2Q6DA 1Z1JA 3OTJE 3VB6A 4BAKB 3O8BA 3LU9B 1P3EA 4MDSA 2QF4A 4TPYA 1CHGA 2O8UA 3S0NA 4ASHA 4JK6A 5E8EH 3MU0A 1F5KU 1VZQH 4GPGA 1C5VA 2A0QB 3N7OA 4OM9A 3NZIA 3CENA 4AFUA 2SGQE 1P2NA 1EPTB 1Y3VA 4ZXYH 1DXWA 1XX9A 1MMJN 4B74A 1IHSH 1C5TA 2AIQA 1SBWA 3SJ8A 4BXWA 2VH6A 2VBCA 3KGPA 3ZYEA 3RXIA 2ZO3H 1SI5H 1JRSA 2P8OB 3PMBB 3RXQA 2WPKS 4XD7D 1W0KD 2BB4A 1WYKA 1MTNB 1WQVH 2G55A 3DA9B 3TPIZ 1PJPA 3F0PA 3SU2A 1INCA 3ZZ5A 1H8HD 3LGWA 1V2VT 1JBUH 4WH8A 3C27B 2V35A 4IGDA 3MNSA 1YCPH 1FXYA 3K6YA 3BEUA 2KFWA 1P8VC 5BRRE 1TGSZ 5CHAC 1FN8A 2L74A 2W6JD 3M7TA 2QE7D 1Z1IA 4YLQH 1NU7B 3BTKE 2F9PA 2VIVA 1HIAA 3P8GA 4Q4LA 2QAAA 8KME2 4NGAH 3EA7A 4IMZA 1OP2A 4JZEH 1ELVA 1KXEA 1HDTH 1OWKA 2FMJA 2JH5D 1Y59T 2R3YA 2WPDD 2ZGCA 1QR3E 4TYDA 2HVYB 3ZVGA 4BNRA 3OTPA 2Z9KA 4DIHH 3GY8A 2BY6X 3HGNA 4Z6AH 2R3UA 2ZPQA 4FUIA 5IK2D 1O5BB 1KXCA 2B8OH 1UVOA 1ABIH 3OSYA 1O5DH 1P0SH 3I29A 2O8LA 4VGCB 3WW7A 2J98A 1AY6H 4YOJA 1ELAA 1ELFA 3FVFB 4OS1A 2VVUA 3QO6A 5EJLA 5C1YA 1ZHRA 2TGTA 2H9EH 1SQOA 2ZGBH 4K8YA 3F2FA 1SGFG 2ZDNA 3JZ2B 1BMMH 1G2LA 1JIMA 1WV7H 1AZ8A 1T4VH 1SLVB 2ZWLH 1P9UA 1YPEH 5T6GA 5C0TA 1HFDA 1FIWA 1Y5AT 4CRGA 4ABAA 3TVJB 1DS2E 5ABWA 1QURH 1K1NA 2H5DA 2JIZD 1DLKB 1N6YA 1ETTH 3VXEH 5GDSH 4IS5A 3BTEE 2OC7A 4AG2A 4ZCNA 2ZFQH 2Z3CA 2J2UA 4BAOB 4OS7A 1TBQH 3EA8A 3GCHB 5C1XA 1MKWK 4DURA 1C2GA 1UTJA 4X1SU 4K5ZA 2UWOA 2XBXA 2OK5A 3HKJB 3DD2H 2KCYA 5FBIA 3BG8A 1XMNB 1ARBA 1IQHA 1QL8A 2WYGA 1UJ1A 3NWUA 2BQWB 4IN1A 3SW2B 4XFQA 1P05A 3HK3B 3QUMP 1L2EA 1P9SA 1G9IE 4KELA 3HK6B 2A2QH 2BXTH 2Y5HA 3MOCA 3STIA 3SI3H 2FWWA 3M37A 3KF2A 3MH6A 1PPBH 2CHAB 1ELGA 1GBJA 3A7TA 1HAGE 1TYNA 2RDEA 4OGYA 2BVXH 2Z9GA 2ULLA 2TPIZ 3BTWE 4WXIA 4X2VA 3Q00A 2W5EA 1MAXA 4D9QA 1ZRKA 8GCHF 1C2LA 3LIWA 2HWLB 1NZQH 3ZYDA 4Q7XA 3SNCA 6GCHF 3ODFA 3TNSA 1BHXF 1PPCE 2FX4A 3URDA 3EE0B 2IOTA 1V2JT 3Q3YA 2K1QA 3C1KA 1T7CA 1SG8B 3ATKA 1KY9A 1AKSB 1Z8JB 2Q1JA 3MI4A 2VIPA 1F0SA 1F5RA 6CHAC 4LK4A 1O2MA 4XBBA 2CF9H 2VIQA 1BMNH 1JXPA 4I32A 5HKKD 2BD2A 5CMXH 5DP8A 2KCOA 3N99A 2UUYA 3UNQA 4F49A 3QTVH 