3SNCA

Crystal structure of sars coronavirus main protease complexed with ac-nstsq-h (soaking)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
total genus 78
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sncA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sncA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sncA02
5A8ZA 1ZGIA 2VH0A 1NFYA 2J92A 4MLFB 1EUFA 2BMGB 4Y71A 2C3SA 2LNCA 5A8XA 3FP8E 4ABIA 1LO6A 1TQ7B 1UVSH 3SV2H 2BDIA 2SGAA 1C1SA 1S83A 1XUFA 3UQVA 2QXIA 1O2ZA 3DD2H 1V2UT 2ZHQH 4X2WA 2ZPQA 1OP8A 2IN2A 2ANWA 3HATH 2D1JA 5T6DA 3SU4A 4GHQA 1G37A 1YGCH 4X2YA 4CBOA 1G2LA 1P10A 1UTKA 3VPKA 3HGNA 4X6OA 1NFXA 4AG2A 4LK4A 4NFFA 1ELEE 1TX6A 1RTLA 2ZPSA 4BAOB 3M3TA 2BLQA 2GP9B 4WH8A 1GJ8B 1PPCE 1BT7A 2XCNA 3K2UA 3SHCH 3FP7E 2BD4A 2BOHB 1EOJA 1A3BH 4GHTA 1T31A 4ABGA 2VIVA 2W26A 4NA7A 5DK1A 1LHFH 1LKBA 3ZZ7A 1QL7A 2VVCA 1F5KU 2UUFB 2XC5A 1TPAE 5E0HA 2FLBH 1KXBA 1GI3A 3K6ZA 5L2YH 1NFWA 4O3TA 3KL6A 5LH8A 2VGCB 4TPIZ 1IQMA 1Y5AT 4K60A 3SUGA 3GY3A 1L1GA 2GGVB 4OS6A 4NIWA 1O2NA 1S81A 4CR9A 2AFQB 3ZYDA 1XM1A 1W13U 5BRRE 4I31A 4FVDA 2A4QA 4JK6A 1S6HA 4FU8A 4DJZB 4D76A 5FPSA 4KTSA 1MTSA 3HK3B 3PWCA 3ZZ8A 3O8RA 5C5OA 2BVRH 3MI4A 1EPTB 1HAXB 3KGPA 3MU4A 3U8TH 1QL9A 4H6TA 3MH6A 4UFDH 1GGDC 2BDHA 3ATLA 4AB9A 2GCTC 1HDTH 2OCVB 3BIUH 1NT1A 5EGMA 4NWLA 3LONA 1GJ4H 4K2YA 1GMDF 3M37A 1A61H 2O9QA 1GMDG 1GBDA 4NSYA 4Y79A 4CRAA 1P2JA 2EI8A 1O34A 1G2MA 1Z8JB 1O2VA 4CRCA 1EB1H 1OWKA 4CHAC 1P8VC 4WVPE 3UWIA 1TBRH 4FUBA 1CT2E 4CR5A 4AYYB 2Z6BD 1VJ9U 1JIMA 2J95A 4U01A 3LJJA 3SUDA 2GD4B 1EZXC 4ZUHA 4FUJA 8LPRA 2ESTE 5A2MH 3SBKA 1THSH 3V3MA 4MDSA 1PQ5A 4ZXYH 3KHVA 1YKTA 1O5AB 4JCNA 1MAXA 2ZPRA 3PWBA 3LC5A 2BY5X 2GMTC 2IJOB 2HALA 1ZYOA 4KELA 1W7XH 3D62A 1C1UH 1O2SA 2QIQA 1WSSH 3BG4C 5LPRA 1LMWB 3QZRA 3E0PB 1SFIA 1BDAA 2ZU2A 1A46H 1PQ7A 3T26A 1ETSH 4BAHB 1MKXK 4CRFA 1AGJA 4AX9H 1UHBA 2ZCKP 1TOCB 2FYRA 1O2JA 2BVSH 1TGBA 4Y0YE 3RXOA 3BTTE 2UWOA 3PROA 3PB1E 3MU8A 1QQUA 3QUMP 2ZHDA 2PUXB 3T2NA 4CREA 4M7GA 3A7ZA 3A88A 3SI4H 2G4TA 1LHDH 2A7CA 3QX5H 1THRH 1O2HA 1YPJH 2FOGA 5JB8S 5F6MA 1FMGA 1UTQA 7LPRA 1J9CH 3E8LA 3AW0A 3SNAA 1GBAA 3M5NA 1W12U 5LPEA 3TNSA 1GHZA 1Y5UT 1SVPA 1HNEE 3LGYA 2BQ7B 1MMJN 4WF8A 4DURA 2B9LA 1B7XB 4WY3A 3M7QA 3S69A 2XTTB 4INKA 3RXMA 1IQIA 1DXPA 2Y7XA 3QGJA 3URCA 1RRKA 3SJKA 3SV7A 1Y3UA 1C1PA 1C5XB 1CGJE 5ESTE 2ZCLP 2EA3A 3RXKA 3LGWA 4J2YB 2PHBA 3MH4A 3KQDA 2J38A 3ZVEA 1O2TA 1S6FA 4ZHLU 4D8NA 4MVNA 3SQHE 1YPMH 4BTTB 2GDDA 2F83A 2P93A 1DLEA 4X8TH 4ZXXH 1SHYA 3UR9A 1MAYA 4JZDH 1HV7A 1O3KA 1AE5A 1H8IH 1V2QT 4FU7A 3M36A 5I46H 1QB9A 2JKHA 2O8WA 1MTUA 3U8OH 2WPJS 3SU3A 1BTHH 1DWCH 5DO4H 3RXBA 4BANB 1OOKB 1E34B 1BJUA 1WUNH 3E6PH 1FIWA 2ZNKH 3VFEA 3PLPA 1MTNB 2XCFA 2Y5GA 1L0ZA 7KMEH 1C5TA 1D3PB 1KXEA 4Y0ZE 1QRWA 6CHAC 2XC0A 1HAOH 1SC8U 3OU0A 2DE9A 4CH2B 1YPGH 1AFQB 2B0FA 1N1LA 2FYQA 1QTFA 1GL0E 1KTTB 4MPVA 3NZIA 2V35A 3LJOA 1HAVB 2ZU4A 2G4UA 1GBFA 3NXPA 1GWAA 3LKWA 1LVYA 2XXLA 3AASA 1QQ4A 1C2KA 1EZQA 1BUIA 3IWMA 3MU0A 3CS7A 1S85A 1DITH 2PW8H 5DJ7A 3CENA 2EI6A 1GHBF 1Y3YA 2PKAB 5DP9A 1GHBG 1TNGA 3MO6A 1BTWA 1CU1A 2Z7FE 2H2ZA 1HAVA 2PV9B 5AFZH 5G4BA 2W3KA 1P2NA 2A5IA 3TGIE 4D7GA 1EASA 4FUHA 2BXUH 1GJCB 1TGTA 3B8JA 1S84A 