3SNCA

Crystal structure of sars coronavirus main protease complexed with ac-nstsq-h (soaking)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 78
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sncA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sncA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sncA02
1MZDA 1UHBA 1ZJKA 1BTZA 2ZDAH 2ZFPH 1ZTJA 1AB9C 3T27A 1TBQH 1W0YH 1GI9B 4X2YA 1O31A 1G36A 1EAXA 4NSYA 3EA8A 2BOKA 3SV8A 1LHFH 3LGIA 5GCHF 2Y82A 3BTKE 5CHAB 2QF0A 1A5HA 5EPNA 1OXGA 4NZQA 1QB1A 4IGDA 1LQEA 1RTKA 1Y3WA 1H9HE 3GDVA 1SGFA 3HGPA 1O5GH 1GHAG 3SN8A 1MAYA 1V2RT 4ZKSU 1N8OB 4UD9H 2XCFA 3UTUH 1WSSH 3U1IB 1O0DH 3MOCA 3RXFA 2B7DH 2BY6X 2XWAA 1SSXA 3LC3A 4ZROA 1SMFE 1QL8A 4X1NU 3SNAA 1P10A 2GCTC 1C2HA 1TNKA 1MTWA 1WAYB 3SU3A 2OTVA 1G2MA 3BIVH 3SGAE 4ZKOU 5TCAA 2QIQA 1GPZA 2GZ7A 1GI2A 4A6LA 1CA0B 2NU4E 1GBIA 2NWNA 5JYIA 1TX8A 1Z8JB 1FZZA 1PPFE 4BAQB 4DIHH 2ZCLP 3SZNA 1ZYOA 1SGQE 1WQVH 4UFGH 3A7YA 1K1PA 1DXPA 3UREA 2GV6A 2FM2A 1HAHH 2AFQB 2V6NA 2FLRH 5DKMA 1ELGA 1MCVA 2G52A 2HPPH 1ZPCA 1TNGA 1DWCH 2C8ZB 2ZGBH 1NTPA 2NU1E 3GY6A 1BTHH 3BIUH 1ZPBA 2ZIQH 4NA9H 2B9LA 2QA9E 4HGCA 5C3NA 1GCTB 2C4FH 4UEHH 3O8CA 1J8AA 1D6WA 3HPTB 1DICA 4ZUHA 2AH4X 5FPSA 8KME2 1P9UA 2VIQA 4WJG2 2PKSC 3A8AA 1J17T 3LGWA 4WMDA 3RXVA 3VB4A 4KGAA 2CN0H 1V2KT 2F9UA 3KQCA 1SI5H 1UJ1A 3RXDA 1C2LA 2CJIA 4NWKA 2C8YB 4XBDA 1NRNH 4Z6AH 1N6YA 5FAHA 1AN1E 3PLKA 1EZXC 1WV7H 3OYPA 4FUHA 2GVFA 1Y3VA 2XNIA 1IQIA 1FDPA 5F8ZA 4IC5A 4YOJA 1O2WA 5PTPA 2UUYA 1NFXA 1O2ZA 2H1UA 3LJOA 1TAWA 5JB9S 1VITF 1HRTH 5CMXH 2AMPA 4INKA 3KN2A 1OWDA 3A8CA 1O3KA 1MTNC 3ZZ7A 3GCTF 1AB9B 4BAOB 1C2FA 2ZHQH 2Z94A 4Y71A 3RDZA 4JYVH 1BHXB 4ASHA 1TRMA 4UFEH 4Y11E 1ANCA 1MAXA 1AY6H 1DITH 2C93B 1OPHB 2EI8A 1GJCB 1KLIH 2FOAA 2OQUA 3A88A 3Q3XA 5FBEA 3UIRA 2ZDLA 1ANBA 2FODA 2BYAX 3SU0A 7LPRA 3MO3A 4HZHA 2D8WA 2XRCA 3ESTA 5LPEA 2BD4A 2W7UA 1TPPA 2HOBA 4UFFH 5A0AE 3VGCC 1QURH 2VWOA 1HFDA 1J14A 3SJ8A 1UVOA 7KMEH 4JZIA 4DIIH 2UWLA 3L6PA 4INLA 2BDBA 2GCTB 3S9CA 3GY7A 1P05A 1PQ5A 6CHAC 3U9AH 3K9XB 1TPOA 4R0IA 2GV7A 1YCPM 2W26A 3K6ZA 1V2WT 4CH2B 3BSQA 1SGIB 2PSYA 1GBFA 1H9LB 5TJXA 3AW1A 1SQAA 2A4GA 2FO9A 3SGBE 3SV7A 2R0KA 1WYKA 1L1JA 1N1LA 3A7ZA 1C4Y2 2BQWB 1BHXF 1YPEH 1F5KU 1UK3A 1D3DB 1RGQA 1DWBH 1V2UT 1P0SH 3VXEH 2ZGXH 1LDTT 1FJSA 1AUJA 1RIWB 1O2XA 5EU8A 1QRWA 2Y81A 4X6MA 1Q31A 1IQNA 2FX4A 2FLBH 2W7SA 1YM0A 3AVZA 3RXUA 1NC6A 3PLPA 3ZZ5A 2ZWLH 1TE0A 1BTPA 4CRFA 1ANDA 2ZA5A 4M7GA 1NFWA 3SGQE 3A85A 4PROA 1LHDH 1O3HA 2QGRA 3ELAH 2VIOA 2XWBI 1HAGE 1ELVA 1V2ST 3UY9A 1O2RA 5DP3A 1TBRH 2QCYA 3MFJA 3Q77A 2ZHFH 1EAIA 1OS8A 3QGJA 2R3UA 1WBGB 4FUGA 1HAVA 3GY5A 2R2MB 5BRRE 3A7WA 4BXWA 1GJ5H 3SHCH 3CS0A 2BZ6H 1XVMA 4K69A 2BDYA 1VITG 5DP5A 1GL0E 1UO6A 2XBVA 1HJ9A 2WUCA 1GBCA 2D2DA 1A61H 5K0HA 3GCTG 1YLDA 1SGEE 1PQ8A 1CT0E 1TNLA 1BQYA 2SGQE 5DK1A 1AFQC 1BRBE 1SG8B 3SV6A 3STJA 1TB6H 1SL3A 2P3TB 1EPTC 2Z6BD 3ZV8A 5FX5A 4BXSA 2ZU1A 1HAPH 4CRCA 1MU6B 3KGPA 1GJBB 2FMJA 2Y5GA 1MTNB 3CENA 4OS7A 1ESBA 5AVDA 2V35A 1BRAA 3MI4A 4IMZA 4UFDH 1L0ZA 3RMNH 2LIZA 1UMAH 5C5OA 4K1SA 1LKBA 1PQAA 5DG6A 4AX9H 1K28D 1TA2A 3A80A 2A0QB 3SU6A 1FMGA 2G55A 1ZSKA 4JZFH 4CREA 2A4OA 4U32A 3GYMA 1DE7H 1O3BA 3E90B 2J4IA 3TGKE 3TGIE 4NIXA 3RC4A 3T28A 1YPJH 3TU7H 1C1UH 4FU9A 2CXVA 1J15A 2ANMH 2ZNKH 2GZ8A 4K5ZA 1TMUH 6CHAB 2FYQA 1WTHD 1AO5A 5JBAS 4Y7BA 1T8MA 2OINA 1O2QA 4JMYA 3SJOA 2WPKS 1SGFG 3SQEE 2PKAA 1DY9A 1JOUB 3C27B 1GG6C 2CF8H 1A4WH 1P2JA 3QZRA 1TONA 3OY5U 3I78A 2VIDA 5JBTA 2BY8X 1O2MA 4AYYB 1FY3A 3ITIA 5EXLA 2F9BH 1JRSA 1GBAA 1Z71A 4OGXA 2Z3CA 2KAIA 2WV5A 5IDKA 1Y3UA 2ZFSA 1C1PA 1PPEE 3KL6A 2BVXH 3E6PH 2XBYA 2BDCA 3EA9A 5DP4A 1GBEA 3SI3H 1ZSJA 4NWLA 4X8SH 3GCNA 1E34B 3A83A 3GY8A 4XE4A 2G81E 3VXFH 1GHBF 1MKXH 1RRKA 1BZXE 1YBWA 4MNXA 3MH4A 3SUFA 1E38B 1Y8TA 2O8UA 2GKVE 4LK4A 2ZFRH 1O2LA 4B2CA 1TNJA 1E36B 4GCHF 1QBNA 4AFQA 4F4OC 2ZHDA 1YC0A 3ZZ4A 1LVBA 2ZP0H 3GISB 3ZVDA 1AFQB 2VWNA 4BNRA 2OC8A 1YPKH 1C1WH 1ESAA 2ZU3A 1YPHE 3F9FA 1VR1H 4NCYA 1EPTB 2Q1JA 3PMBB 4X0WU 1DANH 1LPGB 2AIPA 1UCYH 1O3DA 1A0HB 1QNJA 4K8YA 4GUXA 4X2VA 2FEQH 2PW8H 1IQLA 2G00A 1HXEH 4YOGA 1ZMNA 5EQSA 4OS4A 1C4V2 4OS6A 4LZ1H 1P9SA 5HM9A 1BBRH 2ZDNA 1GMCG 1FAXA 2ZU4A 2GCHG 3L3TA 1CBWB 4B76A 5ETXA 3T2NA 1C5RA 5F6MA 1V3XA 1UTLM 1EZQA 1A1RA 3V7TA 1BMNH 2VVVA 2QXIA 2G51A 1XXDA 4DOQA 3EDXB 1CO7E 2BLQA 4I8JA 4Y8YA 4AN7A 1GHXH 5C1UA 3MH7A 3A86A 2FTLE 2YNAA 1KTSB 4MVNA 1DUEA 2G4TA 1GDQA 1Z6JH 5EPYA 4ABDA 3STIA 1AI8H 2ZGJA 1C5YB 3GY2A 4X8UH 3SV2H 4AOQA 1BJVA 2PV9B 1GG6B 2XYAA 1G30B 3FFGA 2BB4A 2WINI 5I25A 1O2NA 1AWFH 3SNBA 1AD8H 5E2PA 3RMLH 2BY9X 3PYHA 4DURA 2BDGA 2BX4A 2BM2A 3MU4A 2FI3E 1AZ8A 2BDHA 2WYJA 3GYLB 2ZECA 4NG9H 5DP8A 2D26C 3A8BA 3JZ2B 1XUIA 1BIOA 4LOYH 4RN6A 1EP6A 1QBVH 3TH4H 1P02A 1EXFA 2ASUB 3M5NA 1AHTH 4GCHG 2OBOA 1O2PA 2IN2A 4A1VA 4A7IB 4Y8ZA 4MQAA 3GCHC 1GJ6A 1V2TT 2VNTA 2ZPRA 5HGGA 3PB1E 5LPFA 3TK9A 2Z9LA 2ZGCA 1NO9H 2GX4A 2ZC9H 1SGDE 4O03A 1AE8H 3MHWU 5EODA 1TYNA 1S83A 5TCCA 3GOVB 3A8DA 1GI7B 1O3IA 3KF2A 5EW1H 2Y6TA 1O3FA 1O2SA 1HPGA 