1C1RA 2A4RA 2SGFE 2ODPA 1UTMA 1P2KA 3M36A 5T6DA 3RXGA 1HYLA 1GBCA 5C3NA 1B0EA 1NM6A 1LDTT 1TNGA 4I31A 4NFFA 2ZU1A 1DUEA 2EA3A 1KLTA 5DO4H 3DSOA 1Z8RA 1SHHB 3F2HA 1DDJA 3MU1A 5DG6A 2PKAA 1BMAA 1DXPA 1NFWA 3ATWA 1YY3A 1TIOA 4Y79A 1OYTH 1C4U2 1O3LA 1ORFA 2ZHEH 1EJNA 2VGCB 4Z1MD 1NFYA 3U1IB 1K1LA 1O39A 1H8IH 1CT0E 1F0UA 2LPRA 1SQTA 3P8FA 2BLVA 3RP2A 4ABBA 1C1PA 1V2MT 1OHHD 2A7HA 3SUEA 4K1TA 3LOXA 4X1PU 2Y7XA 3PV4A 2Y5FA 3SNAA 5C5OA 5CDFE 1IQKA 2TRMA 3PM3A 4OGXA 5K7RA 1K21H 4O3UA 1GI0A 1MD8A 2GCTC 3LGUA 2QN5T 1BMLA 2A5AA 2J5UA 3AW0A 1GMHG 1Q31A 2ZCLP 4D7GA 5LPEA 1D3TB 2HNTE 3ZIAD 3Q77A 4AFSA 3KIDU 1GBDA 1AUTC 1E79D 1BCUH 5JBAS 1ETRH 1K1PA 1VCQA 1EOLA 3ZZ7A 2EI8A 4LOYH 5EIYA 4ESTE 4AG1A 4X6PA 1UW7A 5AFZH 3URCA 1MABB 1ZLRA 3TH2H 1HRTH 3LPRA 1C5UA 5JBTA 1BRUP 5ESBA 2PSYA 1XKAC 1SQAA 1C5PA 2FOCA 1MCVA 1OWIA 2GJGA 3GYMA 2GTBA 3VEQB 2UUJB 4FXGH 1AO5A 3A84A 3SGBE 4CBNA 1H9HE 3E0PB 4DCDA 2CJIA 1AE8H 1AN1E 4YLUA 1RFNA 1C2FA 2ZF0H 3ZVCA 4OS5A 4FOUC 1GBIA 3MNXA 2TBSA 1ANDA 1V2LT 4YM9A 2J95A 3VPKA 2B7DH 1DT2A 2W3IA 3UR6A 1TPPA 1BZXE 4CR5A 3BIVH 1JMOH 1TA6A 2VJ1A 3BV9B 1ANEA 4GCHG 1O2JA 3ZZCA 5F8TA 1XUHA 1GI4A 2Y82A 4PROA 1O32A 4NSYA 1GJCB 2UUKB 1MTWA 5PTPA 1E36B 1HJAB 3RM0H 1MD7A 1MKXK 1O3KA 1J14A 1O2PA 1Z6JH 4Y7BA 5TCAA 4DGJA 2GT8A 3SV7A 3OU0A 1GHVH 3UB0A 1NRRH 2V0BA 4TY7A 1DFPA 5GNDA 1GDNA 1EB1H 3TH4H 1O2OA 2D26C 2XBYA 3E90B 2RG3A 2SGDE 2D1JA 4HZHA 1W14U 2OTVA 3N7DA 1GHZA 1J17T 1XKBC 3CS0A 2K0QA 2XCNA 1BRAA 3GOVB 5JBCS 2FYRA 1ID5H 3F0OA 4UONA 4Q63A 2Z9JA 2ZU2A 5GXPA 1TAWA 1XVOA 2D2DA 1NROH 4Y11E 4X2WA 3LGTA 3UR9A 1ESBA 2BY7X 1QQ4A 4H42U 2AGGX 1J15A 3QWCH 1E34B 1O2NA 1VKYA 1AUJA 4AFZA 2HRVA 3T25A 1MZAA 5DK1A 5EGMA 2OLGA 2IPQX 1P03A 3S9BA 1GG6B 4NIXA 2OXSA 3MU4A 4H6SB 1O3JA 1UVTH 3ZV8A 5FCKA 4I33A 4AFQA 1C4Y2 4B75A 1RTLA 1TOMH 3PV5A 3U98H 4NZQA 1EUFA 3ZV9A 1A7SA 4ZXXH 4Q7YA 1WSSH 5EJ1A 1O2SA 2O9QA 3GY5A 2QIQA 2PFEA 2WPLS 1EKBB 3BF6H 3U8TH 1PFXC 2AGIX 4CHAB 1YPHC 1B7XB 4X1QU 2VINA 4AB9A 3A7ZA 1O2VA 4XBDA 4Y71A 3EQ0H 4LZ1H 1GBMA 3RMNH 