3SNCA

Crystal structure of sars coronavirus main protease complexed with ac-nstsq-h (soaking)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 78
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sncA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sncA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sncA02
2HRVA 2AERH 1EZSC 1GG6B 1IQEA 2Y81A 1ZJDA 1C1MA 1O2HA 2V3OH 1ELGA 4IMQA 5PTPA 2ZU5A 3H5CB 1C2GA 3QTVH 1E38B 1Y5UT 2A4RA 5GJ4B 3O8BA 4K8YA 1KLIH 3ZV9A 3RXCA 4ABJA 2EI6A 3U8TH 1QQUA 1ZSLA 1PYTD 2J9NA 4IW4E 2NU1E 1YF4A 6CHAB 1C4U2 1OX1A 2LNCA 3S9AA 1IHSH 1VJ9U 5H4IB 5DG6A 1P10A 2Y80A 3GCTG 8ESTE 2QN5T 3S0NA 4A5TS 1HAVB 1O32A 3E3TA 4JZDH 4CBNA 3MNSA 4UFFH 2SGFE 2ZNKH 4XFQA 1VGCB 3A7XA 2BDIA 1EB2A 3A85A 3T5FH 1J8AA 1NN6A 1DX5M 1IQGA 1LDTT 5ETXA 1MTWA 1H9IE 1QR3E 1MTSA 2R0KA 1BT7A 2R0LA 3B23B 5EOKA 1K2I1 4SGBE 3AAVA 2ZDMA 1VCQA 2BY7X 4B71A 2VJ1A 1QY6A 1SSXA 1KY9A 1GDNA 3QGJA 3S69A 2FYQA 2H9HA 1TALA 4A1XA 3QZQA 4CRDA 1IQNA 2GCHF 1P2NA 3ZVGA 1SC8U 5CHAB 4AGJA 4IN2A 1BA8B 1GBBA 5EQQA 5E0JA 1UTOA 2SGAA 2BLOA 5C5OA 1T8NA 1F92A 2Q6GA 1TNKA 5ESBA 2GDEH 6LPRA 2I6SA 3UWJH 1VCWA 2BLQA 3ZVCA 2ZEBA 1EKBB 4FXGH 1GJDB 1HRTH 2J34A 1O2UA 1AFQB 4YOIA 1G36A 3BEFB 2TBSA 2DUCA 2TGTA 2ZDLA 2D2DA 1QHRB 4BTTB 1A5IA 2STAE 2ZA5A 4U01A 1OYTH 1A3EH 4Q2KA 4CR9A 1T4UH 1TX7A 2Y7XA 1ELEE 3KN2A 2BQ6B 3KCGH 1AMHA 1KLTA 2BDYA 2PW8H 5DPAA 3MU1A 2A5AA 2RCEA 4OS5A 1BHXF 1RFNA 2Z9JA 2AIQA 2GCTC 1AGJA 2C8WB 2J38A 1SI5H 1HAZB 1SGPE 4NIVA 4AN7A 3BEUA 1ETRH 3MNXA 4GSOA 1HAVA 1UJ1A 4ZAEA 5AVDA 2P3UB 3MOCA 1GI6A 2H1UA 2VH0A 3ATWA 1B0EA 1SMFE 2XXLA 1CE5A 5DP9A 1BRBE 1YPMH 2ASUB 5F8ZA 1ZRBA 1EJAA 2PV9B 1GVLA 4KGAA 4GLYA 3A81A 1NRSH 4O3UA 1KXBA 1SG8B 2XC5A 3CS7A 4INLA 1C5SA 5AFYH 3QK1A 1W7XH 4LXBH 4YLUA 1P3CA 1GI8B 2XBVA 2JKHA 5JBCS 2FI5E 1SGFA 3STIA 1ELFA 4BAKB 1LVOA 1VITH 2W26A 2TIOA 2F83A 3EA7A 4U30A 5EPNA 3VEQB 1WU1A 2Q6DA 1SGQE 1C1OA 3RM0H 5JPMH 1XVMA 1SFIA 5LH8A 1GDQA 4KTSA 4X2YA 1INCA 3B8JA 1TMBH 3K65B 2CHAB 1YPJH 2G5NA 2PTCE 1O3GA 2GX4A 5J4QA 4B73A 2GVFA 4ISNA 5JYIA 1AE8H 4B74A 2VINA 4K60A 2BM2A 3SI4H 3ZVAA 5LPRA 3G01A 4O9VA 1O5BB 3A8BA 5C2ZA 1XUIA 2C3SA 1C2FA 2ZO3H 1GMDF 2R9PA 1QBOA 1DWDH 1WQSA 3SV9A 1O34A 1RXPA 3F9HA 1P06A 3TU7H 1W0ZU 1AFEH 1CT4E 3SV6A 1GBTA 2SNVA 4K5ZA 2XBWA 3V0XA 2ZDVH 1V2TT 1C5MD 1JIRA 1F0RA 1P02A 1BTHH 1TGBA 1G3EA 3C1KA 1ANEA 3FFGA 4X8TH 3SI3H 1HYLA 5G4BA 4BTIB 1Y3UA 5GWZA 3SOSA 2BQWB 3RDZA 2AMPA 2XNIA 1GHYH 1K28D 1MCVA 3A8DA 1F5KU 4I8LA 2LIZA 3TIUA 1C5XB 1YPHC 1UVTH 3UWIA 5DGJA 2A4GA 1DSUA 2FOAA 1HB0B 2QIQA 2FS8A 4FUEA 4I8HA 2I6QA 1VR1H 3VGCC 3F68H 4D76A 4D9RA 5I46H 2G55A 2O8MA 1EXFA 2JH6D 4Y8XA 3MNCA 3BTGE 1RIWC 2A45B 4A7IB 4UD9H 3A7VA 1GJ4H 1KXEA 1H1BA 1GI0A 1YC0A 3L3TA 3RC6A 2P93A 3RXVA 3LGTA 1OP0A 1SGRE 4E7RG 2OD3B 4Y7AA 2BB4A 3P8FA 4GVUA 3LGWA 5DP7A 1JMOH 2QF3A 4AORA 1UCYK 4AX9H 4ABFA 1FLEE 7KMEH 1P2JA 1ZMNA 2A7CA 3RM2H 5EW1H 1XVOA 3TNTA 3OSYA 2OQUA 3QLPH 3DHKH 1LKBA 5FXLA 1HCGA 3E16B 1ELDE 2F9PA 1SLUB 4B2CA 1E36B 1RS0A 3ELAH 1J15A 4J2YB 1GI4A 3U1IB 1EPTB 1W8BH 1DWEH 2R3YA 4AB9A 3RMNH 1MZDA 1SVPA 2NU3E 1BRAA 3TGIE 2OC1A 3BG8A 4CRBA 1TA6A 2ZU2A 2VB0A 1SLXB 4Y6DA 1YLCA 5HGGA 1RTKA 1W12U 2BX4A 3L6PA 3Q3KA 1RTFB 4OS7A 1UTMA 1O37A 2RA0A 3LU9B 2D8WA 4X6MA 1UK2A 2ZDAH 3EA9A 2Y5HA 1O3AA 1TGSZ 1LHGH 1QBNA 4GAWA 1P09A 4HFPB 5EXNA 3UQVA 3P8GA 4E06H 1D3TB 2HALA 4BANB 1DDJA 1EOLA 5SGAE 1YCPM 1V3XA 3RXFA 3A80A 2FI3E 4JYUH 1CGHA 1HAOH 2GV6A 1MD7A 1CBWC 1DS2E 3MHWU 1O39A 3RMLH 5EU8A 5LPEA 1DXPA 1M9UA 3MFJA 1FNIA 1TLDA 1D3DB 1D3PB 2STBE 1P2MA 1JRTA 1G2MA 2UUFB 3FZZA 2D26C 1O2WA 2G4UA 3MI4A 1GBEA 4WWYA 1SOTA 5E8EH 2F9OA 1UTKA 4LZ1H 4MVNA 3ESTA 2Z3DA 2Z9GA 1WTGH 2WPJS 2WPKS 3PV4A 1O2IA 2BOHB 4KP0A 4IBLH 2FI4E 3A82A 3TVJB 1YPHE 1C5NH 1A0LA 1CT2E 1NTPA 1C5TA 3URDA 1TBQH 2FLRH 3SUDA 3SORA 1TAWA 2FM2A 1DUAA 2FIRH 2WYJA 5C20A 1V2WT 1XMNB 1HJ9A 4DURA 4TY7A 1H8DH 3PO1C 1GHVH 1C1QA 1IAUA 1PPEE 4X2XA 1O2XA 3M5OA 2C8XB 2PKAA 3BIUH 4ISOA 2O8LA 1C4V2 1DUEA 1W11U 1G3DA 2BYAX 1SR5C 2EA3A 3A87A 4BTUB 5A2MH 2BVXH 1GHZA 1AKSB 2GDDA 5A8ZA 2Z9LA 4FUCA 2XCNA 2H9EH 2YNBA 1AB9B 4K1SA 4NA7A 1O33A 3GDUA 4RKJB 3D62A 1C2EA 2EI7A 1HIAB 3M3TA 1HPGA 1GI3A 3V3MA 1C1VH 1TPOA 1BRUP 5E0GA 3PMAB 1JXPA 4KTUA 1GHBF 1G9IE 1UTLM 3ZVDA 1Y59T 2GZ8A 4CRAA 1BQYA 4NFEA 5A09A 3QX5H 4GCHG 1AWHB 3I78A 2Z6BD 4M7GA 1NY22 1S0RA 2ZI2H 2ZTZA 2W7UA 2VIWA 1EAXA 2O8TA 1UO6A 1W10U 1GBLA 1Z8JB 2WUCA 1D3QB 1ANCA 1O3KA 1DE7H 1BBRE 5EXMA 1O30A 2Z3CA 1KSNA 4A1VA 5F03A 4CBOA 1Z1IA 1GGDC 2ZPRA 1DITH 3TJVA 5HM9A 5EQSA 2BVRH 2AS9A 2VWMA 3SBKA 4D7FA 3K9XB 1AVWA 1QRZA 5ABWA 2SGDE 3FP8E 1BHXB 2ZHWH 2O8UA 2GD4B 2QXIA 3NZIA 3Q3XA 1FY1A 1PPZA 1IQKA 3H7TA 1GI2A 2ZU4A 1UVUH 2A4QA 3IG6B 4ISIH 1EQ9A 2B7DH 1FXYA 1O38A 2ZFRH 1NO9H 4KTCA 3T25A 4OGXA 4X6PA 3SV8A 3FAOA 1BMNH 1QA0A 2NU0E 2SGQE 3MO9A 3ATMA 1K22H 4ABAA 2DE8A 2P16A 2AMQA 3KQDA 5IYTA 1BJUA 2KAIA 4E05H 4CRCA 1K1LA 2BY5X 1QJ7B 1EAUA 4H6SB 3RU4D 3DA9B 1HAXB 1ZZZA 1ARCA 1QURH 3QO6A 3Q76A 1BITA 2AGGX 2BY6X 5T6DA 1HAYB 1VZQH 2H6MA 3TJNA 1O2ZA 