4GLYA 2QF3A 4D9RA 2OXSA 5E0GA 1F0UA 5EG4A 2QXJA 1GJ7B 1Z8GA 2QXHA 5JBBS 1ZHMA 3FP8E 3IWMA 3RU4E 2JH6D 2F9NA 1CVWH 1UCYK 2ANYA 4X2WA 4CRAA 4OGYA 4YT7H 4NIYA 4ABHA 4D9QA 4X1QU 4CRGA 3RXAA 2OP9A 5C67A 1PPBH 1BA8B 3T29A 3LGVA 3TK5A 1CA8B 1ELFA 2SGEE 4ABAA 4ABJA 2PUQH 3LGYA 3PTBA 4WF8A 2K1QA 1GHWH 2HRVA 2P59A 3P8FA 1BBRK 1ZMLA 3RLWH 1TPSA 4MDSA 2H9EH 2BQ6B 3JZ1B 1G9IE 2FESH 1EAUA 2ZFTA 2EI7A 3QUMP 1RTFB 3RMOH 2F3CE 1S0QA 1QIXB 1DPOA 4SGAE 1GJ8B 1K1IA 1CQQA 2SGPE 1GVKB 1C5OH 2K7XA 1YGCH 1KXCA 1V2NT 2ZCHP 1GBDA 4O9VA 2ZZUH 3BTME 5A0BA 1CHGA 1NU7B 3MYWA 4JZDH 1C1SA 1VCQA 2XXLA 3BTTE 5EW2H 8GCHG 2VJ1A 3TNSA 1S85A 1EB2A 5J4SA 4WMEA 2C8WB 1PYTC 1FY5A 5E2OA 1JMOH 3IITA 4ABBA 3PO1C 1O3CA 3HK3B 2A31A 3LH1A 1B7XB 1UVSH 4BTUB 1GHYH 4YLUA 1O5DH 4DW2U 1UTMA 1GDNA 1MKWK 3LH3A 1VJAU 3EAJA 1E35B 4NA8A 1BMAA 1SOZA 1CGJE 2P94A 1AVWA 1KXAA 3HATH 1JBUH 1JIRA 1C4U2 1SHYA 4GPGA 5E0JA 1FLEE 2Q6DA 1KDQA 1P04A 1JIMA 2BD9A 3RXCA 1OWHA 2OD3B 3FP7E 3AAUA 1AUTC 4I33A 4BANB 4AFUA 4D7FA 1AE5A 1LPKB 3F9EA 2GDEH 3R3GB 4E06H 1GBKA 3URDA 4D7GA 4AB8A 1WUNH 1F2SE 2UWPA 4I8LA 5GIBA 4ZMAH 1A5IA 1OP0A 2BTCE 1TOMH 1XXFA 3E1XB 3GCHB 5FBIA 4X1RU 2FPZA 3CP7A 2W3IA 2FOEA 3KNXA 2A1DB 4FUDA 3VB5A 2STBE 4K3JA 4HI3A 1HJAC 5AHGH 2BZAA 1CU1A 3VPKA 4O3UA 1T8OA 4B73A 1O2KA 3SUGA 1F92A 1HNEE 4FVDA 3TIUA 4Y0ZE 2FX6A 4WVPE 1H4WA 1QRXA 1SBWA 3QZQA 5A8YA 1W12U 1C5SA 4AGJA 1P8VC 4DGJA 3TH3H 3KQBA 4B71A 2FDAA 3W95A 1GJAB 1TABE 1THPB 3SBKA 1NT1A 1ZHPA 4RKOB 2VH0A 3TGJE 5T6DA 1VCWA 2ESTE 1P2MA 1EASA 3M3VA 2ZHEH 1GWAA 3SUDA 3T25A 3MNSA 1GGDC 2ZG0H 1Y5BT 3LJJA 1OYTH 4F49A 8LPRA 4I8KA 2JETC 3TJUA 2P3FH 4KTSA 5ABWA 3RM0H 1Y59T 3DFLA 1EX3A 2LPRA 4UDWH 3LOXA 1A3BH 1UHBB 4NIVA 1QBOA 3E3TA 4AG1A 1SR5C 1FY4A 3PO1B 4VGCC 2TIOA 1RFNA 1KXDA 1LPZB 3DD2H 2W5EA 4ZXYH 1ZJDA 1LTOA 1W7XH 2SGAA 1EJAA 3U69H 2QAAA 1NRPH 1S0RA 2ODQA 4H4FA 6LPRA 3RXGA 1OKXA 1AZZA 1Y5UT 2PTNA 4JZ1A 1LVYA 1RS0A 2DUCA 3KQDA 1N6XA 1K1LA 2CHAC 3RC5A 3GDUA 3VEQB 3I77A 1KY9A 3EA7A 1ELDE 1P06A 4MG3A 1P2KA 4WY3A 2AGEX 1QJ6B 2SNWA 1MD8A 1NRSH 1G3DA 5FCKA 3S7KB 1XKBC 2A5AA 1SQTA 4TWWA 1W10U 3KIDU 2XC4A 3O8BA 3GY3A 1HIAB 2XC0A 2HVXA 1FY1A 1UK4A 1PFXC 4FU8A 4Y79A 3SU4A 2A7CA 2GT7A 2SGFE 2HNTC 1ARBA 3MU5A 1MMJN 2HALA 2FZZA 5L2YH 1NPMA 1C2GA 3R0FA 3QO6A 1Z1IA 1C5MD 1KSNA 3UFAA 1V2LT 3CS7A 1HJAB 1Z7KA 1C5UA 3E16B 1TX7A 1LHEH 3BEUA 1O3EA 1C1OA 1AU8A 4B75A 2OC0A 2VVUA 2H2ZA 3ATWA 1HDTH 5F8XA 4E7RG 3T5FH 1NM6A 3ENSB 3PROA 2P93A 3M7QA 1FUJA 1P2QA 3FVFB 1C5TA 2P8OC 4THNH 2D1JA 1JRTA 1TGBA 1O2GH 1C5PA 3D49H 3S0NA 2ANKH 2AS9A 1CGHA 1TMTH 2PHBA 5L2ZH 1QA0A 1IQHA 1W2KH 2PKSB 2JH5D 2A5IA 2FXRA 3RUOA 1UVTH 2TGPZ 1XUFA 2FYRA 2ZQ1A 2FOMB 3TVJB 2R2WU 4E7NA 2BDAA 1SB1H 3RXQA 1OSSA 3ZZCA 4FUIA 1MTUA 3Q00A 3A87A 1NROH 4U2WA 1P2NA 1C2DA 4CH8B 3Q3YA 4NFFA 5G4BA 1HJ8A 2JETB 3RXSA 2F9PA 1QA7A 1C2JA 2TGAA 3NWUA 1K1OA 4YLQH 1DXWA 4Q7YA 2A2QH 1K1NA 2OLGA 1GCDA 4VGCB 2BY5X 1ZTLA 2A2XH 2Y5HA 2HLCA 3F68H 1EJMA 3SNEA 2BLOA 1SPJA 1AKSA 2Z9JA 2O9QA 3EYDA 1YPGH 2Q6GA 2ZI2H 3SU1A 1EQ9A 2AEIH 1GBMA 1H8DH 1XVOA 2CMYA 3FP6E 3SNCA 5BPEA 4MNYA 1QTFA 1V6DA 3VGCB 5FXLA 2EA3A 3PMJA 2BOHB 1DLKB 1GBLA 1QR3E 3KCGH 5ESTE 1C9PA 3M7UA 4RKJB 3TLOA 4H6SB 1RD3B 1GI4A 2AYWA 1V2VT 3ZV9A 2RA3A 1GMCF 4J2YB 1YF4A 1LVMA 2VH6A 3MTYA 2GCHF 2HGTH 4ABGA 3S9BA 1OX1A 1QQ4A 2YNBA 2BVSH 1GI1A 4DVAU 1ZPZA 1QB9A 2PWXA 3UR9A 3PWCA 4LZ4B 1D6RA 1Y3YA 3F9HA 2Y80A 4KP0A 3DUXH 1XM1A 3MMGA 3SOSA 1EJNA 1ZTKA 3BN9A 2JKHA 5E8EH 2J92A 4OS2A 1FI8A 1TGTA 1WTGH 2ZFQH 5HMAA 1OWIA 3SHAH 4ABIA 4DT7B 1BMLA 3F1SB 4AB9A 3TITA 1CHOG 5DGJA 4MPUA 5T6GA 3SQHE 1TPAE 1BT7A 2BD2A 2TPIZ 4X6NA 1DWDH 2BLWA 4YTAA 1ETTH 1HAOH 2ODYB 1GVZA 3NXPA 2P8OB 4ISOA 2BHGA 4WWYA 1TOCB 2OUAA 4ZHLU 1WQSA 1QCPA 1HAVB 4BTIB 2TRMA 5JB8S 1G2LA 1WU1A 3P95A 3ATMA 3MO9A 4B2BA 1LVOA 3E91A 1C5VA 1KLTA 1S6FA 2OC7A 4I8HA 4IC6A 4MLFB 4YT6H 2GD4B 1GVLA 2HNTF 3RLYH 1QB6A 5CE1A 1KIGH 1O3GA 3AAVA 1O2JA 1ZHRA 2F9VA 2H9HA 3UNSA 1JWTA 1IQKA 2GGVB 2O8TA 2UUJB 4K2YA 4TWYA 4Y0YE 1TALA 3L33A 3ZZBA 2IPHA 1IOEA 2FS8A 2Y7ZA 7GCHF 1Q2WA 1MBQA 1S5SA 1AVXA 1IQJA 4LXBH 3LT3A 1YLCA 4Y7AA 4FXGH 1O2OA 2BD3A 3UPEA 1TQ0B 2XTTB 4BAKB 4CRBA 3K65B 1C1VH 1XUKA 2V0BA 3LGTA 1C1TA 1D3PB 1HGTH 1KXEA 1DSUA 4OS1A 2AMDA 3MNCA 5FX6A 1P09A 3T26A 3M5LA 4CBOA 2Z3EA 1TNIA 3F9GA 3O8RA 3GDSA 2BX3A 2B8OH 2GMTC 2ZTYA 1BUIA 1SGPE 4Y8XA 4WMFA 4Q7ZA 1C1NA 3ZVEA 2SGDE 4IBLH 3MO6A 2V3HH 2CF9H 2WPHS 3NCLA 4KKDA 5JPMH 2A7HA 2BY7X 4WXVA 1C1RA 1ELTA 8GCHF 2VIWA 1OWJA 1P3EA 5J4QA 1ZOMA 2FIRH 4CHAC 4K8BA 2H5CA 3P6ZB 4H42U 6GCHF 1NFYA 1MBMA 1MKWH 4FU7A 3HKJB 3VB3A 4IMQA 1C9TA 4JYUH 1TRNA 3ZZ9A 2ZHWH 4NA7A 1FV9A 4GAWA 2OC1A 1SLXB 2Q6FA 1LHGH 1SLVB 4INHA 5GPIB 3GCOA 1F5RA 2EC9H 1VGCC 4HFPB 1EOLA 3Q3KA 1GDUA 1DFPA 1MQ6A 1SGTA 5A2MH 2XC5A 2FS9A 2AIQA 4CR5A 4ISLA 1O5CB 3LC5A 1GJ9B 3V13A 1G3CA 2Y5FA 3P70B 2VU8E 3E0PB 1BTXA 2O8MA 2ZF0H 3N7OA 4YOIA 2W3KA 2ZDKA 1TMBH 1IHSH 3RXBA 1P03A 7GCHG 2NU0E 3B9FH 1RTLA 2J95A 3FANA 1O2IA 1RJXB 2FOCA 2UWOA 1T7CA 1YKTA 4ZKNU 1LCYA 3HGNA 1C5NH 1GBTA 3KEEA 2BLVA 5C20A 3OU0A 