3RXRA 3SI4H 2AMQA 5GCHG 4UFDH 1NESE 4XE4A 1BITA 1SGQE 3PTNA 1EPTC 3SNBA 2C93B 2P3FH 5TJXA 2BLOA 2JH0D 1S81A 3LGYA 3NCLA 2BY8X 3EDXB 2WHXA 3P17H 1P11E 3LH3A 1F0TA 2KX4A 1DX5M 1L1NA 3B23B 3Q3KA 4R8TB 1AQ7A 2QGRA 1UK4A 5EQRA 3DFLA 3RXUA 2ZFSA 2P8OC 1BTUA 3IG6B 2NU4E 1BUIA 5F8XA 1V6DA 5EODA 1H9LB 4TPIZ 2BOHB 3RXDA 1GJ8B 3H09A 4X6MA 2BDYA 5T6FA 2XW9A 3SU3A 1S0QA 3Q76A 4X8SH 1XXDA 3M5MA 1ZPBA 4DOQA 2I6QA 3QN7A 4MG3A 2A7CA 2A5IA 4ZKOU 2G00A 3LH1A 1C5ZB 4IBLH 1C2DA 1KIGH 1TB6H 1P2JA 3ZVFA 2BX4A 5IDKA 1ZSKA 1AU8A 2ZP0H 2G51A 1DICA 1O2XA 1G3DA 1S6LA 3MO9A 3KQ5A 1BT7A 1PQAA 1MU6B 1TA2A 1V2QT 3BTHE 3F9EA 3RM2H 5TCCA 2YMSB 3LJJA 2VNTA 4A1TA 3WY8A 4DT7B 1Y8TA 4B2BA 4Y7AA 3LJOA 3E8LA 5DP9A 3UY9A 1UCYH 3ZVBA 5FL7D 1UK2A 2EY4C 2WV9A 3K65B 4E06H 3ELAH 5LPRA 5C20A 3A89A 1LTOA 3MNCA 2AYWA 1W0YH 4D76A 3TK5A 4MVNA 1D9IA 4ZHMU 1LQDB 2STAE 2M2AA 2W7SA 2NWNA 3BEIB 1KTSB 1BTWA 5FBEA 2HVXA 2PV9B 1P57B 3RXVA 2B5TB 3ZZDA 1EATA 2AGEX 1QRWA 1C5YB 1P12E 3BTFE 1Z6EA 3RUOA 3SUDA 2XWAA 2ZFFH 1SGEE 4KTUA 2GZ8A 3UOUA 2KZ4A 2ZIQH 3NK8A 4JZFH 4BAHB 5JDUB 1DANH 1WDIA 4Y76A 1C1NA 1H8DH 2AS9A 1PQ7A 1TFXA 1HJ9A 2BDHA 2OC8A 6GCHG 1O3OA 4Y8ZA 3DUXH 4GCHF 1D3QB 3LGIA 3ATMA 3SU0A 3TGKE 3A7XA 2ZA5A 2AFQB 2J34A 4KP0A 1H1BA 4JZ1A 3TGJE 1O2IA 2VWMA 4M9FA 4X8VH 1G2MA 1OOKB 1BTZA 4B76A 3TJOA 3ZZAA 3UREA 3BEFB 1TBZH 1CA0C 3SZEA 2CHAC 3GCTF 1O5CB 1C1OA 2C8ZB 2ZZUH 1YC0A 4I8KA 4BTTB 4WMEA 1EJAA 1TALA 3F2GA 1GI8B 4IW4E 1O3GA 4BAMB 1NS3A 3V7TA 2A1DB 3NXPA 1HBTH 4X2YA 1W11U 2O8TA 4MNXA 5DSFA 5J4QA 2J94A 3PB1E 2Y80A 2Z3DA 3MFJA 2NU2E 3BG4C 2PSXA 3M5OA 3OX7U 1ESAA 1K0HA 2DUCA 4AYYB 1C2KA 1GI9B 1QNJA 5E0HA 5A0AE 3RXFA 2F9BH 3A7VA 2ZI2H 5AFYH 1CU1A 4I8LA 3U28C 3UPEA 1H9IE 2FDAA 2Z9IA 9ESTA 1MBMA 2HGTH 4B6EA 3PLPA 1TRYA 5EQSA 1SGIB 3FZDA 4UD9H 2SNWA 5L2ZH 1YPJH 1DWCH 2FOHA 3SQEE 2BD4A 2QF5A 2GKVE 3R0FA 1LPZB 3F9FA 1NO9H 4ABEA 1CA8B 3AW1A 1WOFA 2IPHA 3GY4A 2CMYA 2GDDA 1GVLA 4U30A 4JYVH 2ZU4A 1YLCA 5ETXA 3RXPA 5JYIA 2BD5A 1FPHH 1HUTH 2P94A 3H7TA 4WMFA 1TQ7B 2XC4A 2A31A 1CT2E 5HM9A 