1WBGB 1W7GH 2ODQA 2P95A 1NT1A 3VPKA 3O8RA 1A4WH 2PR3A 3M5LA 5FBIA 3SNEA 3MNBA 3L33A 3MMGA 1Q31A 1DM4B 1CHOF 2ZU3A 2QY0B 2ZGXH 3NWUA 1DXWA 4O03A 1THPB 5F8TA 3LIWA 1TNIA 2TGDA 3LJOA 3ATIA 1GL0E 4I33A 4K1EA 2ZQ1A 1G32B 3SQHE 1UMAH 5LGOA 3KEEA 1AD8H 1VCPA 3SV7A 3SUEA 1QA7A 3ATKA 5EG4A 2OINA 3LGIA 3SZNA 1MD8A 3U8RH 5CE1A 1O3MA 3FP6E 5DP8A 1SLWB 1EP5A 2QYIA 1O2PA 2ZGBH 2GZ9A 1GMCF 4FU9A 4AFQA 3UNRA 5JB9S 3F9FA 1C5YB 3DT0H 3P8OA 1GHXH 3LH1A 1JIMA 1PPBH 3RXEA 3EGKH 1C2LA 2VU8E 2ZHQH 4IC6A 4MTBA 1TA2A 1L1NA 1TRNA 5DP6A 4QT8C 2UUYA 1NROH 4UONA 1HUTH 3KNXA 2Y5GA 6GCHF 2ANMH 1GI9B 1GBCA 2BX3A 4FUFA 2PGQB 3P95A 3BTQE 1TPSA 2ZPQA 3U69H 2ZCLP 3A8CA 2QC2A 1SGTA 4I32A 4ZH8A 3KQEA 1VJAU 1V2PT 3QGNB 3RC5A 1RTLA 1BB0B 1SQOA 2A7HA 1D4PB 1NC6A 5AF9H 1F2SE 1TWXB 1GL1A 3SJ8A 3EA8A 1O3DA 1RIWB 1BTUA 4JZ1A 2AYWA 1DY8A 1O2QA 2O8WA 2F9NA 2F91A 1ZHMA 1BBRH 2PLXA 2PUXB 4JCNA 1B7XB 3KIDU 3M3VA 2ZU1A 3RXKA 1TE0A 1CA8B 1NU9A 1O3HA 1C1RA 1UTNA 1DOJA 1LHCH 1CQQA 2BOKA 1YKTA 1ZJKA 4X1SU 3GY2A 1ZHRA 2FOGA 1BTXA 1P03A 5T6FA 7GCHG 2OC8A 3V13A 2BZAA 1XUKA 3KF2A 4CRGA 4MNYA 3SGAE 1O2LA 2XRCA 1EZXC 1WUNH 1ZSJA 2WYGA 3S7HB 1UK4A 1CA0B 5TCAA 1GJ9B 3MO6A 1A3BH 2ZFSA 2VVUA 2WV4A 1O2SA 2FPZA 1S83A 4TWYA 3OTJE 1MTUA 2GGVB 1GMHF 3O8CA 1ELBA 5HMAA 1MU8B 1ZOMA 1HXFH 1SBWA 4MNVA 3HGPA 3K6YA 2UUJB 4X6NA 1P05A 2BDHA 3D65E 4TWWA 3O8DA 1GCTC 1UTQA 2BLWA 1E37B 1WTHD 5HYOA 1C5PA 2BDGA 4HTCH 2A32A 4NFFA 1O36A 1N8OC 2VGCC 1QFKH 5FPTA 5HXFA 1P0SH 3UNQA 2H2ZA 3N7OA 3RXTA 3A83A 2THFB 2FX4A 4X6OA 4AFUA 2M5TA 1FN6A 1BDAA 3TPIZ 4BAOB 2VIQA 4ZXYH 3PYHA 4F4OC 4D9QA 5AHGH 2FOHA 2BQ7B 3RXLA 1XUHA 2FOEA 2FMJA 1MQ5A 1WYKA 2GT8A 3MO3A 3UR6A 1QTFA 2BDBA 5TJXA 3Q77A 1NFYA 4CR5A 4UFDH 1JBUH 1CT0E 2OCVB 3LGYA 4A1TA 1HAPH 3GY3A 1WAYB 3UOPA 4JZFH 4RKOB 4Q7ZA 5DP5A 1SHYA 2FODA 3M37A 3SU3A 5EGMA 1C5LH 1NPMA 4R0IA 4UFGH 1TIOA 1XUGA 2XW9A 3SU1A 5DP3A 1NRQH 2FS9A 2TGAA 4KELA 1TBZH 5JB8S 2P94A 3UREA 5JBTA 1AIXH 1LPZB 2G51A 5EODA 3ZZCA 3PMJA 4NZQA 3M36A 1VITG 3TH3H 1AUTC 1SQTA 3PTNA 3TK9A 2UUKB 1ZGIA 1C2IA 1NRPH 1IQMA 2ZHEH 2ESTE 4UE7H 5GXPA 3MH7A 3BTFE 3KL6A 4X1QU 1AO5A 1V2JT 4NWLA 4DW2U 3ITIA 5EXLA 1O31A 2R3UA 1O3CA 2B8OH 3SNDA 4Q7YA 1PPFE 1C1TA 2HNTC 5TCCA 4D8NA 4DGJA 3TNSA 3ZZ4A 1P01A 2QXJA 4BXWA 4CHAC 2HPQH 1FONA 3RC4A 1S82A 1YCPH 2HNTF 2FOMB 1DLEA 3PLBA 1O3BA 1OWIA 1NFUA 2GMTC 2VVVA 1MTNC 1V2LT 1C1NA 1YPLH 4ABDA 1ZTLA 2ZFFH 1MMJN 1O2KA 2J92A 2JETB 4WH8A 8GCHF 1V2MT 1YP9A 3AAUA 1P2IA 1XUJA 3GY4A 3QN7A 1SOZA 2VWLA 4IC5A 4X8SH 3BTKE 4MPWA 1A0JA 3V12A 3RXUA 1GHAF 3SU2A 5A0BA 5GDSH 1ID5H 1C1UH 2JH5D 1TABE 1BTZA 3NPSA 4VGCB 5B6OA 4LK4A 3GICB 1SGYE 2FOBA 4ZKNU 1IQFA 1O3IA 1BOQA 3SHAH 1EATA 4K2YA 2D1JA 2K1QA 4B76A 3QZRA 1TB6H 3UNSA 1O5AB 2A0QB 3PTBA 4WVPE 1EJNA 4I7YH 1PYTC 3ZVBA 2W3KA 5A8YA 2GKVE 3URCA 1Q3XA 2Z94A 2NWNA 4X2WA 2WPHS 4AOQA 1H9LB 2B5TB 3SGQE 2BLVA 4JMYA 5E0HA 4FU7A 1N6XA 2ANKH 1G3CA 4X1NU 2BXTH 5L2ZH 1UCYE 1GG6C 4JZIA 4WXVA 3SU0A 4FUBA 3M5NA 1MUEB 1HGTH 4H4FA 1SQAA 1S85A 4Y8ZA 1FY5A 1ZTJA 4ZKOU 4AG1A 3HKJB 1MAYA 2J95A 3I29A 2PKSB 2GP9B 4O97A 5GCHF 4A92A 3ZZ5A 1C5QA 3RMOH 4HZHA 2XBYA 4XBCA 4XDEA 2ZZUH 3PLPA 3GCHB 1HJAC 4CREA 4OS2A 3TH2H 1LTOA 2ZC9H 3VXEH 2G8TA 4MG3A 1V2NT 2CGAA 2OUAA 1HNEE 2ZP0H 3BG4B 2IJOB 2PSXA 5ESTE 2PKAB 1T8LA 1MH0A 4BXSA 1Z8IB 3GOVB 2PUQH 1CHGA 1P57B 1VGCC 3ZZ6A 1P8VC 1NFXA 2ZKSA 4Q7XA 1UK3A 1ELVA 1GCDA 3UR9A 4X1RU 1K9OE 2HNTE 9LPRA 4GHTA 4ZROA 1KDQA 1TBRH 1C5WB 1NM6A 1ETSH 1ANBA 4YTAA 3GYMA 2ILNA 9ESTA 3RXMA 2Z3EA 2ALPA 3RP2A 2SFAA 4BAMB 4WMEA 3HPTB 3M7UA 1FY4A 3MYWA 1FUJA 1V6DA 5FPSA 2ZFQH 4GUXA 3TK6A 3ZZ9A 1MKWK 5CHAC 2FO9A 4DG4A 3CS0A 4E7NA 3JZ2B 4I8JA 1B0FA 1GBMA 2QGRA 3GDSA 4WMDA 4RN6A 4MNWA 3QUMP 2TPIZ 1O3FA 3GCTF 3M7QA 4FUHA 3AVZA 4WH6A 3SUGA 1K1NA 1KTTB 3A7ZA 4J1YA 4INHA 1LHEH 1GJAB 1V2OT 4MQAA 3F9EA 2BY9X 1WCZA 3K2UA 4NIXA 3SGBE 4SGAE 1QB1A 1FAXA 1AFQC 3OYPA 5IDKA 1AN1E 1TMUH 1KTSB 1ZMJA 1A61H 1DPOA 1NS3A 5FCKA 1IQLA 4NIYA 2GCHG 3SU5A 4AG2A 4ZKSU 1SGIB 1XXFA 2UWPA 2G00A 1UHBA 1QRXA 5JBBS 1B5GH 3VFEA 1UTJA 2G52A 7LPRA 1IHTH 1HV7A 5FAHA 4FVDA 1PJPA 3RLYH 4DCDA 1H9HE 3BIVH 1XKAC 1N1LA 1U6QA 2O9QA 1TGNA 1FJSA 1EUFA 2KAIB 3TK5A 1L1JA 4Y0YE 1KXDA 3PWBA 4JK5A 2J94A 3LKWA 1Y5AT 1SHHB 2Y5FA 1RD3B 8LPRA 1YYY1 1YPEH 4DIIH 1T8OA 3QDZB 2FYRA 4FVBA 4XSKU 3HATH 2JH0D 2BMGB 1Y5BT 4WY3A 3T2NA 1P2QA 1WQVH 3OY6U 3OX7U 1TONA 4GPGA 1FY3A 1FAKH 1G37A 4U2WA 4ZKRU 1V2UT 4LZ4B 1AI8H 1V2VT 2QAAA 4DIHH 3LT3A 3A88A 1NFWA 1SL3A 1UCYH 1A46H 4ASHA 4FUIA 2RDLA 3EYDA 4IGDA 1A7SA 1ZRKA 2ZCKP 5I25A 2XC0A 3DFLA 3SU4A 2HGTH 2AH4X 3RLWH 1AVGH 1TQ7B 2XBXA 1C2KA 1ANDA 2F3CE 3EDXB 3A8AA 1KXAA 3QWCH 1PFXC 2FP7B 1ESBA 3M61U 4Y0ZE 1V2QT 3GCOA 2ULLA 4DY7B 4I8KA 4ZHLU 1F0UA 3AW0A 2BHGA 3OY5U 2A5IA 2C4FH 3LGVA 4FUGA 2F9UA 1SPJA 3E90B 3RXGA 2C90B 5FCRA 1GJ8B 3A7YA 4Y76A 2GCTB 3GISB 5HM2A 1GJCB 1HAIH 4YZUA 2CN0H 2GV7A 2CJIA 1BBRK 1OSSA 1GJBB 1Z8GA 1X7AC 3NUMA 4ABGA 3ZVEA 2BD8A 4K1TA 3KHVA 1ARBA 1W3CA 1OWDA 3RXPA 1QL7A 3LJJA 5GPIB 3SU6A 1AZ8A 2OBOA 1Z6EA 3RMMH 1MKXH 1GBJA 1GMDG 1S6FA 3P92A 4H42U 