3BEIB 1NZQH 1BJUA 1O5EH 3FAOA 5EXNA 1C2IA 1DX5M 1O3NA 1S82A 4YM9A 1PPCE 1EB1H 3PMHB 1NY22 1T8NA 2ODPA 2EI6A 3SJIA 3NUMA 4K60A 2A32A 1GMHF 2QV1A 1XUHA 1GHZA 4Y76A 2C8XB 3B8JA 4IN2A 1GBBA 4JK6A 2AERH 1KXBA 1GHVH 3RC6A 3RXTA 2V3OH 1EAWA 4ISHH 1C5ZB 1DT2A 3PTNA 2RA0A 3LDXH 1ABIH 1UTJA 2HWLB 1ETSH 2EEKA 1V2PT 1O3MA 1A5GH 1Q3XA 4U01A 2OQ5A 5HXFA 1VZQH 4TPYA 3RU4D 3PWBA 5C1XA 3S69A 3TJNA 1O39A 4AFSA 3SU2A 1ZMJA 4B2AA 1X7AC 2GMTB 6GCHG 1UTPA 1QL7A 2XBXA 1LO6A 3ODFA 1F0TA 4BAMB 2VWLA 1W8BH 1UVPA 1HAYB 3RXOA 3VB6A 2ZTXA 2J94A 4X1SU 5EQQA 1GBJA 1TRYA 2VB0A 2ULLA 4NSVA 4CHAB 1ZGIA 3TNTA 4A1TA 1BITA 4I7YH 3P8GA 2VGCC 1TNHA 3BV9B 3PV4A 2ZPQA 5AFZH 2XCNA 2ZDVH 4A92A 1BMMH 1DSTA 2PGQB 5F8TA 4JYTA 1H9IE 1YPLH 1G3BA 1CGIE 5GDSH 1PPZA 3ZZ8A 1LHCH 3MU1A 1VGCB 2ANWA 1NRQH 1IHTH 4GHTA 2PR3A 1O3AA 2OCVB 1O32A 1YP9A 2GP9B 3RXHA 1KTTB 1Z6EA 2FOHA 1TGNA 3SUEA 4FUJA 1BOQA 1HAZB 1FNIA 5GWZA 1W14U 3ATLA 1SQOA 1H8IH 1AVGH 1TWXB 1ETRH 5LPRA 5AFYH 1B5GH 3SW2B 4RSPA 1GL1A 1QRZA 2WPLS 1HIAA 4Q80A 2LNCA 1GBHA 4ABFA 1ZRKA 1O2UA 1GMHG 1P12E 3M3SA 4NGAH 4B1TA 4X8TH 1O33A 3ZYEA 3EBNA 1THSH 1MH0A 3GICB 2ALVA 3U8OH 4FUBA 1VJ9U 2PTCE 3S9AA 1O3JA 1DY8A 2I6SA 4XDEA 1K9OE 1MTVA 1LMWB 1FY8E 2WPIS 5DPAA 1KLJH 1DM4B 3SNDA 1NESE 3E8LA 3SORA 5L30H 5T3HA 4MPVA 1AWHB 1SHHB 1RIWC 1SFQB 3M7TA 5LGOA 2QC2A 3H7TA 3A82A 1IQFA 3RU4T 1ZR0A 3UWJH 3ZYDA 3W94A 2HNTE 5DO4H 3M35A 3QTOH 4X2XA 2J38A 1MU8B 1PQ7A 1YCPH 1O2HA 4KELA 2Z9KA 3QN7A 2FWWA 2BD5A 2OBQA 1MTSA 3FZZA 2GDDA 3MH6A 1NN6A 1SLUB 3V12A 2ZGHA 1O5AB 2WUBA 3LGUA 2J9NA 1XX9A 3EE0B 5IYTA 5L6NH 3BTQE 1ZZZA 1A46H 3QGNB 3MH5A 1SGYE 1P11E 1WOFA 4WH6A 5H4IB 1QGFA 4TY7A 4ISIH 1FN8A 1EZSC 3ZZAA 1PPHE 2R3YA 3HK6B 3V3MA 3SO3A 1B0FA 1QJ7B 2PLXA 1OOKB 3UNRA 1EOJA 5GCHG 4Z0KA 1GI6A 1DWEH 3DFJA 2H5DA 1F0SA 2STAE 1O37A 2B0FA 2QYIA 3MU0A 2NU2E 5E0HA 5DP9A 1V2OT 5HYOA 1O38A 3NPSA 2A4RA 1KYNA 3P8NA 3FZDA 4K1EA 4AORA 1ELAA 3ATKA 4CRDA 2M5TA 2VGCB 3Q76A 3TJVA 1KDQB 3PM3A 2XW9A 4WH8A 1D3QB 1QL9A 1EZUC 2PFEA 1NU9A 1MZAA 3BTDE 4KTUA 3MNXA 4GSOA 3ZVFA 7ESTE 3RXKA 3ZVGA 1LKAA 1MCTA 4DJZB 5F03A 1SLWB 2SFAA 2FP7B 2A7JA 3RXMA 4YO9A 1EATA 1HXFH 1CE5A 1A7SA 1O35A 1O5BB 1TFXA 1A3EH 1TIOA 2FOFA 4D76A 3M3TA 1DVAH 3ZVBA 2QN5T 3MWIU 4XBCA 1T31A 1HLTH 3SJKA 4O3TA 1C5WB 5EOKA 5JBCS 4R8TB 1Y5AT 4FUCA 3A7XA 3F6UH 1P3CA 5I46H 2UUKB 2BD7A 4B74A 3C1KA 3RXIA 5GXPA 2PGBB 1Y3XA 2YOLA 2QY0B 1E37B 3NK8A 5HM2A 3SJ9A 2FOGA 1UVUH 5T6FA 3HKIB 2PUXB 5SGAE 1BRUP 2FTMA 2IOTA 1SGNE 3ZVCA 4FUFA 1ELCA 2ILNA 1OYQA 3I29A 1YCPK 1CHOF 1QJ1B 4FVBA 4Y10E 3BTHE 1TX6A 1SFIA 1DS2E 1RXPA 1HB0B 2Z7FE 1D3TB 4TYDA 3M5OA 1GGDB 4MNVA 3NZIA 3BTGE 1J16A 1O3PB 1XMNB 3U1JB 2F91A 3A7TA 2B5TB 3UWIA 1V2QT 2J34A 3SV9A 1TA6A 3A89A 1V2MT 2C3SA 1DDJA 2VIVA 3OTJE 3UNQA 1F5LA 1FPHH 1OWEA 2R9PA 1SGRE 3UQOA 1O30A 1IQEA 1W3CA 3T62A 3URCA 1TLDA 3DT0H 2H6MA 4OS5A 2ZU2A 1O2TA 3LONA 3QTVH 1W11U 1V2JT 1CT4E 2ZQ2A 1L4DA 1T4VH 2GT8A 1EPTA 1FXYA 1HV7A 4X6PA 4NZLA 2WV4A 2ZFFH 4I8GA 4ZH8A 1CSOE 3ZZDA 1AFEH 3D62A 4CR9A 3LIWA 1B0EA 5A8ZA 1P2OA 2PSXA 2IJOB 2G4UA 1ZLRA 8ESTE 3BTEE 3EGKH 4XFQA 1MD7A 3GY4A 2CHAB 3D23A 3LKWA 2FI4E 1DUAA 3ATIA 1D9IA 4DCDA 5EQRA 1HYLA 2AMQA 4GHQA 1UTNA 3QX5H 1C5LH 4ZAEA 1G32B 2BXTH 1ABJH 1ESTA 1ACBE 1KXFA 4UONA 4ESTE 1C1QA 4X8VH 1CBWC 1GI5A 2BXUH 2WPJS 4QT8C 4DY7B 3P8OA 1MUEB 4A1XA 1UK2A 3BG4C 4ZKRU 4BOHA 4E05H 1GJ4H 2WYGA 1A0LA 1QFKH 1UCYE 5FPYA 4J1YA 2G5NA 3RXEA 4TY6A 2BD8A 1TQ7B 2FOBA 2THFB 3UOUA 1C2EA 2A45B 3M36A 5B6OA 3KQEA 1H1BA 4MPWA 1C1MA 5DP7A 1QY6A 4IN1A 1LQDB 1BBRE 1ARCA 3LU9B 1TGCA 3MNBA 2VIPA 1G37A 3OX7U 1T4UH 2I6QA 1K22H 5EXMA 2RG3A 3A81A 4NIWA 4MPXA 5C2ZA 3VB7A 1AQ7A 1ELEE 1O2YA 4AFZA 2ALPA 1ELBA 4X1PU 1EKBB 1NFUA 3AASA 3KHVA 1C2MA 3K2UA 2TGDA 4SGBE 5A09A 1D4PB 4NFEA 3QK1A 1M9UA 4K1TA 1W0ZU 1SGCA 1Z1JA 2Z3DA 1SVPA 1YYY1 4BTTB 3BF6H 2C90B 2DE9A 2ZPSA 6ESTA 4ZXXH 4XSKU 1OWKA 1Z8RA 3IG6B 3U98H 4AYVB 1GMDF 3M5MA 4ISNA 2BDIA 4ABEA 1MQ5A 1WCZA 5FCRA 2TGTA 1ANEA 1O2VA 1P01A 3H7OA 1S81A 5FPTA 5GJ4B 1NRRH 2P3UB 4TPIZ 1FIWA 4DG4A 1THRH 2A5KA 2Z9IA 1SOTA 4ZHMU 2ZU5A 4O97A 2R0LA 4U30A 1UTOA 1GI3A 2ZEBA 1F7ZA 2G5VA 3U8TH 2J2UA 3OSYA 4ZHAA 1TBZH 1GJDB 2P95A 3RP2A 1T32A 1AKSB 4D8NA 1YPMH 1HAXB 3TPIZ 3G01A 4GVUA 5EGMA 3M37A 2ZKSA 3PMAB 5ESBA 3SU5A 3S7HB 1P57B 1UTKA 4YESB 3ODDA 4HTCH 4Q2KA 1A2CH 4FUEA 2ZO3H 5JDUB 3RXRA 4AG2A 4MTBA 3UR6A 1K21H 1ZRBA 3A7VA 4JZEH 3BG8A 2PKAB 1AGJA 1AMHA 1BDAA 3ZVAA 4X6OA 1A0JA 1K1MA 2WPMS 2CGAA 5FHTA 3BG4B 2VVCA 4I32A 4JCNA 3VFEA 4AGKA 3ZZ3A 2GZ9A 1O5FH 1O36A 5K7RA 1HCGA 2UUFB 2G8TA 5CHAC 3TK6A 3RXLA 2Y7XA 1C2KA 1ORFA 2KAIB 1J9CH 3OY6U 4JK5A 1K1JA 4IW4E 1BRCE 1S84A 3QWCH 1W13U 4I31A 1T8LA 4XBBA 4AZ2B 1GI8B 1N8OC 2AGIX 2DE8A 1L1GA 3UOPA 1INCA 1CT2E 3EQ0H 4KTCA 1PJPA 1BTYA 2O8WA 3BTFE 1HBTH 1ZSLA 3UQVA 1GHBG 1O3LA 1YPHC 4CBNA 3D65E 1XKAC 2P16A 3QLPH 1GMDG 1EP5A 1QHRB 1DLEA 2O8LA 1IQMA 4H6TA 1BB0B 1GHAF 1FPCH 4XOJA 1PPGE 1MKXK 1CA0C 3M61U 1HAIH 2NU3E 4MNWA 2VINA 3B23B 1NS3A 1BTWA 3O8DA 2HPQH 1L2EA 3V0XA 3BTWE 5C5NA 1O34A 1P2IA 2ZDMA 4A5TS 1TGSZ 3NKKA 1FAKH 2QXGA 2BQ7B 3RMMH 2RDLA 1U6QA 1Z8IB 5DJ7A 2TBSA 2VWMA 3U8RH 5A8XA 2Z9GA 1EUFA 1O3OA 1VITH 3QDZB 1PYTD 3DHKH 2RCEA 1BCUH 2F9OA 3PLBA 1IAUA 1FQ3A 1HUTH 1W7GH 3A84A 5AF9H 3UUZA 9LPRA 2H9TH 2JH0D 2AGGX 2BVRH 1GCTC 1XUJA 3K6YA 4YZUA 2BMGB 1E0FD 1GI0A 4UE7H 3LPRA 1OP2A 4IS5A 4Y6DA 3RXPA 2A4QA 2ZCKP 1DOJA 4Q7XA 1XUGA 3TJOA 5DP6A 2XBWA 1VCPA 3H5CB 1FN6A 1JXPA 1AIXH 1S6HA 2SNVA 5C1YA 1QQUA 1UTQA 9ESTA 1K2I1 1SC8U 3ZZ6A 4BAHB 4WXIA 3MU8A 1FONA 3AW0A 5A0CA 3RXJA 3WY8A 1L1NA 3RM2H 1BTUA 2FI5E 3DA9B 1L4ZA 3E0NB 1ZGVA 2ZTZA 5LH8A 1F0RA 1ID5H 2GTBA 1IQGA 3BEFB 1OP8A 1FIZA 2CV3A 1G3EA 1C5QA 3P92A 3TH2H 2F83A 3SI4H 3P17H 1C5XB