1A46H 1SGRE 5A0CA 4BANB 2O8MA 1GPZA 3MHWU 3RLYH 1FV9A 5GCHF 3HGPA 5FHTA 2BX3A 3QK1A 3SQHE 3UNSA 1GI5A 1BHXB 2VGCC 4KTSA 3M5NA 1O5GH 1AVXA 3GCNA 1T8LA 4U2WA 2ZGJA 3PV2A 2ILNA 1EP5A 1DWEH 2A4OA 1BTPA 1W7XH 1DSTA 1GCDA 4UFFH 1UCYE 3K2UA 1ZYOA 1O3AA 3P70B 2KAIA 4CBOA 4JK5A 3SYJA 1GL0E 2A32A 1C5OH 5HMAA 3QLPH 1PPEE 4Y8YA 6ESTA 5E0JA 1F5LA 1UMAH 5T3HA 1SGFA 5EPYA 2RFKC 2WV5A 1COWD 1JOUB 4ZKRU 3SV9A 3MNBA 3RC6A 3RU4T 4RKJB 1KTTB 3F9HA 2ALPA 1HAVA 3F68H 1VJ9U 1V2PT 4CRAA 3RXBA 1N8OB 4I8HA 1P2QA 4BXSA 1LHGH 3QGJA 1V2NT 2XCFA 2G4UA 3SN8A 2VWLA 1O2QA 4Y0YE 1C5XB 1GBKA 2G5VA 4RN6A 1HV7A 2WV4A 3L6PA 5HIYA 1EXFA 1E35B 3TU7H 2XNDD 2BZ6H 1GL1A 2CN0H 4ZH8A 2K8IA 3PWBA 3TLOA 5J4SA 4NA8A 1IQNA 1O3DA 1DY8A 1OX1A 1AWFH 2ZEBA 4J2YB 2TGPZ 3TITA 3AK5A 1D6WA 1J16A 1O33A 1O5AB 4UEHH 3VFEA 1BTYA 1QQUA 1AI8H 1O3NA 4NWKA 4ZKNU 7ESTE 5EOKA 1MCTA 1GBLA 2V6NA 1A0HB 2ZKSA 1C1MA 1NRSH 2ZDKA 2SGEE 4ZROA 1GHAF 3SOSA 2V3HH 2GMTC 1SGTA 2PP6A 1CA0B 2XXLA 4WXVA 5EW2H 3QZRA 4TSFD 2QC2A 2PLXA 2YNBA 3RXKA 1O3BA 1C5NH 1HJAC 2BY9X 1UHBA 1IQIA 1MKWH 2GCHF 2D8WA 4KGAA 4GVUA 2BDIA 2FPZA 2Y6TA 1TGTA 3P95A 3GISB 1TBRH 2G5NA 1YPHE 2F83A 1SGDE 4P02A 3PTBA 2J9NA 2QYIA 1SHYA 1DM4B 4IMQA 3HPTB 1W3CA 1P2IA 1OWDA 2W3KA 2OC1A 1CO7E 2UUFB 3BG4B 2P95A 5LGOA 1ETSH 1BRBE 2C4FH 4K2YA 3PMAB 1HIAB 5GWZA 3EAJA 3RXEA 1O2TA 1H8ED 3NPSA 1SFIA 3QZQA 1SGYE 5FX5A 3ZVDA 1FAXA 2ZDLA 4U32A 2OCVB 2A7JA 3OAAD 2C90B 2LNCA 1XUGA 1YPMH 2F9VA 2THFB 4B1TA 4ISOA 1T31A 4J1YA 2FESH 1H4WA 1EZXC 2Y7ZA 1BBRK 2NU1E 1A5IA 1LVOA 3SJIA 3MWIU 1YP9A 2J92A 3RXMA 1O2UA 1GG6C 2J98B 1YGCH 1Y3WA 1MZDA 1L0ZA 1SC8U 3ATIA 5I25A 1O2YA 1W10U 2ZHQH 1PPHE 1TNKA 4MLFB 2G4TA 3M7QA 1G3CA 1X7AC 2FI5E 3G01A 1KXBA 2BD9A 1Q3XA 2GZ7A 2HNTF 2BLQA 3S7KB 1P09A 3GY3A 4UFGH 5CHBA 2BLWA 1BBRH 2EQNA 1ARCA 1GVZA 4CHAC 1HNEE 1Z8GA 4GUXA 1SR5C 4TY6A 4U01A 3SHAH 3T26A 5L30H 2BVRH 1ZTLA 1GHBF 2ZGHA 3A8CA 1DPOA 2YMSD 4FUHA 1Z71A 5DJ7A 1LCYA 1XVMA 3L3TA 1SLXB 4JZIA 1C4V2 1O2WA 2Z94A 2ZECA 2KCAA 3D23A 4YT7H 5I46H 1A3BH 1KDQA 5GJ4B 3PYHA 5HYOA 3FO8D 1E38B 2PUQH 2EEKA 1BJUA 1PPZA 1ZGVA 5EXMA 3VB5A 3DT0H 4MNWA 2CK3D 1C2EA 2XBWA 1L1JA 1NY22 3E6PH 1SL3A 2BDBA 2BXUH 5EPNA 1UHBB 1KLIH 3BTDE 2BOKA 1ZR0A 2Q6FA 5FXLA 2G81E 3O8CA 1VITH 4X6NA 4ZUHA 1NBMD 3RU4D 2WZQA 1XUKA 4M7GA 1TQ0B 1MQ6A