4MNYA 3BSQA 1KLJH 3U98H 3RXUA 1ANCA 4XE4A 3M5LA 1C1WH 4ZMAH 3SGQE 3B9FH 1SGFG 1KDQA 4O97A 3CS0A 1TPOA 4FXGH 1C5OH 4ZKNU 2KAIA 1UVPA 1BJVA 4B74A 2A2QH 3UY9A 1FONA 2A4GA 1L4ZA 4ASHA 1O2GH 2WUCA 3ZZ6A 5BPEA 3ZZBA 5T6GA 4JZFH 2ILNA 5DGJA 1ELBA 1Z1JA 2WPIS 1A5HA 1ZMJA 1ZZZA 2CGAA 1KIGH 1GVLA 3QN7A 3P8FA 4FUCA 4MNXA 1SGFA 1V2VT 5CHAB 3E0NB 3QDZB 1OWEA 4B2BA 1C4Y2 1DWDH 1ESBA 2F9OA 2OBQA 2BYAX 1GJ7B 2BD2A 1Z6JH 4NIVA 1ZJKA 3GCHC 5DPAA 5EXNA 1FPHH 4IS5A 1XUIA 1JXPA 5J4QA 5EOKA 3RC6A 1ANBA 2HPPH 3RU4D 1L2EA 5CMXH 3OX7U 2BY6X 5C20A 2BTCE 1P9UA 3RMLH 4K8YA 1SGNE 1VGCB 2P3TB 4ZROA 1ESTA 1CT0E 3O8DA 4ISNA 4INLA 4K5ZA 3SN8A 2F9NA 1CO7E 3MH5A 1EAIA 4X6NA 3TVJB 1GJ9B 2CJIA 1UK2A 1GJAB 2PGBB 2F3CE 2HWLB 1SOZA 2GVFA 1XVOA 1EAWA 2FDAA 4K1EA 1O5FH 1ETRH 1UJ1A 5FAHA 3DHKH 2H9EH 1PFXC 8GCHF 1WCZA 3MYWA 3EQ0H 4ABAA 3MFJA 2Q6GA 1HB0B 2FMJA 2XWAA 3PYHA 2GZ9A 3RLYH 1Z8GA 1K1PA 1F0SA 1O3NA 4Y8YA 2G5VA 1ARBA 1EB2A 2R9PA 1V2RT 4TY7A 1FN6A 4B71A 2TBSA 3RXIA 2TRMA 1O3JA 3P6ZB 1O33A 2ZQ2A 2A5KA 1QRXA 1YPEH 1UK3A 3T29A 2CHAC 2GV7A 1W3CA 1DE7H 5FXLA 4DG4A 5C1UA 1YC0A 1O31A 3A8AA 5TCCA 3E16B 4I8JA 1TMBH 1GI9B 2J34A 5F03A 4H4FA 1TMUH 2BY8X 3T62A 4AFQA 3ZZ5A 1QY6A 3RXEA 1FDPA 1DS2E 5FHTA 5C3NA 1O3IA 1W2KH 1O2XA 2A4RA 4DVAU 4XOJA 1WV7H 1QB6A 4NZQA 1H9HE 3ZZAA 1BCUH 1UTPA 3DT0H 1BTXA 3ATMA 5A0AE 1O2IA 1IQLA 3ZVGA 1TX7A 2AH4X 5JBCS 3CP7A 2GKVE 4H42U 1SSXA 1O2QA 1JOUB 2OP9A 1TA6A 3QTOH 3I77A 3M5MA 4IN1A 5IDKA 1FPCH 3TJOA 1XX9A 3RXPA 5ESBA 1XUHA 2WV4A 3UPEA 3F9HA 2BDBA 1YLDA 1JMOH 1GI5A 5JB9S 4RKOB 1QNJA 4I8GA 3MNBA 3GDSA 1ELDE 4LXBH 1BTUA 3RXJA 1C2MA 2FX6A 1O2LA 1F2SE 7GCHG 3SGBE 3M7TA 3ODDA 1P06A 4OS5A 1C2LA 2R0KA 4XSKU 2J9NA 3QTVH 4X2XA 1FQ3A 1K9OE 1VR1H 1SGCA 1QL8A 1ARCA 1G3CA 3L3TA 1ZR0A 5HYOA 3VB5A 1ACBE 1HAZB 1Y3WA 2C93B 3MH7A 5FPYA 3SZNA 1THPB 4ZH8A 3SNBA 2AEIH 5EQSA 2YNBA 4CHAB 3JZ1B 3E1XB 2P95A 4IMZA 4Q7XA 4WH6A 3SU2A 2A7HA 4I8KA 1ZHMA 2FEQH 2ZTZA 2CMYA 5JBBS 1YM0A 4MPUA 1VITG 3LU9B 2H5DA 3NUMA 1TB6H 1P3EA 4A92A 2OC1A 1C2FA 1UK4A 1UTLM 4YTAA 2HLCA 2YOLA 1FNIA 5GDSH 3ZVFA 1L1NA 4XDEA 1P2QA 3SHAH 2JETB 2GMTB 2PTCE 1FAXA 1C2DA 3T27A 2BHGA 2LIZA 3P95A 4GAWA 3BG4B 2ZEBA 3AAVA 1TOMH 1GI4A 2BZAA 2BX3A 3VEQB 1OWDA 1IHTH 3VB6A 4TPYA 3GY4A 3QK1A 2H5CA 4FUGA 4Y11E 4I32A 2G81E 5EU8A 4PROA 5EPYA 3SJIA 2NWNA 1BMMH 4AZ2B 3MMGA 1CQQA 3V0XA 1AKSA 2QC2A 2Z3EA 1D4PB 1P2KA 4LOYH 3BN9A 2ZWLH 1EP5A 2RG3A 3F9FA 1TQ0B 3MNXA 1T8NA 4I8HA 1FJSA 3M61U 2G55A 2FTLE 1B0EA 2FWWA 2V6NA 1DXWA 4R0IA 4HZHA 2ASUB 3BF6H 5K7RA 2BLWA 2B8OH 1GHWH 1FLEE 1FY8E 1O3PB 1BA8B 1QRZA 2ZGBH 1CSOE 1M9UA 1NRNH 4WXIA 2F91A 1Q31A 2VIPA 2AGGX 4MTBA 1K1NA 1ZRKA 4Y7BA 3ZZDA 1YCPM 1NU9A 2SNVA 1HJ9A 1SLVB 1QBOA 4AGKA 1DT2A 4AFZA 5JDUB 5DP7A 3T25A 4BAKB 1C5WB 1C9PA 2ZCHP 2F9VA 1NY22 3GYLB 3GCOA 1GDQA 4FUIA 4O9VA 1GBKA 4FVBA 2Y7ZA 1G30B 1NRSH 1GG6C 1O3BA 5LGOA 1KXAA 1OWJA 1QB1A 1SQOA 3GYMA 5FX6A 2G51A 2ODQA 3RU4E 4YZUA 4SGBE 1BBRE 2WV5A 4YT6H 3RP2A 1MUEB 4ABJA 2BLOA 3FZZA 1ELCA 2FXRA 4IN2A 3A81A 1MBQA 2PR3A 3SU1A 4BXSA 3MNSA 4GLYA 4TY6A 1NTPA 2ZDKA 3BTDE 2VU8E 5EXLA 3EDXB 1EQ9A 1MQ5A 4UEHH 5GPIB 2QCYA 2OINA 4AOQA 1ZSKA 3TIUA 3A82A 1C5NH 1ANDA 2BD9A 3P17H 2OLGA 1CBWC 1C9TA 1HAIH 4K69A 2THFB 1EAXA 3SNEA 3KF2A 