chains in the Genus database with same CATH superfamily
1MZDA 1UHBA 1ZJKA 1BTZA 2ZDAH 2ZFPH 1ZTJA 1AB9C 3T27A 1TBQH 1W0YH 1GI9B 4X2YA 1O31A 1G36A 1EAXA 4NSYA 3EA8A 2BOKA 3SV8A 1LHFH 3LGIA 5GCHF 2Y82A 3BTKE 5CHAB 2QF0A 1A5HA 5EPNA 1OXGA 4NZQA 1QB1A 4IGDA 1LQEA 1RTKA 1Y3WA 1H9HE 3GDVA 1SGFA 3HGPA 1O5GH 1GHAG 3SN8A 1MAYA 1V2RT 4ZKSU 1N8OB 4UD9H 2XCFA 3UTUH 1WSSH 3U1IB 1O0DH 3MOCA 2JDID 3RXFA 2B7DH 2BY6X 2XWAA 1SSXA 3LC3A 4ZROA 1SMFE 1QL8A 4X1NU 3SNAA 1P10A 2GCTC 1C2HA 1TNKA 1MTWA 2VBCA 1WAYB 3SU3A 2OTVA 1G2MA 3BIVH 3SGAE 4ZKOU 5TCAA 2QIQA 1GPZA 2GZ7A 1GI2A 4A6LA 1CA0B 2NU4E 1GBIA 2NWNA 3KQ5A 1TX8A 1Z8JB 5JYIA 1FZZA 1PPFE 4BAQB 4DIHH 2ZCLP 3SZNA 1ZYOA 1SGQE 1WQVH 4UFGH 3A7YA 1K1PA 1DXPA 3UREA 2GV6A 3W1EA 2FM2A 1HAHH 2AFQB 3MQKC 2V6NA 2FLRH 5DKMA 1ELGA 1MCVA 2G52A 2HPPH 1ZPCA 1TNGA 1DWCH 2C8ZB 2ZGBH 1NTPA 2OK5A 2NU1E 3EE7A 3GY6A 1BTHH 3BIUH 1ZPBA 2ZIQH 4NA9H 2B9LA 2QA9E 4HGCA 5C3NA 1GCTB 2C4FH 4UEHH 3O8CA 1J8AA 1D6WA 3HPTB 1DICA 4ZUHA 2AH4X 5EJ1A 5FPSA 8KME2 1P9UA 2VIQA 4WJG2 2PKSC 3A8AA 1J17T 3LGWA 4WMDA 3RXVA 3VB4A 4KGAA 2CN0H 1V2KT 2F9UA 3KQCA 1SI5H 1UJ1A 3RXDA 1C2LA 2CJIA 4NWKA 2C8YB 4XBDA 1NRNH 1SKYE 4Z6AH 1N6YA 5FAHA 1AN1E 3PLKA 1EZXC 1WV7H 3OYPA 4FUHA 2GVFA 1Y3VA 2XNIA 1IQIA 1FDPA 5F8ZA 4IC5A 4YOJA 1O2WA 5PTPA 2UUYA 1NFXA 1O2ZA 2H1UA 3LJOA 1TAWA 5JB9S 1VITF 1HRTH 5CMXH 2AMPA 4INKA 3KN2A 1OWDA 3A8CA 1O3KA 1MTNC 3ZZ7A 3GCTF 3OAAD 1AB9B 5C94A 4BAOB 1C2FA 2ZHQH 4HG6A 2Z94A 4Y71A 3RDZA 4JYVH 1BHXB 4ASHA 1TRMA 4UFEH 4Y11E 1ANCA 1MAXA 1AY6H 1DITH 2FOAA 1OPHB 2EI8A 1GJCB 1KLIH 2C93B 2OQUA 3A88A 3Q3XA 5FBEA 3UIRA 2ZDLA 1ANBA 2FODA 2BYAX 3SU0A 7LPRA 3MO3A 4HZHA 2D8WA 2XRCA 3ESTA 5LPEA 2BD4A 2W7UA 1TPPA 2HOBA 4UFFH 5A0AE 3VGCC 1QURH 2K0QA 2VWOA 1HFDA 1J14A 3SJ8A 1UVOA 7KMEH 4JZIA 4DIIH 2UWLA 2KM0A 3L6PA 4INLA 2BDBA 2GCTB 3S9CA 3GY7A 1P05A 1PQ5A 6CHAC 3U9AH 3K9XB 1TPOA 4R0IA 2GV7A 1YCPM 2W26A 3K6ZA 1V2WT 4CH2B 3BSQA 1SGIB 2PSYA 1GBFA 1H9LB 5TJXA 3AW1A 1SQAA 2A4GA 2FO9A 3SGBE 3SV7A 2R0KA 1WYKA 1L1JA 1N1LA 3A7ZA 1C4Y2 2BQWB 1BHXF 1YPEH 1F5KU 1UK3A 1D3DB 1RGQA 1DWBH 1V2UT 1P0SH 3VXEH 2ZGXH 3GS9A 1LDTT 1FJSA 1AUJA 1RIWB 1O2XA 5EU8A 1QRWA 2Y81A 4X6MA 1Q31A 1IQNA 2FX4A 2FLBH 2W7SA 1YM0A 3AVZA 3RXUA 1NC6A 3PLPA 3ZZ5A 2ZWLH 1TE0A 2YMSB 1BTPA 4CRFA 1ANDA 2ZA5A 3SYJA 4M7GA 1NFWA 3SGQE 3A85A 4PROA 1LHDH 1O3HA 2QGRA 3ELAH 2VIOA 2XWBI 3OTPA 1HAGE 1ELVA 1V2ST 3UY9A 3KYFA 1O2RA 5DP3A 1TBRH 2QCYA 3MFJA 3Q77A 2ZHFH 1EAIA 1OS8A 3QGJA 2R3UA 1WBGB 4FUGA 1HAVA 3GY5A 5EJZA 2R2MB 5BRRE 5HIZA 5IK2D 3A7WA 4BXWA 1COWD 1GJ5H 2KCOA 3SHCH 3CS0A 2BZ6H 3F0OA 1XVMA 4K69A 2BDYA 1VITG 4Q63A 5DP5A 1GL0E 1UO6A 2XBVA 1HJ9A 2WUCA 1GBCA 2D2DA 1A61H 5K0HA 3GCTG 1YLDA 1SGEE 1PQ8A 1CT0E 1TNLA 1BQYA 2SGQE 5DK1A 1AFQC 1BRBE 1SG8B 3SV6A 3STJA 1TB6H 3OFND 1SL3A 2P3TB 1EPTC 2Z6BD 3ZV8A 5FX5A 4BXSA 2ZU1A 1HAPH 4CRCA 1MU6B 3KGPA 1GJBB 2FMJA 2Y5GA 1MTNB 3CENA 4OS7A 4OM9A 1ESBA 5AVDA 2V35A 1BRAA 3MI4A 4IMZA 4UFDH 1L0ZA 4XRNA 3RMNH 2LIZA 1UMAH 5C5OA 4K1SA 1LKBA 1PQAA 5DG6A 4AX9H 1K28D 1TA2A 3A80A 4YXWD 2A0QB 3SU6A 1FMGA 2G55A 1ZSKA 4JZFH 4CREA 4DT4A 2A4OA 4U32A 3GYMA 1DE7H 2J97A 1O3BA 3E90B 2J4IA 3TGKE 3TGIE 4NIXA 3RC4A 3T28A 1YPJH 3TU7H 1C1UH 4FU9A 2CXVA 1J15A 2ANMH 2ZNKH 2GZ8A 4K5ZA 1TMUH 6CHAB 2FYQA 1WTHD 1AO5A 5JBAS 4Y7BA 1T8MA 2OINA 1O2QA 4JMYA 3SJOA 2WPKS 1SGFG 3SQEE 2PKAA 1DY9A 1WXRA 1JOUB 3C27B 1GG6C 2CF8H 1A4WH 1P2JA 3QZRA 1TONA 3OY5U 3I78A 2VIDA 5JBTA 2BY8X 1FX0B 1O2MA 4AYYB 1FY3A 2EY4C 3ITIA 5EXLA 2F9BH 1JRSA 1GBAA 1Z71A 2CK3D 4OGXA 2Z3CA 2KAIA 2WV5A 5IDKA 1Y3UA 2ZFSA 1C1PA 1PPEE 3KL6A 2BVXH 3E6PH 2XBYA 2BDCA 3EA9A 5DP4A 1GBEA 3SI3H 1ZSJA 4NWLA 4X8SH 3GCNA 1E34B 3A83A 3GY8A 4XE4A 2G81E 3VXFH 1GHBF 1MKXH 1RRKA 1BZXE 1YBWA 4MNXA 3MH4A 3SUFA 1E38B 1Y8TA 2O8UA 5T1VA 2GKVE 4LK4A 2HVYB 2KX4A 2ZFRH 1O2LA 4B2CA 1TNJA 1E36B 4GCHF 1QBNA 4AFQA 4F4OC 2ZHDA 1YC0A 3ZZ4A 1LVBA 2ZP0H 3GISB 3ZVDA 1AFQB 5F53A 2VWNA 4BNRA 2OC8A 1YPKH 1C1WH 1ESAA 2ZU3A 1YPHE 3F9FA 1VR1H 4NCYA 1EPTB 2Q1JA 3PMBB 4X0WU 1DANH 1LPGB 2AIPA 1UCYH 1O3DA 1A0HB 1QNJA 4K8YA 4GUXA 4X2VA 2FEQH 2PW8H 3H09A 1IQLA 2G00A 1HXEH 4YOGA 3F2FA 1ZMNA 5EQSA 4OS4A 1C4V2 2LP6A 4OS6A 4LZ1H 1P9SA 5HM9A 1BBRH 2ZDNA 1GMCG 1FAXA 2ZU4A 2GCHG 3L3TA 1CBWB 4B76A 5ETXA 3T2NA 1C5RA 5F6MA 1V3XA 1UTLM 1EZQA 1A1RA 3V7TA 1BMNH 2VVVA 2QXIA 2G51A 1XXDA 4DOQA 3EDXB 1CO7E 2BLQA 4I8JA 4Y8YA 4AN7A 1GHXH 5C1UA 3MH7A 3A86A 4XD7D 2FTLE 