chains in the Genus database with same CATH topology
4THNH 4NG9H 3NKKA 1K28D 3VGCC 2GT7A 4XDEA 4WJG2 1A1RA 1AD8H 2FP7B 1WCZA 3BTQE 2ZFRH 2YOLA 1TNLA 2RA0A 4A5TS 1D6RA 3RXHA 4A1XA 2XTTB 1UTPA 2R0KA 2V3OH 1O30A 3EGKH 2PGQB 2XWBI 3A7YA 2FZZA 5HM2A 3V12A 1TNIA 2M5TA 4B73A 1C1UH 1OS8A 3A87A 2GMTB 4AX9H 3FZZA 1YBWA 5EXLA 1L4ZA 1LPKB 3RC5A 1DE7H 2FODA 1O2KA 2ZPSA 3U8RH 2WYJA 5DP7A 1WU1A 2W7UA 3QTOH 4IC6A 3F9GA 4K1EA 2AH4X 1LKBA 3SJ9A 3UUZA 1NTPA 1MTUA 3SU1A 1BA8B 1V2UT 2ESTE 1EAIA 3GCTG 4Q80A 3LDXH 1ZHMA 2PKAB 4XSKU 2PR3A 4FUFA 1AMHA 3KL6A 4ABDA 2ZTZA 3O8DA 4CREA 3PMHB 1T8OA 1YCPM 1MKXH 1O3FA 1LO6A 2BY5X 1PPGE 3SU6A 3V0XA 3GDVA 1A4WH 1SGPE 3UWJH 5DP5A 2AMDA 3PROA 1CVWH 2FLBH 3B8JA 1G3EA 5C1UA 1LVBA 1KDQB 3GY2A 4K3JA 1UTKA 2OBQA 1G32B 1A3EH 4RKOB 5AHGH 1NFXA 3RXOA 1TNJA 2HPPH 2IN2A 1Y3UA 3MO3A 3GYLB 3A85A 2FTLE 5EG4A 1FMGA 1ZTJA 4FU7A 1BBRE 2ZFTA 2CXVA 3KNXA 1IAUA 4O3TA 1NU9A 3M5LA 1GBBA 3RMOH 3I77A 1S85A 1IQLA 1CQQA 1E37B 2SGPE 1BB0B 2OBOA 3ZVAA 2QF3A 2TGDA 2Z3EA 3UQOA 3F6UH 1J9CH 1VITF 3MYWA 1C1VH 1QY6A 3M3TA 1SFQB 1WTHD 5JBBS 1C1SA 1K1IA 1MUEB 4H4FA 1V2RT 1M9UA 3SUGA 1T32A 4WF8A 1GMCG 4HGCA 2F9OA 1OXGA 1NRPH 1SB1H 3PMJA 4H6TA 1LQEA 1V3XA 2PKSB 1GI1A 1QIXB 1QJ7B 2Z6BD 1F92A 5AF9H 4CRFA 1LHCH 1VR1H 1AZZA 1TMBH 1SVPA 3PLBA 3T28A 4ISNA 3K6ZA 3BIUH 3S9CA 1MTSA 4WVPE 2FOMB 2AMPA 4X8UH 1SOZA 3AASA 1WBGB 3HKIB 5FCRA 2GDEH 3UTUH 3ZVEA 1EAXA 3LKWA 1T8NA 4K69A 2BDGA 2BMGB 1GJ6A 2FEQH 1EP6A 3VGCB 4B2AA 4D7FA 1ZMLA 4JYUH 2R2MB 1EB2A 1GDQA 4E05H 1TGBA 1DVAH 1O3PB 1A5HA 1C1QA 1D3PB 1TX6A 2FOEA 4NIWA 3UNRA 2HOBA 1AWHB 1PQ8A 1QL7A 5IYTA 1DITH 2I6SA 2FS9A 4O9VA 4BOHA 7KMEH 2BD3A 1C5LH 1TABE 2QF0A 4CH8B 4NZLA 8LPRA 1IQFA 2G52A 1HAHH 3AAVA 2GV7A 1FLEE 2ASUB 3AAUA 3MH4A 1ZMJA 1GJAB 1FONA 5F03A 4FUGA 1GMDG 