1MU6B 3PO1C 2G8TA 3M3SA 1UTJA 5K0HA 2BD7A 3LGIA 3EA9A 1XKAC 2ZFTA 1GCTC 4X6MA 3K65B 2ALVA 2Z9GA 2G00A 1BQYA 5E2OA 2BD8A 1ZGVA 2XW9A 1JRTA 4NCYA 1EJMA 3Q00A 2AIQA 2BXTH 3A7VA 5L2ZH 2YNAA 1ELVA 3RXGA 2OD3B 2OUAA 1MKXH 3A89A 4Z0KA 1AWFH 1UHBB 1S5SA 2D2DA 1Y3XA 2VWOA 1GBIA 1QIXB 1TRYA 2PKSB 4XBBA 1P03A 3E91A 1SI5H 2C8WB 3P70B 4B75A 1OWHA 1Z7KA 2ZU1A 3GICB 4OS1A 2FOCA 1ID5H 1V2KT 1SBWA 2BB4A 3DUXH 2AGIX 4NWKA 2BDCA 1MCTA 4E7NA 3F68H 2OBOA 3EAJA 4MQAA 1O3OA 1C5SA 1MH0A 1YPKH 1EZSC 2D8WA 1E38B 4DOQA 4A1XA 5HM9A 1O38A 4DT7B 1MCVA 1ANEA 4Y8XA 3MU5A 1AUJA 1B5GH 1HXFH 1FN8A 1ZHPA 1HGTH 2FPZA 1W8BH 3ELAH 3JZ2B 3M5OA 4OS7A 1W10U 4IGDA 3P8NA 1D6RA 5JYIA 1TONA 1GBHA 2BY9X 3SO3A 1P01A 4BTIB 3UNSA 2Z9LA 5GWZA 1SLXB 1AWHB 1GJBB 1G3BA 3UR6A 3GDVA 1UCYK 1FY5A 1IHSH 2NU2E 3RUOA 1WU1A 1KSNA 1W14U 1CA0C 1CT4E 1J16A 1O2RA 4ZHAA 3S7HB 6ESTA 2ZZUH 1IAUA 2Y82A 3HK6B 2ZHFH 4WMDA 3A80A 1JBUH 3LGTA 1D3TB 1LVOA 1GJ5H 4X8VH 2EI7A 2VGCC 4ESTE 1MZAA 2O8TA 3Q3YA 3LC3A 1HXEH 1X7AC 3GCHB 1WTGH 4IMQA 4MPWA 2OC7A 3A84A 4DY7B 3R0FA 2FOEA 4U32A 1T4UH 3SUFA 1O3EA 2IOTA 1K1IA 2ZGCA 1GBLA 8ESTE 2PUQH 5PTPA 2BVXH 2ZHWH 3HGPA 1EPTC 2VWNA 4ISIH 4D7FA 1AN1E 1O2MA 2ZFFH 4GUXA 1G9IE 1O39A 3VB4A 1SGEE 2BD5A 4HGCA 2JH6D 3SJ9A 5C1XA 4X2VA 1XUJA 3RLWH 2ZF0H 2J4IA 1BRAA 2TGAA 2QA9E 2B5TB 2A31A 1TABE 4WJG2 3RC4A 1YP9A 1SOTA 1ZHRA 1CGHA 1NRQH 1CA8B 1DWEH 3SNCA 1DUEA 2FP7B 1AUTC 1K1OA 5AFYH 1CHOF 3Q3KA 1O2PA 1CHOG 3V12A 1G36A 1SLWB 1TFXA 4JYTA 3PMBB 1TNJA 3H5CB 4ZHMU 1N8OB 1TNIA 1YLCA 2XBYA 3QWCH 3NWUA 1NO9H 1NPMA 1FI8A 1VITH 2FM2A 1TGNA 2XNIA 1T7CA 2BOKA 3SUEA 2VJ1A 2BQ6B 2HNTC 1HAYB 1IOEA 4MNWA 2QY0B 1AVWA 2K1QA 1C2GA 1IQKA 1H9IE 3FAOA 4UFEH 1QA7A 2WPHS 1VCWA 3SU5A 1P2MA 3SNDA 2FTMA 2G52A 1KDQB 3BTQE 2P16A 1Q3XA 4VGCC 3ZZ4A 2VB0A 3UTUH 5JBAS 1RIWB 1UCYE 2KAIB 2QGRA 3ZZ3A 2SFAA 4B2AA 1FXYA 2VIQA 4JZEH 2VIWA 1RFNA 3NKKA 2VIDA 2GV6A 1BB0B 4X8UH 3SJOA 3UOUA 1AB9B 3L33A 1PPGE 1WYKA 1V2PT 1JIRA 1ZTKA 1H9LB 2PGQB 3MTYA 6GCHF 1HJ8A 4OGYA 3S9CA 6GCHG 3WY8A 1V2NT 3TJVA 2GT8A 1YCPH 1SGQE 1A5IA 2PFEA 1C1RA 1WQVH 2WPKS 4AYVB 1ZPZA 1YYY1 1C5UA 1SG8B 1GDNA 1EJAA 2FI5E 2ODPA 4YOIA 1ABJH 1LHGH 5EW2H 1TGSZ 3PLBA 2XRCA 3TH4H 1LDTT 3SV6A 3SORA 1QGFA 3QLPH 2P94A 2ZI2H 5FCRA 4XBCA 2PLXA 1UTMA 4AG1A 1EATA 1YCPK 2GX4A 1PPZA 1E35B 4LZ1H 1GDUA 3D49H 1O0DH 3VB3A 2FI4E 1C1MA 1HRTH 1ZTLA 3RMMH 4ISHH 2VNTA 1P12E 2QXJA 1SGRE 2ZTYA 2CXVA 3LT3A 2V3HH 1HIAA 4BOHA 5EW1H 2ZGJA 1Y3VA 1ZMLA 1RD3B 3A7WA 3FVFB 4KGAA 5FBEA 4A1TA 1OSSA 1UTOA 1V2ST 2Y81A 3QO6A 1NESE 2ZDVH 3GY2A 5AVDA 4ABDA 1N6XA 4NA8A 3LIWA 1SGTA 1ABIH 1WTHD 2ZHEH 4Y10E 1LVBA 2TIOA 2W5EA 4INHA 4Y7AA 1K1MA 1E37B 3S7KB 1O2WA 1BMLA 4TWYA 3ZVDA 3P8OA 4A7IB 4AB8A 1CGIE 4OGXA 4ABFA 3KCGH 3OSYA 4GPGA 3RMNH 2BX4A 3E3TA 3SW2B 5C2ZA 3UNRA 2Q1JA 5L30H 2R2WU 4A6LA 1YBWA 2NU4E 2FOHA 1SPJA 3NPSA 3HPTB 4KTUA 9LPRA 8GCHG 3MHWU 2XYAA 1O37A 2ZG0H 3TLOA 3UREA 1C2IA 1BRCE 1C4V2 1OS8A 4ISOA 3C27B 5DP6A 2OC8A 2NU0E 1DPOA 3PV4A 1AMHA 4UE7H 1MD8A 1P3CA 1DVAH 1AI8H 1HUTH 3FFGA 1OP2A 1O2YA 1J8AA 4F4OC 4K1TA 2ANMH 1A5GH 2P59A 1HAGE 3ODFA 4NIYA 4BNRA 1O3HA 4Q2KA 2VWMA 2WYGA 3BTFE 1RTFB 3MOCA 3G01A 2SGEE 3LOXA 3R3GB 4WXVA 1FY3A 4MNVA 3RXTA 2VVUA 2TPIZ 1YPHC 1Z1IA 1KXDA 