3SNCA

Crystal structure of sars coronavirus main protease complexed with ac-nstsq-h (soaking)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 78
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sncA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sncA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sncA02
3SNAA 1GGDC 3ODDA 1D3TB 3SUDA 5IDKA 3DA9B 3M7UA 1HPGA 4UD9H 3VXEH 1SI5H 4NA8A 2RG3A 1TA6A 2QCYA 2Q1JA 1QA7A 1ETTH 2P59A 1Y3UA 3RU4E 2VH0A 4DVAU 2YNBA 3KEEA 4Y8XA 5ESTE 7ESTE 5ETXA 3URDA 5DP5A 1S84A 2OC7A 1P3EA 1HAVB 2ZU3A 1C5VA 1QBOA 1K9OE 4K8BA 1V2ST 1NTPA 2RDLA 2P3FH 1O5EH 1HXFH 2BQ6B 1BRCE 3S0NA 2B9LA 1EUFA 1FAXA 3F1SB 3PWBA 1OXGA 1H1BA 2ANYA 2W3IA 1UCYE 3QO6A 1ZGVA 1TFXA 2AFQB 2RCEA 2AIPA 2Z3CA 3EQ0H 5K0HA 1AVWA 1H9IE 3BIUH 1ZRKA 2W7UA 4DOQA 1H8DH 5IYTA 3GY8A 1PPCE 1EXFA 3RM0H 1C5ZB 3RXPA 1UJ1A 1G30B 1BTZA 1MTWA 3SORA 3ZVFA 1GG6B 4CBNA 4I32A 1CHOG 3KN2A 2FOAA 3KNXA 3M5NA 2CHAC 3SU3A 1VZQH 4LXBH 4XSKU 3SJ8A 5ABWA 2HRVA 2P94A 4YESB 2HALA 2WINI 4A92A 4JZEH 1ZTKA 2ILNA 4DY7B 1UTPA 3ELAH 3TIUA 1ZR0A 3SJIA 2B8OH 5I46H 1GG6C 2BDAA 4ISIH 1QJ7B 3M5MA 4ISHH 3UTUH 3QTOH 3ZYEA 2O8TA 1BJUA 3TJUA 3BTKE 3TK5A 2CHAB 1MU6B 1BMAA 1O38A 2QGRA 1JMOH 1SHHB 1ZRBA 1S6FA 2A4QA 2SGQE 1MAYA 2C3SA 1PPHE 5FPYA 1QRZA 1BCUH 2K1QA 3M7TA 2A7JA 4NGAH 1GHBF 1PPEE 1BMMH 3UQOA 3V3MA 3TGJE 1L0ZA 1RFNA 3MU1A 4ISOA 4LZ1H 1A0HB 4JZDH 2GDEH 1O5BB 3TH3H 4SGAE 4DG4A 3PV4A 2BVSH 2V3HH 1G2LA 3HGPA 1AD8H 3Q00A 1N6XA 5C1XA 1K1NA 1FIWA 1O3GA 4B2CA 1GBMA 1P2JA 2XNIA 2G4TA 2W7SA 5DO4H 1OWIA 1O2KA 1V2VT 1W7XH 4AFZA 1P3CA 2PKAB 1OYTH 4MNYA 5J4QA 3SV2H 2HNTC 2A0QB 1V2WT 2PSYA 8LPRA 4INHA 3BV9B 1L1GA 3GY7A 3O8RA 1GVKB 5C5NA 4NIXA 2CN0H 1VITF 1KLJH 3NZIA 1O3EA 2BD3A 3SZNA 2LPRA 2VB0A 1SC8U 2F3CE 3M35A 2F9BH 2JH6D 4A1VA 1WUNH 1GHBG 1UTOA 3PWCA 1BHXB 1IHSH 4AGJA 2Z7FE 3MYWA 2ALPA 1GJCB 1K1IA 3RXGA 4NWKA 2Z9GA 3DHKH 1TX6A 4U30A 1Z71A 2TBSA 1SMFE 5E2PA 3FZDA 5BPEA 2CJIA 5HM2A 7LPRA 4YOGA 1TYNA 2J92A 1ZJKA 4Y7BA 5EXNA 2PWXA 1K1MA 1J14A 2FLRH 4NCYA 1DUAA 1MTVA 3SW2B 1YPKH 1P2MA 3U8RH 2OLGA 1M9UA 2QC2A 2KAIA 3ITIA 5LPEA 3FP7E 1O3HA 3K6YA 1Z8JB 2W26A 2H9HA 5GWZA 4ZXXH 2ZGXH 3GY4A 1QGFA 2SNVA 2A2XH 2ZGBH 1V2JT 2JKHA 1P2NA 1ZZZA 1PQ7A 2C8YB 4F49A 3VB7A 1QB6A 1QB9A 1Y3VA 1C2KA 1LVMA 2SNWA 3OY5U 1TBZH 4CRBA 1LPGB 3RU4T 3ZZAA 1TPAE 2G5NA 4H42U 5GDSH 1THPB 1LKAA 2FODA 4BNRA 3A85A 1GBKA 2XBYA 1O2VA 1AE8H 2A45B 3ZZ6A 1EJAA 1IQEA 1C2GA 1GI6A 1EPTA 3TGIE 1UCYK 4WH6A 1GMHG 4X1SU 3MNCA 3NCLA 1GHZA 1LHCH 4YOIA 3UPEA 4X6MA 3BG8A 1MKXH 3HGNA 4TY7A 2ZDKA 1LHDH 3SV7A 2OBQA 1HDTH 3RXMA 4CR5A 4O3TA 4FUHA 1E0FD 2FWWA 2JETB 1SOZA 1FY5A 4UEHH 2P93A 1FNIA 4X6PA 5E0HA 1W13U 3ZZ5A 2Z3DA 1THSH 3PMAB 1QBVH 1WTGH 2G00A 4GPGA 1O3LA 1GMCG 1YLDA 1DUEA 4CRAA 4NSYA 3KIDU 1UMAH 1UTLM 5A2MH 1UVOA 2A7HA 1TPOA 1P09A 4ABFA 4Y0ZE 3S9BA 2R2MB 1HAHH 1GDNA 4MPVA 3BTEE 4JYVH 4TPYA 1DDJA 5A8YA 2JETC 1UO6A 1DLKB 3QX5H 2DE8A 3ZVDA 4FUIA 2F91A 1VGCC 3CS0A 1HJ8A 4FUEA 1O2LA 1ZHMA 1BBRK 2GDDA 1EASA 1KY9A 1N8OC 3EA8A 1ELCA 3PO1C 3FP6E 5B6OA 1E34B 2GCTB 1WQVH 1ZYOA 3AASA 1YP9A 3T25A 1XXFA 4AGKA 1V2QT 4ZKRU 1HAZB 1Z8RA 3BTME 1W0ZU 2IOTA 3T62A 2XTTB 3LGTA 1WSSH 2F9OA 2PTNA 3S9CA 2F83A 2GT7A 3FVFB 4R0IA 3V7TA 3W94A 1GMCF 1PPFE 2ZQ1A 1SGFA 4A6LA 1BTWA 1C2MA 5DK1A 2OD3B 3PLKA 1OX1A 1B7XB 1P10A 2HWLB 3MWIU 1VCWA 3OU0A 4O97A 2J9NA 2F9NA 1CA8B 4ZMAH 2BM2A 3RP2A 5EOKA 1FPHH 3SUGA 2ZTZA 1MQ6A 1EOLA 3A88A 3RXCA 3TNSA 3DFJA 2BOHB 2ZFSA 4X8TH 1RTKA 1KXAA 1TONA 6GCHF 1SGYE 2FTLE 3QZQA 3JZ1B 1QL9A 3C1KA 4B71A 4FUGA 4PROA 2EC9H 4JK6A 4Z6AH 1P2KA 3BN9A 1K28D 2AH4X 4NIWA 1ARCA 3SN8A 1Z6EA 2J95A 1UVSH 2D8WA 2OXSA 3ATKA 1VR1H 2ZWLH 3OTJE 1VITG 4Q80A 2ZC9H 1GI2A 1NRSH 1NRPH 1O3DA 3DT0H 8GCHF 1F0RA 1F5RA 2OC1A 4H6TA 2FX4A 1NPMA 1C2IA 1OP2A 2Z9JA 1EAWA 1LO6A 1PYTD 1Z7KA 3LT3A 1XUJA 3UOUA 1E36B 1HIAB 2VWOA 1EAIA 1GI5A 1TOCB 3MO9A 4WF8A 2W3KA 1L1NA 1O2GH 1KLIH 3SI4H 1TNHA 3MH6A 1GBCA 5ESBA 3I29A 3BTWE 1NFYA 4CRFA 1MTSA 4K8YA 2Z3EA 6CHAC 4AX9H 1AWHB 1GI1A 1FPCH 2VIOA 1QY6A 1OPHB 4BAKB 4BOHA 4FVDA 3DUXH 1Q3XA 1QFKH 3E90B 1K1JA 1HAOH 4GAWA 1MTNC 1BRBE 1P0SH 4BAMB 4MVNA 1LDTT 3HPTB 3P17H 1CE5A 2V3OH 2WPHS 4I33A 4HFPB 2ZGCA 1SR5C 1GBTA 1ID5H 4IS5A 2BMGB 1J8AA 2G51A 4NFFA 2FP7B 3ZZCA 4FXGH 3F9FA 3PTNA 3TJOA 3EBNA 2Z9IA 4GLYA 2R3YA 4DURA 1MTUA 4D76A 1UTJA 1P8VC 2GZ7A 2ZFQH 3EA7A 1O3BA 5C3NA 3D49H 3MOCA 3LH1A 1EZUC 1J15A 3RUOA 3NPSA 4WWYA 1AU8A 2QXIA 4MDSA 1ELGA 1O5CB 5FX6A 1IHTH 2J34A 1GI8B 3LGIA 8KME2 5E2OA 5A8ZA 3IWMA 1RD3B 1A2CH 2AEIH 2VNTA 1V2TT 4AYYB 1W3CA 2CXVA 1ESBA 2WPLS 3MO3A 2PKSB 4YZUA 1A5IA 1H9HE 1QL8A 5LPRA 1C5OH 4WXVA 1GBEA 1BTUA 1NFXA 5TJXA 1AGJA 2BVXH 1SPJA 2BLVA 2BVRH 5L2ZH 1XVOA 1F0SA 1XVMA 3KF2A 1F5KU 4K3JA 2FMJA 2ANKH 2QXJA 3MH5A 3PMBB 1SSXA 2GV6A 4ABEA 5A0BA 3HATH 1T7CA 2PKSC 1F5LA 2TIOA 1YCPH 4H4FA 3UNRA 3TLOA 1SL3A 1O32A 3RC5A 1O2SA 1O2XA 3MU5A 1ANCA 1V2MT 1J9CH 2BDBA 1DWEH 2C4FH 1T8OA 1FMGA 1RGQA 1W11U 2AIQA 1YKTA 3A81A 2JH0D 4VGCB 3O8BA 2BD8A 1ABJH 4X6OA 4FVBA 2NU2E 1SGFG 1O5AB 1A5GH 2ZO3H 1C4Y2 4ZKSU 