4ESTE 1CU1A 3Q00A 3BTDE 3ZYEA 4DT7B 1SFQB 4TPIZ 2A1DB 1OPHB 1OOKB 3T27A 4NIWA 1LPKB 4I31A 4HGCA 3CP7A 3SJIA 1FZZA 1DANH 4GHQA 3AASA 5LPFA 1MQ6A 4ZMAH 4TPYA 4YLQH 1O2MA 2A5KA 3ZVFA 1FPHH 1NRNH 1YPKH 1QL8A 2AGEX 1N6YA 2FESH 3UFAA 2VIDA 1AU8A 5DO4H 3UPEA 3SNBA 1J9CH 1TMTH 1ZSKA 1A2CH 1L4ZA 3JZ1B 3EE0B 1RRKA 4XOJA 1Y8TA 1O5CB 4Y79A 1EX3A 3LH3A 2GMTB 2UWLA 4Z0KA 1C5ZB 1O2VA 2W5EA 1GVZA 1GBKA 2LPRA 5A8XA 3MU0A 1FMGA 3TITA 2BY8X 3CENA 1FIWA 3R3GB 2G81E 5JDUB 2EEKA 1EPTC 3HGNA 1QCPA 3RXJA 2SNWA 5EW2H 1ELTA 1LVBA 3PM3A 1WOFA 4Y7BA 3GDVA 1BRCE 1C2MA 3P6ZB 1P9SA 4JZEH 3BTEE 1KIGH 1A5GH 5GCHG 2FDAA 1K1JA 1MAXA 2ZFTA 5L6NH 1LMWB 2IPHA 4MNXA 1C2DA 1BTYA 2BXUH 2ANWA 3T62A 3A86A 4Y10E 1A5HA 2C93B 2RG3A 1LHFH 1LQDB 1Y3XA 3V7TA 1GJ6A 3FVFB 1EOJA 2GTBA 1OXGA 3D49H 3VGCB 3RXRA 4UDWH 4XBDA 3ODDA 2WINI 1ABIH 5FHTA 1TPAE 1ZTKA 1AQ7A 1EASA 2BD3A 3HK3B 1GJ5H 3ENSB 5EPYA 1O3LA 2P3TB 8KME2 1O2JA 3GY6A 1TRYA 2ZTXA 1SGFG 1GBIA 1W0YH 1QB9A 3A7WA 1TQ0B 1O3NA 3BTTE 3MH6A 3A7TA 2OQ5A 1DWCH 1SGCA 1TNLA 4WXIA 3K6ZA 3MH5A 3IITA 5CMXH 1UVOA 3W95A 3VB7A 1AE5A 1TX6A 3U8OH 1GBAA 1O2GH 1DSTA 1O35A 2HWLB 4YOJA 1RGQA 3BTHE 3GYLB 1QB6A 2EC9H 2BDCA 1SLVB 1QGFA 4YT7H 1EAWA 3SUFA 2BVSH 1HJAB 1LKAA 1PPHE 1HXEH 2V35A 3Q3YA 1SB1H 1YCPK 3TH4H 1S81A 1OP8A 3DD2H 3M5MA 3RXIA 1W2KH 1Z71A 5J4SA 2V0BA 4AGKA 1C1SA 1BTPA 1NU7B 2Q1JA 2HPPH 3FP7E 2RA3A 1ZPZA 4WMFA 1GDUA 4YM9A 4H6TA 2PHBA 5T6GA 4D7GA 1W14U 3ZZ7A 3TGKE 1S84A 1OKXA 4F49A 1LHDH 5C1UA 1H8IH 5E2OA 1GBHA 3PB1E 1AB9C 2A2XH 4NA8A 3STJA 2PTNA 2Y7ZA 2OC0A 1GJ7B 5FX5A 5GIBA 3ZZ3A 1J17T 2Z9KA 4K69A 4MPUA 1O2OA 3NCLA 1IQHA 3EQ0H 2HOBA 1C5UA 1CBWB 4DJZB 3MU5A 1AWFH 5DJ7A 3MU8A 3ZZAA 1C2JA 4B1TA 3SHCH 3ZZBA 3SV2H 4X2VA 1P3EA 2TRMA 4OS4A 1DT2A 3H7OA 3P70B 1FY8E 2W7SA 2QV1A 2BDAA 3M35A 3MTYA 3S9BA 1HBTH 2OP9A 2HLCA 1UTPA 3SNAA 2QXGA 2BD2A 4ZHAA 2QCYA 1FDPA 1ESAA 1Y3VA 1QIXB 2OLGA 4UFEH 1G30B 1JWTA 1ETTH 1O3EA 1C1WH 1GHBG 1YPGH 3RU4T 1O3OA 1Y3YA 3BN9A 1V2ST 1KLJH 2ZHDA 1ELAA 3BEIB 1OWEA 1Z8RA 1HLTH 2EI8A 1EZQA 4ABHA 2VVCA 1C2HA 1PQ7A 1BIOA 3WY8A 4Q80A 3VB4A 1THSH 7ESTE 2TGPZ 3MU4A 4TY6A 3PO1B 1IOEA 2VIPA 2ANYA 2P8OC 5A0CA 1O5EH 2WPIS 1L1GA 4GCHF 1CGJE 2H5DA 4B2AA 3NK8A 1QJ6B 4CRFA 2B9LA 4LOYH 3VB5A 1BMLA 1OS8A 1DFPA 4NSYA 2J2UA 1KXFA 2SGPE 3GY7A 3RXSA 3NXPA 1BZXE 4ABBA 1ABJH 3U1JB 1EJMA 5DK1A 4AYVB 1EZUC 2OBQA 1ACBE 4AFSA 2CF8H 1PPGE 1LVYA 4AB8A 4TYDA 4JYTA 4INKA 2VH6A 3T29A 2C8YB 4THNH 1ZMLA 3E6PH 1JOUB 5C67A 4XE4A 4HI3A 2ZIQH 5A0AE 1K1IA 1L4DA 1AZZA 1NESE 3OU0A 3EAJA 4NCYA 1FN8A 5JBAS 1YLDA 1GI5A 4JYVH 1LCYA 1H4WA 1P11E 2FLBH 2WUBA 4BOHA 4YESB 3KQBA 3W94A 1ZGVA 1BMMH 4AYYB 1HAGE 1GGDB 2BD5A 4ABIA 2YOLA 1C5RA 2A2QH 1BJVA 2PFEA 5F6MA 3P17H 2Q6FA 3BTWE 1CHOG 1OWHA 1V2KT 1LPGB 5FBEA 1BCUH 1KDQB 4A6LA 2ODPA 1O2TA 3PMHB 1TNJA 1S5SA 5FPYA 1W13U 1UVPA 1GPZA 1O3JA 3UQOA 1Z6JH 3DUXH 3BTME 2OXSA 2ZDKA 3ZYDA 3E8LA 3E91A 2OC7A 3UTUH 2HVXA 3PWCA 2AMDA 1CVWH 1ESTA 1TFXA 2FTLE 2XWBI 2B0FA 2AIPA 3LC3A 1GMCG 2ZCHP 2V3HH 2K7XA 2FOCA 2XCFA 3RXBA 2GT7A 2IN2A 2F9BH 1BUIA 4Z6AH 1O5DH 3RU4E 4YO9A 3HKIB 4IN1A 3U98H 1GI1A 4NSVA 1ORFA 4X1PU 3S7KB 1ZYOA 4RSPA 3VB3A 1TOMH 3E0PB 2VNTA 2FXRA 1SGNE 2VIOA 1MZAA 1E0FD 1UHBB 4Y8YA 1QQ4A 6GCHG 1ZLRA 1ZPCA 2ZDNA 6CHAC 1WV7H 4WJG2 1TNHA 3LOXA 4NZLA 1T32A 2J4IA 4FU8A 3MH4A 4NWKA 3LDXH 4OS6A 5L30H 1J14A 2CV3A 5C3NA 1WSSH 1AUJA 1SGEE 3UIRA 1O3PB 1DLKB 3M3SA 3VXFH 4KKDA 1YM0A 4XBBA 2CF9H 2C8ZB 3SN8A 3QTOH 1QL9A 4I8GA 3ODFA 1BTWA 1G3BA 1TX8A 1NRRH 1CA0C 5E2PA 1GI7B 5K0HA 3GCNA 4NA9H 1KXCA 4B2BA 2GZ7A 1YBWA 2Z7FE 1TOCB 2WPMS 4Y71A 1MBQA 1GBDA 3EBNA 3SNCA 1E35B 3ZZDA 5T3HA 1EB1H 1C5VA 3HK6B 4JK6A 1C5OH 1C9TA 2R2MB 1Q2WA 3T26A 2ZG0H 1EP6A 4ZXXH 1MTVA 1GHWH 1FI8A 1TNGA 4DOQA 3ZZ8A 2CMYA 4WF8A 4YOGA 2VWNA 4IS5A 2XWAA 3A89A 3LONA 3TJUA 3BSQA 4MPXA 7GCHF 1GMHG 1YGCH 1L2EA 1MKXK 4B75A 3SJ9A 1QJ1B 1NZQH 5BPEA 2NU2E 1AVXA 1PQ5A 4FUJA 3LGUA 1F5RA 5K7RA 3SO3A 3A84A 2ZGJA 3BV9B 3SW2B 4K3JA 1XKBC 2PSYA 4Y11E 2QF0A 3P8NA 5C5NA 3IWMA 4ISHH 1IQJA 4OS1A 1Y3WA 3E0NB 1DVAH 2FEQH 1TPPA 1OP2A 3B9FH 2BD4A 6ESTA 1P12E 1RJXB 3F6UH 1OWKA 1CGIE 3SJOA 1EPTA 2BD9A 3SJKA 1P04A 1XXDA 4O3TA 5C1YA 1D6WA 5EQRA 1ELCA 2CXVA 4U32A 4ZUHA 2XTTB 1O2RA 1LQEA 1QRWA 3UUZA 1K1OA 3KQCA 1E34B 1GCTB 1UVSH 1LVMA 5L2YH 1HFDA 2ZGHA 5AFZH 1P9UA 1HDTH 3SQEE 1IQIA 1AY6H 2DE9A 4NGAH 1N8OB 2AEIH 2VGCB 2FX6A 5DKMA 3TLOA 1HJ8A 3TJOA 2CHAC 1DICA 1TYNA 1A1RA 2WPLS 1T7CA 1CO7E 2BZ6H 2H5CA 3RUOA 2W3IA 1D6RA 2ZECA 4AFZA 1SGDE 3PROA 1FIZA 2JETC 2ZF0H 1QNJA 1T8MA 4X8VH 1GBFA 1LO6A 3AW1A 1KYNA 2PGBB 2ZTYA 2ZGCA 3FANA 1PQAA 4BAQB 3S9CA 3RXAA 4CH8B 1THRH 2NU4E 2G4TA 2Z9IA 1C9PA 1VITF 2ZQ2A 3PLKA 2Y6TA 1GVKB 2Y82A 4UEHH 4K8BA 4VGCC 3UY9A 2AFQB 1PPCE 2A7JA 2VIVA 3FZDA 4ABEA 2SGEE 4CH2B 1L0ZA 1MKWH 3GY5A 8GCHG 4AZ2B 4X8UH 3RXHA 2BD7A 2P8OB 3RXOA 4X0WU 2VWOA 3KGPA 3LPRA 1O0DH 3F1SB 1O2YA 3DFJA 1K21H 2BTCE 1GHAG 1FQ3A 3RXQA 2ZHFH 1Z7KA 5FX6A 4R8TB 2FOFA 4MDSA 2V6NA 1EAIA 1XX9A 1AKSA 1ZPBA 1DY9A 1HAHH 4FUDA 3ZV8A 4BNRA 1MCTA 1P2KA 2PWXA 2H9TH 3MWIU 4MPVA 1HIAA 1FPCH 1F0TA 4CHAB 4PROA 2R2WU 3E1XB 1C4Y2 1D9IA 3C27B 2FWWA 1CSOE 1Z1JA 5DP4A 1MTNB 2PKSC 3TGJE 2IOTA 3PMBB 3R0FA 3UOUA 3I77A 1S0QA 2QXHA 2P59A 1FV9A 1J16A 2G5VA 1F7ZA 1S6HA 4MLFB 3T28A 1ZHPA 1P2OA 3M7TA 3GCHC 4BAHB 2FTMA 2XC4A 2FZZA 1AHTH 1C1PA 1MBMA 2YNAA 1F5LA 4NG9H 2F9VA 1XUFA 3BG4C 1O5FH 2A4OA 1OWJA 1K1MA 1T31A 2A31A 5C1XA 1ZR0A 4ISLA 1TGTA 3F9GA 1XM1A 2XYAA 1GWAA 5F8XA 3VB6A 1JRSA 1TRMA 1T4VH 1OYQA 2ZFPH 4ZHMU 2ALVA 2ODYB 3GY8A 1BMAA 3LC5A 3D23A 2AGIX 4DVAU 1PQ8A 2ZWLH 1K1PA 1MU6B 3NKKA 4YT6H 4OGYA 2ZPSA 3ATLA 1A0HB 1DWBH 1V2RT 3U9AH 1G2LA 2QA9E 2WV5A 1O5GH 5BRRE 2P3FH 2OTVA 1O2NA 1QBVH 1F0SA 2UWOA 4IMZA 3RXDA 1TGCA 3BF6H