1DOJA 1DLKB 1O3FA 4O3UA 1VCPA 2DUCA 1O3GA 1SQAA 3Q3XA 7ESTE 1P11E 1TX8A 3TITA 5GJ4B 2Y5HA 4ABEA 1FAKH 1BHXF 1BIOA 1GHVH 4GSOA 2GZ8A 2CV3A 5B6OA 1AE8H 1GHAF 3B23B 4ABBA 1AO5A 1GHAG 4JZIA 5A0BA 1HAPH 1GI0A 4RSPA 3U1JB 5IYTA 1QJ6B 2FOFA 4YT7H 3PLKA 1GJDB 1P02A 2A45B 2ZKSA 2HRVA 1BTPA 3OTJE 5FCKA 1QA0A 2CN0H 2ZC9H 2XBWA 3TGJE 2BDGA 3GY6A 1SL3A 4U2WA 3RXLA 1GGDB 1GG6B 2Y6TA 2QXGA 3GY8A 3PTNA 4H6SB 1OYQA 2GCTB 2R0LA 1P0SH 2WUBA 1CVWH 2A7JA 3RXFA 1F0UA 2ZECA 3UWJH 3LDXH 3RXHA 1D3QB 3IITA 2WINI 4X1PU 3BEIB 4YESB 1BZXE 1OWIA 4CRGA 1JRSA 1O2UA 1F7ZA 4CRBA 3A8DA 2ZO3H 4D9QA 4Q7ZA 3VXFH 5EQQA 1RJXB 4CBNA 5AHGH 1SMFE 1WQSA 2VVVA 1C5VA 1H1BA 3UUZA 3KQBA 4B2CA 4A1VA 1GCTB 3KQEA 5DP8A 3RXDA 2SGFE 1INCA 3FP6E 1QR3E 2ZDAH 1BBRK 2RA3A 3M7UA 2ZP0H 2ZFQH 5F8XA 4ZAEA 4FU9A 1AFEH 1SLUB 1MBMA 1GI7B 4ZKOU 1AKSB 1SR5C 3TJNA 1O36A 1GBCA 2QYIA 4SGAE 1TPPA 1V2JT 2QV1A 3PTBA 1UVTH 9ESTA 3W94A 3TH2H 2QAAA 2FOBA 1DSUA 1FZZA 4UFGH 1KXFA 3OYPA 1GMCF 4RKJB 1V2OT 1AD8H 1GMCG 1BTZA 1YF4A 1TBZH 3HKJB 2FLRH 2OXSA 2HNTE 1H4WA 1SFQB 3EGKH 1DANH 2A4OA 1C2HA 2FOMB 5C1YA 3RC5A 1GBJA 1H8DH 4LZ4B 2A2XH 1N6YA 1A0LA 1EKBB 2FS9A 1K28D 1C1QA 1P09A 2P8OC 4JYUH 3Q76A 1AIXH 1DWBH 2C8ZB 1D3DB 3RXRA 2Z3CA 1MQ6A 1Y59T 3EE0B 4ZKSU 2BDYA 1Y8TA 1G32B 4CRDA 2CF8H 2VH6A 1IQHA 2FX4A 1BTYA 1YPLH 4B76A 4ABHA 2ZGXH 1GVZA 2Z9JA 4KKDA 3S9BA 2XC4A 3UIRA 1T8LA 2RDLA 4BAQB 4B1TA 1V2TT 1QBNA 2OTVA 4JYVH 4R8TB 5EG4A 1GI2A 1CA0B 1HPGA 2ODYB 2A0QB 3U9AH 2O8UA 1ESAA 1V2LT 2VINA 3P8GA 4I33A 5DG6A 4IC5A 2SGDE 1LCYA 3GDUA 2RCEA 2Y5FA 3PMAB 5HMAA 2I6SA 1TYNA 3F9GA 1MZDA 3RXCA 2W7UA 1O30A 4OS2A 3I78A 1C2JA 3DFLA 1GHYH 1MTVA 1TALA 1LKAA 3GCNA 3GCTF 1GBBA 1UVUH 2OC0A 2WPMS 3GCTG 3RXAA 1LPGB 3VXEH 3KIDU 1TNHA 5EODA 2A5AA 2J94A 5EXMA 1T8OA 1WAYB 2ZGHA 1V2MT 2ZDLA 3SI3H 1SGYE 1G3EA 1P04A 2QXHA 2ULLA 5GIBA 1FIZA 3A8BA 3TH3H 4UDWH 3S9AA 1ELFA 1KLIH 1CHGA 1PQ8A 1J14A 1O5GH 1RGQA 3ZVCA 1KY9A 3IG6B 3RXVA 3TK5A 3VGCC 2SGQE 1OKXA 3BTHE 1C5PA 3W95A 4DIIH 5C5NA 1ZSJA 1GPZA 6CHAB 1WOFA 6LPRA 3ATWA 1E36B 3ZZCA 3GISB 1NS3A 2STAE 4UD9H 2H1UA 3E90B 5E8EH 2WYJA 1EPTA 2PTNA 1MKWH 1QJ7B 2RA0A 3C1KA 4DGJA 3ESTA 2Q6FA 1HCGA 1KYNA 5HM2A 5DP5A 4X1RU 4WMFA 8KME2 1HJAC 3RU4T 2HNTF 1NRPH 2OQ5A 5A09A 5E2PA 1NU7B 2ZFPH 1VCQA 5LPFA 2AERH 2AS9A 2PSXA 1AU8A 1MKWK 5JBTA 3GY7A 2JETC 1NRRH 4NIXA 3A85A 1W11U 1ZPCA 3RMOH 4Z6AH 3LGUA 4VGCB 3D65E 4IBLH 2UUJB 2HGTH 1C5MD 1AHTH 2ZU3A 3AAUA 1SGDE 5T6FA 2DE8A 2VWLA 5CE1A 4E05H 4YOGA 4K8BA 1AVGH 5DP4A 4MG3A 1C1NA 1S0QA 2GT7A 2BZ6H 1UCYH 2BQWB 4TYDA 3BEUA 5F8TA 1QBVH 1WBGB 3ZZ9A 3KN2A 1TAWA 1DY8A 2JH0D 3H7OA 1O3LA 3NCLA 2QN5T 1KLTA 1PQAA 1LQDB 2AMDA 1VZQH 3LH1A 4D9RA 1QJ1B 1W0ZU 2AGEX 1O5DH 2FS8A 1UMAH 5DKMA 3A86A 5EPNA 2C8YB 1YPHE 4NA9H 1BMNH 1J17T 1BITA 3PMHB 1Y5BT 2AIPA 4NSVA 3V13A 4A5TS 5L6NH 1ZRBA 4HI3A 4J1YA 1ZMNA 3UOPA 4YLUA 4K1SA 1ZPBA 3BTKE 4IW4E 1GBEA 5DP3A 1MU8B 2C4FH 2V0BA 1CE5A 5SGAE 4THNH 3O8CA 3BV9B 1HAHH 1DM4B 1MD7A 3MNCA 4Q80A 3V7TA 1QFKH 2M5TA 1J15A 1C1OA 2I6QA 1HYLA 1K2I1 1B0FA 4KP0A 3TK9A 1PJPA 4X1QU 1Z8RA 3DA9B 2R3UA 1OP0A 1TE0A 4F49A 1S0RA 2C90B 2OQUA 2ZU5A 1W0YH 2IPHA 4KTCA 4O03A 3SU0A 4JMYA 3EA7A 1TRMA 2ZTXA 1T4VH 1P57B 3ZVAA 3M3VA 1DX5M 2Y80A 3TK6A 3EA8A 3QZQA 4ISLA 