4X2XA 1AWFH 1G37A 1YCPK 2XBXA 4FUCA 2ZU2A 4BAHB 1YPMH 2BXTH 2R2WU 2J94A 3M37A 1NU9A 4I8JA 2GV7A 1ANBA 1LHGH 3LGYA 2ZI2H 3A83A 4JZFH 1RXPA 1SGDE 3T26A 2QV1A 1EX3A 4WY3A 4BTUB 2DUCA 1C1SA 1NFWA 6LPRA 4NSVA 3GCNA 1OWHA 3TGKE 4LK4A 3BTGE 4CH2B 1HLTH 1INCA 1HCGA 1UK3A 2THFB 5FXLA 1CU1A 1Y3WA 3IG6B 2FLBH 1VGCB 3PB1E 1F0UA 3BTDE 3CP7A 1N8OB 1MAXA 1P03A 2ZQ2A 1ZMNA 1FI8A 5CHAB 4YTAA 3WY8A 3RXKA 3PO1B 1W12U 4AFUA 2GCTC 1QIXB 3FFGA 1UTKA 2HPPH 2ZU1A 3ENSB 1XMNB 2SGAA 4U01A 1UVTH 2OC0A 2IN2A 5TCCA 1GJBB 5EQQA 1K2I1 2FYQA 3A80A 1E35B 2A32A 4K1TA 2B5TB 1QBNA 4OS2A 1S82A 3QTVH 3N7OA 3TH4H 4OGXA 4Y76A 4Q7ZA 5A09A 4WMFA 2C8XB 1SGPE 1C1RA 1W10U 1AO5A 1EAUA 1HXEH 1SBWA 2A4GA 3M3SA 2FOCA 4Q7XA 2BY9X 3QZRA 1O2QA 3A7VA 2ZHQH 1BJVA 1O3KA 3QDZB 5GJ4B 2FOBA 4U2WA 2H9TH 1S0QA 2GX4A 2OP9A 4I8GA 3SU1A 3M5LA 3BIVH 3U69H 5DP8A 4FUBA 2QAAA 3P8GA 1TNLA 2J38A 1ZMJA 1OS8A 4SGBE 1O3MA 2ZHWH 4RKJB 2VIPA 4I8LA 1NU7B 4MNWA 1HFDA 5C20A 1TMBH 1Y5BT 4KTCA 1FIZA 3SNBA 3F9EA 1S85A 4NIYA 1GDQA 2Z6BD 4AYVB 1NRNH 2FDAA 3UIRA 3E8LA 1WOFA 2NU0E 1TOMH 4ZKNU 1FXYA 1Z6JH 3RU4D 1ARBA 3D23A 1C1VH 2OQ5A 3U8TH 3GDUA 3EYDA 1J17T 2G52A 1IQIA 1FAKH 1PPGE 2FS9A 3T5FH 3W95A 1LTOA 2FOHA 4Y11E 3SNEA 4LZ4B 3BG4B 3ZZ3A 4Y10E 3VB3A 1YPGH 4AG1A 1PFXC 3RXQA 3TITA 2XC4A 4AOQA 5F6MA 3ZZ4A 1A61H 2XCFA 3MH7A 1OKXA 1ETRH 2HNTE 2NU3E 1SGQE 1GMDF 3TNTA 3VB5A 1SLWB 1WV7H 5DGJA 1GI3A 3UNSA 5J4SA 1BIOA 1ELVA 1CQQA 4OS5A 3BEUA 3LGVA 1C5NH 3E16B 2B0FA 4D9RA 1C2EA 2G55A 3RXUA 3SO3A 3BG4C 3CENA 3V12A 3AAUA 1LHFH 3JZ2B 1KXFA 3SU2A 1N6YA 1LVYA 1MCTA 2OINA 1C5YB 4IW4E 2FOMB 2YOLA 4U32A 3EA9A 5C1YA 1HAPH 6CHAB 4AFSA 4Y8ZA 1EAXA 2ZPSA 2IJOB 4X2WA 1AVXA 1MMJN 1FDPA 1TQ7B 5EPYA 5HMAA 1NC6A 1QA0A 2A5KA 1XUKA 4IBLH 2AYWA 3LU9B 4D9QA 2HPQH 2BY7X 1H4WA 1MTNB 3NWUA 2VINA 1G3BA 1IQHA 1W2KH 2ZA5A 2VGCC 1A5HA 1C1TA 1A1RA 3ZZ9A 1VJ9U 3BTQE 1GHYH 5JPMH 5EPNA 1P12E 1CVWH 4TYDA 1AUTC 4YLUA 1YPHE 2XWBI 1JRTA 1TNGA 1D6RA 4MTBA 1DXPA 2FO9A 4AN7A 4IN2A 2QN5T 5F8ZA 4ZH8A 1YM0A 2R0KA 4AB8A 1G3CA 2FX6A 3RXRA 1OWEA 2JH5D 2ODPA 1DOJA 4GUXA 1SGIB 1KXCA 2WPKS 2VIWA 1C4V2 2VIVA 3MFJA 1HUTH 9LPRA 2FPZA 2BD2A 3EGKH 2LNCA 1C5MD 1TMTH 3ZZBA 3ZYDA 3MNSA 2ZU5A 1UTNA 3L33A 3SQEE 5HXFA 1AQ7A 1WYKA 3F6UH 2WPMS 3T29A 3PYHA 3RLYH 1RIWC 2D26C 1K21H 1ELFA 3VFEA 1MD8A 1O2WA 1QTFA 4WMDA 2G5VA 1VITH 2EA3A 2Y7ZA 2BD5A 3MNBA 1ZSJA 1TQ0B 5EU8A 1TBRH 2GP9B 3MMGA 1C1QA 1E38B 2G8TA 1GJ4H 2VWLA 3HK3B 1FN6A 2XC0A 2QF0A 2VIDA 2GMTC 3T2NA 3B9FH 3ATLA 2ALVA 2ZF0H 4D8NA 2Y80A 1NT1A 2UUKB 4TWWA 4AFQA 1GCTC 1H9LB 2IPHA 1ZPCA 4MG3A 2G81E 1SQAA 2P95A 4X8VH 4BTIB 8GCHG 3B8JA 2A5IA 3SGAE 4OS4A 1RIWB 1HBTH 1EJMA 1O37A 4NIVA 2ZFFH 1PYTC 3KGPA 1G3DA 3M5OA 5C2ZA 1C5WB 1BTXA 3KQCA 5DJ7A 2ZFRH 2PLXA 5FCRA 3IITA 4IGDA 1GWAA 1VCPA 4LOYH 4UFDH 2ZPQA 4VGCC 1GBDA 5E0JA 4ZUHA 3T27A 3K2UA 3AAVA 1GCTB 4X1PU 1BITA 3RXEA 4TWYA 4NG9H 1O39A 3AW1A 1V2LT 2Z9KA 2ESTE 1DWCH 2KAIB 1GHAG 3TPIZ 4B1TA 1GJ9B 2FI5E 3FZZA 2BB4A 1CT0E 4OS7A 3LONA 1O2ZA 1DANH 3EDXB 4D7FA 4K60A 3M3VA 3TJNA 1A7SA 1TALA 2D2DA 1S6HA 6ESTA 4IMZA 1TRMA 1AB9B 3EAJA 2O9QA 5DP3A 3R0FA 1OP0A 1ZHPA 2VWMA 2LIZA 1W0YH 2VWNA 5CHAC 5LPFA 1ABIH 3U98H 2AGEX 3KQEA 1QJ6B 3GY5A 1CGJE 1L1JA 3M36A 3VPKA 2OBOA 1QURH 1KTTB 1SQTA 5EQSA 1RS0A 5JBBS 2UUFB 2FOGA 1N1LA 2QY0B 1T8NA 4IC5A 1K1LA 1PQ5A 1TNIA 2Z9LA 1PPZA 3GICB 3UWIA 4MQAA 1LQDB 3UR9A 3MHWU 4WJG2 3GISB 1MCVA 1ELBA 1TRYA 1UTQA 3BF6H 4BANB 3GCTG 3E6PH 4Q2KA 1Z8IB 4DCDA 1P9SA 3GDSA 3RXHA 3E0NB 5JB8S 1C4U2 1O36A 2AMDA 1HNEE 2A31A 2O8UA 1GBLA 2BOKA 5AFYH 1KDQB 3O8CA 1LVOA 2QIQA 1IQLA 2ZDLA 1UVPA 1HJ9A 4X2YA 1JRSA 1TGSZ 2W5EA 3TK9A 4X0WU 1OP8A 3AVZA 1V2NT 4UFEH 4F4OC 1UHBA 1DS2E 1IQGA 1C2JA 1GL1A 1LKBA 1W14U 4THNH 4BAOB 1GBJA 2TGAA 4XDEA 2FI4E 2C8WB 2Y5FA 5CMXH 2C8ZB 1GBAA 5H4IB 2ZGHA 3TK6A 4IMQA 3SI3H 1MZDA 1C2DA 4OS1A 2VVUA 1SG8B 2FOFA 2XRCA 4GHTA 1Y5AT 3A8DA 1DM4B 2DE9A 2Y81A 1QRWA 5F8XA 2ZECA 3H5CB 1F92A 1FY3A 4NA7A 3A86A 1JIRA 1IQMA 1XKAC 2XC5A 4JMYA 4UFGH 2BDHA 1QB1A 4BTTB 2ANWA 2NWNA 1Y8TA 1GI4A 4ABGA 4ESTE 1K22H 3ATWA 1TPPA 1S83A 1A0LA 4KTSA 4K5ZA 5EW2H 1DSTA 1GVZA 2XBWA 3SOSA 4UONA 3GCHC 3RXJA 3Q76A 1CSOE 1CBWB 1JIMA 2SGPE 2ZDNA 1UCYH 3TVJB 3ZZDA 2GZ9A 4B75A 1TIOA 1P01A 2V0BA 3KL6A 1SGNE 2V35A 4ABIA 3F68H 4WMEA 1TLDA 1HGTH 2HNTF 3A7TA 1EZXC 3LJOA 1HAXB 2VH6A 1PPBH 3U1JB 1OSSA 3K9XB 2B7DH 3S9AA 1AN1E 3LC3A 3SJOA 1O3JA 3R3GB 1V2KT 3AW0A 3OSYA 1UK2A 1SFQB 3D62A 1PJPA 2TGTA 1CBWC 5CE1A 1O2YA 3LGWA 4YOJA 2PW8H 1ZMLA 3SU6A 5JBCS 3A87A 1IAUA 1YPLH 2PV9B 4ABBA 1YYY1 1B5GH 3FAOA 1C1PA 2VGCB 1ORFA 1O5FH 1AKSB 4CR9A 2AMPA 3P6ZB 1BRAA 2AGGX 1CHOF 3SU0A 3ZZ8A 1SLXB 2ZU4A 1K1OA 3SJKA 5EQRA 2BZAA 5L6NH 2ZFPH 3ATIA 5SGAE 2VU8E 2BXUH 1XUGA 3P8FA 3MNXA 1F7ZA 3GOVB 2TRMA 2ZP0H 3RC4A 1L2EA 3SBKA 1P2IA 3M7QA 3QK1A 1A0JA 3F9GA 2FZZA 5E0GA 5GXPA 1VCQA 1ZOMA 1DY8A 1SLUB 2P16A 2TPIZ 1D3DB 3S7KB 4K69A 1QRXA 4B2BA 5HM9A 2ZZUH 1BB0B 1WQSA 1GBHA 1UTMA 3B23B 3T28A 1G36A 1O3AA 1TRNA 1ZJDA 4Y71A 4R8TB 1A46H 3STIA 1D4PB 2H1UA 2OTVA 3LDXH 4WH8A 1Z1IA 1O2PA 1C9TA 1GBFA 1JXPA 4Y7AA 4Z0KA 5DKMA 