chains in the Genus database with same CATH superfamily
2HRVA 4I86A 2AERH 1H8HD 1EZSC 1GG6B 1IQEA 2Y81A 1ZJDA 1C1MA 1O2HA 2V3OH 1ELGA 4IMQA 5PTPA 2ZU5A 3H5CB 1C2GA 3QTVH 1E38B 1Y5UT 2A4RA 5GJ4B 2IPQX 3O8BA 4K8YA 1KLIH 3ZV9A 5KGOA 3RXCA 4ABJA 2EI6A 3U8TH 1QQUA 1ZSLA 1PYTD 2J9NA 2QF4A 4IW4E 2NU1E 1YF4A 6CHAB 1C4U2 1OX1A 2LNCA 3S9AA 1IHSH 1VJ9U 5H4IB 5DG6A 1P10A 2Y80A 3GCTG 8ESTE 2QN5T 3S0NA 4A5TS 1HAVB 1O32A 3E3TA 4JZDH 4CBNA 2HLDD 3MNSA 4UFFH 2SGFE 2ZNKH 4XFQA 1VGCB 3A7XA 2BDIA 1EB2A 3A85A 3T5FH 1J8AA 1NN6A 1DX5M 1IQGA 1LDTT 5ETXA 1MTWA 1H9IE 1QR3E 1MTSA 2R0KA 1BT7A 2R0LA 3B23B 5EOKA 1K2I1 4SGBE 3AAVA 2ZDMA 1VCQA 2BY7X 4B71A 2VJ1A 1QY6A 1SSXA 1KY9A 1GDNA 3QGJA 3S69A 2FYQA 2H9HA 1TALA 4A1XA 3QZQA 4CRDA 1IQNA 2GCHF 3PV5A 1FX0B 1P2NA 3ZVGA 1SC8U 5CHAB 4AGJA 4IN2A 1BA8B 1GBBA 5EQQA 5E0JA 1UTOA 2SGAA 2BLOA 5C5OA 1T8NA 1F92A 2Q6GA 1TNKA 5ESBA 2GDEH 6LPRA 2I6SA 3UWJH 1VCWA 2BLQA 3ZVCA 2ZEBA 1EKBB 4FXGH 1GJDB 1HRTH 2J34A 1O2UA 1AFQB 4YOIA 1G36A 3BEFB 2TBSA 2DUCA 2WSSD 2TGTA 3ZIAD 2ZDLA 2D2DA 1QHRB 4BTTB 1A5IA 2STAE 2ZA5A 4U01A 1OYTH 1A3EH 4Q2KA 4CR9A 1T4UH 1TX7A 2Y7XA 1ELEE 3KN2A 2BQ6B 3KCGH 1AMHA 1KLTA 2BDYA 2PW8H 5DPAA 3MU1A 2A5AA 2RCEA 4OS5A 1BHXF 1RFNA 2Z9JA 2AIQA 2GCTC 1AGJA 2KFWA 2C8WB 2J38A 1SI5H 1HAZB 1SGPE 4NIVA 4AN7A 3BEUA 1ETRH 3MNXA 4GSOA 1HAVA 5HKKD 1UJ1A 4ZAEA 5AVDA 2P3UB 3MOCA 1GI6A 2H1UA 2VH0A 3ATWA 1B0EA 1SMFE 2XXLA 1CE5A 5DP9A 2KCPA 1BRBE 1COWD 1YPMH 3WWFA 2ASUB 5F8ZA 1ZRBA 1EJAA 2PV9B 1GVLA 4KGAA 4GLYA 3A81A 1NRSH 1YY3A 4O3UA 1KXBA 1SG8B 2XC5A 3CS7A 4INLA 1C5SA 5AFYH 3QK1A 1W7XH 4LXBH 4YLUA 1P3CA 1GI8B 2EQNA 2HVYB 2XBVA 2JKHA 5JBCS 2FI5E 1SGFA 3STIA 1ELFA 5IK2D 4BAKB 4ASUD 1LVOA 1VITH 2W26A 2TIOA 2F83A 3EA7A 4U30A 5EPNA 3VEQB 1WU1A 2Q6DA 1SGQE 1C1OA 3RM0H 2M2AA 5JPMH 1XVMA 1SFIA 5LH8A 1GDQA 4KTSA 4X2YA 1INCA 3B8JA 1TMBH 3K65B 2CHAB 1YPJH 2G5NA 2PTCE 1O3GA 2GX4A 5J4QA 4B73A 2GVFA 4ISNA 5JYIA 1AE8H 4B74A 2VINA 4K60A 2BM2A 3SI4H 3ZVAA 5LPRA 3G01A 4O9VA 1O5BB 3A8BA 5C2ZA 1XUIA 2C3SA 1C2FA 2ZO3H 1GMDF 2R9PA 1QBOA 1DWDH 1WQSA 3SV9A 1O34A 1RXPA 3F9HA 1P06A 3TU7H 1W0ZU 1AFEH 1CT4E 3SV6A 1GBTA 2SNVA 4K5ZA 2XBWA 3V0XA 2ZDVH 1V2TT 1C5MD 1JIRA 1F0RA 1P02A 1BTHH 1TGBA 1G3EA 3C1KA 1ANEA 3FFGA 4X8TH 3SI3H 1HYLA 5G4BA 4BTIB 1Y3UA 5GWZA 3SOSA 2BQWB 3RDZA 2AMPA 1KMHB 2XNIA 1GHYH 1K28D 1MCVA 3A8DA 1F5KU 4I8LA 2LIZA 3TIUA 1C5XB 1YPHC 1UVTH 3UWIA 5DGJA 2A4GA 1DSUA 2FOAA 1HB0B 2QIQA 2FS8A 4FUEA 4I8HA 2I6QA 3F2FA 1VR1H 3VGCC 3F68H 4D76A 4D9RA 5I46H 2G55A 2O8MA 1EXFA 2JH6D 4Y8XA 3MNCA 3BTGE 1RIWC 2A45B 4A7IB 4UD9H 3A7VA 1GJ4H 1KXEA 1H1BA 1GI0A 1YC0A 3L3TA 3RC6A 2P93A 3RXVA 3LGTA 1OP0A 1SGRE 4E7RG 2OD3B 2V7QD 4Y7AA 2BB4A 3P8FA 4GVUA 3LGWA 5DP7A 1JMOH 2QF3A 4AORA 1UCYK 2KCYA 4AX9H 4ABFA 1FLEE 2YMSC 7KMEH 1P2JA 1ZMNA 2A7CA 3RM2H 5EW1H 1XVOA 3TNTA 3OSYA 2OQUA 3QLPH 3DHKH 1LKBA 5FXLA 1HCGA 3E16B 1ELDE 2F9PA 1SLUB 4B2CA 1K0HA 1E36B 1RS0A 3ELAH 1J15A 4J2YB 1GI4A 3U1IB 1EPTB 1W8BH 1DWEH 2R3YA 4AB9A 3RMNH 1MZDA 1SVPA 2NU3E 1BRAA 3TGIE 2OC1A 3BG8A 4CRBA 1TA6A 2ZU2A 2VB0A 1SLXB 4Y6DA 1YLCA 5HGGA 1RTKA 1W12U 2BX4A 4P00A 3L6PA 3Q3KA 1RTFB 4OS7A 1UTMA 1O37A 2RA0A 3LU9B 2D8WA 4X6MA 1UK2A 2ZDAH 3EA9A 2Y5HA 1O3AA 1TGSZ 1LHGH 1QBNA 4GAWA 1P09A 4HFPB 5EXNA 3UQVA 3P8GA 4E06H 1D3TB 2HALA 4BANB 1DDJA 1EOLA 5SGAE 1YCPM 1V3XA 3RXFA 3F2HA 3A80A 2FI3E 4JYUH 1CGHA 2JDID 1HAOH 2GV6A 1MD7A 1CBWC 1DS2E 3MHWU 1O39A 3RMLH 4DT4A 5EU8A 5LPEA 1DXPA 1M9UA 3MFJA 1FNIA 1TLDA 1VKYA 1D3DB 1D3PB 2STBE 1P2MA 1JRTA 1G2MA 2UUFB 3FZZA 2D26C 1O2WA 2G4UA 3MI4A 1GBEA 4WWYA 1SOTA 5E8EH 2F9OA 1UTKA 4LZ1H 4MVNA 3ESTA 2Z3DA 2Z9GA 1WTGH 2WPJS 2WPKS 3PV4A 1O2IA 2BOHB 4KP0A 4IBLH 2FI4E 3A82A 3TVJB 1YPHE 1C5NH 1A0LA 1CT2E 1NTPA 1C5TA 3URDA 1TBQH 2FLRH 3SUDA 3SORA 1TAWA 2FM2A 1DUAA 2FIRH 2WYJA 5C20A 2OK5A 1V2WT 1XMNB 1HJ9A 4DURA 4TY7A 1H8DH 3PO1C 1GHVH 1C1QA 1IAUA 1PPEE 4X2XA 1O2XA 3M5OA 2C8XB 2PKAA 3BIUH 3CNRA 4ISOA 2O8LA 3KYGA 1C4V2 1DUEA 1W11U 1G3DA 2BYAX 1SR5C 2EA3A 3A87A 4BTUB 5A2MH 2BVXH 1GHZA 1AKSB 2GDDA 5A8ZA 2Z9LA 4FUCA 2XCNA 2H9EH 2YNBA 1AB9B 3PRDA 4K1SA 4NA7A 1O33A 3GDUA 4RKJB 3D62A 1C2EA 2EI7A 1HIAB 3M3TA 1HPGA 1GI3A 3V3MA 1C1VH 1TPOA 1BRUP 5E0GA 3PMAB 1JXPA 4KTUA 1GHBF 1G9IE 1UTLM 3ZVDA 1Y59T 2GZ8A 4CRAA 1BQYA 4NFEA 5A09A 3QX5H 4GCHG 1AWHB 3I78A 2Z6BD 4M7GA 1NBME 1NY22 1S0RA 2ZI2H 2ZTZA 2W7UA 2VIWA 1EAXA 2O8TA 1UO6A 1W10U 1GBLA 1Z8JB 2WUCA 1D3QB 1ANCA 1O3KA 