1ELGA 1PPEE 1S82A 3MWIU 4FUDA 4AN7A 3O8BA 1BRBE 1GMHF 3T5FH 1XMNB 2FI3E 1GMHG 1A7SA 1C4U2 1TNLA 2K7XA 1SGIB 3KNXA 1TRNA 3SJ8A 4DCDA 1IQFA 4ZKRU 1EXFA 2VIOA 3TPIZ 3TNTA 1ELAA 1QURH 1PPHE 1P2OA 2AYWA 1A3EH 4IC6A 1GI6A 1GI1A 1G3DA 3VB7A 4E06H 4WWYA 4X1NU 4RN6A 3K9XB 2ZFRH 1V3XA 2H9HA 3ZYEA 1C5LH 1NROH 2Q6DA 3P92A 2GZ7A 1EX3A 2WPLS 1XXDA 4WMEA 2BLVA 3ATKA 2BY7X 2CHAB 4NFEA 3ITIA 2QF3A 3AW1A 1EAUA 5TCAA 4K3JA 1O2KA 2XBXA 1RS0A 3FANA 1Q2WA 1ZJDA 1E0FD 2BM2A 2PKSC 1TPSA 2O8LA 4U30A 1A0JA 3FZDA 2BD3A 3S0NA 3UFAA 3ATIA 3PMJA 1GVKB 1LHEH 1DDJA 3I29A 2FO9A 1DY9A 1D6WA 1PPFE 4Q7YA 5TJXA 1O3CA 4YO9A 1W7GH 4XFQA 1F5RA 1Z8IB 1GBMA 1O5CB 1O35A 1C5QA 1LPKB 2ZDMA 3A87A 2O8MA 1HFDA 4UFFH 1AY6H 1UVOA 4AORA 1BRUP 4YOJA 1ORFA 1LTOA 2B7DH 1ZLRA 1K1LA 1BOQA 4HFPB 1ELTA 1HIAB 1UO6A 3ENSB 3A7YA 2W3IA 2PKAA 1VJAU 5F8ZA 3F9EA 2GCHF 2UUKB 3BIVH 4QT8C 2Z3DA 5J4SA 2PSYA 2GCHG 3TJUA 3PM3A 3OY5U 1A0HB 5I25A 3TGKE 4AGJA 3U69H 3KEEA 2PWXA 1BMAA 2FOAA 3EBNA 1XUGA 1HBTH 1SQTA 2ZA5A 5HGGA 3RDZA 3SU6A 1LPZB 1L1JA 3N7OA 4NZLA 5FBIA 3STJA 1JWTA 5EQRA 3MU1A 3T28A 2H9TH 1FV9A 3BTEE 4GVUA 2R3YA 3SV8A 4B73A 2STBE 4FUFA 1XKBC 1K22H 1SGPE 2HPQH 2F9BH 1GBTA 1A2CH 3A7XA 4UONA 1LQEA 3BTWE 2TGPZ 3SGAE 1C5ZB 1NFUA 2NU3E 3BEFB 5HXFA 2F9PA 1O3MA 4JK5A 5T3HA 2Z94A 3SV9A 4BTUB 1F0RA 1ZSLA 4I8LA 4DIHH 3MO9A 4XBDA 2UWPA 3URDA 5GXPA 2W7SA 2P3UB 1AQ7A 2V3OH 5ETXA 3ZV9A 3D23A 2XWBI 4BXWA 3QGNB 1FUJA 1U6QA 1OXGA 5FX5A 2XBVA 4NGAH 1O5EH 1ETTH 3GOVB 1A1RA 1TBQH 1V2WT 1TNKA 1AZ8A 1TLDA 5AF9H 1MTNC 1TIOA 2P3FH 1ZTJA 2SGPE 1AVXA 4X0WU 3LGVA 2CF9H 1XXFA 3L6PA 1DICA 1IQEA 1O5BB 1GI8B 1LHCH 4NG9H 1OX1A 1OYTH 2J2UA 4OS4A 4YM9A 3GY5A 1AFQC 1GCDA 1GHXH 1IQNA 1O3AA 5A0CA 2ZQ1A 1C2EA 1Z71A 2A1DB 1F0TA 4X6PA 1NN6A 1UTNA 1IQJA 1TA2A 2QF0A 1N8OC 1K1JA 2ANYA 1MTWA 2AMPA 1C5RA 2P8OB 2H6MA 1AZZA 3SQEE 1SB1H 2JH5D 1RXPA 1SHHB 2TGDA 4AFUA 1C5YB 3K6YA 3A7TA 1KXCA 2ALPA 1O2OA 4MPXA 3OY6U 4CH8B 3STIA 4GCHF 1EJNA 3BG8A 1PPBH 4JZ1A 4GCHG 2Z9IA 1L4DA 2ZIQH 1EP6A 1RIWC 2ZDNA 4X1SU 1HLTH 2FIRH 3RM2H 2UUYA 3U1IB 1A4WH 1PYTC 1Z6EA 1BHXB 1EOLA 1TWXB 3UQOA 1LVMA 2SNWA 1AB9C 1F92A 3H7TA 2BDAA 3NK8A 3EYDA 1T32A 1TGCA 2EC9H 5E0JA 2FODA 2FESH 3TU7H 1P9SA 1IQGA 1ZOMA 1V6DA 2ANKH 2LPRA 4FUEA 3ZV8A 1NM6A 1PYTD 4X8SH 4YLQH 3U8RH 1FY1A 2F9UA 3SOSA 1T8MA 4Y76A 1P2IA 1O3DA 5GCHF 1C1TA 4BAMB 1QHRB 4Y6DA 5GCHG 3LPRA 5E0GA 4AFSA 1TMTH 1F5LA 2ZFSA 1GJ6A 4TWWA 5H4IB 1O32A 3F6UH 2NU1E 4DW2U 1NZQH 2FZZA 1OPHB 3ZVBA 3BTME 4HTCH 2R2MB 5CHAC 1FY4A 3BTGE 2HOBA 2C8XB 1BBRH 5A8YA 1EZUC 1DFPA 7GCHF 1D9IA 1K21H 5FPTA 3MO3A 1CBWB 4E7RG 1XVMA 2HVXA 1C1VH 3KQCA 5C67A 3DFJA 3PO1B 2GTBA 5ABWA 3VGCB 1NC6A 5JPMH 1DUAA 2Z9KA 2G5NA 3A83A 2TGTA 3HKIB 1XUKA 2EEKA 1DSTA 4I7YH 2A32A 3A8CA 1GL1A 2AMQA 1P05A 3F1SB 1VGCC 3RM0H 2D26C 3RXQA 1KTSB 2UWLA 3M35A 3AVZA 1QCPA 3LH3A 3Q77A 1VITF 1HJAB 2GDEH 3RXSA 1RTKA 3UNQA 4Y8ZA
chains in the Genus database with same CATH superfamily