4Y8YA 1KTSB 3RM2H 1ETSH 3MTYA 1A3EH 3PTBA 1AKSA 4D7GA 2QXGA 3E3TA 5A0CA 2GMTB 2G4UA 2RA0A 1UVUH 1BUIA 4BXSA 3S69A 4ABAA 1TGBA 4CRGA 1DT2A 2FI3E 4WVPE 4K1SA 1DICA 1GI9B 1GHWH 2BDCA 3SGBE 1P9UA 2PHBA 2WYGA 1O2JA 3P8OA 1LVBA 2F9PA 4DT7B 3DD2H 3U8OH 1CT2E 2H6MA 2C90B 1ZTJA 1Q31A 1O5DH 1JOUB 2Y82A 2WPIS 2ZCHP 1NESE 2QYIA 1FY4A 3Q77A 2CGAA 3RMNH 5T3HA 2GCHG 2V6NA 7GCHF 3ZVCA 1GHAF 3H7TA 4UDWH 2EI6A 1C9PA 5T6FA 2A4OA 1NM6A 4KTUA 3GDVA 5AHGH 2BX4A 1O3IA 1KYNA 1B0FA 1BTYA 1BA8B 1THRH 1BDAA 5C67A 2I6SA 1SGRE 1MBQA 1P06A 1BTPA 2HOBA 1G2MA 1DY9A 2WPJS 1AHTH 1GI7B 4E7NA 1EP6A 4ABJA 3KQDA 3EE0B 1S81A 4RN6A 1DWBH 1WU1A 1K1PA 1NROH 1AB9C 2H2ZA 3E0PB 5T6DA 1O31A 2VIQA 1IQFA 1JBUH 1GPZA 1Q2WA 2GT8A 2GCHF 1G9IE 1WTHD 2HGTH 3RXFA 1ZPZA 1P2OA 1O3CA 1YC0A 4FU9A 3SUFA 2ZKSA 1GHVH 4Y0YE 1C1MA 1O33A 1DPOA 3ESTA 3RXVA 3A8BA 3BTTE 1KXEA 1AE5A 2UWOA 2WUCA 5JBAS 4RSPA 9ESTA 4QT8C 4X2VA 1CGHA 5HYOA 3STJA 3ZVAA 3S7HB 4B74A 1Y3YA 3TJVA 1GJ8B 4JYTA 2CF8H 3SU4A 4KP0A 1TABE 1ZSLA 3SNCA 4DIIH 3RXTA 3K6ZA 3M61U 1F2SE 2PTCE 1AMHA 4MPXA 2BYAX 1GJ5H 1GJAB 3LJJA 1CO7E 3FANA 2P3TB 5I25A 5JB9S 2GVFA 3KHVA 2ZHEH 3HK6B 3K65B 1U6QA 3LC5A 3VB4A 2FXRA 3BEIB 1ZTLA 1BT7A 1FONA 2BY8X 1TWXB 2BDGA 4CRCA 1OWDA 3VEQB 2OUAA 3A8CA 4KGAA 3PLBA 5HGGA 4AB9A 3V13A 2VJ1A 4Y79A 3P70B 3Q3YA 2UWPA 4MNVA 3ODFA 2ZPRA 2PGQB 3GY6A 1BTHH 4XBCA 5LGOA 1XM1A 1DE7H 1NRRH 2ZDVH 1OOKB 2ZCKP 1NRQH 3LGUA 1OWJA 4O3UA 3VXFH 1P57B 2QA9E 3RDZA 1J16A 5GCHG 3U1IB 3ZV8A 1GL0E 1HB0B 1L4ZA 1AI8H 3SQHE 2HVXA 1MH0A 3ATMA 2VVCA 4INLA 1TNKA 4X6NA 1DXWA 2PSXA 1SVPA 1SHYA 1GCDA 5AVDA 4YM9A 1HAGE 1MKXK 2BLOA 4FU8A 1C1NA 1GJ6A 1ZHRA 2XXLA 2WV4A 1TGTA 4AORA 4CHAB 1SLVB 2A2QH 1RJXB 1WAYB 2Q6DA 1T8MA 2I6QA 1OYQA 4OS6A 1HAVA 1W7GH 1ANDA 4ISLA 3GCHB 5C1UA 1Y59T 1EQ9A 1Y3XA 1C1UH 1S0RA 2CMYA 1F0TA 1SFIA 3NKKA 3PROA 4O03A 3UFAA 4X1NU 4YLQH 1V3XA 2ODYB 1MBMA 2SGEE 5FPTA 2M5TA 1BQYA 2XWAA 3HKIB 4MPWA 2WUBA 1YCPM 4B76A 1V2RT 2OC8A 1FV9A 5DPAA 1DVAH 3GYLB 4NWLA 1PQAA 2H5DA 1ZGIA 4A1TA 1EZQA 1HRTH 1SGEE 3A7ZA 1D6WA 1QQ4A 2PGBB 4GSOA 1YPHC 1MQ5A 1Y5UT 1LMWB 2BD4A 3UWJH 5EXMA 2H9EH 5PTPA 4I8KA 3RMLH 4I31A 5LH8A 1C5UA 4KELA 1IOEA 5DP9A 1TMUH 3SGQE 1O3FA 4J2YB 1EB1H 4ISNA 1ANEA 1EKBB 5FCKA 2OQUA 2Y5HA 4HTCH 2BQ7B 1QCPA 1ELAA 3ZVBA 2A7CA 2PUXB 1YPEH 5JYIA 3KCGH 3RXSA 1ZPBA 2A5AA 2UUJB 1GMDG 3CS7A 1V6DA 1KXDA 1IQNA 1BMLA 1C5QA 4X1QU 4DW2U 1EB2A 4GCHF 4JYUH 2BQWB 1HV7A 4XBDA 1XXDA 1O30A 4I8HA 3SV9A 2ZTXA 4HZHA 1C2HA 1O2TA 1C1WH 1H8IH 2XYAA 1NZQH 2F9UA 3PMJA 5JDUB 4YT6H 2FM2A 5DP6A 1HYLA 2GZ8A 1C1OA 1VJAU 2FIRH 1XKBC 4ABHA 1TBQH 4ZHLU 1AY6H 3MU8A 1C5XB 1C5SA 1KIGH 2GTBA 2BHGA 5AFZH 1CT4E 3TU7H 1QHRB 3UR6A 5G4BA 1C5PA 4NA9H 1DSUA 3ZV9A 3ZVEA 3QUMP 4JCNA 5F03A 1B0EA 8ESTE 1G32B 2QF3A 4A5TS 4WXIA 3HKJB 4ABDA 4DIHH 1Z1JA 3TH2H 1HJAC 3SUEA 1TX7A 1YLCA 1O2UA 4FU7A 5A8XA 1O5GH 2A1DB 4BXWA 1FJSA 1AFQB 1P2QA 1A4WH 4J1YA 2PKAA 1KLTA 1X7AC 3NK8A 1DFPA 1FY1A 3A82A 2PR3A 1TB6H 1O2OA 1EPTB 3A89A 1GBBA 2C93B 3G01A 3BTFE 3P8NA 1E37B 5C5OA 1G3EA 6GCHG 4ZHMU 1BMNH 2D1JA 1BZXE 1RTFB 5EG4A 4TPIZ 1L4DA 1AUJA 5K7RA 1O35A 4YO9A 2R9PA 3E1XB 3P92A 4X8SH 1AZZA 1TGCA 3D65E 1T4VH 2CV3A 2OCVB 3RXDA 4O9VA 2Y7XA 5FBIA 1QR3E 3QLPH 2BTCE 1SOTA 3UQVA 1EPTC 4RKOB 1T8LA 5FPSA 3RXIA 1QNJA 4OGYA 1QQUA 4X1RU 1CA0C 4MLFB 4FUJA 3RXBA 1T31A 2VVVA 3RC6A 2PUQH 4INKA 4ZHAA 2ZIQH 2ZDMA 3L3TA 1C2LA 2NU1E 4K1EA 3UUZA 4ASHA 4FUDA 5GPIB 1W8BH 1P11E 1HIAA 1CGIE 5FAHA 1AIXH 2EI8A 1KDQA 1P05A 2ZCLP 5EODA 1CHGA 2PFEA 1D9IA 1TGNA 3BEFB 4JZIA 1C5RA 2ZNKH 1TPSA 4MNXA 1TNJA 2RA3A 1CA0B 1V2OT 2FYRA 2O8LA 3ZZ7A 3KQBA 1Z8GA 3SHCH 1EATA 3E91A 1S5SA 3NUMA 5L30H 2ZHFH 1IQKA 4FUFA 5F8TA 3C27B 1MZAA 1GBIA 2R0LA 4IN1A 3GCTF 3FP8E 5FBEA 3LOXA 3DFLA 2AMQA 1XUFA 1ACBE 2FESH 1PQ8A 3SV8A 1GVLA 2ZGJA 3PLPA 3MH4A 1NS3A 1AZ8A 1D3QB 3MU0A 4H6SB 1RTLA 1JWTA 3O8DA 3PM3A 3LPRA 1FQ3A 2TGPZ 1EJNA 2BD9A 3I77A 2F9VA 5FX5A 1AFEH 3UOPA 1XX9A 2SGDE 2Y5GA 1YF4A 4I7YH 3A8AA 1ZSKA 5EXLA 4XFQA 3SNDA 1SB1H 3Q3KA 1OWKA 4YT7H 1BRUP 2BLQA 2EI7A 2AS9A 1C5LH 3GY3A 2XCNA 4DJZB 2YNAA 2SGFE 5DP4A 2BDIA 3UNQA 1UK4A 4CH8B 1LQEA 1NFUA 1KSNA 4M7GA 3V0XA 2BD7A 1QL7A 2P3UB 3LH3A 2BY6X 1HAYB 4CBOA 2BLWA 2Z94A 2ANMH 2CF9H 2J2UA 7GCHG 7KMEH 1WCZA 2STAE 5JBTA 3SU5A 1NN6A 1BBRH 3QGNB 2HLCA 4AZ2B 1ELTA 1O2IA 5AF9H 2STBE 5GIBA 4BAQB 4XE4A 2WV5A 3ZVGA 2XW9A 4ZXYH 1ZLRA 4GHQA 1MKWH 1D3PB 1FY8E 2GKVE 3I78A 1P04A 3PMHB 1FUJA 1TA2A 4CHAC 4GCHG 3A7YA 1O3OA 4NZLA 4HGCA 1NO9H 5DP7A 1C5TA 4Y6DA 3NXPA 1EOJA 1ELEE 1ELDE 1MU8B 4B73A 1YPJH 3MU4A 1T32A 3VB6A 2Q6GA 2P8OB 1TX8A 4NZQA 3BSQA 1YGCH 4JZ1A 2BZ6H 1MD7A 2AERH 4TY6A 3OX7U 2ZTYA 1MKWK 1O2HA 1NY22 2BY5X 1MUEB 1O3NA 2FTMA 4KKDA 4E7RG 4K2YA 1A3BH 2BX3A 1BOQA 3H7OA 3RXAA 1V2UT 3A7WA 4MPUA 2FOEA 1TE0A 4XBBA 5E8EH 5DG6A 2SFAA 2BDYA 3UY9A 2UUYA 4JK5A 3GCOA 5L2YH 3OY6U 4Q7YA 3RMMH 1ESTA 1XUHA 2P8OC 3RXLA 2UWLA 3M3TA 5BRRE 1DX5M 1V2PT 2GD4B 3L6PA 2NU4E 3QGJA 4GVUA 3MI4A 3RMOH 1DITH 1RRKA 5EGMA 2ZFTA 1FN8A 4UFFH 2ZHDA 4XOJA 4E05H 1WBGB 2AGIX 1SGCA 5FHTA 3URCA 2R3UA 3GYMA 3GY2A 5EW1H 2ZG0H 4ZROA 1YBWA 1O34A 2FS8A 4B2AA 2QXHA 4X8UH 2ODQA 5A0AE 1BBRE 1FLEE 4A1XA 1GMHF 4IC6A 2H5CA 4NFEA 1UHBB 3P95A 1P02A 2EEKA 1DLEA 1GJDB 3SV6A 3QWCH 3SJ9A 1O0DH 2GGVB 3UREA 3Q3XA 1O3PB 1BHXF 1KXBA 3MO6A 2J4IA 4AG2A 3LKWA 1LPKB 5GCHF 4A7IB 4CREA 1LCYA 3BTHE 3RLWH 1HAIH 1EZSC 1GHXH 1AVGH 1SQOA 1LHEH 4CRDA 1SGTA 4UE7H 1O2NA 3VGCC 5TCAA 3OYPA 2ULLA 1O2MA 3F9HA 1HJAB 3A84A 4ZKOU 1FZZA 2ZDAH 3QN7A 1GGDB 1TAWA 4HI3A 1AFQC 2ASUB 1QJ1B 1C2FA 2O8WA 5T6GA 1EP5A 1XUIA 2XBVA 1T4UH 2WYJA 3A7XA 1O2RA 2A4RA 3U9AH 2Q6FA 1GI0A 4ZAEA 2K7XA 2O8MA 2TGDA 4DGJA 1DWDH 3LIWA 1ESAA 3RXOA 3VGCB 1LPZB 2Y6TA 1GJ7B 1GDUA 2FEQH 4E06H 3SHAH 1IQJA 2ZEBA