1DE7H 1BBRE 1YWUA 1O30A 2Z3CA 5EXMA 3UAIC 4F55A 1KSNA 4FOUC 4A1VA 5F53A 5F03A 4CBOA 2KCOA 1Z1IA 1GGDC 2ZPRA 1DITH 3TJVA 5HM9A 5EQSA 2BVRH 2WHXA 3FN8A 2AS9A 2VWMA 3SBKA 4D7FA 3K9XB 1AVWA 1QRZA 5ABWA 2SGDE 3FP8E 1BHXB 2ZHWH 2O8UA 2GD4B 2QXIA 3NZIA 3Q3XA 1FY1A 1PPZA 1IQKA 3H7TA 1GI2A 2ZU4A 1UVUH 2A4QA 3IG6B 4ISIH 1EQ9A 2B7DH 1FXYA 1O38A 2ZFRH 1NO9H 3DSGA 4KTCA 3T25A 4OGXA 4X6PA 3SV8A 3FAOA 1BMNH 1QA0A 2NU0E 2SGQE 2F43B 3MO9A 3ATMA 1K22H 4ABAA 2DE8A 2P16A 2AMQA 3KQDA 5IYTA 1BJUA 2KAIA 4E05H 4CRCA 1K1LA 2BY5X 1QJ7B 1EAUA 4H6SB 3RU4D 3DA9B 1HAXB 1ZZZA 1ARCA 1QURH 3QO6A 3Q76A 1BITA 2AGGX 2BY6X 5T6DA 1HAYB 1VZQH 2H6MA 3TJNA 1O2ZA 1WBGB 1W7GH 2ODQA 2P95A 1NT1A 3VPKA 3O8RA 1A4WH 2PR3A 3M5LA 5FBIA 3SNEA 3MNBA 3L33A 3MMGA 1Q31A 1DM4B 1CHOF 2ZU3A 2QY0B 2ZGXH 3NWUA 1DXWA 4O03A 2AHME 1THPB 5F8TA 3LIWA 1TNIA 2TGDA 3LJOA 3ATIA 1GL0E 4I33A 4K1EA 2ZQ1A 5EJ1A 1G32B 3SQHE 1UMAH 5LGOA 3KEEA 1AD8H 1VCPA 3SV7A 3SUEA 1QA7A 3ATKA 5EG4A 2OINA 3LGIA 3SZNA 1MD8A 3U8RH 5CE1A 1O3MA 3FP6E 5DP8A 1SLWB 3FOAA 1EP5A 2QYIA 1O2PA 2ZGBH 2GZ9A 1GMCF 4FU9A 4AFQA 3UNRA 5JB9S 3F9FA 1C5YB 5HIYA 3DT0H 3P8OA 1GHXH 3LH1A 1JIMA 1PPBH 3RXEA 3EGKH 1C2LA 2VU8E 2ZHQH 4IC6A 4MTBA 1TA2A 1L1NA 1UW7A 1TRNA 5DP6A 4QT8C 2UUYA 1NROH 1YLNA 4UONA 1HUTH 3KNXA 2Y5GA 6GCHF 2ANMH 1GI9B 1GBCA 3DCLA 2BX3A 5CDFE 4FUFA 2PGQB 3P95A 3BTQE 1TPSA 2ZPQA 3U69H 2ZCLP 3A8CA 2QC2A 1SGTA 4I32A 4ZH8A 3KQEA 1VJAU 1V2PT 3QGNB 3RC5A 1RTLA 1BB0B 1SQOA 2A7HA 1D4PB 1NC6A 5AF9H 1F2SE 1TWXB 1GL1A 3SJ8A 3EA8A 1O3DA 1RIWB 1BTUA 4JZ1A 2AYWA 1DY8A 1O2QA 2O8WA 2F9NA 2F91A 3WWBA 1ZHMA 2CK3D 1BBRH 2PLXA 2PUXB 4JCNA 1B7XB 3KIDU 3M3VA 2ZU1A 3RXKA 1TE0A 1CA8B 1NU9A 1O3HA 1C1RA 2GJGA 1UTNA 1DOJA 1LHCH 1CQQA 2BOKA 2YMSB 3WW7A 1YKTA 1ZJKA 4X1SU 3GY2A 1ZHRA 2FOGA 1BTXA 1P03A 5T6FA 7GCHG 2OC8A 3V13A 2BZAA 1XUKA 3KF2A 4CRGA 4MNYA 3SGAE 1O2LA 2XRCA 1EZXC 1WUNH 1ZSJA 2WYGA 3S7HB 1UK4A 1CA0B 5TCAA 3KYFA 1GJ9B 3MO6A 1A3BH 2ZFSA 2VVUA 2WV4A 1O2SA 2FPZA 1S83A 4TWYA 3OTJE 1MTUA 2GGVB 1GMHF 3O8CA 1ELBA 5HMAA 1MU8B 1ZOMA 1HXFH 1SBWA 4MNVA 3HGPA 3K6YA 2UUJB 4X6NA 2EY4C 1P05A 2BDHA 5B6LA 3D65E 4HG6A 4TWWA 3O8DA 1GCTC 1UTQA 2BLWA 1E37B 1WTHD 5HYOA 1C5PA 2BDGA 4HTCH 5KECA 2A32A 4NFFA 2RFKC 1O36A 1N8OC 2VGCC 1QFKH 5FPTA 5HXFA 1P0SH 3UNQA 2H2ZA 3N7OA 3RXTA 3A83A 2THFB 2FX4A 4X6OA 4AFUA 2M5TA 1FN6A 1BDAA 2LELA 5FL7D 3TPIZ 4BAOB 2VIQA 4ZXYH 3PYHA 4F4OC 4D9QA 5AHGH 2FOHA 2BQ7B 3RXLA 1XUHA 2FOEA 2FMJA 1MQ5A 3F0OA 1WYKA 2GT8A 2KZ4A 3MO3A 4B6FA 3UR6A 1QTFA 2BDBA 5TJXA 3Q77A 1NFYA 2LP6A 4CR5A 4UFDH 1JBUH 1CT0E 2OCVB 3LGYA 4A1TA 1HAPH 3GY3A 1E1RD 1WAYB 3UOPA 4JZFH 4RKOB 4Q7ZA 5DP5A 1SHYA 2FODA 3M37A 3SU3A 5EGMA 1C5LH 1NPMA 4R0IA 4UFGH 1TIOA 1XUGA 2XW9A 3SU1A 5DP3A 1NRQH 2FS9A 2TGAA 4KELA 1TBZH 5JB8S 2P94A 3UREA 5JBTA 1AIXH 1LPZB 2G51A 5EODA 3ZZCA 3PMJA 4RI0A 4NZQA 3M36A 1VITG 2IJD1 3TH3H 1AUTC 1SQTA 3PTNA 3TK9A 2UUKB 1ZGIA 1C2IA 1NRPH 1IQMA 2ZHEH 2ESTE 4UE7H 3F2GA 4XD7D 5GXPA 3MH7A 3BTFE 3KL6A 4X1QU 1AO5A 1V2JT 4NWLA 4DW2U 3ITIA 5EXLA 1O31A 2R3UA 1O3CA 2B8OH 3SNDA 4Q7YA 1PPFE 1C1TA 2HNTC 2VBCA 5TCCA 4D8NA 4DGJA 3TNSA 3ZZ4A 1P01A 2QXJA 4BXWA 4CHAC 2HPQH 1FONA 3RC4A 1S82A 1YCPH 2HNTF 2FOMB 1DLEA 3PLBA 1O3BA 1OWIA 1NFUA 2GMTC 2VVVA 1MTNC 1V2LT 1C1NA 1YPLH 4ABDA 1ZTLA 2ZFFH 1MMJN 1O2KA 2J92A 2JETB 4WH8A 8GCHF 1V2MT 1YP9A 3AAUA 5EJLA 1QZ8A 1P2IA 1XUJA 3GY4A 3QN7A 1SOZA 2VWLA 3EE7A 4IC5A 4X8SH 3BTKE 4MPWA 1A0JA 3V12A 3RXUA 1GHAF 3SU2A 5A0BA 5GDSH 1ID5H 1C1UH 2JH5D 1TABE 1BTZA 3NPSA 4VGCB 5B6OA 4LK4A 3GICB 1SGYE 2FOBA 4ZKNU 1IQFA 1O3IA 3OAAD 1BOQA 3SHAH 1EATA 4K2YA 2D1JA 2K1QA 4B76A 3QZRA 1TB6H 3UNSA 1O5AB 2A0QB 3PTBA 4WVPE 1EJNA 4I7YH 1PYTC 1MABB 3ZVBA 2W3KA 5A8YA 2GKVE 3URCA 1Q3XA 2Z94A 2NWNA 4X2WA 2WPHS 4AOQA 1H9LB 2B5TB 3SGQE 2BLVA 4JMYA 5E0HA 4FU7A 1N6XA 2ANKH 1G3CA 4X1NU 2BXTH 5L2ZH 3OFND 1UCYE 1GG6C 4JZIA 4WXVA 3SU0A 4FUBA 3M5NA 3H09A 2WPDD 1MUEB 1HGTH 4H4FA 1SQAA 1S85A 4Y8ZA 1FY5A 1ZTJA 4ZKOU 4AG1A 3HKJB 1MAYA 2J95A 3I29A 2PKSB 2GP9B 4O97A 5GCHF 4A92A 3ZZ5A 1C5QA 3RMOH 4HZHA 2XBYA 4XBCA 4XDEA 2ZZUH 3PLPA 3GCHB 1HJAC 4CREA 4OS2A 3TH2H 1LTOA 2ZC9H 3VXEH 2RDEA 2G8TA 4MG3A 1V2NT 2CGAA 2OUAA 1HNEE 2ZP0H 3BG4B 2IJOB 2PSXA 5ESTE 2PKAB 1T8LA 1MH0A 4BXSA 1Z8IB 3GOVB 2PUQH 1CHGA 1P57B 1VGCC 3ZZ6A 1P8VC 1NFXA 2ZKSA 4Q7XA 1UK3A 1ELVA 1GCDA 3UR9A 4X1RU 1K9OE 2HNTE 9LPRA 4GHTA 4ZROA 1KDQA 1TBRH 1C5WB 1NM6A 1ETSH 1ANBA 4YTAA 3GYMA 2ILNA 9ESTA 3RXMA 2Z3EA 2ALPA 3RP2A 2SFAA 4BAMB 4WMEA 3HPTB 3M7UA 1FY4A 3MYWA 1FUJA 1V6DA 5FPSA 2ZFQH 4GUXA 3TK6A 3ZZ9A 1MKWK 5CHAC 2KM0A 3GS9A 2FO9A 4DG4A 3CS0A 4E7NA 2JJ1D 4F48B 1H8ED 3JZ2B 4I8JA 1B0FA 1GBMA 2QGRA 3GDSA 4WMDA 4RN6A 4MNWA 3QUMP 2TPIZ 1O3FA 3GCTF 3M7QA 4FUHA 3AVZA 4WH6A 3SUGA 1K1NA 1KTTB 3A7ZA 4J1YA 4INHA 1LHEH 1GJAB 1V2OT 4MQAA 3F9EA 2BY9X 1WCZA 3K2UA 4NIXA 3SGBE 4SGAE 1QB1A 1FAXA 2J5UA 1AFQC 3OYPA 5IDKA 1AN1E 1TMUH 1KTSB 4Z1MD 1ZMJA 1A61H 1DPOA 1NS3A 5FCKA 1IQLA 4NIYA 2GCHG 3SU5A 4AG2A 4ZKSU 1SGIB 1XXFA 2UWPA 2J97A 2G00A 1UHBA 1QRXA 5JBBS 1B5GH 3VFEA 1UTJA 2G52A 7LPRA 1IHTH 1HV7A 5FAHA 4FVDA 1PJPA 