5A8ZA 1ZGIA 2VH0A 1NFYA 2J92A 4MLFB 1EUFA 2BMGB 4Y71A 2C3SA 2LNCA 5A8XA 3FP8E 4ABIA 1LO6A 1TQ7B 1UVSH 3SV2H 5EJ1A 2BDIA 2PP6A 2SGAA 1C1SA 1S83A 1XUFA 3UQVA 2QXIA 1O2ZA 3DD2H 1V2UT 2ZHQH 4X2WA 2ZPQA 1OP8A 2IN2A 2ANWA 3HATH 2D1JA 5T6DA 3SU4A 4GHQA 1G37A 1YGCH 4X2YA 4CBOA 1G2LA 1P10A 1UTKA 3VPKA 3HGNA 4X6OA 5HIZA 1NFXA 4AG2A 4LK4A 2K8IA 4NFFA 1ELEE 1TX6A 1RTLA 2ZPSA 4BAOB 3M3TA 2KZ4A 2BLQA 2GP9B 4WH8A 1GJ8B 1PPCE 1BT7A 2XCNA 3K2UA 3SHCH 3FP7E 2BD4A 4ASUD 2BOHB 1EOJA 2KFWA 1A3BH 4GHTA 1T31A 4ABGA 2VIVA 2W26A 4NA7A 5DK1A 1LHFH 1LKBA 3ZZ7A 1QL7A 2VVCA 1F5KU 2UUFB 2XC5A 1TPAE 5E0HA 2FLBH 1KXBA 1GI3A 3K6ZA 5L2YH 1NFWA 4O3TA 3KL6A 5LH8A 2VGCB 5EJLA 4TPIZ 1IQMA 1Y5AT 4K60A 3SUGA 3GY3A 1L1GA 3PRBA 2GGVB 1E1QD 4OS6A 4NIWA 1O2NA 1S81A 4CR9A 2AFQB 3ZYDA 1XM1A 1W13U 5BRRE 4I31A 4FVDA 2A4QA 4JK6A 1S6HA 4FU8A 4DJZB 4D76A 5FPSA 4KTSA 1MTSA 3HK3B 3PWCA 3ZZ8A 3O8RA 5C5OA 2BVRH 3MI4A 1EPTB 1HAXB 3KGPA 3MU4A 4P02A 3U8TH 1QL9A 4H6TA 3MH6A 4UFDH 1GGDC 2BDHA 3ATLA 4AB9A 2GCTC 1HDTH 2OCVB 3BIUH 1NT1A 5EGMA 4NWLA 3LONA 1GJ4H 4K2YA 1GMDF 2CK3D 3M37A 1A61H 2O9QA 1GMDG 1GBDA 2F4LA 4NSYA 4Y79A 4CRAA 1P2JA 2EI8A 1O34A 1G2MA 2KCOA 1Z8JB 1O2VA 4CRCA 1EB1H 1OWKA 4CHAC 1P8VC 4WVPE 3UWIA 1TBRH 4FUBA 1CT2E 2KCPA 4CR5A 4AYYB 2Z6BD 1VJ9U 1JIMA 2J95A 4U01A 1W0JD 3LJJA 3SUDA 2GD4B 1EZXC 4ZUHA 4FUJA 3N99A 8LPRA 2ESTE 5A2MH 3SBKA 1THSH 3V3MA 4MDSA 1PQ5A 4ZXYH 3KHVA 1YKTA 1O5AB 4JCNA 1MAXA 2ZPRA 3PWBA 3LC5A 2BY5X 2GMTC 2IJOB 3OE7D 2HALA 1ZYOA 1E1RD 4KELA 1W7XH 3D62A 1C1UH 1O2SA 2QIQA 1WSSH 3BG4C 5LPRA 1LMWB 3QZRA 3E0PB 1SFIA 1BDAA 2ZU2A 1A46H 1PQ7A 3T26A 1ETSH 4BAHB 1MKXK 4CRFA 1AGJA 4AX9H 1H8ED 1UHBA 2ZCKP 1TOCB 2FYRA 1O2JA 2BVSH 1TGBA 4Y0YE 3RXOA 3BTTE 2UWOA 3PROA 3PB1E 3MU8A 1QQUA 3QUMP 2ZHDA 2PUXB 4FETA 2J5UA 3T2NA 4CREA 4M7GA 3A7ZA 3A88A 3SI4H 2G4TA 1LHDH 2A7CA 3QX5H 1THRH 1O2HA 1YPJH 2FOGA 5JB8S 2L74A 2W6ID 5F6MA 1FMGA 1UTQA 7LPRA 1J9CH 3E8LA 3AW0A 3SNAA 1GBAA 3M5NA 1W12U 5LPEA 3WW7A 3TNSA 1GHZA 1Y5UT 1SVPA 1HNEE 3LGYA 2BQ7B 1MMJN 4WF8A 4DURA 2B9LA 1B7XB 4WY3A 3M7QA 3S69A 2XTTB 4INKA 3RXMA 1IQIA 1DXPA 2Y7XA 3QGJA 3URCA 1RRKA 3SZEA 3SJKA 3SV7A 1Y3UA 1C1PA 1C5XB 4AC9A 1CGJE 5ESTE 2ZCLP 2EA3A 3RXKA 3LGWA 4J2YB 2PHBA 3MH4A 3KQDA 2J98B 2J38A 3ZVEA 1O2TA 1S6FA 4ZHLU 4D8NA 4MVNA 3SQHE 1YPMH 4BTTB 2GDDA 2F83A 2P93A 1DLEA 4X8TH 4ZXXH 1SHYA 3UR9A 1MAYA 3OFND 4JZDH 1HV7A 1O3KA 1AE5A 2QF4A 1H8IH 1V2QT 4FU7A 3M36A 5I46H 1QB9A 2JKHA 2O8WA 1MTUA 3U8OH 2WPJS 3SU3A 1BTHH 1DWCH 5DO4H 2J98A 3RXBA 4BANB 1OOKB 1E34B 1BJUA 1WUNH 3E6PH 1FIWA 2ZNKH 3VFEA 3PLPA 1MTNB 2XCFA 2Y5GA 5IK2D 1L0ZA 7KMEH 1C5TA 1D3PB 1KXEA 4Y0ZE 1QRWA 6CHAC 2XC0A 1HAOH 1SC8U 3OU0A 2DE9A 4CH2B 1YPGH 1AFQB 2B0FA 1N1LA 2FYQA 1YLNA 1QTFA 1GL0E 1KTTB 4MPVA 3NZIA 2V35A 3LJOA 1HAVB 2ZU4A 2G4UA 1GBFA 3NXPA 1GWAA 3LKWA 1LVYA 2XXLA 3AASA 1QQ4A 5F53A 1C2KA 1EZQA 1BUIA 3IWMA 3MU0A 3CS7A 1S85A 1DITH 2PW8H 5DJ7A 3CENA 2EI6A 1GHBF 1WXRA 1Y3YA 2PKAB 5DP9A 1GHBG 1TNGA 3MO6A 1BTWA 1CU1A 2Z7FE 2H2ZA 1HAVA 2PV9B 5AFZH 5G4BA 1E79D 2W3KA 1P2NA 2A5IA 3TGIE 4D7GA 1EASA 4FUHA 2M2AA 2BXUH 1GJCB 1TGTA 3B8JA 1S84A 4MNYA 3BSQA 1KLJH 3U98H 3RXUA 1ANCA 4XE4A 3M5LA 1C1WH 4ZMAH 3SGQE 3B9FH 1SGFG 1KDQA 4O97A 3CS0A 1TPOA 4FXGH 1C5OH 4ZKNU 2KAIA 1UVPA 1BJVA 4B74A 2A2QH 4XRNA 3UY9A 1FONA 2A4GA 1L4ZA 5T1VA 4ASHA 1O2GH 2WUCA 3ZZ6A 5BPEA 3ZZBA 5T6GA 4JZFH 2ILNA 5DGJA 1ELBA 1Z1JA 2WPIS 1A5HA 3PV2A 1ZMJA 1EFRD 1ZZZA 2CGAA 1KIGH 1GVLA 3QN7A 3P8FA 4FUCA 4MNXA 1SGFA 1V2VT 5CHAB 3E0NB 3QDZB 1OWEA 4B2BA 1C4Y2 1DWDH 