chains in the Genus database with same CATH superfamily
3SNAA 1GGDC 3ODDA 1D3TB 3SUDA 5IDKA 3DA9B 3M7UA 1HPGA 4UD9H 3VXEH 1SI5H 4NA8A 2RG3A 1TA6A 2QCYA 2Q1JA 1QA7A 1ETTH 2P59A 1Y3UA 3RU4E 2VH0A 4DVAU 2YNBA 3KEEA 4Y8XA 5ESTE 7ESTE 5ETXA 3URDA 5DP5A 1S84A 2OC7A 1P3EA 1HAVB 2ZU3A 1C5VA 1QBOA 1K9OE 4K8BA 1V2ST 1NTPA 2RDLA 2P3FH 1O5EH 1HXFH 2BQ6B 1BRCE 3S0NA 2B9LA 1EUFA 1FAXA 3F1SB 3WWFA 1E1QD 3PWBA 1OXGA 1H1BA 2ANYA 2W3IA 1UCYE 3QO6A 1ZGVA 1TFXA 2AFQB 2RCEA 2AIPA 2Z3CA 3EQ0H 5K0HA 1AVWA 1H9IE 3BIUH 1ZRKA 2W7UA 4DOQA 1H8DH 5IYTA 3GY8A 1PPCE 1EXFA 3RM0H 1C5ZB 3RXPA 1UJ1A 1G30B 1BTZA 1MTWA 3SORA 3ZVFA 1GG6B 4CBNA 4I32A 2EQNA 1CHOG 3KN2A 2FOAA 3KNXA 3M5NA 2CHAC 3SU3A 1VZQH 4LXBH 4XSKU 3SJ8A 5ABWA 2HRVA 2P94A 4YESB 2HALA 2WINI 4A92A 4JZEH 1ZTKA 2IJD1 2ILNA 4DY7B 1UTPA 3ELAH 3TIUA 1ZR0A 3SJIA 2B8OH 5I46H 1GG6C 2BDAA 4ISIH 1QJ7B 3M5MA 4ISHH 3UTUH 3QTOH 3ZYEA 2O8TA 1BJUA 3TJUA 3BTKE 3TK5A 2CHAB 1MU6B 1BMAA 1O38A 2QGRA 1JMOH 1SHHB 1ZRBA 1S6FA 2A4QA 2SGQE 1MAYA 2C3SA 1PPHE 5FPYA 1QRZA 1BCUH 2K1QA 3M7TA 2A7JA 4NGAH 1GHBF 1PPEE 2QF4A 1BMMH 3UQOA 3V3MA 3TGJE 1L0ZA 1RFNA 3MU1A 4ISOA 4LZ1H 1A0HB 4JZDH 2GDEH 1O5BB 3TH3H 4SGAE 4DG4A 3PV4A 2BVSH 2V3HH 1G2LA 3HGPA 1AD8H 3Q00A 1N6XA 5C1XA 1K1NA 1FIWA 1O3GA 4B2CA 1GBMA 1P2JA 2XNIA 2G4TA 2W7SA 5DO4H 1OWIA 1O2KA 1V2VT 1W7XH 4AFZA 1P3CA 2PKAB 1OYTH 4MNYA 3F2FA 5J4QA 3SV2H 2HNTC 2A0QB 1V2WT 2PSYA 8LPRA 4INHA 3BV9B 1L1GA 3GY7A 3O8RA 1GVKB 5C5NA 4NIXA 2CN0H 1VITF 1KLJH 3NZIA 1O3EA 2BD3A 3SZNA 2LPRA 2VB0A 1SC8U 2F3CE 3M35A 2F9BH 2JH6D 2KCYA 4A1VA 1WUNH 1GHBG 1UTOA 3PWCA 1BHXB 1IHSH 4AGJA 1MABB 2Z7FE 2KR7A 3MYWA 2ALPA 1GJCB 1K1IA 3RXGA 4NWKA 2Z9GA 3DHKH 1TX6A 2L74A 1Z71A 4U30A 2TBSA 1SMFE 5E2PA 3FZDA 2KM0A 2CJIA 5BPEA 5HM2A 7LPRA 4YOGA 1TYNA 2J92A 1ZJKA 4Y7BA 5EXNA 2PWXA 1K1MA 1J14A 2FLRH 4NCYA 1DUAA 1MTVA 3SW2B 1E1RD 2JJ2D 1YPKH 1P2MA 3U8RH 2OLGA 1M9UA 2QC2A 2KAIA 3ITIA 5LPEA 3FP7E 1O3HA 3K6YA 1Z8JB 2W26A 2H9HA 5GWZA 4ZXXH 2ZGXH 3GY4A 1QGFA 2SNVA 2A2XH 2ZGBH 1V2JT 2JKHA 1P2NA 1ZZZA 1PQ7A 2C8YB 4F49A 1W0KD 3VB7A 1QB6A 1QB9A 1Y3VA 1C2KA 1LVMA 2SNWA 3OY5U 1TBZH 4CRBA 1LPGB 3RU4T 3ZZAA 1TPAE 2G5NA 4H42U 5GDSH 3ZIAD 1THPB 5C0TA 1LKAA 2FODA 3PV5A 4BNRA 3A85A 1GBKA 2XBYA 1O2VA 1AE8H 2A45B 3ZZ6A 1EJAA 1IQEA 1C2GA 1GI6A 1EPTA 3TGIE 1UCYK 4WH6A 1GMHG 4X1SU 3MNCA 3NCLA 1GHZA 1LHCH 4YOIA 3UPEA 4P02A 4X6MA 3BG8A 1MKXH 3HGNA 4TY7A 2ZDKA 1LHDH 3SV7A 2OBQA 1HDTH 3RXMA 4CR5A 4O3TA 4FUHA 2YMSC 5GNDA 1E0FD 2FWWA 2JETB 1SOZA 1FY5A 4UEHH 2P93A 1FNIA 4X6PA 5E0HA 1W13U 3ZZ5A 2Z3DA 1THSH 3PMAB 1QBVH 1WTGH 4YXWD 2G00A 4GPGA 1O3LA 1GMCG 1YLDA 1DUEA 4CRAA 4NSYA 3KIDU 1UMAH 1UTLM 5A2MH 1UVOA 2A7HA 1TPOA 1P09A 4ABFA 4Y0ZE 3S9BA 2R2MB 1HAHH 1GDNA 4MPVA 3BTEE 4JYVH 4TPYA 1DDJA 5A8YA 2JETC 2VBCA 1UO6A 1DLKB 3QX5H 2DE8A 3ZVDA 4FUIA 2F91A 1VGCC 3CS0A 1HJ8A 4FUEA 1O2LA 1ZHMA 1BBRK 2GDDA 1EASA 1KY9A 1N8OC 4Z1MD 3EA8A 1ELCA 3PO1C 3FP6E 5B6OA 3FN8A 1E34B 2GCTB 1WQVH 1ZYOA 3AASA 1YP9A 3T25A 1XXFA 4AGKA 1V2QT 4ZKRU 1HAZB 1Z8RA 3BTME 1W0ZU 2IOTA 3T62A 2XTTB 3LGTA 1WSSH 2F9OA 2PTNA 3WWBA 3S9CA 2F83A 1KMHB 2GT7A 3FVFB 4R0IA 3V7TA 3W94A 1GMCF 1PPFE 2ZQ1A 1SGFA 4A6LA 1BTWA 1C2MA 2PP6A 5DK1A 2OD3B 3PLKA 1OX1A 1B7XB 1P10A 2HWLB 3MWIU 1VCWA 3OU0A 3W1EA 4O97A 2J9NA 2F9NA 1CA8B 4ZMAH 2BM2A 3RP2A 5EOKA 1FPHH 3SUGA 2ZTZA 2F4LA 1MQ6A 1EOLA 3A88A 3RXCA 3TNSA 3DFJA 2BOHB 2ZFSA 4X8TH 1RTKA 1KXAA 1TONA 6GCHF 1SGYE 2FTLE 3QZQA 3JZ1B 1QL9A 3C1KA 4B71A 4FUGA 4PROA 2EC9H 4JK6A 4Z6AH 3GS9A 1P2KA 3BN9A 1K28D 2AH4X 4NIWA 1ARCA 3OAAD 3SN8A 1Z6EA 2J95A 1UVSH 2D8WA 5EJLA 2OXSA 3ATKA 1VR1H 2ZWLH 3OTJE 1VITG 4Q80A 2ZC9H 2KCOA 1GI2A 1NRSH 1NRPH 1O3DA 3DT0H 8GCHF 1F0RA 1F5RA 2OC1A 5B6LA 4H6TA 2FX4A 1NPMA 1C2IA 1OP2A 2Z9JA 1EAWA 1LO6A 1PYTD 1Z7KA 3LT3A 1XUJA 3UOUA 1E36B 1HIAB 2VWOA 1EAIA 1GI5A 1TOCB 3MO9A 4WF8A 2W3KA 1L1NA 1O2GH 1KLIH 3SI4H 1TNHA 3MH6A 1GBCA 5ESBA 3I29A 3BTWE 1NFYA 4CRFA 1MTSA 4I86A 4K8YA 2Z3EA 6CHAC 4AX9H 1AWHB 1GI1A 1FPCH 2VIOA 1QY6A 1OPHB 4BAKB 4BOHA 4FVDA 3DUXH 1Q3XA 1QFKH 3E90B 1K1JA 1HAOH 4GAWA 1MTNC 1BRBE 1P0SH 4BAMB 4MVNA 1LDTT 3HPTB 3P17H 1CE5A 2V3OH 2WPHS 4I33A 4HFPB 2ZGCA 1SR5C 1GBTA 1ID5H 4IS5A 2BMGB 1J8AA 4DT4A 2G51A 4NFFA 2FP7B 3ZZCA 3F2GA 4FXGH 3F9FA 3PTNA 3TJOA 3EBNA 2Z9IA 1SQRA 4GLYA 2R3YA 4DURA 1MTUA 2RFKC 4D76A 1UTJA 1P8VC 2GZ7A 2ZFQH 3EA7A 1O3BA 5C3NA 2XOKD 3D49H 2GJGA 3MOCA 3LH1A 1EZUC 1J15A 3RUOA 3NPSA 4WWYA 1AU8A 