3RLYH 4DCDA 1EFRD 1H9HE 3BIVH 1XKAC 1N1LA 1U6QA 2O9QA 1TGNA 2JIZD 1FJSA 1EUFA 2KAIB 3TK5A 1E79D 1L1JA 4Y0YE 1KXDA 3PWBA 4JK5A 2J94A 3LKWA 1Y5AT 1SHHB 2Y5FA 1RD3B 8LPRA 1YYY1 1YPEH 4DIIH 1T8OA 3QDZB 2FYRA 4FVBA 4XSKU 3HATH 2JH0D 2BMGB 1Y5BT 4WY3A 3PRBA 3T2NA 1P2QA 1WQVH 3OY6U 2V3MA 3OX7U 1TONA 3OE7D 4GPGA 1FY3A 1FAKH 1G37A 4U2WA 4ZKRU 1V2UT 4LZ4B 1AI8H 1V2VT 2QAAA 4DIHH 3LT3A 3AK5A 3A88A 1NFWA 1SL3A 1UCYH 1A46H 4ASHA 4FUIA 2RDLA 3EYDA 4IGDA 1A7SA 1ZRKA 2ZCKP 5I25A 2XC0A 3DFLA 3SU4A 2HGTH 2AH4X 3RLWH 1AVGH 1TQ7B 2XBXA 1C2KA 1ANDA 2F3CE 3EDXB 3A8AA 1KXAA 3QWCH 1PFXC 2FP7B 1ESBA 5GNDA 3M61U 4Y0ZE 1V2QT 3GCOA 2ULLA 4DY7B 4I8KA 4ZHLU 1F0UA 3AW0A 2BHGA 3OY5U 2A5IA 2C4FH 3W1EA 3LGVA 4FUGA 2F9UA 1SPJA 3E90B 3RXGA 2C90B 5FCRA 1GJ8B 5T1VA 3A7YA 4Y76A 2GCTB 3GISB 5HM2A 1GJCB 1HAIH 4YZUA 2CN0H 2GV7A 2CJIA 1OHHD 1BBRK 3OTPA 1OSSA 1GJBB 1Z8GA 1X7AC 3NUMA 4XRNA 4ABGA 3ZVEA 2BD8A 4K1TA 3KHVA 1ARBA 1W3CA 1OWDA 3RXPA 1QL7A 3LJJA 5GPIB 3SU6A 1AZ8A 2OBOA 1Z6EA 3RMMH 1MKXH 1GBJA 1GMDG 1S6FA 3P92A 4H42U 4ESTE 1CU1A 3Q00A 3BTDE 3ZYEA 4DT7B 1SFQB 4TPIZ 2A1DB 1OPHB 1OOKB 3T27A 4NIWA 1LPKB 4I31A 4HGCA 3CP7A 3SJIA 1FZZA 1DANH 4GHQA 3AASA 5LPFA 1MQ6A 4ZMAH 4TPYA 4YLQH 1O2MA 2A5KA 3ZVFA 1FPHH 1NRNH 1YPKH 1QL8A 2AGEX 1N6YA 2FESH 3UFAA 2VIDA 1AU8A 3F0PA 1SQRA 5DO4H 3UPEA 3SNBA 1J9CH 1TMTH 1ZSKA 1A2CH 1L4ZA 3JZ1B 3EE0B 1RRKA 3KQ5A 4XOJA 1Y8TA 1O5CB 4Y79A 1EX3A 3LH3A 2GMTB 2UWLA 5DN6D 4Z0KA 1C5ZB 1O2VA 2W5EA 1GVZA 1GBKA 2LPRA 2WV9A 5A8XA 3MU0A 1FMGA 3TITA 2BY8X 3CENA 1FIWA 3R3GB 2G81E 5JDUB 4TT3D 2EEKA 3FO8D 1WDIA 1EPTC 3HGNA 1QCPA 3RXJA 4P02A 2SNWA 5EW2H 1ELTA 1LVBA 2XNDD 3PM3A 1WOFA 4Y7BA 3GDVA 1BRCE 1C2MA 3P6ZB 1P9SA 4JZEH 3BTEE 1KIGH 1A5GH 5GCHG 2FDAA 1K1JA 1MAXA 2ZFTA 5L6NH 1LMWB 2IPHA 4MNXA 1C2DA 1BTYA 2BXUH 5C0TA 2ANWA 3T62A 3A86A 4Y10E 1A5HA 2C93B 2RG3A 1LHFH 1LQDB 1Y3XA 3V7TA 5C17A 1GJ6A 3FVFB 1EOJA 2GTBA 1OXGA 3D49H 3VGCB 3RXRA 4UDWH 4XBDA 3ODDA 2WINI 1ABIH 5FHTA 1TPAE 1ZTKA 1AQ7A 1EASA 2BD3A 3HK3B 1GJ5H 3ENSB 2QF5A 5EPYA 1O3LA 2P3TB 1SKYE 8KME2 1O2JA 3GY6A 1TRYA 2ZTXA 1SGFG 1GBIA 1W0YH 1QB9A 3A7WA 1TQ0B 1O3NA 3BTTE 3MH6A 3A7TA 2OQ5A 1DWCH 1SGCA 1TNLA 4WXIA 3K6ZA 3MH5A 3IITA 5CMXH 1UVOA 3W95A 3VB7A 1AE5A 1TX6A 3U8OH 1GBAA 1O2GH 1DSTA 1O35A 2HWLB 4YOJA 1RGQA 3BTHE 3GYLB 1QB6A 2EC9H 2BDCA 1SLVB 1QGFA 4YT7H 1EAWA 3SUFA 2BVSH 1HJAB 1LKAA 1PPHE 1HXEH 4RT0A 2V35A 2L6OA 3Q3YA 1SB1H 1YCPK 3TH4H 2W6JD 1S81A 1OP8A 3DD2H 3M5MA 3RXIA 1W2KH 1Z71A 5J4SA 2V0BA 2F4LA 4AGKA 1C1SA 1BTPA 1NU7B 2Q1JA 2HPPH 3FP7E 2RA3A 1ZPZA 4WMFA 1GDUA 4YM9A 4H6TA 4ZCNA 2PHBA 5T6GA 4D7GA 1W14U 3ZZ7A 3TGKE 2YMSD 1S84A 1OKXA 4F49A 1LHDH 4TSFD 5C1UA 1H8IH 1W0KD 5E2OA 3MQKC 1GBHA 3PB1E 1AB9C 2A2XH 4NA8A 3STJA 2PTNA 2Y7ZA 2OC0A 1GJ7B 5FX5A 5GIBA 3ZZ3A 1J17T 4YXWD 5EIYA 2Z9KA 4K69A 4MPUA 1O2OA 3NCLA 4ACBA 1IQHA 3UB0A 3EQ0H 2HOBA 1C5UA 1CBWB 4DJZB 1NBMD 2K0QA 3MU5A 1AWFH 5DJ7A 3MU8A 3ZZAA 1C2JA 4B1TA 3SHCH 3ZZBA 3SV2H 4X2VA 1P3EA 2TRMA 4OS4A 1DT2A 3H7OA 3P70B 1FY8E 2W7SA 2QV1A 2BDAA 3M35A 3MTYA 3S9BA 1HBTH 2OP9A 2HLCA 1UTPA 3SNAA 2QXGA 2BD2A 4ZHAA 2QCYA 1FDPA 1ESAA 3N7DA 1Y3VA 1QIXB 2OLGA 4UFEH 1G30B 1JWTA 4AC9A 1ETTH 1O3EA 1C1WH 1GHBG 1YPGH 3RU4T 1O3OA 1Y3YA 3BN9A 1V2ST 1KLJH 2ZHDA 1ELAA 3BEIB 1OWEA 1Z8RA 1HLTH 2EI8A 1EZQA 3N99A 3PV2A 2VVCA 4ABHA 1C2HA 1PQ7A 1BIOA 3WY8A 4Q80A 3VB4A 1THSH 7ESTE 2TGPZ 3MU4A 4TY6A 3PO1B 1IOEA 2VIPA 2J98B 2ANYA 2P8OC 5A0CA 1O5EH 2WPIS 1L1GA 4GCHF 1CGJE 2H5DA 4B2AA 3NK8A 1QJ6B 4CRFA 2B9LA 1S6LA 4LOYH 3VB5A 1BMLA 1OS8A 1DFPA 4NSYA 2J2UA 1KXFA 5CHBA 2SGPE 3GY7A 3RXSA 3NXPA 1BZXE 3SZEA 1ABJH 4ABBA 2KCAA 3U1JB 1EJMA 5DK1A 4AYVB 1EZUC 2OBQA 1ACBE 3VG8A 4AFSA 2CF8H 1PPGE 1LVYA 4AB8A 4TYDA 4JYTA 4INKA 2VH6A 3T29A 2C8YB 4THNH 4OM9A 1ZMLA 3E6PH 1JOUB 5C67A 4XE4A 4HI3A 2ZIQH 5A0AE 1K1IA 1L4DA 1AZZA 1NESE 3OU0A 4Q63A 3EAJA 3F3BA 4NCYA 1FN8A 5JBAS 1YLDA 1GI5A 4JYVH 1LCYA 1H4WA 1P11E 2FLBH 2WUBA 4BOHA 4YESB 3KQBA 3W94A 1ZGVA 1BMMH 4AYYB 1HAGE 2WZQA 1GGDB 3NRLA 2KR7A 4RT1A 2BD5A 4ABIA 2YOLA 1C5RA 2A2QH 1BJVA 2PFEA 5F6MA 3P17H 2Q6FA 3BTWE 1CHOG 1OWHA 1V2KT 1LPGB 5FBEA 1BCUH 1KDQB 4A6LA 2ODPA 1O2TA 3PMHB 1TNJA 5HIZA 1S5SA 5FPYA 1W13U 5KEDA 1UVPA 1GPZA 1O3JA 3SYJA 3UQOA 1Z6JH 3DUXH 3BTME 2OXSA 2ZDKA 3ZYDA 2J98A 3E8LA 3E91A 2OC7A 3UTUH 2HVXA 3PWCA 2AMDA 1CVWH 1ESTA 1TFXA 2FTLE 2XWBI 2B0FA 2AIPA 5DSFA 3LC3A 1GMCG 2ZCHP 2V3HH 2K7XA 2FOCA 2XCFA 3RXBA 2GT7A 2IN2A 2F9BH 1BUIA 4Z6AH 1O5DH 3RU4E 4YO9A 5EJZA 3HKIB 4IN1A 3U98H 1GI1A 4NSVA 1ORFA 4X1PU 3S7KB 1ZYOA 4RSPA 3VB3A 1TOMH 3E0PB 2VNTA 2FXRA 1SGNE 4FETA 2VIOA 1MZAA 1E0FD 1UHBB 4Y8YA 1QQ4A 6GCHG 1ZLRA 1ZPCA 2ZDNA 6CHAC 1WV7H 4WJG2 1TNHA 3LOXA 4NZLA 1T32A 2J4IA 4FU8A 3MH4A 4NWKA 3LDXH 1W0JD 4OS6A 5L30H 1J14A 2CV3A 5C3NA 1WSSH 1AUJA 1SGEE 3UIRA 1O3PB 1DLKB 3M3SA 3OEED 3VXFH 4KKDA 1YM0A 4XBBA 2CF9H 2C8ZB 3SN8A 3QTOH 1QL9A 4I8GA 3ODFA 1BTWA 1G3BA 1TX8A 1NRRH 1CA0C 5E2PA 1GI7B 5K0HA 3GCNA 4NA9H 1KXCA 4B2BA 2GZ7A 1YBWA 2Z7FE 1TOCB 2WPMS 4Y71A 1MBQA 1GBDA 3EBNA 3SNCA 1E35B 3ZZDA 5T3HA 1EB1H 1C5VA 3HK6B 4JK6A 1C5OH 1C9TA 