1ESBA 2F9OA 2OBQA 2BYAX 1GJ7B 1MABB 2BD2A 1Z6JH 4NIVA 1ZJKA 3GCHC 5DPAA 5EXNA 2YMSC 1FPHH 4IS5A 1XUIA 1JXPA 5J4QA 5EOKA 1NBMD 3RC6A 1ANBA 2HPPH 3RU4D 1L2EA 5CMXH 3OX7U 2BY6X 1COWD 5C20A 2BTCE 1P9UA 3RMLH 4K8YA 4RT0A 1SGNE 1VGCB 2P3TB 4ZROA 1ESTA 1CT0E 3O8DA 4ISNA 4INLA 4K5ZA 3SN8A 2F9NA 1CO7E 3MH5A 1EAIA 4X6NA 3TVJB 1GJ9B 2CJIA 1UK2A 1GJAB 2PGBB 5EJZA 2F3CE 2HWLB 1SOZA 2GVFA 1XVOA 2J97A 1EAWA 2FDAA 4K1EA 1O5FH 1ETRH 1UJ1A 5FAHA 3DHKH 2H9EH 1PFXC 8GCHF 1WCZA 3MYWA 3EQ0H 4ABAA 3MFJA 2Q6GA 1HB0B 2FMJA 2XWAA 3PYHA 2GZ9A 3RLYH 1Z8GA 3H09A 5C0UA 3DSPA 1K1PA 1F0SA 1O3NA 4Y8YA 2G5VA 1ARBA 1EB2A 2R9PA 1V2RT 4TY7A 1FN6A 4B71A 2TBSA 3RXIA 2TRMA 1O3JA 3P6ZB 1O33A 2ZQ2A 2A5KA 1QRXA 1YPEH 1UK3A 3T29A 2CHAC 2GV7A 1W3CA 1DE7H 5FXLA 4DG4A 5C1UA 1YC0A 1O31A 3A8AA 5TCCA 3E16B 4I8JA 1TMBH 1GI9B 2J34A 5F03A 2RFKC 4H4FA 1TMUH 2BY8X 3T62A 5HKKD 4AFQA 3ZZ5A 1QY6A 3RXEA 1FDPA 1DS2E 5FHTA 5C3NA 1O3IA 1W2KH 1O2XA 2A4RA 4DVAU 4XOJA 1WV7H 1QB6A 4NZQA 1H9HE 3ZZAA 1BCUH 1UTPA 3DT0H 1BTXA 3ATMA 5A0AE 1O2IA 1IQLA 3ZVGA 1TX7A 2AH4X 5JBCS 3CP7A 2XOKD 2GKVE 1YWUA 4H42U 1SSXA 2V3MA 1O2QA 5FL7D 1JOUB 2OP9A 1TA6A 3QTOH 3I77A 3M5MA 4IN1A 5IDKA 1FPCH 3TJOA 1XX9A 3F2FA 2KCYA 3RXPA 5ESBA 1XUHA 2WV4A 3UPEA 3F9HA 2BDBA 1YLDA 1JMOH 1GI5A 5JB9S 4RKOB 3MQKC 1QNJA 4I8GA 3MNBA 2KR7A 3GDSA 1ELDE 4LXBH 1BTUA 3RXJA 1C2MA 2FX6A 1O2LA 1F2SE 7GCHG 3SGBE 2WSSD 3M7TA 3ODDA 1P06A 4OS5A 1C2LA 2R0KA 4XSKU 2J9NA 3QTVH 4X2XA 1FQ3A 1K9OE 1VR1H 1SGCA 1QL8A 1ARCA 1G3CA 1YY3A 3L3TA 1ZR0A 5HYOA 3VB5A 1ACBE 1HAZB 1Y3WA 2C93B 3MH7A 5FPYA 3SZNA 1THPB 4ZH8A 4Z1MD 3SNBA 2AEIH 5EQSA 2YNBA 4CHAB 3JZ1B 3E1XB 2P95A 4IMZA 4Q7XA 4WH6A 3SU2A 2A7HA 4I8KA 3KYGA 1ZHMA 2FEQH 2ZTZA 2CMYA 5JBBS 1YM0A 4MPUA 1VITG 3LU9B 4ACAA 2H5DA 3NUMA 1TB6H 1P3EA 4A92A 2OC1A 1C2FA 1UK4A 1UTLM 4YTAA 2HLCA 2YOLA 4F48B 1FNIA 3KYFA 5GDSH 3ZVFA 1L1NA 4XDEA 1P2QA 3SHAH 2JETB 2GMTB 2PTCE 1FAXA 1C2DA 3T27A 2BHGA 2LIZA 3P95A 4GAWA 3BG4B 2ZEBA 3AAVA 1TOMH 1GI4A 2BZAA 2BX3A 3VEQB 1OWDA 2QF5A 1IHTH 3VB6A 3F2HA 4TPYA 3GY4A 3QK1A 2H5CA 4FUGA 4Y11E 4I32A 2G81E 5EU8A 4PROA 5EPYA 3SJIA 2NWNA 1BMMH 4AZ2B 3MMGA 1CQQA 3V0XA 1AKSA 2QC2A 2Z3EA 1D4PB 1P2KA 4LOYH 3BN9A 2ZWLH 1EP5A 2RG3A 3F9FA 1TQ0B 3MNXA 2K0QA 1T8NA 3WWBA 4I8HA 1FJSA 3M61U 2G55A 2FTLE 1B0EA 2FWWA 2IJD1 2V6NA 1DXWA 4R0IA 4HZHA 2ASUB 3BF6H 5K7RA 2BLWA 2B8OH 1GHWH 1FLEE 1FY8E 1O3PB 1BA8B 1QRZA 2ZGBH 1CSOE 1M9UA 1NRNH 4WXIA 2F91A 1Q31A 3DSGA 2VIPA 2AGGX 4MTBA 1K1NA 1ZRKA 4Y7BA 3ZZDA 1YCPM 1NU9A 2SNVA 4B6EA 1HJ9A 1SLVB 1QBOA 4AGKA 1DT2A 4AFZA 5JDUB 5DP7A 3T25A 4BAKB 1C5WB 1C9PA 2ZCHP 2F9VA 3W1EA 1NY22 3GYLB 3GCOA 1GDQA 4FUIA 4O9VA 1GBKA 4FVBA 2Y7ZA 1G30B 1NRSH 1GG6C 1O3BA 1WDIA 5LGOA 1KXAA 1OWJA 1QB1A 1SQOA 3GYMA 5FX6A 1NBME 2G51A 2ODQA 3RU4E 4YZUA 4SGBE 1BBRE 2WV5A 4YT6H 2KM0A 3RP2A 1MUEB 4ABJA 2BLOA 3FZZA 1ELCA 2FXRA 4IN2A 3A81A 1MBQA 2PR3A 3SU1A 4BXSA 3MNSA 4GLYA 4TY6A 1NTPA 2ZDKA 3BTDE 2VU8E 5EXLA 3EDXB 1EQ9A 1MQ5A 4UEHH 5GPIB 2QCYA 2OINA 4AOQA 1ZSKA 3TIUA 3A82A 1C5NH 1ANDA 2BD9A 3P17H 2OLGA 1CBWC 1C9TA 1HAIH 4K69A 2THFB 1EAXA 3SNEA 3KF2A 1MU6B 3PO1C 2G8TA 3M3SA 1UTJA 5K0HA 1SQRA 2BD7A 3LGIA 3EA9A 1XKAC 2ZFTA 1GCTC 4X6MA 3K65B 2ALVA 2Z9GA 2G00A 1BQYA 5E2OA 2BD8A 1ZGVA 2XW9A 