2QXIA 3DSOA 4MDSA 1ELGA 1O5CB 5FX6A 1IHTH 2J34A 1GI8B 3LGIA 8KME2 5E2OA 5A8ZA 3IWMA 1RD3B 1A2CH 1SKYE 2AEIH 2VNTA 1V2TT 4AYYB 1W3CA 2CXVA 1ESBA 2WPLS 3MO3A 2PKSB 3VG8A 4YZUA 1A5IA 1H9HE 1QL8A 5LPRA 1C5OH 4WXVA 1GBEA 1BTUA 1NFXA 5TJXA 1AGJA 2BVXH 1SPJA 3DCLA 2BLVA 2BVRH 5L2ZH 1XVOA 1F0SA 3PRDA 1XVMA 3KF2A 1F5KU 4K3JA 2FMJA 2JDID 2ANKH 2QXJA 3MH5A 3PMBB 1SSXA 2GV6A 4ABEA 5A0BA 3HATH 1T7CA 2PKSC 1F5LA 2TIOA 1YCPH 4H4FA 3UNRA 3TLOA 1SL3A 1O32A 3RC5A 1O2SA 1O2XA 3MU5A 1ANCA 1V2MT 1J9CH 2BDBA 1DWEH 2C4FH 1T8OA 1FMGA 1RGQA 1W11U 2LP6A 2AIQA 1YKTA 2YMSB 3A81A 2JH0D 4VGCB 3O8BA 2BD8A 1ABJH 4X6OA 4FVBA 2NU2E 1SGFG 1O5AB 1A5GH 2ZO3H 1C4Y2 4ZKSU 4X2XA 1AWFH 1G37A 1YCPK 2XBXA 4FUCA 2ZU2A 4BAHB 1YPMH 2BXTH 2R2WU 2J94A 3M37A 1NU9A 4I8JA 2GV7A 1ANBA 1LHGH 3LGYA 2ZI2H 3A83A 4JZFH 1RXPA 2WHXA 1SGDE 3T26A 2QV1A 1EX3A 4WY3A 4BTUB 2DUCA 1C1SA 1NFWA 6LPRA 3F3BA 4NSVA 2L6OA 1OWHA 3GCNA 4LK4A 3TGKE 4F55A 3BTGE 4CH2B 1HLTH 1INCA 1HCGA 1UK3A 2THFB 5FXLA 1CU1A 1Y3WA 5F53A 3IG6B 2FLBH 1VGCB 3PB1E 1F0UA 3BTDE 3CP7A 1N8OB 1MAXA 1P03A 2ZQ2A 1ZMNA 1FI8A 5CHAB 4YTAA 3WY8A 3RXKA 3PO1B 1W12U 4AFUA 2GCTC 1QIXB 3FFGA 1UTKA 2HPPH 2ZU1A 3ENSB 1XMNB 2SGAA 4U01A 2OC0A 1UVTH 2IN2A 5TCCA 2HLDD 1GJBB 5EQQA 1K2I1 2FYQA 3A80A 1E35B 2A32A 4K1TA 2B5TB 1QBNA 4OS2A 1S82A 3QTVH 3N7OA 3TH4H 4OGXA 4Y76A 4Q7ZA 5A09A 4WMFA 2C8XB 1SGPE 1C1RA 1W10U 1AO5A 1EAUA 1HXEH 1SBWA 2A4GA 3M3SA 2FOCA 3DSPA 4Q7XA 2BY9X 4TT3D 3QZRA 1O2QA 3A7VA 2ZHQH 1BJVA 1O3KA 3F0PA 3QDZB 2FOBA 5GJ4B 4U2WA 2H9TH 1S0QA 2GX4A 5KECA 2OP9A 4I8GA 3SU1A 3M5LA 3BIVH 3U69H 5DP8A 4FUBA 2QAAA 3P8GA 1TNLA 2J38A 1ZMJA 1OS8A 4SGBE 1O3MA 3OE7D 2ZHWH 4RKJB 2VIPA 4I8LA 1NU7B 4MNWA 1HFDA 2J97A 5C20A 1TMBH 1Y5BT 4KTCA 1FIZA 3SNBA 3F9EA 1S85A 4NIYA 1GDQA 2Z6BD 4AYVB 1NRNH 2FDAA 3UIRA 4ACBA 2V3MA 4RI0A 3E8LA 1WOFA 2NU0E 1TOMH 4ZKNU 1FXYA 3PRBA 1Z6JH 3RU4D 1ARBA 3D23A 1C1VH 2OQ5A 3U8TH 5IK2D 3GDUA 3EYDA 1J17T 2G52A 1K0HA 1IQIA 1FAKH 1PPGE 2FS9A 3T5FH 3W95A 1LTOA 2FOHA 4Y11E 3SNEA 4LZ4B 4M9FA 3BG4B 3ZZ3A 4Y10E 3VB3A 1YPGH 4AG1A 1PFXC 3RXQA 3TITA 2XC4A 4AOQA 5F6MA 3ZZ4A 1A61H 2XCFA 3MH7A 1OKXA 1ETRH 2HNTE 2NU3E 5FL7D 1SGQE 1GMDF 3TNTA 3VB5A 1SLWB 1WV7H 5DGJA 1GI3A 3UNSA 5J4SA 1BIOA 1ELVA 1CQQA 4OS5A 3BEUA 3LGVA 1C5NH 3E16B 2B0FA 4D9RA 1C2EA 2G55A 3RXUA 3SO3A 3BG4C 3CENA 3KQ5A 3V12A 3AAUA 2K8IA 1LHFH 3JZ2B 1KXFA 3SU2A 1N6YA 1LVYA 1MCTA 2OINA 1C5YB 4IW4E 2FOMB 2YOLA 4U32A 3EA9A 5C1YA 1HAPH 6CHAB 4AFSA 1QZ8A 4Y8ZA 1EAXA 2IPQX 2ZPSA 2IJOB 4X2WA 1AVXA 1MMJN 1FDPA 1TQ7B 5EPYA 5HMAA 3OEHD 2QE7D 1FX0B 1NC6A 1QA0A 2A5KA 1XUKA 4IBLH 2AYWA 3LU9B 4D9QA 2HPQH 2BY7X 1H4WA 1MTNB 4XD7D 3NWUA 2VINA 1G3BA 1IQHA 1W2KH 2ZA5A 2VGCC 1A5HA 1C1TA 1A1RA 3ZZ9A 1VJ9U 3BTQE 1GHYH 5JPMH 5EPNA 1P12E 3OTPA 1CVWH 4TYDA 1AUTC 5CHBA 4YLUA 5DSFA 1YPHE 2XWBI 1JRTA 1TNGA 1D6RA 4MTBA 2M2AA 1DXPA 2FO9A 4AN7A 4IN2A 2QN5T 5F8ZA 4ZH8A 1YM0A 2R0KA 4AB8A 1G3CA 2FX6A 2WZQA 3RXRA 1OWEA 2JH5D 2ODPA 1DOJA 4GUXA 1SGIB 1KXCA 2WPKS 2VIWA 1C4V2 2VIVA 3MFJA 1HUTH 1UW7A 9LPRA 2FPZA 2BD2A 3EGKH 2LNCA 1C5MD 1TMTH 3ZZBA 3ZYDA 3MNSA 2ZU5A 1UTNA 3L33A 3SQEE 5HXFA 1AQ7A 1WYKA 3F6UH 2WPMS 3T29A 3KYGA 3PYHA 3RLYH 1RIWC 2D26C 1K21H 1ELFA 3VFEA 2KZ4A 1MD8A 1O2WA 4FOUC 1QTFA 4WMDA 2G5VA 1VITH 2EA3A 2Y7ZA 2BD5A 3MNBA 1ZSJA 1TQ0B 5EU8A 2QF5A 1TBRH 2GP9B 3MMGA 1C1QA 1E38B 2G8TA 1GJ4H 2VWLA 3MQKC 3HK3B 1FN6A 2XC0A 2QF0A 2VIDA 2GMTC 3T2NA 3B9FH 3ATLA 3N7EA 2ALVA 2ZF0H 4D8NA 2Y80A 1NT1A 2UUKB 4TWWA 4AFQA 1GCTC 1H9LB 2IPHA 1ZPCA 4MG3A 2G81E 1SQAA 2P95A 4X8VH 4BTIB 8GCHG 3B8JA 2A5IA 3SGAE 4OS4A 1RIWB 1HBTH 1EJMA 1O37A 4NIVA 2ZFFH 1PYTC 3KGPA 1G3DA 3NRLA 3M5OA 5C2ZA 1C5WB 1BTXA 3KQCA 5DJ7A 2ZFRH 2PLXA 5FCRA 3IITA 4IGDA 1GWAA 1VCPA 4LOYH 4UFDH 2ZPQA 4VGCC 1GBDA 5E0JA 4ZUHA 3T27A 4P00A 3K2UA 3AAVA 1GCTB 4X1PU 5EJZA 1BITA 3RXEA 4TWYA 4NG9H 1O39A 3AW1A 1V2LT 2Z9KA 2ESTE 1DWCH 2KAIB 2WSSD 1GHAG 3TPIZ 4B1TA 1GJ9B 2FI5E 3FZZA 2BB4A 1CT0E 4OS7A 3LONA 1O2ZA 1DANH 3EDXB 5DN6D 4D7FA 4K60A 3M3VA 3TJNA 1A7SA 1WDIA 1TALA 2D2DA 1S6HA 6ESTA 4IMZA 1TRMA 1AB9B 3EAJA 2O9QA 5DP3A 3R0FA 1OP0A 1ZHPA 2VWMA 2LIZA 1W0YH 2VWNA 5CHAC 5LPFA 1ABIH 3U98H 2AGEX 3KQEA 1QJ6B 3GY5A 1CGJE 1L1JA 3M36A 3AK5A 3VPKA 2OBOA 1QURH 3FO8D 1KTTB 1SQTA 5EQSA 1RS0A 5JBBS 2UUFB 2FOGA 1N1LA 2QY0B 1T8NA 4IC5A 1K1LA 1PQ5A 1TNIA 2Z9LA 1PPZA 3GICB 3UWIA 4MQAA 1LQDB 3UR9A 3MHWU 4WJG2 3GISB 1MCVA 1ELBA 1TRYA 1UTQA 3BF6H 1BMFD 4BANB 3GCTG 3E6PH 4Q2KA 1Z8IB 3OFND 1P9SA 4Q4LA 4DCDA 3GDSA 3RXHA 3E0NB 5JB8S 1C4U2 1COWD 1O36A 1WXRA 2AMDA 1HNEE 2A31A 2O8UA 1GBLA 2BOKA 5AFYH 1KDQB 3O8CA 1LVOA 2QIQA 1IQLA 2ZDLA 1UVPA 1HJ9A 4X2YA 1JRSA 1TGSZ 2J98A 2W5EA 4X0WU 1OP8A 3TK9A 3AVZA 1V2NT 4UFEH 4F4OC 1UHBA 1DS2E 1S6LA 1IQGA 1C2JA 1GL1A 1LKBA 1W14U 4THNH 4BAOB 1GBJA 2TGAA 4XDEA 2FI4E 2C8WB 2Y5FA 5CMXH 2C8ZB 2F43B 1GBAA 5H4IB 2ZGHA 3TK6A 4IMQA 3SI3H 1MZDA 1C2DA 4OS1A 2VVUA 1SG8B 2FOFA 2W6ID 2XRCA 4GHTA 1Y5AT 3U28C 3A8DA 1DM4B 2DE9A 2Y81A 1QRWA 5F8XA 2ZECA 3H5CB 1F92A 1FY3A 4NA7A 3A86A 1JIRA 1IQMA 1XKAC 1YY3A 2XC5A 4JMYA 4UFGH 2BDHA 1QB1A 4BTTB 2ANWA 2NWNA 