2R2MB 1Q2WA 3T26A 2ZG0H 1EP6A 4ZXXH 1MTVA 1GHWH 1FI8A 1BMFD 1TNGA 3ZZ8A 4DOQA 2CMYA 4WF8A 4YOGA 2VWNA 4IS5A 2XWAA 3A89A 3LONA 3TJUA 3BSQA 4MPXA 3OEHD 7GCHF 1GMHG 1YGCH 1L2EA 1MKXK 4B75A 3SJ9A 1QJ1B 1NZQH 5BPEA 2NU2E 1AVXA 1PQ5A 4FUJA 3LGUA 1F5RA 5K7RA 3SO3A 3A84A 2ZGJA 3BV9B 2L74A 3SW2B 4K3JA 1WXRA 3DSOA 1XKBC 2PSYA 4Y11E 2QF0A 3P8NA 5C5NA 3IWMA 4ISHH 1IQJA 4OS1A 1Y3WA 3E0NB 1DVAH 2FEQH 1TPPA 1OP2A 3B9FH 2BD4A 6ESTA 1P12E 1RJXB 3F6UH 1OWKA 1CGIE 3SJOA 1EPTA 2BD9A 2QE7D 3SJKA 1P04A 1XXDA 4O3TA 5C1YA 1D6WA 5EQRA 1ELCA 2CXVA 4U32A 4ZUHA 2XTTB 1O2RA 1LQEA 1QRWA 3UUZA 1E1QD 1K1OA 3KQCA 1E34B 1GCTB 1UVSH 1LVMA 5L2YH 1HFDA 2ZGHA 5AFZH 1P9UA 1HDTH 3SQEE 1IQIA 1AY6H 2KX4A 2DE9A 4NGAH 1N8OB 2AEIH 2VGCB 2FX6A 5DKMA 3TLOA 1HJ8A 3TJOA 2CHAC 1DICA 1TYNA 1A1RA 2WPLS 1T7CA 1CO7E 2BZ6H 2H5CA 3RUOA 2W3IA 1D6RA 2ZECA 4AFZA 1SGDE 3PROA 1FIZA 2JETC 2ZF0H 1QNJA 1T8MA 4ACAA 4X8VH 1GBFA 4Q4LA 1LO6A 3AW1A 1KYNA 2PGBB 2ZTYA 2ZGCA 3FANA 4M9FA 5C0UA 1PQAA 4BAQB 3S9CA 3RXAA 2PP6A 4CH8B 1THRH 2NU4E 2G4TA 2Z9IA 1C9PA 1VITF 2ZQ2A 3PLKA 3U28C 2Y6TA 1GVKB 2Y82A 4UEHH 4K8BA 4VGCC 3UY9A 2AFQB 1PPCE 2A7JA 2VIVA 3FZDA 4ABEA 2SGEE 4CH2B 3DSPA 1L0ZA 2JJ2D 1MKWH 3GY5A 8GCHG 4AZ2B 4X8UH 3RXHA 5C94A 2BD7A 2P8OB 3RXOA 4X0WU 2VWOA 3KGPA 3LPRA 1O0DH 3F1SB 1O2YA 3DFJA 1K21H 2BTCE 1GHAG 1FQ3A 3RXQA 2ZHFH 3N7EA 2XOKD 1Z7KA 5FX6A 4R8TB 2FOFA 4MDSA 2V6NA 1EAIA 1XX9A 1AKSA 1ZPBA 1DY9A 1HAHH 4FUDA 3ZV8A 4BNRA 1MCTA 1P2KA 2PWXA 2H9TH 3MWIU 4MPVA 1HIAA 1FPCH 1F0TA 4CHAB 4PROA 2R2WU 3E1XB 1C4Y2 1D9IA 3C27B 2FWWA 2W6ID 1CSOE 1Z1JA 5DP4A 1MTNB 2PKSC 3TGJE 2IOTA 3PMBB 3R0FA 3UOUA 3I77A 1S0QA 2QXHA 2P59A 1FV9A 1J16A 2G5VA 1F7ZA 1S6HA 4MLFB 3T28A 1ZHPA 1P2OA 3M7TA 3GCHC 4BAHB 2FTMA 2XC4A 2FZZA 1AHTH 1C1PA 1MBMA 2YNAA 1F5LA 4NG9H 2F9VA 1XUFA 3BG4C 1O5FH 2A4OA 1OWJA 1K1MA 3FKSD 1T31A 2A31A 5C1XA 1ZR0A 4ISLA 1TGTA 3F9GA 1XM1A 2XYAA 2K8IA 1GWAA 5F8XA 3VB6A 1JRSA 1TRMA 1T4VH 1OYQA 4B6EA 2ZFPH 4ZHMU 2ALVA 2ODYB 3GY8A 1BMAA 3LC5A 3D23A 2AGIX 4DVAU 1PQ8A 2ZWLH 1K1PA 1MU6B 3NKKA 4YT6H 4OGYA 2ZPSA 3ATLA 1A0HB 1DWBH 1V2RT 3U9AH 1G2LA 2QA9E 2WV5A 1O5GH 5BRRE 2P3FH 2OTVA 1O2NA 1QBVH 1F0SA 2UWOA 4IMZA 3RXDA 1TGCA 3BF6H
chains in the Genus database with same CATH topology
2HRVA 2AERH 1EZSC 1GG6B 1IQEA 2Y81A 1ZJDA 1C1MA 1O2HA 2V3OH 1ELGA 4IMQA 5PTPA 2ZU5A 3H5CB 1C2GA 3QTVH 1E38B 1Y5UT 2A4RA 5GJ4B 3O8BA 4K8YA 1KLIH 3ZV9A 3RXCA 4ABJA 2EI6A 3U8TH 1QQUA 1ZSLA 1PYTD 2J9NA 4IW4E 2NU1E 1YF4A 6CHAB 1C4U2 1OX1A 2LNCA 3S9AA 1IHSH 1VJ9U 5H4IB 5DG6A 1P10A 2Y80A 3GCTG 8ESTE 2QN5T 3S0NA 4A5TS 1HAVB 1O32A 3E3TA 4JZDH 4CBNA 3MNSA 4UFFH 2SGFE 2ZNKH 4XFQA 1VGCB 3A7XA 2BDIA 1EB2A 3A85A 3T5FH 1J8AA 1NN6A 1DX5M 1IQGA 1LDTT 5ETXA 1MTWA 1H9IE 1QR3E 1MTSA 2R0KA 1BT7A 2R0LA 3B23B 5EOKA 1K2I1 4SGBE 3AAVA 2ZDMA 1VCQA 2BY7X 4B71A 2VJ1A 1QY6A 1SSXA 1KY9A 1GDNA 3QGJA 3S69A 2FYQA 2H9HA 1TALA 4A1XA 3QZQA 4CRDA 1IQNA 2GCHF 1P2NA 3ZVGA 1SC8U 5CHAB 4AGJA 4IN2A 1BA8B 1GBBA 5EQQA 5E0JA 1UTOA 2SGAA 2BLOA 5C5OA 1T8NA 1F92A 2Q6GA 1TNKA 5ESBA 2GDEH 6LPRA 2I6SA 3UWJH 1VCWA 2BLQA 3ZVCA 2ZEBA 1EKBB 4FXGH 1GJDB 1HRTH 2J34A 1O2UA 1AFQB 4YOIA 1G36A 3BEFB 2TBSA 2DUCA 2TGTA 2ZDLA 2D2DA 1QHRB 4BTTB 1A5IA 2STAE 2ZA5A 4U01A 1OYTH 1A3EH 4Q2KA 4CR9A 1T4UH 1TX7A 2Y7XA 1ELEE 3KN2A 2BQ6B 3KCGH 1AMHA 1KLTA 2BDYA 2PW8H 5DPAA 3MU1A 2A5AA 2RCEA 4OS5A 1BHXF 1RFNA 2Z9JA 2AIQA 2GCTC 1AGJA 2C8WB 2J38A 1SI5H 1HAZB 1SGPE 4NIVA 4AN7A 3BEUA 1ETRH 3MNXA 4GSOA 1HAVA 1UJ1A 4ZAEA 5AVDA 2P3UB 3MOCA 1GI6A 2H1UA 2VH0A 3ATWA 1B0EA 1SMFE 2XXLA 1CE5A 5DP9A 1BRBE 1YPMH 2ASUB 5F8ZA 1ZRBA 1EJAA 2PV9B 1GVLA 4KGAA 4GLYA 3A81A 1NRSH 4O3UA 1KXBA 1SG8B 2XC5A 3CS7A 4INLA 1C5SA 5AFYH 3QK1A 1W7XH 4LXBH 4YLUA 1P3CA 1GI8B 2XBVA 2JKHA 5JBCS 2FI5E 1SGFA 3STIA 1ELFA 4BAKB 1LVOA 1VITH 2W26A 2TIOA 2F83A 3EA7A 4U30A 5EPNA 3VEQB 1WU1A 2Q6DA 1SGQE 1C1OA 3RM0H 5JPMH 1XVMA 1SFIA 5LH8A 1GDQA 4KTSA 4X2YA 1INCA 3B8JA 1TMBH 3K65B 2CHAB 1YPJH 2G5NA 2PTCE 1O3GA 2GX4A 5J4QA 4B73A 2GVFA 4ISNA 5JYIA 1AE8H 4B74A 2VINA 4K60A 2BM2A 3SI4H 3ZVAA 5LPRA 3G01A 4O9VA 1O5BB 3A8BA 5C2ZA 1XUIA 2C3SA 1C2FA 2ZO3H 1GMDF 2R9PA 1QBOA 1DWDH 1WQSA 3SV9A 1O34A 1RXPA 3F9HA 1P06A 3TU7H 1W0ZU 1AFEH 1CT4E 3SV6A 1GBTA 2SNVA 4K5ZA 2XBWA 3V0XA 2ZDVH 1V2TT 1C5MD 1JIRA 1F0RA 1P02A 1BTHH 1TGBA 1G3EA 3C1KA 1ANEA 3FFGA 4X8TH 3SI3H 1HYLA 5G4BA 4BTIB 1Y3UA 5GWZA 3SOSA 2BQWB 3RDZA 2AMPA 2XNIA 1GHYH 1K28D 1MCVA 3A8DA 1F5KU 4I8LA 2LIZA 3TIUA 1C5XB 1YPHC 1UVTH 3UWIA 5DGJA 2A4GA 1DSUA 2FOAA 1HB0B 2QIQA 2FS8A 4FUEA 4I8HA 2I6QA 1VR1H 3VGCC 3F68H 4D76A 4D9RA 5I46H 2G55A 2O8MA 1EXFA 2JH6D 4Y8XA 3MNCA 3BTGE 1RIWC 2A45B 4A7IB 4UD9H 3A7VA 1GJ4H 1KXEA 1H1BA 1GI0A 1YC0A 3L3TA 3RC6A 2P93A 3RXVA 3LGTA 1OP0A 1SGRE 4E7RG 2OD3B 4Y7AA 2BB4A 3P8FA 4GVUA 3LGWA 5DP7A 1JMOH 2QF3A 4AORA 1UCYK 4AX9H 4ABFA 1FLEE 7KMEH 1P2JA 1ZMNA 2A7CA 3RM2H 5EW1H 1XVOA 3TNTA 3OSYA 2OQUA 3QLPH 3DHKH 1LKBA 5FXLA 1HCGA 3E16B 1ELDE 2F9PA 1SLUB 4B2CA 1E36B 1RS0A 3ELAH 1J15A 4J2YB 1GI4A 3U1IB 1EPTB 1W8BH 1DWEH 2R3YA 4AB9A 3RMNH 1MZDA 1SVPA 2NU3E 1BRAA 3TGIE 2OC1A 3BG8A 4CRBA 