1LMWB 2GVFA 1QA0A 1T8MA 1GHAG 1NT1A 2SFAA 2UWLA 3A80A 2BZAA 2WPIS 1TGNA 1N8OC 3L33A 1S83A 2H9TH 3LT3A 1GHYH 1ACBE 3E16B 2GCHG 2ZG0H 3BSQA 8ESTE 1QB9A 1YM0A 1O36A 5E0GA 2JKHA 2VVCA 3GY6A 4WWYA 3QDZB 1EQ9A 2VH0A 1CHOF 1OPHB 1DLEA 1TONA 3PO1B 1FY3A 1WTGH 1P06A 1BTXA 4A7IB 4MPVA 4DY7B 1HAYB 3OY6U 1NFUA 6LPRA 2H9HA 4OS4A 1RIWC 2VIDA 1TMUH 2PTNA 3QX5H 1GJ5H 2QV1A 1AVWA 3E1XB 2QXIA 1FNIA 5A09A 1QCPA 1OSSA 1GHWH 3SGQE 1S6FA 2BHGA 1ANCA 4WMDA 1MAYA 1O2HA 3STJA 1EJMA 2ANMH 3SORA 3LC5A 3MMGA 1WQSA 4CR9A 7GCHF 1RTFB 3GCOA 4DVAU 2BYAX 1O0DH 5GPIB 1QGFA 3R3GB 1XM1A 4UDWH 1MBQA 1GWAA 1IOEA 4ABIA 1S0RA 3ZZ9A 2SNVA 5C67A 1O5EH 4ABJA 5H4IB 2R9PA 4GHTA 2Z9LA 4FVDA 1N1LA 1TPSA 1ZSLA 1BJVA 3U9AH 1O5FH 2IJOB 4TWWA 2FXRA 3SV6A 1ZRBA 1EZSC 3VB4A 1QHRB 5SGAE 3FANA 1GHBG 1TMTH 4FUBA 1IQMA 2XYAA 1GJ9B 2H1UA 1GI6A 1G30B 2PWXA 5BPEA 3A82A 4Y0ZE 1UTQA 1C5MD 2EC9H 1THPB 1LPGB 5A8ZA 1V2TT 3I78A 4HI3A 2BQ7B 1L1GA 2A45B 1QA7A 2VVVA 1TX7A 1ELCA 2BDCA 2FOFA 2OP9A 3D62A 1YCPK 1AHTH 3ESTA 5EQQA 1P02A 2O8WA 2Z7FE 4FUEA 4ZAEA 1FPCH 1ZTKA 1FAKH 1FY5A 3AVZA 5FPYA 2ZNKH 4QT8C 3U1JB 1HJ8A 4ISIH 2RCEA 4WY3A 1GMCF 1XUIA 4A1VA 3SNEA 4I8JA 3JZ1B 4ISLA 3PWCA 3UWIA 2XBVA 2XC5A 4CRCA 1C2MA 1KLJH 5DGJA 3IITA 1QRZA 1PPFE 4CRBA 3A8AA 2QXJA 1B5GH 1L4DA 1VJAU 4KTCA 1NRQH 3A7WA 3LGVA 1CGHA 1RD3B 5DP6A 4SGAE 1AKSA 1MH0A 3E0NB 3RXTA 1SGCA 5A8YA 1IHTH 3U69H 4BTUB 2XRCA 3MO6A 5FPSA 1C5QA 1GBHA 2F9UA 4INKA 4DW2U 1K2I1 3P92A 3A86A 1A5GH 1THSH 1BTHH 1IQEA 5ESTE 1ESTA 4X0WU 1FDPA 5LH8A 1K22H 1BDAA 3RLWH 2ZCHP 2HPQH 3UIRA 2R0LA 4MPUA 1EZQA 1JWTA 2BD8A 1DWBH 2VIOA 2ZTYA 2JETC 3D65E 4CRDA 1F7ZA 1U6QA 3TK9A 1OKXA 3U8OH 1FJSA 4FUJA 1OWJA 2ZCKP 3KHVA 3RU4E 2OQ5A 1QJ1B 4ABFA 4JZDH 2VWOA 3ZZ8A 1F2SE 1S5SA 2H5CA 3SGAE 2P16A 4JCNA 2P93A 1YPGH 1TE0A 1D3DB 1XUFA 5EW1H 3FP7E 3S9AA 2NU3E 2ANYA 3GY7A 2PW8H 1RIWB 4ZMAH 1GMDF 2QY0B 1FY4A 1HAIH 4D8NA 3RXLA 1GCTC 3BN9A 4K8BA 2FOGA 1ELDE 2ODYB 3M3VA 4BTIB 1B0FA 2FS8A 1ZPZA 1HCGA 4AOQA 1RXPA 3E3TA 2YNAA 3ENSB 2FX6A 4K1SA 3W95A 3SZNA 1CBWB 1NPMA 4ABGA 