2YNAA 1KTSB 4MVNA 1DUEA 2G4TA 1GDQA 1Z6JH 5EPYA 4ABDA 3STIA 1AI8H 2ZGJA 1C5YB 3GY2A 4X8UH 3SV2H 4AOQA 1BJVA 2PV9B 1GG6B 2XYAA 1G30B 3FFGA 2BB4A 2WINI 5I25A 1O2NA 1AWFH 3SNBA 1AD8H 5E2PA 3RMLH 2BY9X 3PYHA 4DURA 2BDGA 2BX4A 2BM2A 3MU4A 2FI3E 1AZ8A 2BDHA 2WYJA 3GYLB 2ZECA 4NG9H 5DP8A 2D26C 3A8BA 3JZ2B 1XUIA 4F48B 1BIOA 4LOYH 4RN6A 1EP6A 1QBVH 3TH4H 1P02A 1EXFA 2ASUB 3M5NA 1AHTH 4GCHG 2OBOA 1O2PA 2IN2A 4A1VA 4A7IB 4Y8ZA 4MQAA 3GCHC 1GJ6A 1V2TT 2VNTA 2ZPRA 5HGGA 3PB1E 5LPFA 3TK9A 2Z9LA 2ZGCA 1NO9H 2GX4A 2ZC9H 2HLDD 1SGDE 4O03A 1AE8H 3MHWU 5EODA 1TYNA 1S83A 5TCCA 3GOVB 3A8DA 1GI7B 1O3IA 3KF2A 5EW1H 2Y6TA 1O3FA 1O2SA 1HPGA 4GLYA 2EQNA 2QF3A 4D9RA 2OXSA 5E0GA 1F0UA 5EG4A 2QXJA 1GJ7B 1Z8GA 2QXHA 5JBBS 1ZHMA 3FP8E 3IWMA 3RU4E 2JH6D 2F9NA 1CVWH 1UCYK 2ANYA 4X2WA 4CRAA 4OGYA 2RDEA 4YT7H 4NIYA 4ABHA 4D9QA 4X1QU 4CRGA 3RXAA 2OP9A 5C67A 1PPBH 1BA8B 3T29A 3LGVA 3TK5A 1CA8B 1ELFA 2WHXA 2SGEE 4ABAA 4ABJA 2PUQH 3LGYA 3PTBA 4WF8A 3SZEA 2K1QA 1GHWH 2HRVA 2P59A 3P8FA 1BBRK 1ZMLA 3RLWH 1TPSA 4MDSA 2H9EH 2BQ6B 3JZ1B 1G9IE 2FESH 1EAUA 2ZFTA 2EI7A 3QUMP 1RTFB 3RMOH 2F3CE 1S0QA 1QIXB 1DPOA 4SGAE 1GJ8B 1K1IA 1CQQA 2SGPE 1GVKB 1C5OH 2K7XA 1YGCH 1KXCA 1V2NT 2ZCHP 1GBDA 3F2GA 1NBMD 4O9VA 2ZZUH 3BTME 5A0BA 1CHGA 1NU7B 3MYWA 4JZDH 1C1SA 1VCQA 2XXLA 3BTTE 5EW2H 8GCHG 2VJ1A 3TNSA 1S85A 1EB2A 5J4SA 4WMEA 2C8WB 1PYTC 1FY5A 5E2OA 1JMOH 3IITA 4ABBA 3PO1C 1O3CA 3HK3B 2A31A 3LH1A 1B7XB 1VKYA 1UVSH 4BTUB 2K8IA 1GHYH 4YLUA 1O5DH 4DW2U 1UTMA 1GDNA 1MKWK 3LH3A 1VJAU 3EAJA 1E35B 4NA8A 1BMAA 1SOZA 1CGJE 2P94A 1AVWA 1KXAA 3HATH 1JBUH 1JIRA 1C4U2 1SHYA 4GPGA 5E0JA 1FLEE 2Q6DA 1KDQA 1P04A 1JIMA 2BD9A 3RXCA 1OWHA 2OD3B 3FP7E 3AAUA 1AUTC 2WPDD 4I33A 4BANB 4AFUA 4D7FA 1AE5A 1LPKB 1W0KD 3F9EA 2GDEH 3R3GB 4E06H 1GBKA 3URDA 4D7GA 4AB8A 1WUNH 1F2SE 2UWPA 4I8LA 5GIBA 4ZMAH 1A5IA 1OP0A 2BTCE 5HKKD 1TOMH 1XXFA 3E1XB 3GCHB 5FBIA 4X1RU 2FPZA 3CP7A 2W3IA 2FOEA 3KNXA 2A1DB 4FUDA 3VB5A 2STBE 4K3JA 4HI3A 1HJAC 5AHGH 4B6FA 2BZAA 1CU1A 3VPKA 4I86A 4O3UA 1T8OA 4B73A 1O2KA 2JJ1D 3SUGA 1F92A 1HNEE 4FVDA 3TIUA 4Y0ZE 2FX6A 4WVPE 1H4WA 1QRXA 1SBWA 1SQRA 3QZQA 5A8YA 1W12U 1C5SA 4AGJA 1P8VC 4DGJA 3TH3H 3KQBA 4B71A 2FDAA 3W95A 1GJAB 1TABE 1THPB 3SBKA 1NT1A 1ZHPA 4RKOB 2VH0A 3TGJE 5T6DA 1VCWA 2ESTE 1P2MA 1EASA 3M3VA 2ZHEH 1GWAA 3SUDA 3T25A 3MNSA 1GGDC 2QE7D 2ZG0H 1Y5BT 3LJJA 1OYTH 4F49A 8LPRA 4I8KA 5KECA 2JETC 3TJUA 2P3FH 4KTSA 5ABWA 3RM0H 1Y59T 3DFLA 1EX3A 2LPRA 4UDWH 3LOXA 1A3BH 1UHBB 4NIVA 1QBOA 3E3TA 3N99A 4AG1A 2V3MA 1SR5C 1FY4A 3PO1B 4VGCC 2TIOA 1RFNA 1KXDA 1LPZB 3DD2H 2W5EA 4ZXYH 1ZJDA 1LTOA 1W7XH 2SGAA 1EJAA 3U69H 4ACBA 2QAAA 1NRPH 1S0RA 2ODQA 4H4FA 6LPRA 3RXGA 1OKXA 1AZZA 1Y5UT 2PTNA 4JZ1A 1LVYA 1RS0A 2DUCA 3KQDA 1N6XA 1K1LA 2CHAC 3RC5A 3GDUA 3VEQB 3I77A 1KY9A 3EA7A 1ELDE 1P06A 4MG3A 1P2KA 4WY3A 2AGEX 1QJ6B 3F0PA 2SNWA 1MD8A 1NRSH 1G3DA 5FCKA 3S7KB 1BMFD 1XKBC 2A5AA 1SQTA 4TWWA 1W10U 3KIDU 2XC4A 3O8BA 3GY3A 1HIAB 4B6EA 2RFKC 2XC0A 2HVXA 1FY1A 2F43B 1UK4A 1PFXC 4FU8A 4Y79A 3SU4A 2A7CA 2GT7A 2J98A 2HNTC 1ARBA 2SGFE 3MU5A 1MMJN 2HALA 3N7EA 2FZZA 5L2YH 1NPMA 1C2GA 4TT3D 3R0FA 3QO6A 1Z1IA 1C5MD 1KSNA 3UFAA 1V2LT 3CS7A 1HJAB 1Z7KA 1C5UA 3E16B 4FOUC 1TX7A 1LHEH 3BEUA 1O3EA 1C1OA 1AU8A 4B75A 2OC0A 2VVUA 2H2ZA 3ATWA 1HDTH 3VG8A 5F8XA 4E7RG 3T5FH 1NM6A 3ENSB 3PROA 2P93A 3M7QA 1FUJA 1P2QA 3FVFB 1C5TA 2P8OC 4THNH 2D1JA 1JRTA 1TGBA 1O2GH 1C5PA 3D49H 3S0NA 2ANKH 2AS9A 1CGHA 1TMTH 2PHBA 5L2ZH 1QA0A 1IQHA 1W2KH 2PKSB 2JH5D 2A5IA 2FXRA 3RUOA 1UVTH 2TGPZ 1XUFA 2FYRA 2ZQ1A 2FOMB 1S6LA 3TVJB 2R2WU 4E7NA 2BDAA 1SB1H 3RXQA 1OSSA 3ZZCA 4FUIA 1MTUA 3Q00A 3OEHD 3A87A 1NROH 4U2WA 1P2NA 1C2DA 4CH8B 3Q3YA 4NFFA 5G4BA 1HJ8A 2JETB 3RXSA 2F9PA 3WW7A 1QA7A 2W6JD 1C2JA 2TGAA 3NWUA 1K1OA 4YLQH 1DXWA 4Q7YA 2A2QH 1K1NA 2OLGA 1GCDA 4VGCB 2BY5X 1ZTLA 2A2XH 2Y5HA 2HLCA 3F68H 5C0TA 1EJMA 5KGOA 3SNEA 2BLOA 1SPJA 1AKSA 2Z9JA 2O9QA 3EYDA 1YPGH 2Q6GA 1E1RD 2ZI2H 3SU1A 1EQ9A 2AEIH 1GBMA 1H8DH 1XVOA 2CMYA 3FP6E 3SNCA 5BPEA 4MNYA 1QTFA 1V6DA 3VGCB 5FXLA 2EA3A 3PMJA 2BOHB 1DLKB 1GBLA 1QR3E 3KCGH 2V7QD 5ESTE 1C9PA 3M7UA 4RKJB 2JJ2D 3TLOA 4H6SB 1RD3B 1GI4A 2AYWA 1V2VT 1H8ED 3ZV9A 2RA3A 1GMCF 4J2YB 1YF4A 1LVMA 2VH6A 3MTYA 2GCHF 2HGTH 4ABGA 3S9BA 1OX1A 1QQ4A 2YNBA 2BVSH 1GI1A 4DVAU 1ZPZA 3ZIAD 1QB9A 2PWXA 3UR9A 3PWCA 4LZ4B 1D6RA 1Y3YA 3F9HA 2KFWA 2Y80A 4KP0A 3DUXH 1XM1A 3MMGA 3SOSA 1EJNA 1ZTKA 3BN9A 2JKHA 5E8EH 2J92A 4OS2A 1FI8A 1TGTA 1WTGH 2ZFQH 5HMAA 1OWIA 3SHAH 4ABIA 4DT7B 1BMLA 3F1SB 3DSOA 3TITA 1CHOG 5DGJA 4AB9A 4MPUA 5T6GA 3SQHE 1TPAE 1BT7A 2BD2A 2TPIZ 4X6NA 3DCLA 1DWDH 2BLWA 4YTAA 1ETTH 1HAOH 2ODYB 1GVZA 3CNRA 3NXPA 2P8OB 4ISOA 2BHGA 4WWYA 1TOCB 2OUAA 4ZHLU 1WQSA 1QCPA 5C17A 1HAVB 4BTIB 2TRMA 3NRLA 5JB8S 1G2LA 1WU1A 3P95A 3ATMA 3MO9A 4B2BA 1LVOA 3E91A 1C5VA 1KLTA 1S6FA 2OC7A 4I8HA 4IC6A 4MLFB 4YT6H 2GD4B 1GVLA 2HNTF 3RLYH 1QB6A 5CE1A 1KIGH 5B6LA 1O3GA 3AAVA 1O2JA 1ZHRA 2F9VA 2H9HA 3UNSA 1JWTA 1IQKA 2GGVB 2O8TA 2UUJB 4K2YA 4TWYA 4Y0YE 1TALA 3L33A 3FN8A 3ZZBA 2IPHA 1IOEA 2FS8A 2Y7ZA 7GCHF 1Q2WA 1MBQA 1S5SA 1AVXA 1IQJA 