1Y8TA 1GI4A 4ABGA 4ESTE 1K22H 3ATWA 1TPPA 1S83A 1A0LA 4KTSA 4K5ZA 5EW2H 1DSTA 1GVZA 2XBWA 3SOSA 4UONA 3GCHC 3RXJA 3Q76A 2CK3D 1CSOE 3EE7A 1CBWB 1JIMA 2SGPE 2ZDNA 1UCYH 3TVJB 3ZZDA 2GZ9A 4B75A 1TIOA 1P01A 2V0BA 3KL6A 1SGNE 2V35A 4ABIA 3F68H 4WMEA 1TLDA 1HGTH 2HNTF 3A7TA 1EZXC 3LJOA 1HAXB 2VH6A 1PPBH 3U1JB 1OSSA 3K9XB 2B7DH 3S9AA 1AN1E 2K0QA 3LC3A 3SJOA 1O3JA 3R3GB 1V2KT 3AW0A 2AHME 3OSYA 1UK2A 1SFQB 3D62A 1PJPA 2TGTA 1CBWC 5CE1A 1O2YA 3LGWA 4YOJA 2PW8H 1ZMLA 3SU6A 5JBCS 3A87A 1IAUA 1YPLH 2PV9B 4ABBA 1YYY1 1B5GH 3FAOA 1C1PA 2VGCB 1ORFA 1O5FH 1AKSB 4CR9A 2AMPA 3P6ZB 1BRAA 2AGGX 1CHOF 3SU0A 3ZZ8A 1SLXB 2ZU4A 1K1OA 3SJKA 5EQRA 2BZAA 5L6NH 2ZFPH 3ATIA 5SGAE 2VU8E 5EJ1A 2BXUH 1XUGA 5HIYA 3P8FA 3MNXA 1F7ZA 4B6EA 3GOVB 2TRMA 2ZP0H 3RC4A 1L2EA 3SBKA 1P2IA 3M7QA 3QK1A 1A0JA 3F9GA 2FZZA 5E0GA 5GXPA 1VCQA 1ZOMA 1DY8A 1SLUB 2P16A 2TPIZ 1D3DB 3S7KB 5HIZA 3FKSD 4K69A 1QRXA 4B2BA 5HM9A 2ZZUH 1BB0B 1WQSA 1GBHA 1UTMA 3B23B 3T28A 1G36A 1O3AA 1TRNA 1ZJDA 4Y71A 4R8TB 1A46H 3STIA 1D4PB 5T1VA 2H1UA 2OTVA 3LDXH 4WH8A 1Z1IA 1O2PA 1C9TA 1GBFA 1JXPA 4Y7AA 4Z0KA 5DKMA 4Y8YA 1KTSB 2WPDD 3RM2H 1ETSH 3MTYA 1A3EH 3PTBA 1AKSA 4D7GA 4RT0A 2QXGA 3E3TA 5A0CA 2GMTB 2G4UA 2RA0A 1UVUH 1BUIA 4BXSA 1H8ED 3S69A 4ABAA 1TGBA 4CRGA 1DT2A 2FI3E 4WVPE 4K1SA 1DICA 1GI9B 1GHWH 2BDCA 3SGBE 1P9UA 2KCAA 2PHBA 1O2JA 2WYGA 1LVBA 3P8OA 2F9PA 4DT7B 3DD2H 3U8OH 1CT2E 5C0UA 2H6MA 2C90B 1ZTJA 1Q31A 1O5DH 1JOUB 2Y82A 2WPIS 2ZCHP 1NESE 2QYIA 1FY4A 3Q77A 2CGAA 3RMNH 5T3HA 3DSGA 2GCHG 2V6NA 7GCHF 3ZVCA 1GHAF 3H7TA 4UDWH 2EI6A 1C9PA 5T6FA 2A4OA 1NM6A 2KFWA 4F48B 4KTUA 3GDVA 5AHGH 2BX4A 1O3IA 1KYNA 1B0FA 1BTYA 1BA8B 1THRH 3PV2A 1BDAA 5C67A 2I6SA 1SGRE 1MBQA 1P06A 3SYJA 1BTPA 2HOBA 1G2MA 1DY9A 2WPJS 1AHTH 1GI7B 4E7NA 1EP6A 4ABJA 3KQDA 3EE0B 1S81A 4RN6A 1DWBH 1WU1A 1K1PA 1NROH 1AB9C 2H2ZA 3H09A 3E0PB 5CDFE 5T6DA 1O31A 2VIQA 4Q63A 1IQFA 1JBUH 1GPZA 1Q2WA 2GT8A 2GCHF 1G9IE 1WTHD 2HGTH 3RXFA 1ZPZA 1P2OA 1O3CA 1YC0A 4FU9A 3SUFA 2ZKSA 1GHVH 1EFRD 4Y0YE 1C1MA 1O33A 1DPOA 3ESTA 3RXVA 3A8BA 3BTTE 1KXEA 1AE5A 3UB0A 2UWOA 2WUCA 5JBAS 4RSPA 9ESTA 4QT8C 4X2VA 1CGHA 5HYOA 3STJA 3FOAA 3ZVAA 3S7HB 4B74A 1Y3YA 3TJVA 1GJ8B 4JYTA 2CF8H 3SU4A 4KP0A 1TABE 1ZSLA 3SNCA 4DIIH 3RXTA 3K6ZA 3M61U 1F2SE 2PTCE 2OK5A 1AMHA 4MPXA 2BYAX 1GJ5H 1GJAB 3LJJA 1CO7E 3FANA 2P3TB 5I25A 5JB9S 2GVFA 3KHVA 2ZHEH 3HK6B 3K65B 1U6QA 3LC5A 3VB4A 2FXRA 3BEIB 1ZTLA 1BT7A 1FONA 2BY8X 1TWXB 2BDGA 4CRCA 1OWDA 3VEQB 2OUAA 3A8CA 4KGAA 3PLBA 5HGGA 4AB9A 3N99A 3V13A 2VJ1A 4Y79A 3P70B 3Q3YA 2UWPA 4MNVA 3ODFA 2ZPRA 2PGQB 3GY6A 1BTHH 5KGOA 4XBCA 1NBMD 5LGOA 1XM1A 1DE7H 1NRRH 2ZDVH 1OOKB 2ZCKP 1NRQH 3LGUA 1E79D 1OWJA 4O3UA 3VXFH 1P57B 2QA9E 3RDZA 1J16A 2XNDD 5GCHG 3U1IB 3ZV8A 1GL0E 1HB0B 1L4ZA 1AI8H 3SQHE 2HVXA 1MH0A 3ATMA 2VVCA 4INLA 1TNKA 4X6NA 1DXWA 2PSXA 1SVPA 1SHYA 1GCDA 5AVDA 4YM9A 1HAGE 1MKXK 2BLOA 4FU8A 1C1NA 5EIYA 1GJ6A 1ZHRA 2XXLA 2WV4A 4AC9A 1TGTA 4AORA 2RDEA 1SLVB 4CHAB 4RT1A 2A2QH 1RJXB 1WAYB 2Q6DA 1T8MA 2I6QA 1OYQA 4OS6A 1HAVA 1W7GH 1ANDA 4ISLA 3GCHB 5C1UA 1Y59T 1EQ9A 1Y3XA 1C1UH 1S0RA 2CMYA 1F0TA 1SFIA 3NKKA 3PROA 4O03A 3UFAA 4X1NU 4YLQH 1V3XA 2ODYB 1MBMA 2SGEE 5FPTA 2M5TA 1BQYA 2XWAA 3HKIB 4MPWA 2WUBA 1YCPM 4B76A 1V2RT 2OC8A 4XRNA 5HKKD 2KX4A 1FV9A 5DPAA 1DVAH 3GYLB 4NWLA 1PQAA 2H5DA 1ZGIA 4A1TA 1EZQA 1HRTH 1SGEE 3A7ZA 1D6WA 1QQ4A 2PGBB 4GSOA 1YPHC 1MQ5A 1Y5UT 1LMWB 2BD4A 3UWJH 5EXMA 2H9EH 2LELA 4I8KA 5PTPA 3RMLH 4I31A 5LH8A 1C5UA 4KELA 1IOEA 5DP9A 1TMUH 3SGQE 1O3FA 4J2YB 1EB1H 4ISNA 1ANEA 1EKBB 5FCKA 2OQUA 2KCPA 2Y5HA 4HTCH 2BQ7B 1QCPA 1ELAA 3ZVBA 2A7CA 2PUXB 1YPEH 5JYIA 3KCGH 3RXSA 1ZPBA 2A5AA 2UUJB 1GMDG 3CS7A 1V6DA 1KXDA 1IQNA 1BMLA 1C5QA 4X1QU 4DW2U 1EB2A 4GCHF 4JYUH 2BQWB 1HV7A 4XBDA 1XXDA 1O30A 4I8HA 3SV9A 2ZTXA 4HZHA 1C2HA 1O2TA 1C1WH 2YMSD 1H8IH 2XYAA 1NZQH 2F9UA 3PMJA 5JDUB 4YT6H 2FM2A 3KYFA 1HYLA 2GZ8A 3N7DA 5DP6A 1C1OA 1VJAU 2FIRH 2HVYB 1XKBC 4ABHA 1TBQH 4ZHLU 1AY6H 3MU8A 1C5XB 1C5SA 1KIGH 2GTBA 2BHGA 5AFZH 1CT4E 3TU7H 1QHRB 3UR6A 5G4BA 1C5PA 4NA9H 1DSUA 3ZV9A 2JIZD 4B6FA 3ZVEA 3QUMP 4JCNA 5F03A 1B0EA 8ESTE 2V7QD 1G32B 2QF3A 4A5TS 4WXIA 3HKJB 4ABDA 4DIHH 3F0OA 1Z1JA 3TH2H 1HJAC 3SUEA 1TX7A 1YLCA 1O2UA 4FU7A 5A8XA 1O5GH 2A1DB 4BXWA 1FJSA 1AFQB 1P2QA 1A4WH 4J1YA 2PKAA 1KLTA 1X7AC 3NK8A 1DFPA 1FY1A 3A82A 2PR3A 1TB6H 1O2OA 1EPTB 3A89A 1GBBA 2EY4C 2C93B 3G01A 3BTFE 3P8NA 1E37B 5C5OA 1G3EA 6GCHG 4ZHMU 1BMNH 2D1JA 2WV9A 1BZXE 1RTFB 5EG4A 4TPIZ 1L4DA 1AUJA 5K7RA 1O35A 4YO9A 2R9PA 3E1XB 3P92A 4X8SH 1AZZA 1TGCA 3D65E 1T4VH 2CV3A 2OCVB 3RXDA 4O9VA 2Y7XA 5FBIA 1QR3E 3QLPH 2BTCE 1SOTA 3UQVA 1EPTC 4RKOB 1T8LA 5FPSA 3RXIA 4FETA 1QNJA 4OGYA 1QQUA 4X1RU 4ZCNA 1CA0C 4MLFB 4FUJA 3RXBA 1T31A 2VVVA 3RC6A 2PUQH 4INKA 4ZHAA 2ZIQH 2ZDMA 3L3TA 1C2LA 2NU1E 4K1EA 3UUZA 4ASHA 4FUDA 5GPIB 1W8BH 1P11E 1HIAA 1NBME 1CGIE 5FAHA 1AIXH 2EI8A 1KDQA 1P05A 2ZCLP 5EODA 1CHGA 2PFEA 1D9IA 1TGNA 3BEFB 4JZIA 1C5RA 2ZNKH 1TPSA 4MNXA 1TNJA 2RA3A 1CA0B 1V2OT 2FYRA 2O8LA 3ZZ7A 3KQBA 1Z8GA 3SHCH 1EATA 3E91A 1S5SA 3NUMA 5L30H 2ZHFH 1IQKA 4FUFA 5F8TA 