1YKTA 1AIXH 2B0FA 3B9FH 5DP4A 2WPMS 1AB9B 3A81A 5JB8S 3MU8A 1AFQB 3P8OA 4GHQA 1DSUA 4F4OC 1FI8A 3ZZ4A 3ZZBA 1KXFA 3DFJA 2WUBA 3MU5A 1TGCA 2H6MA 4YO9A 4ZKSU 2P3TB 1TOCB 3H7OA 1W12U 1V2OT 2CGAA 2FYQA 1CGIE 2ZDMA 3M3SA 1XXFA 5A8XA 4YTAA 3RXCA 2FM2A 4NWLA 1FIZA 3BTME 1NN6A 1RGQA 2VB0A 1P3CA 1Q2WA 1HAPH 3Q3XA 2WPHS 1PQ5A 1O2GH 1VITG 2KAIB 4FU9A 1HAOH 1SLWB 4X8TH 1GGDC 1OP8A 2C8YB 2STBE 2FI4E 4ZHLU 2ZDVH 3KCGH 1FUJA 3MTYA 1AE5A 1O38A 1W0ZU 2ANKH 3SU4A 1Y5UT 3UOPA 4I8GA 2XC0A 1QB6A 3RXAA 1GI7B 4KKDA 1BQYA 1HAVB 1C5WB 1HAZB 3TNTA 1LHEH 1O3IA 1LVYA 2PHBA 3W94A 5L2YH 3S69A 1YYY1 4E7RG 1CSOE 4MNYA 1DY9A 4XOJA 1OWEA 3SJKA 4GSOA 1NC6A 1W7GH 2P59A 4LXBH 2BD7A 2JH6D 1BOQA 1GBEA 1C9PA 4NIVA 1P2OA 5CHAB 2EI6A 3M7UA 1SSXA 2GX4A 1GJ7B 1UO6A 1UVUH 2AIPA 4NFEA 1HGTH 1C2JA 3UFAA 1NRNH 4YZUA 2Y81A 2F9NA 3A88A 1WUNH 2PKSC 2FO9A 7LPRA 2ZDAH 4GLYA 5A2MH 1FY1A 1K1OA 2GZ9A 2OUAA 3A83A 3E91A 5DP3A 2BTCE 4Q7ZA 2FOBA 4NA9H 4OS6A 1VCWA 4WH6A 2CF8H 1GBAA 2ZPRA 1QB1A 1AVGH 1GJ4H 1S6HA 1O3CA 1TWXB 2JETB 1YLDA 1KYNA 1W8BH 1TPAE 2R2WU 1V2ST 1ELTA 1WAYB 2Y5GA 2HALA 1ABJH 4NCYA 1G36A 5A0BA 1ZPCA 4AGKA 1JRTA 3TIUA 1D4PB 1KXAA 5EXNA 1C2IA 3ZZ3A 1SMFE 1O31A 2NU0E 3BTGE 3KQBA 5HXFA 1E0FD 4AORA 1VCPA 1K9OE 2ZQ2A 5DKMA 1FY8E 2WUCA 1GI2A 1YPKH 4INLA 3RXSA 1C1TA 1QJ6B 2EI7A 1ELEE 4YT6H 1A2CH 1ZMNA 1CT4E 1ZZZA 1CHOG 1GCTB 3V3MA 4UE7H 5EU8A 1W13U 3DHKH 2ZFPH 1A61H 1UTNA 4IN2A 3GICB 2AERH 4TWYA 1K1JA 1OP0A 1Y3YA 3KN2A 3M35A 1ZGIA 1UVSH 3KEEA 3SU5A 2WINI 3M61U 1EX3A 4O03A 3O8RA 4MTBA 4BAQB 3RMMH 4Y8XA 4Y10E 1QTFA 2ZTXA 2Q6GA 1TPOA 3S7HB 2UWPA 2HLCA 4A92A 2ZHFH 2A2XH 7GCHG 1DWDH 4LZ4B 4FUDA 1RRKA 1A0LA 3TJNA 4HTCH 2F91A 2A4GA 4MQAA 4AYVB 1OWHA 4ZHAA 3NUMA 5C2ZA 3ZZ6A 4CH2B 3PO1C 1UTOA 4B71A 1G3BA 1QRXA 1ZJDA 1GGDB 3SJOA 1J8AA 3MH5A 2QXHA 4AN7A 3ODDA 5CE1A 3IWMA 4GAWA 2ANWA 1O2LA 3TGIE 5LPFA 1UVPA 4XBCA 6CHAB 1MTVA 1T4UH 1O2RA 1ANBA 1HLTH 4X2XA 3GDUA 4DG4A 1O37A 1O34A 1S82A 2A5KA 4K60A 1YPLH 4NSVA 1JIRA 3H5CB 1HXFH 1BIOA 1C9TA 2FOAA 4X6OA 5DPAA 9LPRA 3LONA 1CE5A 1O2ZA 