4LXBH 3LT3A 1YLCA 4Y7AA 4FXGH 1O2OA 2BD3A 3UPEA 1TQ0B 2XTTB 4BAKB 4CRBA 3K65B 1C1VH 1XUKA 2V0BA 3LGTA 1C1TA 1D3PB 1HGTH 1KXEA 1DSUA 3DSPA 4OS1A 2AMDA 3MNCA 5FX6A 4RT0A 1P09A 3T26A 3M5LA 4CBOA 2Z3EA 1TNIA 3F9GA 3O8RA 3GDSA 2BX3A 2B8OH 2GMTC 2ZTYA 2J5UA 1BUIA 1SGPE 4Y8XA 4WMFA 4Q7ZA 1C1NA 1MABB 3ZVEA 2SGDE 4IBLH 3MO6A 2V3HH 2CF9H 2WPHS 3NCLA 4KKDA 5JPMH 2A7HA 2BY7X 4WXVA 1C1RA 3DSGA 4RI0A 1ELTA 8GCHF 2VIWA 1OWJA 1P3EA 5GNDA 5J4QA 1ZOMA 2FIRH 4CHAC 4K8BA 2H5CA 3P6ZB 4H42U 6GCHF 1NFYA 1MBMA 1MKWH 3UAIC 2IJD1 4FU7A 3HKJB 3VB3A 4IMQA 1C9TA 4JYUH 1TRNA 3ZZ9A 2ZHWH 4NA7A 1FV9A 4GAWA 2OC1A 1SLXB 2Q6FA 1LHGH 1SLVB 4INHA 5GPIB 3GCOA 1F5RA 5KEDA 2EC9H 1KMHB 1VGCC 4HFPB 1EOLA 3Q3KA 1GDUA 1DFPA 1MQ6A 1SGTA 5A2MH 2XC5A 2FS9A 2AIQA 4CR5A 4ISLA 1O5CB 3LC5A 1GJ9B 3V13A 1G3CA 2Y5FA 3P70B 2VU8E 1YLNA 3E0PB 1BTXA 2AHME 2O8MA 2ZF0H 3N7OA 4YOIA 2W3KA 2ZDKA 1TMBH 1IHSH 3RXBA 1P03A 2JIZD 7GCHG 2NU0E 3B9FH 1RTLA 2J95A 3FANA 1O2IA 1RJXB 2FOCA 2UWOA 1T7CA 1YKTA 4ZKNU 1LCYA 3HGNA 1C5NH 1GBTA 3KEEA 2BLVA 5C20A 3OU0A 3BEIB 1NZQH 1BJUA 1O5EH 3FAOA 5EXNA 1C2IA 1DX5M 1O3NA 1S82A 4YM9A 1PPCE 1EB1H 3PMHB 1NY22 1T8NA 2ODPA 2EI6A 3SJIA 3NUMA 4K60A 2A32A 1GMHF 2QV1A 1XUHA 1GHZA 4Y76A 2C8XB 3B8JA 4IN2A 1GBBA 1NBME 4JK6A 1UW7A 1YY3A 2AERH 1KXBA 1GHVH 2L6OA 3RC6A 3RXTA 2V3OH 1EAWA 4ISHH 1C5ZB 1DT2A 3PTNA 2RA0A 3LDXH 1ABIH 1WDIA 1UTJA 2HWLB 1ETSH 2EEKA 1V2PT 1O3MA 2KR7A 3UB0A 1A5GH 1Q3XA 4U01A 2OQ5A 5HXFA 1VZQH 2XOKD 1H8HD 4TPYA 3RU4D 3PWBA 5C1XA 3S69A 3TJNA 1O39A 4AFSA 3SU2A 1ZMJA 4B2AA 1X7AC 2GMTB 6GCHG 1UTPA 1QL7A 2XBXA 1LO6A 3ODFA 1F0TA 4BAMB 2VWLA 5CDFE 2WSSD 1W8BH 1UVPA 1HAYB 3RXOA 3VB6A 2ZTXA 2J94A 4X1SU 5EQQA 1GBJA 1TRYA 2VB0A 2ULLA 4NSVA 5FL7D 1ZGIA 4CHAB 3TNTA 1OHHD 4A1TA 1BITA 4I7YH 3P8GA 2VGCC 1TNHA 3BV9B 3PV4A 2ZPQA 5AFZH 2XCNA 2ZDVH 4A92A 1BMMH 1DSTA 2PGQB 5F8TA 4JYTA 1H9IE 1YPLH 2YMSD 1K0HA 1G3BA 1CGIE 5GDSH 1PPZA 3ZZ8A 1LHCH 3MU1A 1VGCB 2ANWA 2XNDD 1NRQH 1IHTH 4GHTA 2PR3A 1O3AA 2OCVB 1O32A 5CHBA 1YP9A 2GP9B 3RXHA 1KTTB 1Z6EA 2FOHA 1TGNA 3SUEA 4FUJA 1BOQA 1HAZB 1FNIA 5GWZA 1W14U 3ATLA 1SQOA 1QZ8A 1H8IH 1AVGH 1TWXB 1ETRH 5LPRA 5AFYH 1B5GH 3SW2B 4RSPA 1GL1A 1QRZA 2WPLS 1HIAA 4Q80A 2LNCA 1GBHA 4ABFA 1ZRKA 1O2UA 1GMHG 1P12E 3M3SA 4NGAH 4B1TA 4X8TH 1O33A 1YWUA 3ZYEA 3EBNA 1THSH 1MH0A 3GICB 2ALVA 3U8OH 4FUBA 1VJ9U 2PTCE 3S9AA 1O3JA 1DY8A 2I6SA 4XDEA 1K9OE 1MTVA 1LMWB 1FY8E 2WPIS 5DPAA 1KLJH 1DM4B 3SNDA 1NESE 3E8LA 3SORA 5L30H 5T3HA 4MPVA 1AWHB 1SHHB 1RIWC 1SFQB 3M7TA 5EIYA 5LGOA 2QC2A 3H7TA 3A82A 1IQFA 3RU4T 1ZR0A 2YMSC 3UWJH 3ZYDA 3W94A 2HNTE 5DO4H 3M35A 3QTOH 4X2XA 2J38A 1MU8B 1PQ7A 1YCPH 1O2HA 3FO8D 4TSFD 4KELA 2Z9KA 3QN7A 2FWWA 2BD5A 2OBQA 1MTSA 3FZZA 2GDDA 3MH6A 1NN6A 1SLUB 3V12A 2ZGHA 1O5AB 2WUBA 3LGUA 2J9NA 1XX9A 3EE0B 5IYTA 5L6NH 3BTQE 2F4LA 1A46H 1ZZZA 4ZCNA 3QGNB 3MH5A 1SGYE 2PP6A 1P11E 1WOFA 4WH6A 5H4IB 1QGFA 4TY7A 4ISIH 1FN8A 1EZSC 3ZZAA 1PPHE 2R3YA 3HK6B 3V3MA 3SO3A 1B0FA 1QJ7B 2PLXA 1OOKB 3UNRA 1EOJA 5GCHG 4Z0KA 1GI6A 1DWEH 3DFJA 2H5DA 1F0SA 2STAE 1O37A 2B0FA 2QYIA 3MU0A 2NU2E 3OE7D 5E0HA 5DP9A 1V2OT 5HYOA 1O38A 3NPSA 2A4RA 1KYNA 3P8NA 3FZDA 4K1EA 4AORA 1ELAA 3ATKA 4CRDA 5HIYA 2M5TA 2VGCB 3Q76A 3TJVA 1KDQB 3PM3A 2XW9A 4WH8A 1D3QB 1QL9A 1EZUC 2PFEA 1NU9A 1MZAA 3BTDE 4KTUA 3MNXA 4GSOA 3ZVFA 7ESTE 3RXKA 3ZVGA 1LKAA 1MCTA 4DJZB 5F03A 1SLWB 2SFAA 2FP7B 2A7JA 2W6ID 3RXMA 4YO9A 1EATA 1HXFH 1CE5A 1A7SA 1O35A 1O5BB 1TFXA 1A3EH 1TIOA 2FOFA 4D76A 3M3TA 1DVAH 3ZVBA 2QN5T 3MWIU 4XBCA 1T31A 1HLTH 3PRBA 3U28C 3SJKA 4O3TA 2LELA 1C5WB 5EOKA 5JBCS 4R8TB 1Y5AT 4FUCA 3A7XA 3F6UH 1P3CA 5I46H 2UUKB 2BD7A 4B74A 3C1KA 3RXIA 1W0JD 2PGBB 1Y3XA 2YOLA 5GXPA 2QY0B 1E37B 3NK8A 5DSFA 5HM2A 3SJ9A 2FOGA 1UVUH 5T6FA 3HKIB 2PUXB 2QF5A 1BRUP 5SGAE 2FTMA 2IOTA 1SGNE 3ZVCA 4FUFA 4Q4LA 1ELCA 2ILNA 1OYQA 3I29A 1YCPK 1CHOF 1QJ1B 4FVBA 4Y10E 3BTHE 3WWFA 1TX6A 1SFIA 1DS2E 1RXPA 1HB0B 2Z7FE 1D3TB 4TYDA 3M5OA 1GGDB 4MNVA 3NZIA 3BTGE 1J16A 1O3PB 1XMNB 1E1QD 3U1JB 2F91A 3A7TA 2B5TB 3UWIA 1V2QT 2J34A 3SV9A 1TA6A 3A89A 1V2MT 2C3SA 1DDJA 2VIVA 3OTJE 3UNQA 1F5LA 1FPHH 3F3BA 1OWEA 2R9PA 1SGRE 3UQOA 1O30A 1IQEA 1W3CA 3T62A 3URCA 1TLDA 1EFRD 3DT0H 2H6MA 4OS5A 2ZU2A 1O2TA 3LONA 3QTVH 1W11U 1V2JT 1CT4E 2ZQ2A 1L4DA 1T4VH 2GT8A 4AC9A 2IPQX 1EPTA 1FXYA 1HV7A 4X6PA 4NZLA 2WV4A 2ZFFH 4I8GA 4ZH8A 1CSOE 3ZZDA 1AFEH 3D62A 4CR9A 3LIWA 1B0EA 5A8ZA 1P2OA 2PSXA 2IJOB 2G4UA 1ZLRA 8ESTE 3BTEE 3EGKH 4XFQA 1MD7A 3GY4A 2CHAB 3D23A 3LKWA 2FI4E 1DUAA 3ATIA 1D9IA 4DCDA 5EQRA 1HYLA 2AMQA 4GHQA 1UTNA 3QX5H 1C5LH 4ZAEA 1G32B 2BXTH 1ABJH 1ESTA 1ACBE 1KXFA 3N7DA 4UONA 4ESTE 1C1QA 4X8VH 1CBWC 1GI5A 2BXUH 2J98B 2WPJS 4QT8C 4DY7B 3P8OA 1MUEB 4A1XA 1UK2A 3BG4C 4ZKRU 2KCYA 3KYGA 4BOHA 4E05H 1GJ4H 2WYGA 1A0LA 1QFKH 1UCYE 5FPYA 4J1YA 2G5NA 3RXEA 4TY6A 2BD8A 1TQ7B 2FOBA 2THFB 3UOUA 3PV5A 1C2EA 2A45B 3M36A 5B6OA 3KQEA 1H1BA 4MPWA 1C1MA 5DP7A 1QY6A 4IN1A 1LQDB 1BBRE 1ARCA 2QF4A 3LU9B 1TGCA 3MNBA 3FOAA 2VIPA 1G37A 3OX7U 1T4UH 2I6QA 1K22H 5EXMA 2RG3A 3A81A 4NIWA 4MPXA 5C2ZA 3VB7A 1AQ7A 1ELEE 1O2YA 4AFZA 2ALPA 2WV9A 