3C27B 1MZAA 1GBIA 2R0LA 4IN1A 3GCTF 3FP8E 5FBEA 3LOXA 3DFLA 2AMQA 1XUFA 3WW7A 1ACBE 2FESH 1PQ8A 3SV8A 1GVLA 2ZGJA 3PLPA 3MH4A 1NS3A 1AZ8A 1D3QB 3MU0A 4H6SB 1RTLA 1JWTA 3O8DA 3PM3A 3LPRA 1FQ3A 2TGPZ 2J5UA 1EJNA 2BD9A 3I77A 2F9VA 5FX5A 1AFEH 3UOPA 1XX9A 2SGDE 2Y5GA 1YF4A 4I7YH 3A8AA 3UAIC 1ZSKA 5EXLA 4XFQA 3SNDA 1SB1H 3Q3KA 1OWKA 4YT7H 1BRUP 2BLQA 2EI7A 2AS9A 1C5LH 3GY3A 2XCNA 1W0JD 4DJZB 2YNAA 1VKYA 2SGFE 5DP4A 2BDIA 3UNQA 1UK4A 4ACAA 4CH8B 1LQEA 1NFUA 1KSNA 4M7GA 3V0XA 2BD7A 1QL7A 2P3UB 3LH3A 2BY6X 1HAYB 4CBOA 2BLWA 2Z94A 2ANMH 2CF9H 2J2UA 7GCHG 7KMEH 1WCZA 2STAE 5JBTA 3SU5A 1NN6A 1BBRH 3QGNB 2HLCA 4AZ2B 1ELTA 1O2IA 5AF9H 2STBE 5GIBA 4BAQB 4XE4A 2WV5A 3ZVGA 2XW9A 4ZXYH 1ZLRA 4GHQA 1MKWH 1D3PB 1FY8E 2GKVE 3I78A 1P04A 3PMHB 1FUJA 1TA2A 4CHAC 4GCHG 3A7YA 1O3OA 4NZLA 4HGCA 1NO9H 5DP7A 1C5TA 4Y6DA 3NXPA 1EOJA 1ELEE 1ELDE 1MU8B 4B73A 1YPJH 3MU4A 1T32A 3VB6A 2Q6GA 2P8OB 1TX8A 4NZQA 3BSQA 1YGCH 4JZ1A 2BZ6H 1MD7A 2AERH 4TY6A 3OX7U 2ZTYA 1MKWK 1O2HA 1NY22 2BY5X 1MUEB 1O3NA 2FTMA 4KKDA 4E7RG 4K2YA 1A3BH 2BX3A 1BOQA 3H7OA 3RXAA 4ASUD 1V2UT 3A7WA 4MPUA 2FOEA 2J98B 1TE0A 4XBBA 5C17A 5E8EH 5DG6A 2SFAA 2BDYA 3UY9A 2UUYA 4JK5A 3GCOA 5L2YH 3OY6U 4Q7YA 3RMMH 3SZEA 1ESTA 1XUHA 2P8OC 3RXLA 2UWLA 3M3TA 5BRRE 1DX5M 1V2PT 2GD4B 3L6PA 2NU4E 3QGJA 4GVUA 3MI4A 3RMOH 1DITH 1RRKA 5EGMA 2ZFTA 1FN8A 4UFFH 2ZHDA 4XOJA 4E05H 1WBGB 2AGIX 1SGCA 5FHTA 3URCA 2R3UA 3GYMA 3GY2A 5EW1H 2ZG0H 4ZROA 1YBWA 1O34A 2JJ1D 2FS8A 4B2AA 2QXHA 4X8UH 2ODQA 5A0AE 1BBRE 1FLEE 4A1XA 1GMHF 4IC6A 2H5CA 4NFEA 1UHBB 3F2HA 3P95A 3CNRA 4OM9A 1P02A 2EEKA 1DLEA 1GJDB 3SV6A 1YLNA 3QWCH 3SJ9A 3OEED 1O0DH 1YWUA 2GGVB 3UREA 3Q3XA 1O3PB 1BHXF 1KXBA 3MO6A 2J4IA 4AG2A 3LKWA 1LPKB 5GCHF 4A7IB 4CREA 1LCYA 3BTHE 3RLWH 1HAIH 1EZSC 1GHXH 1AVGH 1SQOA 1LHEH 4CRDA 1SGTA 4UE7H 1O2NA 3VGCC 5TCAA 3OYPA 2ULLA 1O2MA 3F9HA 1HJAB 3A84A 4ZKOU 1FZZA 2ZDAH 3QN7A 1GGDB 1TAWA 4HI3A 1H8HD 1AFQC 2ASUB 1QJ1B 1C2FA 2O8WA 4HG6A 5T6GA 1EP5A 1XUIA 2W6JD 2XBVA 1T4UH 2WYJA 3A7XA 1O2RA 2A4RA 3U9AH 1OHHD 2Q6FA 1GI0A 4ZAEA 2K7XA 2O8MA 2TGDA 4DGJA 1DWDH 3LIWA 1ESAA 3RXOA 5KEDA 3VGCB 5C94A 1LPZB 2Y6TA 1GJ7B 1GDUA 2FEQH 4TSFD 4E06H 3SHAH 1IQJA 2ZEBA
chains in the Genus database with same CATH topology
3SNAA 1GGDC 3ODDA 1D3TB 3SUDA 5IDKA 3DA9B 3M7UA 1HPGA 4UD9H 3VXEH 1SI5H 4NA8A 2RG3A 1TA6A 2QCYA 2Q1JA 1QA7A 1ETTH 2P59A 1Y3UA 3RU4E 2VH0A 4DVAU 2YNBA 3KEEA 4Y8XA 5ESTE 7ESTE 5ETXA 3URDA 5DP5A 1S84A 2OC7A 1P3EA 1HAVB 2ZU3A 1C5VA 1QBOA 1K9OE 4K8BA 1V2ST 1NTPA 2RDLA 2P3FH 1O5EH 1HXFH 2BQ6B 1BRCE 3S0NA 2B9LA 1EUFA 1FAXA 3F1SB 3PWBA 1OXGA 1H1BA 2ANYA 2W3IA 1UCYE 3QO6A 1ZGVA 1TFXA 2AFQB 2RCEA 2AIPA 2Z3CA 3EQ0H 5K0HA 1AVWA 1H9IE 3BIUH 1ZRKA 2W7UA 4DOQA 1H8DH 5IYTA 3GY8A 1PPCE 1EXFA 3RM0H 1C5ZB 3RXPA 1UJ1A 1G30B 1BTZA 1MTWA 3SORA 3ZVFA 1GG6B 4CBNA 4I32A 1CHOG 3KN2A 2FOAA 3KNXA 3M5NA 2CHAC 3SU3A 1VZQH 4LXBH 4XSKU 3SJ8A 5ABWA 2HRVA 2P94A 4YESB 2HALA 2WINI 4A92A 4JZEH 1ZTKA 2ILNA 4DY7B 1UTPA 3ELAH 3TIUA 1ZR0A 3SJIA 2B8OH 5I46H 1GG6C 2BDAA 4ISIH 1QJ7B 3M5MA 4ISHH 3UTUH 3QTOH 3ZYEA 2O8TA 1BJUA 3TJUA 3BTKE 3TK5A 2CHAB 1MU6B 1BMAA 1O38A 2QGRA 1JMOH 1SHHB 1ZRBA 1S6FA 2A4QA 2SGQE 1MAYA 2C3SA 1PPHE 5FPYA 1QRZA 1BCUH 2K1QA 3M7TA 2A7JA 4NGAH 1GHBF 1PPEE 1BMMH 3UQOA 3V3MA 3TGJE 1L0ZA 1RFNA 3MU1A 4ISOA 4LZ1H 1A0HB 4JZDH 2GDEH 1O5BB 3TH3H 4SGAE 4DG4A 3PV4A 2BVSH 2V3HH 1G2LA 3HGPA 1AD8H 3Q00A 1N6XA 5C1XA 1K1NA 1FIWA 1O3GA 4B2CA 1GBMA 1P2JA 2XNIA 2G4TA 2W7SA 5DO4H 1OWIA 1O2KA 1V2VT 1W7XH 4AFZA 1P3CA 2PKAB 1OYTH 4MNYA 5J4QA 3SV2H 2HNTC 2A0QB 1V2WT 2PSYA 8LPRA 4INHA 3BV9B 1L1GA 3GY7A 3O8RA 1GVKB 5C5NA 4NIXA 2CN0H 1VITF 1KLJH 3NZIA 1O3EA 2BD3A 3SZNA 2LPRA 2VB0A 1SC8U 2F3CE 3M35A 2F9BH 2JH6D 4A1VA 1WUNH 1GHBG 1UTOA 3PWCA 1BHXB 1IHSH 4AGJA 2Z7FE 3MYWA 2ALPA 1GJCB 1K1IA 3RXGA 4NWKA 2Z9GA 3DHKH 1TX6A 4U30A 1Z71A 2TBSA 1SMFE 5E2PA 3FZDA 5BPEA 2CJIA 5HM2A 7LPRA 4YOGA 1TYNA 2J92A 1ZJKA 4Y7BA 5EXNA 2PWXA 1K1MA 1J14A 2FLRH 4NCYA 1DUAA 1MTVA 3SW2B 1YPKH 1P2MA 3U8RH 2OLGA 1M9UA 2QC2A 2KAIA 3ITIA 5LPEA 3FP7E 1O3HA 3K6YA 1Z8JB 2W26A 2H9HA 5GWZA 4ZXXH 2ZGXH 3GY4A 1QGFA 2SNVA 2A2XH 2ZGBH 1V2JT 2JKHA 1P2NA 1ZZZA 1PQ7A 2C8YB 4F49A 3VB7A 1QB6A 1QB9A 1Y3VA 1C2KA 1LVMA 2SNWA 3OY5U 1TBZH 4CRBA 1LPGB 3RU4T 3ZZAA 1TPAE 2G5NA 4H42U 5GDSH 1THPB 1LKAA 2FODA 4BNRA 3A85A 1GBKA 2XBYA 1O2VA 1AE8H 2A45B 3ZZ6A 1EJAA 1IQEA 1C2GA 1GI6A 1EPTA 3TGIE 1UCYK 4WH6A 1GMHG 4X1SU 3MNCA 3NCLA 1GHZA 1LHCH 4YOIA 3UPEA 4X6MA 3BG8A 1MKXH 3HGNA 4TY7A 2ZDKA 1LHDH 3SV7A 2OBQA 1HDTH 3RXMA 4CR5A 4O3TA 4FUHA 1E0FD 2FWWA 2JETB 1SOZA 1FY5A 4UEHH 2P93A 1FNIA 4X6PA 5E0HA 1W13U 3ZZ5A 2Z3DA 1THSH 3PMAB 1QBVH 1WTGH 2G00A 4GPGA 1O3LA 1GMCG 1YLDA 1DUEA 4CRAA 4NSYA 3KIDU 1UMAH 1UTLM 5A2MH 1UVOA 2A7HA 1TPOA 1P09A 4ABFA 4Y0ZE 3S9BA 2R2MB 1HAHH 1GDNA 4MPVA 3BTEE 4JYVH 4TPYA 1DDJA 5A8YA 2JETC 1UO6A 1DLKB 3QX5H 2DE8A 3ZVDA 4FUIA 2F91A 1VGCC 3CS0A 1HJ8A 4FUEA 1O2LA 1ZHMA 1BBRK 2GDDA 1EASA 1KY9A 1N8OC 3EA8A 1ELCA 3PO1C 3FP6E 5B6OA 1E34B 2GCTB 1WQVH 1ZYOA 3AASA 1YP9A 3T25A 1XXFA 4AGKA 1V2QT 4ZKRU 1HAZB 1Z8RA 3BTME 