2TIOA 3ATLA 4OS2A 1V2KT 2J4IA 3RDZA 4I7YH 1AFEH 2ZC9H 3K9XB 1VGCC 1Z7KA 5B6OA 1EAWA 2W26A 1ZHPA 2ZHWH 4MNVA 2OINA 2ZU3A 1EASA 1P01A 1QBOA 1ZSJA 2ALVA 1PYTD 2GV6A 1BRCE 1P10A 5C5NA 5JB9S 3BTTE 4O97A 2RDLA 1Y3XA 1FN6A 1W2KH 3ITIA 5JPMH 4AB8A 1IQGA 2BQ6B 1QL9A 2QA9E 3SO3A 2OC0A 3D49H 1S84A 1C5SA 1O3HA 1TLDA 1C2HA 2RA3A 5AVDA 3RMLH 3V13A 1EZUC 4Y6DA 1Y5BT 2FI3E 4DIIH 1P2MA 3RC4A 2GCTB 3T27A 4D9RA 2ZHDA 5FX6A 2ZGXH 1FQ3A 1GDUA 1GJBB 1LKAA 1SPJA 1YF4A 1G37A 2FTMA 4JMYA 5K0HA 5HGGA 3TH3H 2OQUA 1EAUA 3RXJA 3VB7A 2C8WB 3QGNB 4HFPB 4JYTA 2CV3A 3P6ZB 4NIYA 2PGBB 3KQEA 2VU8E 1MTNC 4ABHA 1THRH 1TRMA 4FU8A 4SGBE 4X1RU 1GVKB 2B9LA 4B2CA 2GGVB 1FZZA 4ISHH 4X1NU 2GD4B 1LHDH 1QFKH 1Z8IB 1TRNA 1UCYK 1GHXH 1LHFH 2WPJS 2XNIA 5FAHA 2C8XB 3TK6A 3LC3A 1K1MA 1PYTC 3F1SB 1MQ5A 3T29A 1HXEH 3GDSA 3OYPA 1ZOMA 1C5RA 1EPTA 2ZQ1A 1IQJA 5L6NH 1DUAA 1RTKA 1CGJE 1HAXB 1GMHF 3FAOA 2PTCE 4YOGA 2VWNA 5GIBA 1TNHA 4IC5A 1UTLM 1QBVH 3SV8A 1C1WH 5E2PA 2ZU5A 3CP7A 2QXGA 1N6XA 1EOJA 2F3CE 1GI3A 2FLRH 3HATH 3SBKA 2P3UB 1ELBA 3SUFA 4VGCC 1P04A 2BVSH 1GJDB 1SGNE 2HNTC 4Z0KA 1SLUB 3MH7A 5E2OA 4Q2KA 1GBTA 2SGAA 5FPTA 4E7NA 1O3MA 4FUCA 1KXDA 4INHA 1RJXB 1RS0A 1ZJKA 1AGJA 3FFGA 3VB3A 4R0IA 1DOJA 2AEIH 3P8NA 3TJVA 1GBFA 1V2WT 3TJUA 5F6MA 4RSPA 3KQDA 2PUXB 3VXFH 2J38A 8GCHG 1O3EA 2A4QA 1LVMA 1TX8A 2C3SA 4A6LA 1MU8B 4YOIA 4UFEH 2QCYA 4MPXA 3KQCA 3SNDA 3GCHC 1OYQA 2H2ZA 2OD3B 1SOTA 3SHCH 1A0JA 1CBWC 4MPWA 3EA9A 3PLKA 2FIRH 1O35A 2BDAA 4YESB 4AGJA 1AB9C 3CS7A 1HPGA 4AZ2B 1AFQC 4NA7A 2ODQA 1HB0B 3OY5U 3T2NA 2G8TA 3FP6E 1VGCB 4DJZB 1XUJA 2BM2A 1KSNA 1UK3A 3UQVA 2GP9B 2DE9A 3A8BA 2TGAA 3T62A 3A8DA 3EYDA 3FP8E 4FVBA 3T5FH 5F8ZA 5G4BA 3SV2H 1QBNA 1F0RA 2VIWA 2DE8A 2Q6DA 1Z1JA 3OTJE 3VB6A 4BAKB 3O8BA 3LU9B 1P3EA 4MDSA 4TPYA 1CHGA 2O8UA 3S0NA 4ASHA 4JK6A 5E8EH 3MU0A 1F5KU 1VZQH 4GPGA 1C5VA 2A0QB 3N7OA 3NZIA 3CENA 4AFUA 2SGQE 1P2NA 1EPTB 1Y3VA 4ZXYH 1DXWA 1XX9A 1MMJN 4B74A 1IHSH 1C5TA 2AIQA 1SBWA 3SJ8A 4BXWA 2VH6A 3KGPA 3ZYEA 3RXIA 2ZO3H 1SI5H 1JRSA 2P8OB 3PMBB 3RXQA 2WPKS 2BB4A