4RT1A 1ELBA 4X1PU 1EKBB 1NFUA 3AASA 3KHVA 1C2MA 3K2UA 2TGDA 4SGBE 5A09A 1D4PB 4NFEA 3QK1A 1M9UA 4K1TA 1W0ZU 1SGCA 1Z1JA 2Z3DA 1SVPA 1YYY1 4BTTB 3BF6H 2C90B 2DE9A 2ZPSA 4M9FA 6ESTA 4ZXXH 4XSKU 1OWKA 1Z8RA 3IG6B 3U98H 4AYVB 1GMDF 3M5MA 4ISNA 2BDIA 4ABEA 1MQ5A 1WCZA 5FCRA 2TGTA 1ANEA 1O2VA 1P01A 3H7OA 1S81A 5FPTA 5GJ4B 1NRRH 2P3UB 4TPIZ 1FIWA 4DG4A 1THRH 2A5KA 2Z9IA 3FKSD 1SOTA 4ZHMU 2ZU5A 4O97A 2R0LA 4U30A 1UTOA 1GI3A 2ZEBA 1F7ZA 2G5VA 3U8TH 2J2UA 3OSYA 4ZHAA 1TBZH 1GJDB 2P95A 3RP2A 1T32A 1AKSB 4D8NA 1YPMH 1HAXB 3TPIZ 3G01A 4GVUA 5DN6D 5EGMA 3M37A 2ZKSA 3PMAB 5ESBA 3SU5A 3S7HB 1P57B 1UTKA 4YESB 3ODDA 4HTCH 5EJLA 4Q2KA 2KCPA 1A2CH 4FUEA 2ZO3H 5JDUB 3RXRA 4AG2A 3F2HA 4MTBA 3UR6A 1K21H 1ZRBA 3A7VA 4JZEH 3BG8A 2PKAB 3PRDA 1AGJA 1AMHA 1BDAA 3ZVAA 4X6OA 1A0JA 1K1MA 2WPMS 2CGAA 5FHTA 3BG4B 2VVCA 4I32A 4JCNA 3VFEA 4AGKA 4Z1MD 3ZZ3A 2GZ9A 1O5FH 1O36A 5K7RA 1HCGA 2UUFB 2G8TA 4P02A 5CHAC 3TK6A 3RXLA 2Y7XA 1C2KA 1ORFA 4P00A 2KAIB 2L74A 1J9CH 3OY6U 4JK5A 1K1JA 4IW4E 1BRCE 1S84A 3QWCH 1W13U 4I31A 1T8LA 4XBBA 4AZ2B 1GI8B 1N8OC 2AGIX 2KZ4A 4ACAA 2DE8A 1L1GA 5C0UA 3UOPA 1INCA 1CT2E 3EQ0H 4KTCA 4ASUD 1PJPA 1BTYA 2O8WA 3BTFE 1HBTH 1ZSLA 3UQVA 2M2AA 1GHBG 1O3LA 1YPHC 4CBNA 3D65E 1E79D 1XKAC 2P16A 3QLPH 1GMDG 1EP5A 2WZQA 1QHRB 1DLEA 2O8LA 1IQMA 4H6TA 1BB0B 1GHAF 1FPCH 4XOJA 1PPGE 1MKXK 1CA0C 3M61U 1HAIH 2NU3E 4MNWA 2GJGA 2VINA 3B23B 1NS3A 1BTWA 3O8DA 2HPQH 1L2EA 3V0XA 3BTWE 5C5NA 1O34A 1P2IA 2KCAA 2ZDMA 4A5TS 1TGSZ 3NKKA 1FAKH 2QXGA 3OEED 2BQ7B 3RMMH 2RDLA 1U6QA 1Z8IB 5DJ7A 2TBSA 2VWMA 3U8RH 5A8XA 2Z9GA 1EUFA 1O3OA 1VITH 3QDZB 1PYTD 3DHKH 2RCEA 1BCUH 2F9OA 3PLBA 1IAUA 1FQ3A 1HUTH 1W7GH 3A84A 5AF9H 3UUZA 9LPRA 2H9TH 2JH0D 2AGGX 2BVRH 1GCTC 1XUJA 3K6YA 4YZUA 3WWBA 2BMGB 3AK5A 1E0FD 1GI0A 4UE7H 3LPRA 1OP2A 4IS5A 4Y6DA 3RXPA 2A4QA 2ZCKP 1DOJA 4Q7XA 1XUGA 3TJOA 5DP6A 2XBWA 1VCPA 3H5CB 1FN6A 1JXPA 1AIXH 1S6HA 2SNVA 4F55A 5C1YA 1QQUA 1UTQA 9ESTA 1K2I1 1SC8U 3ZZ6A 4BAHB 4WXIA 3MU8A 1FONA 3AW0A 5A0CA 3RXJA 4FETA 3PV2A 3WY8A 1L1NA 3RM2H 1BTUA 2FI5E 3DA9B 1L4ZA 3E0NB 1ZGVA 2ZTZA 5LH8A 1F0RA 1ID5H 2GTBA 1IQGA 3BEFB 1OP8A 1FIZA 2CV3A 1G3EA 1C5QA 3P92A 3TH2H 2F83A 3SI4H 3P17H 1C5XB
chains in the Genus database with same CATH topology
1MZDA 1UHBA 1ZJKA 1BTZA 2ZDAH 2ZFPH 1ZTJA 1AB9C 3T27A 1TBQH 1W0YH 1GI9B 4X2YA 1O31A 1G36A 1EAXA 4NSYA 3EA8A 2BOKA 3SV8A 1LHFH 3LGIA 5GCHF 2Y82A 3BTKE 5CHAB 2QF0A 1A5HA 5EPNA 1OXGA 4NZQA 1QB1A 4IGDA 1LQEA 1RTKA 1Y3WA 1H9HE 3GDVA 1SGFA 3HGPA 1O5GH 1GHAG 3SN8A 1MAYA 1V2RT 4ZKSU 1N8OB 4UD9H 2XCFA 3UTUH 1WSSH 3U1IB 1O0DH 3MOCA 3RXFA 2B7DH 2BY6X 2XWAA 1SSXA 3LC3A 4ZROA 1SMFE 1QL8A 4X1NU 3SNAA 1P10A 2GCTC 1C2HA 1TNKA 1MTWA 1WAYB 3SU3A 2OTVA 1G2MA 3BIVH 3SGAE 4ZKOU 5TCAA 2QIQA 1GPZA 2GZ7A 1GI2A 4A6LA 1CA0B 2NU4E 1GBIA 2NWNA 5JYIA 1TX8A 1Z8JB 1FZZA 1PPFE 4BAQB 4DIHH 2ZCLP 3SZNA 1ZYOA 1SGQE 1WQVH 4UFGH 3A7YA 1K1PA 1DXPA 3UREA 2GV6A 2FM2A 1HAHH 2AFQB 2V6NA 2FLRH 5DKMA 1ELGA 1MCVA 2G52A 2HPPH 1ZPCA 1TNGA 1DWCH 2C8ZB 2ZGBH 1NTPA 2NU1E 3GY6A 1BTHH 3BIUH 1ZPBA 2ZIQH 4NA9H 2B9LA 2QA9E 4HGCA 5C3NA 1GCTB 2C4FH 4UEHH 3O8CA 1J8AA 1D6WA 3HPTB 1DICA 4ZUHA 2AH4X 5FPSA 8KME2 1P9UA 2VIQA 4WJG2 2PKSC 3A8AA 1J17T 3LGWA 4WMDA 3RXVA 3VB4A 4KGAA 2CN0H 1V2KT 2F9UA 3KQCA 1SI5H 1UJ1A 3RXDA 1C2LA 2CJIA 4NWKA 2C8YB 4XBDA 1NRNH 4Z6AH 1N6YA 5FAHA 1AN1E 3PLKA 1EZXC 1WV7H 3OYPA 4FUHA 2GVFA 1Y3VA 2XNIA 1IQIA 1FDPA 5F8ZA 4IC5A 4YOJA 1O2WA 5PTPA 2UUYA 1NFXA 1O2ZA 2H1UA 3LJOA 1TAWA 5JB9S 1VITF 1HRTH 5CMXH 2AMPA 4INKA 3KN2A 1OWDA 3A8CA 1O3KA 1MTNC 3ZZ7A 3GCTF 1AB9B 4BAOB 1C2FA 2ZHQH 2Z94A 4Y71A 3RDZA 4JYVH 1BHXB 4ASHA 1TRMA 4UFEH 4Y11E 1ANCA 1MAXA 1AY6H 1DITH 2C93B 1OPHB 2EI8A 1GJCB 1KLIH 2FOAA 2OQUA 3A88A 3Q3XA 5FBEA 3UIRA 2ZDLA 1ANBA 2FODA 2BYAX 3SU0A 7LPRA 3MO3A 4HZHA 2D8WA 2XRCA 3ESTA 5LPEA 2BD4A 2W7UA 1TPPA 2HOBA 4UFFH 5A0AE 3VGCC 1QURH 2VWOA 1HFDA 1J14A 3SJ8A 1UVOA 7KMEH 4JZIA 4DIIH 2UWLA 3L6PA 4INLA 2BDBA 2GCTB 3S9CA 3GY7A 1P05A 1PQ5A 6CHAC 3U9AH 3K9XB 1TPOA 4R0IA 2GV7A 1YCPM 2W26A 3K6ZA 1V2WT 4CH2B 3BSQA 1SGIB 2PSYA 1GBFA 1H9LB 5TJXA 3AW1A 1SQAA 2A4GA 2FO9A 3SGBE 3SV7A 2R0KA 1WYKA 1L1JA 1N1LA 3A7ZA 1C4Y2 2BQWB 1BHXF 1YPEH 1F5KU 1UK3A 1D3DB 1RGQA 1DWBH 1V2UT 1P0SH 3VXEH 2ZGXH 1LDTT 1FJSA 1AUJA 1RIWB 1O2XA 5EU8A 1QRWA 2Y81A 4X6MA 1Q31A 1IQNA 2FX4A 2FLBH 2W7SA 1YM0A 3AVZA 3RXUA 1NC6A 3PLPA 3ZZ5A 2ZWLH 1TE0A 1BTPA 4CRFA 1ANDA 2ZA5A 4M7GA 1NFWA 3SGQE 3A85A 4PROA 1LHDH 1O3HA 2QGRA 3ELAH 2VIOA 2XWBI 1HAGE 1ELVA 1V2ST 3UY9A 1O2RA 5DP3A 1TBRH 2QCYA 3MFJA 3Q77A 2ZHFH 1EAIA 1OS8A 3QGJA 2R3UA 1WBGB 4FUGA 1HAVA 3GY5A 2R2MB 5BRRE 3A7WA 4BXWA 1GJ5H 3SHCH 3CS0A 2BZ6H 1XVMA 4K69A 2BDYA 1VITG 5DP5A 1GL0E 1UO6A 2XBVA 1HJ9A 2WUCA 1GBCA 2D2DA 1A61H 5K0HA 3GCTG 1YLDA 1SGEE 1PQ8A 1CT0E 1TNLA 1BQYA 2SGQE 5DK1A 1AFQC 1BRBE 1SG8B 3SV6A 3STJA 1TB6H 1SL3A 2P3TB 1EPTC 2Z6BD 3ZV8A 5FX5A 4BXSA 2ZU1A 1HAPH 4CRCA 1MU6B 3KGPA 1GJBB 2FMJA 2Y5GA 1MTNB 3CENA 4OS7A 1ESBA 5AVDA 2V35A 1BRAA 3MI4A 4IMZA 4UFDH 1L0ZA 3RMNH 2LIZA 1UMAH 5C5OA 4K1SA 1LKBA 1PQAA 5DG6A 4AX9H 1K28D 1TA2A 3A80A 2A0QB 