1W0ZU 2IOTA 3T62A 2XTTB 3LGTA 1WSSH 2F9OA 2PTNA 3S9CA 2F83A 2GT7A 3FVFB 4R0IA 3V7TA 3W94A 1GMCF 1PPFE 2ZQ1A 1SGFA 4A6LA 1BTWA 1C2MA 5DK1A 2OD3B 3PLKA 1OX1A 1B7XB 1P10A 2HWLB 3MWIU 1VCWA 3OU0A 4O97A 2J9NA 2F9NA 1CA8B 4ZMAH 2BM2A 3RP2A 5EOKA 1FPHH 3SUGA 2ZTZA 1MQ6A 1EOLA 3A88A 3RXCA 3TNSA 3DFJA 2BOHB 2ZFSA 4X8TH 1RTKA 1KXAA 1TONA 6GCHF 1SGYE 2FTLE 3QZQA 3JZ1B 1QL9A 3C1KA 4B71A 4FUGA 4PROA 2EC9H 4JK6A 4Z6AH 1P2KA 3BN9A 1K28D 2AH4X 4NIWA 1ARCA 3SN8A 1Z6EA 2J95A 1UVSH 2D8WA 2OXSA 3ATKA 1VR1H 2ZWLH 3OTJE 1VITG 4Q80A 2ZC9H 1GI2A 1NRSH 1NRPH 1O3DA 3DT0H 8GCHF 1F0RA 1F5RA 2OC1A 4H6TA 2FX4A 1NPMA 1C2IA 1OP2A 2Z9JA 1EAWA 1LO6A 1PYTD 1Z7KA 3LT3A 1XUJA 3UOUA 1E36B 1HIAB 2VWOA 1EAIA 1GI5A 1TOCB 3MO9A 4WF8A 2W3KA 1L1NA 1O2GH 1KLIH 3SI4H 1TNHA 3MH6A 1GBCA 5ESBA 3I29A 3BTWE 1NFYA 4CRFA 1MTSA 4K8YA 2Z3EA 6CHAC 4AX9H 1AWHB 1GI1A 1FPCH 2VIOA 1QY6A 1OPHB 4BAKB 4BOHA 4FVDA 3DUXH 1Q3XA 1QFKH 3E90B 1K1JA 1HAOH 4GAWA 1MTNC 1BRBE 1P0SH 4BAMB 4MVNA 1LDTT 3HPTB 3P17H 1CE5A 2V3OH 2WPHS 4I33A 4HFPB 2ZGCA 1SR5C 1GBTA 1ID5H 4IS5A 2BMGB 1J8AA 2G51A 4NFFA 2FP7B 3ZZCA 4FXGH 3F9FA 3PTNA 3TJOA 3EBNA 2Z9IA 4GLYA 2R3YA 4DURA 1MTUA 4D76A 1UTJA 1P8VC 2GZ7A 2ZFQH 3EA7A 1O3BA 5C3NA 3D49H 3MOCA 3LH1A 1EZUC 1J15A 3RUOA 3NPSA 4WWYA 1AU8A 2QXIA 4MDSA 1ELGA 1O5CB 5FX6A 1IHTH 2J34A 1GI8B 3LGIA 8KME2 5E2OA 5A8ZA 3IWMA 1RD3B 1A2CH 2AEIH 2VNTA 1V2TT 4AYYB 1W3CA 2CXVA 1ESBA 2WPLS 3MO3A 2PKSB 4YZUA 1A5IA 1H9HE 1QL8A 5LPRA 1C5OH 4WXVA 1GBEA 1BTUA 1NFXA 5TJXA 1AGJA 2BVXH 1SPJA 2BLVA 2BVRH 5L2ZH 1XVOA 1F0SA 1XVMA 3KF2A 1F5KU 4K3JA 2FMJA 2ANKH 2QXJA 3MH5A 3PMBB 1SSXA 2GV6A 4ABEA 5A0BA 3HATH 1T7CA 2PKSC 1F5LA 2TIOA 1YCPH 4H4FA 3UNRA 3TLOA 1SL3A 1O32A 3RC5A 1O2SA 1O2XA 3MU5A 1ANCA 1V2MT 1J9CH 2BDBA 1DWEH 2C4FH 1T8OA 1FMGA 1RGQA 1W11U 2AIQA 1YKTA 3A81A 2JH0D 4VGCB 3O8BA 2BD8A 1ABJH 4X6OA 4FVBA 2NU2E 1SGFG 1O5AB 1A5GH 2ZO3H 1C4Y2 4ZKSU 4X2XA 1AWFH 1G37A 1YCPK 2XBXA 4FUCA 2ZU2A 4BAHB 1YPMH 2BXTH 2R2WU 2J94A 3M37A 1NU9A 4I8JA 2GV7A 1ANBA 1LHGH 3LGYA 2ZI2H 3A83A 4JZFH 1RXPA 1SGDE 3T26A 2QV1A 1EX3A 4WY3A 4BTUB 2DUCA 1C1SA 1NFWA 6LPRA 4NSVA 3GCNA 1OWHA 3TGKE 4LK4A 3BTGE 4CH2B 1HLTH 1INCA 1HCGA 1UK3A 2THFB 5FXLA 1CU1A 1Y3WA 3IG6B 2FLBH 1VGCB 3PB1E 1F0UA 3BTDE 3CP7A 1N8OB 1MAXA 1P03A 2ZQ2A 1ZMNA 1FI8A 5CHAB 4YTAA 3WY8A 3RXKA 3PO1B 1W12U 4AFUA 2GCTC 1QIXB 3FFGA 1UTKA 2HPPH 2ZU1A 3ENSB 1XMNB 2SGAA 4U01A 1UVTH 2OC0A 2IN2A 5TCCA 1GJBB 5EQQA 1K2I1 2FYQA 3A80A 1E35B 2A32A 4K1TA 2B5TB 1QBNA 4OS2A 1S82A 3QTVH 3N7OA 3TH4H 4OGXA 4Y76A 4Q7ZA 5A09A 4WMFA 2C8XB 1SGPE 1C1RA 1W10U 1AO5A 1EAUA 1HXEH 1SBWA 2A4GA 3M3SA 2FOCA 4Q7XA 2BY9X 3QZRA 1O2QA 3A7VA 2ZHQH 1BJVA 1O3KA 3QDZB 5GJ4B 2FOBA 4U2WA 2H9TH 1S0QA 2GX4A 2OP9A 4I8GA 3SU1A 3M5LA 3BIVH 3U69H 5DP8A 4FUBA 2QAAA 3P8GA 1TNLA 2J38A 1ZMJA 1OS8A 4SGBE 1O3MA 2ZHWH 4RKJB 2VIPA 4I8LA 1NU7B 4MNWA 1HFDA 5C20A 1TMBH 1Y5BT 4KTCA 1FIZA 3SNBA 3F9EA 1S85A 4NIYA 1GDQA 2Z6BD 4AYVB 1NRNH 2FDAA 3UIRA 3E8LA 1WOFA 2NU0E 1TOMH 4ZKNU 1FXYA 1Z6JH 3RU4D 1ARBA 3D23A 1C1VH 2OQ5A 3U8TH 3GDUA 3EYDA 1J17T 2G52A 1IQIA 1FAKH 1PPGE 2FS9A 3T5FH 3W95A 1LTOA 2FOHA 4Y11E 3SNEA 4LZ4B 3BG4B 3ZZ3A 4Y10E 3VB3A 1YPGH 4AG1A 1PFXC 3RXQA 3TITA 2XC4A 4AOQA 5F6MA 3ZZ4A 1A61H 2XCFA 3MH7A 1OKXA 1ETRH 2HNTE 2NU3E 1SGQE 1GMDF 3TNTA 3VB5A 1SLWB 1WV7H 5DGJA 1GI3A 3UNSA 5J4SA 1BIOA 1ELVA 1CQQA 4OS5A 3BEUA 3LGVA 1C5NH 3E16B 2B0FA 4D9RA 1C2EA 2G55A 3RXUA 3SO3A 3BG4C 3CENA 3V12A 3AAUA 1LHFH 3JZ2B 1KXFA 3SU2A 1N6YA 1LVYA 1MCTA 2OINA 1C5YB 4IW4E 2FOMB 2YOLA 4U32A 3EA9A 5C1YA 1HAPH 6CHAB 4AFSA 4Y8ZA 1EAXA 2ZPSA 2IJOB 4X2WA 1AVXA 1MMJN 1FDPA 1TQ7B 5EPYA 5HMAA 1NC6A 1QA0A 2A5KA 1XUKA 4IBLH 2AYWA 3LU9B 4D9QA 2HPQH 2BY7X 1H4WA 1MTNB 3NWUA 2VINA 1G3BA 1IQHA 1W2KH 2ZA5A 2VGCC 1A5HA 1C1TA 1A1RA 3ZZ9A 1VJ9U 3BTQE 1GHYH 5JPMH 5EPNA 1P12E 1CVWH 4TYDA 1AUTC 4YLUA 1YPHE 2XWBI 1JRTA 1TNGA 1D6RA 4MTBA 1DXPA 2FO9A 4AN7A 4IN2A 2QN5T 5F8ZA 4ZH8A 1YM0A 2R0KA 4AB8A 1G3CA 2FX6A 3RXRA 1OWEA 2JH5D 2ODPA 1DOJA 4GUXA 1SGIB 1KXCA 2WPKS 2VIWA 1C4V2 2VIVA 3MFJA 1HUTH 9LPRA 2FPZA 2BD2A 3EGKH 2LNCA 1C5MD 1TMTH 3ZZBA 3ZYDA 3MNSA 2ZU5A 1UTNA 3L33A 3SQEE 5HXFA 1AQ7A 1WYKA 3F6UH 2WPMS 3T29A 3PYHA 3RLYH 1RIWC 2D26C 1K21H 1ELFA 3VFEA 1MD8A 1O2WA 1QTFA 4WMDA 2G5VA 1VITH 2EA3A 2Y7ZA 2BD5A 3MNBA 1ZSJA 1TQ0B 5EU8A 1TBRH 2GP9B 3MMGA 1C1QA 1E38B 2G8TA 1GJ4H 2VWLA 3HK3B 1FN6A 2XC0A 2QF0A 2VIDA 2GMTC 3T2NA 3B9FH 3ATLA 2ALVA 2ZF0H 4D8NA 2Y80A 1NT1A 2UUKB 4TWWA 4AFQA 1GCTC 1H9LB 2IPHA 1ZPCA 4MG3A 2G81E 1SQAA 2P95A 4X8VH 4BTIB 8GCHG 3B8JA 2A5IA 3SGAE 4OS4A 1RIWB 1HBTH 1EJMA 1O37A 4NIVA 2ZFFH 1PYTC 3KGPA 1G3DA 3M5OA 5C2ZA 1C5WB 1BTXA 3KQCA 5DJ7A 2ZFRH 2PLXA 5FCRA 3IITA 4IGDA 1GWAA 1VCPA 4LOYH 4UFDH 2ZPQA 4VGCC 1GBDA 5E0JA 4ZUHA 3T27A 3K2UA 3AAVA 1GCTB 4X1PU 1BITA 3RXEA 4TWYA 4NG9H 1O39A 3AW1A 1V2LT 2Z9KA 2ESTE 1DWCH 2KAIB 1GHAG 3TPIZ 4B1TA 1GJ9B 2FI5E 3FZZA 2BB4A 1CT0E 4OS7A 3LONA 1O2ZA 1DANH 3EDXB 4D7FA 4K60A 3M3VA 3TJNA 1A7SA 1TALA 2D2DA 1S6HA 6ESTA 4IMZA 1TRMA 1AB9B 3EAJA 2O9QA 5DP3A 3R0FA 1OP0A 1ZHPA 2VWMA 2LIZA 1W0YH 2VWNA 5CHAC 5LPFA