1TA6A 2ZU2A 2VB0A 1SLXB 4Y6DA 1YLCA 5HGGA 1RTKA 1W12U 2BX4A 3L6PA 3Q3KA 1RTFB 4OS7A 1UTMA 1O37A 2RA0A 3LU9B 2D8WA 4X6MA 1UK2A 2ZDAH 3EA9A 2Y5HA 1O3AA 1TGSZ 1LHGH 1QBNA 4GAWA 1P09A 4HFPB 5EXNA 3UQVA 3P8GA 4E06H 1D3TB 2HALA 4BANB 1DDJA 1EOLA 5SGAE 1YCPM 1V3XA 3RXFA 3A80A 2FI3E 4JYUH 1CGHA 1HAOH 2GV6A 1MD7A 1CBWC 1DS2E 3MHWU 1O39A 3RMLH 5EU8A 5LPEA 1DXPA 1M9UA 3MFJA 1FNIA 1TLDA 1D3DB 1D3PB 2STBE 1P2MA 1JRTA 1G2MA 2UUFB 3FZZA 2D26C 1O2WA 2G4UA 3MI4A 1GBEA 4WWYA 1SOTA 5E8EH 2F9OA 1UTKA 4LZ1H 4MVNA 3ESTA 2Z3DA 2Z9GA 1WTGH 2WPJS 2WPKS 3PV4A 1O2IA 2BOHB 4KP0A 4IBLH 2FI4E 3A82A 3TVJB 1YPHE 1C5NH 1A0LA 1CT2E 1NTPA 1C5TA 3URDA 1TBQH 2FLRH 3SUDA 3SORA 1TAWA 2FM2A 1DUAA 2FIRH 2WYJA 5C20A 1V2WT 1XMNB 1HJ9A 4DURA 4TY7A 1H8DH 3PO1C 1GHVH 1C1QA 1IAUA 1PPEE 4X2XA 1O2XA 3M5OA 2C8XB 2PKAA 3BIUH 4ISOA 2O8LA 1C4V2 1DUEA 1W11U 1G3DA 2BYAX 1SR5C 2EA3A 3A87A 4BTUB 5A2MH 2BVXH 1GHZA 1AKSB 2GDDA 5A8ZA 2Z9LA 4FUCA 2XCNA 2H9EH 2YNBA 1AB9B 4K1SA 4NA7A 1O33A 3GDUA 4RKJB 3D62A 1C2EA 2EI7A 1HIAB 3M3TA 1HPGA 1GI3A 3V3MA 1C1VH 1TPOA 1BRUP 5E0GA 3PMAB 1JXPA 4KTUA 1GHBF 1G9IE 1UTLM 3ZVDA 1Y59T 2GZ8A 4CRAA 1BQYA 4NFEA 5A09A 3QX5H 4GCHG 1AWHB 3I78A 2Z6BD 4M7GA 1NY22 1S0RA 2ZI2H 2ZTZA 2W7UA 2VIWA 1EAXA 2O8TA 1UO6A 1W10U 1GBLA 1Z8JB 2WUCA 1D3QB 1ANCA 1O3KA 1DE7H 1BBRE 5EXMA 1O30A 2Z3CA 1KSNA 4A1VA 5F03A 4CBOA 1Z1IA 1GGDC 2ZPRA 1DITH 3TJVA 5HM9A 5EQSA 2BVRH 2AS9A 2VWMA 3SBKA 4D7FA 3K9XB 1AVWA 1QRZA 5ABWA 2SGDE 3FP8E 1BHXB 2ZHWH 2O8UA 2GD4B 2QXIA 3NZIA 3Q3XA 1FY1A 1PPZA 1IQKA 3H7TA 1GI2A 2ZU4A 1UVUH 2A4QA 3IG6B 4ISIH 1EQ9A 2B7DH 1FXYA 1O38A 2ZFRH 1NO9H 4KTCA 3T25A 4OGXA 4X6PA 3SV8A 3FAOA 1BMNH 1QA0A 2NU0E 2SGQE 3MO9A 3ATMA 1K22H 4ABAA 2DE8A 2P16A 2AMQA 3KQDA 5IYTA 1BJUA 2KAIA 4E05H 4CRCA 1K1LA 2BY5X 1QJ7B 1EAUA 4H6SB 3RU4D 3DA9B 1HAXB 1ZZZA 1ARCA 1QURH 3QO6A 3Q76A 1BITA 2AGGX 2BY6X 5T6DA 1HAYB 1VZQH 2H6MA 3TJNA 1O2ZA 1WBGB 1W7GH 2ODQA 2P95A 1NT1A 3VPKA 3O8RA 1A4WH 2PR3A 3M5LA 5FBIA 3SNEA 3MNBA 3L33A 3MMGA 1Q31A 1DM4B 1CHOF 2ZU3A 2QY0B 2ZGXH 3NWUA 1DXWA 4O03A 1THPB 5F8TA 3LIWA 1TNIA 2TGDA 3LJOA 3ATIA 1GL0E 4I33A 4K1EA 2ZQ1A 1G32B 3SQHE 1UMAH 5LGOA 3KEEA 1AD8H 1VCPA 3SV7A 3SUEA 1QA7A 3ATKA 5EG4A 2OINA 3LGIA 3SZNA 1MD8A 3U8RH 5CE1A 1O3MA 3FP6E 5DP8A 1SLWB 1EP5A 2QYIA 1O2PA 2ZGBH 2GZ9A 1GMCF 4FU9A 4AFQA 3UNRA 5JB9S 3F9FA 1C5YB 3DT0H 3P8OA 1GHXH 3LH1A 1JIMA 1PPBH 3RXEA 3EGKH 1C2LA 2VU8E 2ZHQH 4IC6A 4MTBA 1TA2A 1L1NA 1TRNA 5DP6A 4QT8C 2UUYA 1NROH 4UONA 1HUTH 3KNXA 2Y5GA 6GCHF 2ANMH 1GI9B 1GBCA 2BX3A 4FUFA 2PGQB 3P95A 3BTQE 1TPSA 2ZPQA 3U69H 2ZCLP 3A8CA 2QC2A 1SGTA 4I32A 4ZH8A 3KQEA 1VJAU 1V2PT 3QGNB 3RC5A 1RTLA 1BB0B 1SQOA 2A7HA 1D4PB 1NC6A 5AF9H 1F2SE 1TWXB 1GL1A 3SJ8A 3EA8A 1O3DA 1RIWB 1BTUA 4JZ1A 2AYWA 1DY8A 1O2QA 2O8WA 2F9NA 2F91A 1ZHMA 1BBRH 2PLXA 2PUXB 4JCNA 1B7XB 3KIDU 3M3VA 2ZU1A 3RXKA 1TE0A 1CA8B 1NU9A 1O3HA 1C1RA 1UTNA 1DOJA 1LHCH 1CQQA 2BOKA 1YKTA 1ZJKA 4X1SU 3GY2A 1ZHRA 2FOGA 1BTXA 1P03A 5T6FA 7GCHG 2OC8A 3V13A 2BZAA 1XUKA 3KF2A 4CRGA 4MNYA 3SGAE 1O2LA 2XRCA 1EZXC 1WUNH 1ZSJA 2WYGA 3S7HB 1UK4A 1CA0B 5TCAA 1GJ9B 3MO6A 1A3BH 2ZFSA 2VVUA 2WV4A 1O2SA 2FPZA 1S83A 4TWYA 3OTJE 1MTUA 2GGVB 1GMHF 3O8CA 1ELBA 5HMAA 1MU8B 1ZOMA 1HXFH 1SBWA 4MNVA 3HGPA 3K6YA 2UUJB 4X6NA 1P05A 2BDHA 3D65E 4TWWA 3O8DA 1GCTC 1UTQA 2BLWA 1E37B 1WTHD 5HYOA 1C5PA 2BDGA 4HTCH 2A32A 4NFFA 1O36A 1N8OC 2VGCC 1QFKH 5FPTA 5HXFA 1P0SH 3UNQA 2H2ZA 3N7OA 3RXTA 3A83A 2THFB 2FX4A 4X6OA 4AFUA 2M5TA 1FN6A 1BDAA 3TPIZ 4BAOB 2VIQA 4ZXYH 3PYHA 4F4OC 4D9QA 5AHGH 2FOHA 2BQ7B 3RXLA 1XUHA 2FOEA 2FMJA 1MQ5A 1WYKA 2GT8A 3MO3A 3UR6A 1QTFA 2BDBA 5TJXA 3Q77A 1NFYA 4CR5A 4UFDH 1JBUH 1CT0E 2OCVB 3LGYA 4A1TA 1HAPH 3GY3A 1WAYB 3UOPA 4JZFH 4RKOB 4Q7ZA 5DP5A 1SHYA 2FODA 3M37A 3SU3A 5EGMA 1C5LH 1NPMA 4R0IA 4UFGH 1TIOA 1XUGA 2XW9A 3SU1A 5DP3A 1NRQH 2FS9A 2TGAA 4KELA 1TBZH 5JB8S 2P94A 3UREA 5JBTA 1AIXH 1LPZB 2G51A 5EODA 3ZZCA 3PMJA 4NZQA 3M36A 1VITG 3TH3H 1AUTC 1SQTA 3PTNA 3TK9A 2UUKB 1ZGIA 1C2IA 1NRPH 1IQMA 2ZHEH 2ESTE 4UE7H 5GXPA 3MH7A 3BTFE 3KL6A 4X1QU 1AO5A 1V2JT 4NWLA 4DW2U 3ITIA 5EXLA 1O31A 2R3UA 1O3CA 2B8OH 3SNDA 4Q7YA 1PPFE 1C1TA 2HNTC 5TCCA 4D8NA 4DGJA 3TNSA 3ZZ4A 1P01A 2QXJA 4BXWA 4CHAC 2HPQH 1FONA 3RC4A 1S82A 1YCPH 2HNTF 2FOMB 1DLEA 3PLBA 1O3BA 1OWIA 1NFUA 2GMTC 2VVVA 1MTNC 1V2LT 1C1NA 1YPLH 4ABDA 1ZTLA 2ZFFH 1MMJN 1O2KA 2J92A 2JETB 4WH8A 8GCHF 1V2MT 1YP9A 3AAUA 1P2IA 1XUJA 3GY4A 3QN7A 1SOZA 2VWLA 4IC5A 4X8SH 3BTKE 4MPWA 1A0JA 3V12A 3RXUA 1GHAF 3SU2A 5A0BA 5GDSH 1ID5H 1C1UH 2JH5D 1TABE 1BTZA 3NPSA 4VGCB 5B6OA 4LK4A 3GICB 1SGYE 2FOBA 4ZKNU 1IQFA 1O3IA 1BOQA 3SHAH 1EATA 4K2YA 2D1JA 2K1QA 4B76A 3QZRA 1TB6H 3UNSA 1O5AB 2A0QB 3PTBA 4WVPE 1EJNA 4I7YH 1PYTC 3ZVBA 2W3KA 5A8YA 2GKVE 3URCA 1Q3XA 2Z94A 2NWNA 4X2WA 2WPHS 4AOQA 1H9LB 2B5TB 3SGQE 2BLVA 4JMYA 5E0HA 4FU7A 1N6XA 2ANKH 1G3CA 4X1NU 2BXTH 5L2ZH 1UCYE 1GG6C 4JZIA 4WXVA 3SU0A 4FUBA 3M5NA 1MUEB 1HGTH 4H4FA 1SQAA 1S85A 4Y8ZA 1FY5A 1ZTJA 4ZKOU 4AG1A 3HKJB 1MAYA 2J95A 3I29A 2PKSB 2GP9B 4O97A 5GCHF 4A92A 3ZZ5A 1C5QA 3RMOH 4HZHA 2XBYA 4XBCA 4XDEA 2ZZUH 3PLPA