3SU6A 1FMGA 2G55A 1ZSKA 4JZFH 4CREA 2A4OA 4U32A 3GYMA 1DE7H 1O3BA 3E90B 2J4IA 3TGKE 3TGIE 4NIXA 3RC4A 3T28A 1YPJH 3TU7H 1C1UH 4FU9A 2CXVA 1J15A 2ANMH 2ZNKH 2GZ8A 4K5ZA 1TMUH 6CHAB 2FYQA 1WTHD 1AO5A 5JBAS 4Y7BA 1T8MA 2OINA 1O2QA 4JMYA 3SJOA 2WPKS 1SGFG 3SQEE 2PKAA 1DY9A 1JOUB 3C27B 1GG6C 2CF8H 1A4WH 1P2JA 3QZRA 1TONA 3OY5U 3I78A 2VIDA 5JBTA 2BY8X 1O2MA 4AYYB 1FY3A 3ITIA 5EXLA 2F9BH 1JRSA 1GBAA 1Z71A 4OGXA 2Z3CA 2KAIA 2WV5A 5IDKA 1Y3UA 2ZFSA 1C1PA 1PPEE 3KL6A 2BVXH 3E6PH 2XBYA 2BDCA 3EA9A 5DP4A 1GBEA 3SI3H 1ZSJA 4NWLA 4X8SH 3GCNA 1E34B 3A83A 3GY8A 4XE4A 2G81E 3VXFH 1GHBF 1MKXH 1RRKA 1BZXE 1YBWA 4MNXA 3MH4A 3SUFA 1E38B 1Y8TA 2O8UA 2GKVE 4LK4A 2ZFRH 1O2LA 4B2CA 1TNJA 1E36B 4GCHF 1QBNA 4AFQA 4F4OC 2ZHDA 1YC0A 3ZZ4A 1LVBA 2ZP0H 3GISB 3ZVDA 1AFQB 2VWNA 4BNRA 2OC8A 1YPKH 1C1WH 1ESAA 2ZU3A 1YPHE 3F9FA 1VR1H 4NCYA 1EPTB 2Q1JA 3PMBB 4X0WU 1DANH 1LPGB 2AIPA 1UCYH 1O3DA 1A0HB 1QNJA 4K8YA 4GUXA 4X2VA 2FEQH 2PW8H 1IQLA 2G00A 1HXEH 4YOGA 1ZMNA 5EQSA 4OS4A 1C4V2 4OS6A 4LZ1H 1P9SA 5HM9A 1BBRH 2ZDNA 1GMCG 1FAXA 2ZU4A 2GCHG 3L3TA 1CBWB 4B76A 5ETXA 3T2NA 1C5RA 5F6MA 1V3XA 1UTLM 1EZQA 1A1RA 3V7TA 1BMNH 2VVVA 2QXIA 2G51A 1XXDA 4DOQA 3EDXB 1CO7E 2BLQA 4I8JA 4Y8YA 4AN7A 1GHXH 5C1UA 3MH7A 3A86A 2FTLE 2YNAA 1KTSB 4MVNA 1DUEA 2G4TA 1GDQA 1Z6JH 5EPYA 4ABDA 3STIA 1AI8H 2ZGJA 1C5YB 3GY2A 4X8UH 3SV2H 4AOQA 1BJVA 2PV9B 1GG6B 2XYAA 1G30B 3FFGA 2BB4A 2WINI 5I25A 1O2NA 1AWFH 3SNBA 1AD8H 5E2PA 3RMLH 2BY9X 3PYHA 4DURA 2BDGA 2BX4A 2BM2A 3MU4A 2FI3E 1AZ8A 2BDHA 2WYJA 3GYLB 2ZECA 4NG9H 5DP8A 2D26C 3A8BA 3JZ2B 1XUIA 1BIOA 4LOYH 4RN6A 1EP6A 1QBVH 3TH4H 1P02A 1EXFA 2ASUB 3M5NA 1AHTH 4GCHG 2OBOA 1O2PA 2IN2A 4A1VA 4A7IB 4Y8ZA 4MQAA 3GCHC 1GJ6A 1V2TT 2VNTA 2ZPRA 5HGGA 3PB1E 5LPFA 3TK9A 2Z9LA 2ZGCA 1NO9H 2GX4A 2ZC9H 1SGDE 4O03A 1AE8H 3MHWU 5EODA 1TYNA 1S83A 5TCCA 3GOVB 3A8DA 1GI7B 1O3IA 3KF2A 5EW1H 2Y6TA 1O3FA 1O2SA 1HPGA 4GLYA 2QF3A 4D9RA 2OXSA 5E0GA 1F0UA 5EG4A 2QXJA 1GJ7B 1Z8GA 2QXHA 5JBBS 1ZHMA 3FP8E 3IWMA 3RU4E 2JH6D 2F9NA 1CVWH 1UCYK 2ANYA 4X2WA 4CRAA 4OGYA 4YT7H 4NIYA 4ABHA 4D9QA 4X1QU 4CRGA 3RXAA 2OP9A 5C67A 1PPBH 1BA8B 3T29A 3LGVA 3TK5A 1CA8B 1ELFA 2SGEE 4ABAA 4ABJA 2PUQH 3LGYA 3PTBA 4WF8A 2K1QA 1GHWH 2HRVA 2P59A 3P8FA 1BBRK 1ZMLA 3RLWH 1TPSA 4MDSA 2H9EH 2BQ6B 3JZ1B 1G9IE 2FESH 1EAUA 2ZFTA 2EI7A 3QUMP 1RTFB 3RMOH 2F3CE 1S0QA 1QIXB 1DPOA 4SGAE 1GJ8B 1K1IA 1CQQA 2SGPE 1GVKB 1C5OH 2K7XA 1YGCH 1KXCA 1V2NT 2ZCHP 1GBDA 4O9VA 2ZZUH 3BTME 5A0BA 1CHGA 1NU7B 3MYWA 4JZDH 1C1SA 1VCQA 2XXLA 3BTTE 5EW2H 8GCHG 2VJ1A 3TNSA 1S85A 1EB2A 5J4SA 4WMEA 2C8WB 1PYTC 1FY5A 5E2OA 1JMOH 3IITA 4ABBA 3PO1C 1O3CA 3HK3B 2A31A 3LH1A 1B7XB 1UVSH 4BTUB 1GHYH 4YLUA 1O5DH 4DW2U 1UTMA 1GDNA 1MKWK 3LH3A 1VJAU 3EAJA 1E35B 4NA8A 1BMAA 1SOZA 1CGJE 2P94A 1AVWA 1KXAA 3HATH 1JBUH 1JIRA 1C4U2 1SHYA 4GPGA 5E0JA 1FLEE 2Q6DA 1KDQA 1P04A 1JIMA 2BD9A 3RXCA 1OWHA 2OD3B 3FP7E 3AAUA 1AUTC 4I33A 4BANB 4AFUA 4D7FA 1AE5A 1LPKB 3F9EA 2GDEH 3R3GB 4E06H 1GBKA 3URDA 4D7GA 4AB8A 1WUNH 1F2SE 2UWPA 4I8LA 5GIBA 4ZMAH 1A5IA 1OP0A 2BTCE 1TOMH 1XXFA 3E1XB 3GCHB 5FBIA 4X1RU 2FPZA 3CP7A 2W3IA 2FOEA 3KNXA 2A1DB 4FUDA 3VB5A 2STBE 4K3JA 4HI3A 1HJAC 5AHGH 2BZAA 1CU1A 3VPKA 4O3UA 1T8OA 4B73A 1O2KA 3SUGA 1F92A 1HNEE 4FVDA 3TIUA 4Y0ZE 2FX6A 4WVPE 1H4WA 1QRXA 1SBWA 3QZQA 5A8YA 1W12U 1C5SA 4AGJA 1P8VC 4DGJA 3TH3H 3KQBA 4B71A 2FDAA 3W95A 1GJAB 1TABE 1THPB 3SBKA 1NT1A 1ZHPA 4RKOB 2VH0A 3TGJE 5T6DA 1VCWA 2ESTE 1P2MA 1EASA 3M3VA 2ZHEH 1GWAA 3SUDA 3T25A 3MNSA 1GGDC 2ZG0H 1Y5BT 3LJJA 1OYTH 4F49A 8LPRA 4I8KA 2JETC 3TJUA 2P3FH 4KTSA 5ABWA 3RM0H 1Y59T 3DFLA 1EX3A 2LPRA 4UDWH 3LOXA 1A3BH 1UHBB 4NIVA 1QBOA 3E3TA 4AG1A 1SR5C 1FY4A 3PO1B 4VGCC 2TIOA 1RFNA 1KXDA 1LPZB 3DD2H 2W5EA 4ZXYH 1ZJDA 1LTOA 1W7XH 2SGAA 1EJAA 3U69H 2QAAA 1NRPH 1S0RA 2ODQA 4H4FA 6LPRA 3RXGA 1OKXA 1AZZA 1Y5UT 2PTNA 4JZ1A 1LVYA 1RS0A 2DUCA 3KQDA 1N6XA 1K1LA 2CHAC 3RC5A 3GDUA 3VEQB 3I77A 1KY9A 3EA7A 1ELDE 1P06A 4MG3A 1P2KA 4WY3A 2AGEX 1QJ6B 2SNWA 1MD8A 1NRSH 1G3DA 5FCKA 3S7KB 1XKBC 2A5AA 1SQTA 4TWWA 1W10U 3KIDU 2XC4A 3O8BA 3GY3A 1HIAB 2XC0A 2HVXA 1FY1A 1UK4A 1PFXC 4FU8A 4Y79A 3SU4A 2A7CA 2GT7A 2SGFE 2HNTC 1ARBA 3MU5A 1MMJN 2HALA 2FZZA 5L2YH 1NPMA 1C2GA 3R0FA 3QO6A 1Z1IA 1C5MD 1KSNA 3UFAA 1V2LT 3CS7A 1HJAB 1Z7KA 1C5UA 3E16B 1TX7A 1LHEH 3BEUA 1O3EA 1C1OA 1AU8A 4B75A 2OC0A 2VVUA 2H2ZA 3ATWA 1HDTH 5F8XA 4E7RG 3T5FH 1NM6A 3ENSB 3PROA 2P93A 3M7QA 1FUJA 1P2QA 3FVFB 1C5TA 2P8OC 4THNH 2D1JA 1JRTA 1TGBA 1O2GH 1C5PA 3D49H 3S0NA 2ANKH 2AS9A 1CGHA 1TMTH 2PHBA 5L2ZH 1QA0A 1IQHA 1W2KH 2PKSB 2JH5D 2A5IA 2FXRA 3RUOA 1UVTH 2TGPZ 1XUFA 2FYRA 2ZQ1A 2FOMB 3TVJB 2R2WU 4E7NA 2BDAA 1SB1H 3RXQA 1OSSA 3ZZCA 4FUIA 1MTUA 3Q00A 3A87A 1NROH 4U2WA 1P2NA 1C2DA 4CH8B 3Q3YA 4NFFA 5G4BA 1HJ8A 2JETB 3RXSA 2F9PA 1QA7A 1C2JA 2TGAA 3NWUA 1K1OA 4YLQH 1DXWA 4Q7YA 2A2QH 1K1NA 2OLGA 1GCDA 4VGCB 2BY5X 1ZTLA 2A2XH 2Y5HA 2HLCA 3F68H 1EJMA 3SNEA 2BLOA 1SPJA 1AKSA 2Z9JA 2O9QA 3EYDA 1YPGH 2Q6GA 2ZI2H 3SU1A 1EQ9A 2AEIH 1GBMA 1H8DH 1XVOA 2CMYA 3FP6E 3SNCA 5BPEA 4MNYA 1QTFA 1V6DA 3VGCB 5FXLA 2EA3A 3PMJA 2BOHB 1DLKB