1JRTA 4NCYA 1EJMA 3Q00A 2AIQA 2BXTH 3A7VA 5L2ZH 2YNAA 1ELVA 3RXGA 2OD3B 2OUAA 1MKXH 3A89A 4Z0KA 1AWFH 1UHBB 1S5SA 2D2DA 1Y3XA 2VWOA 1GBIA 1QIXB 1TRYA 2PKSB 4XBBA 1P03A 3E91A 1SI5H 2C8WB 3P70B 4B75A 1OWHA 1Z7KA 2ZU1A 3GICB 4OS1A 2FOCA 1ID5H 1V2KT 1SBWA 2BB4A 3DUXH 2AGIX 4NWKA 2BDCA 1MCTA 4E7NA 3F68H 3NRLA 2OBOA 3EAJA 4MQAA 1O3OA 1C5SA 1MH0A 1YPKH 1EZSC 2D8WA 1E38B 4DOQA 4A1XA 5HM9A 1O38A 4DT7B 1MCVA 1ANEA 4Y8XA 3MU5A 1AUJA 1B5GH 1HXFH 1FN8A 1ZHPA 3VG8A 1HGTH 2FPZA 1W8BH 3ELAH 3JZ2B 3M5OA 4OS7A 1W10U 4IGDA 3N7EA 3P8NA 1D6RA 5JYIA 1TONA 1GBHA 2BY9X 3SO3A 1P01A 4BTIB 3UNSA 2Z9LA 5GWZA 1SLXB 1AWHB 1GJBB 1G3BA 3UR6A 3GDVA 1UCYK 1FY5A 1IHSH 2NU2E 3RUOA 1WU1A 1KSNA 1W14U 1CA0C 1CT4E 1J16A 2KX4A 1O2RA 4ZHAA 3S7HB 2VBCA 6ESTA 2ZZUH 1IAUA 2LP6A 2Y82A 3HK6B 2ZHFH 4WMDA 3A80A 1JBUH 3LGTA 1D3TB 3PRDA 1LVOA 2RDEA 1GJ5H 4X8VH 2EI7A 2VGCC 4ESTE 1MZAA 2O8TA 3Q3YA 3LC3A 1HXEH 1X7AC 3GCHB 1WTGH 4IMQA 4MPWA 2OC7A 3A84A 4DY7B 3R0FA 2FOEA 4U32A 1T4UH 3SUFA 1O3EA 2IOTA 1K1IA 2ZGCA 4Q4LA 5KEDA 1GBLA 8ESTE 2PUQH 5PTPA 2BVXH 2ZHWH 3HGPA 1EPTC 2VWNA 4ISIH 4D7FA 1AN1E 1O2MA 2ZFFH 4GUXA 1G9IE 1O39A 3VB4A 1SGEE 2BD5A 4HGCA 2JH6D 3SJ9A 5C1XA 4X2VA 1XUJA 3RLWH 2ZF0H 2J4IA 1BRAA 2TGAA 2QA9E 5HIYA 2B5TB 2A31A 1TABE 4WJG2 3RC4A 1YP9A 1SOTA 1ZHRA 1CGHA 1NRQH 1CA8B 1DWEH 3SNCA 1DUEA 2FP7B 1AUTC 1K1OA 5AFYH 1CHOF 3Q3KA 1O2PA 1CHOG 3V12A 1G36A 1SLWB 1TFXA 4JYTA 3PMBB 1TNJA 3H5CB 4ZHMU 1N8OB 1TNIA 1YLCA 1BMFD 2XBYA 3QWCH 3NWUA 1NO9H 1NPMA 1FI8A 1VITH 2FM2A 1TGNA 2XNIA 1T7CA 2BOKA 3SUEA 2VJ1A 2BQ6B 2HNTC 1HAYB 1IOEA 4MNWA 2QY0B 1AVWA 5EIYA 2K1QA 1C2GA 1IQKA 1H9IE 3FAOA 4UFEH 1QA7A 2WPHS 1VCWA 3SU5A 3F0PA 1P2MA 2EY4C 3SNDA 2FTMA 2G52A 2JJ1D 1KDQB 3BTQE 2P16A 1Q3XA 4VGCC 3ZZ4A 2VB0A 3UTUH 5JBAS 1RIWB 1UCYE 2KAIB 2QGRA 3ZZ3A 2SFAA 4B2AA 1FXYA 2VIQA 4JZEH 2VIWA 1RFNA 3NKKA 2VIDA 2GV6A 1BB0B 4X8UH 3SJOA 4HG6A 3UOUA 1AB9B 3L33A 1PPGE 1WYKA 1V2PT 1JIRA 1ZTKA 1H9LB 2PGQB 3MTYA 6GCHF 1HJ8A 4OGYA 3S9CA 6GCHG 3WY8A 1K0HA 1V2NT 3TJVA 2GT8A 1YCPH 1SGQE 1A5IA 2PFEA 1C1RA 1WQVH 2WPKS 4AYVB 1ZPZA 1YYY1 1C5UA 1SG8B 1GDNA 1EJAA 2FI5E 2ODPA 4YOIA 1ABJH 1LHGH 3OEHD 1TGSZ 5EW2H 3PLBA 2XRCA 3TH4H 1LDTT 3SV6A 3SORA 1QGFA 3QLPH 2P94A 2ZI2H 5FCRA 4XBCA 2PLXA 1UTMA 4AG1A 1EATA 1YCPK 2GX4A 1PPZA 1E35B 4LZ1H 1GDUA 3D49H 5CHBA 1O0DH 3VB3A 2FI4E 1C1MA 1HRTH 1ZTLA 3RMMH 4ISHH 2VNTA 1P12E 2QXJA 1SGRE 3FO8D 2ZTYA 2CXVA 3LT3A 2V3HH 1HIAA 4BOHA 5EW1H 2ZGJA 1Y3VA 1ZMLA 1RD3B 3A7WA 3FVFB 4KGAA 5FBEA 4A1TA 1OSSA 1UTOA 1V2ST 2Y81A 3OEED 3QO6A 1NESE 2ZDVH 3GY2A 5AVDA 4ABDA 1N6XA 4NA8A 3LIWA 1SGTA 1ABIH 1WTHD 2ZHEH 4Y10E 1LVBA 2TIOA 2W5EA 4INHA 4Y7AA 1K1MA 1E37B 2YMSD 3S7KB 1O2WA 1BMLA 4TWYA 3ZVDA 3F3BA 3P8OA 4A7IB 4AB8A 1CGIE 4OGXA 4ABFA 3KCGH 3OSYA 4GPGA 1VKYA 4RT1A 3RMNH 2BX4A 3E3TA 3SW2B 5C2ZA 3UNRA 2Q1JA 3DSOA 5L30H 2R2WU 4A6LA 1YBWA 2NU4E 2FOHA 1SPJA 3NPSA 3HPTB 4KTUA 9LPRA 8GCHG 3MHWU 2XYAA 3FN8A 1O37A 2ZG0H 4Q63A 2OK5A 3TLOA 3UREA 1C2IA 1BRCE 1C4V2 1OS8A 4ISOA 3C27B 5DP6A 2OC8A 2NU0E 1DPOA 3PV4A 1AMHA 4UE7H 1MD8A 1P3CA 1DVAH 3F0OA 1AI8H 1HUTH 3FFGA 1OP2A 1O2YA 1J8AA 4F4OC 4K1TA 2ANMH 1A5GH 2P59A 1HAGE 3ODFA 4NIYA 4BNRA 1O3HA 2L6OA 4Q2KA 2VWMA 2WYGA 3BTFE 1RTFB 3MOCA 3G01A 2SGEE 3LOXA 3R3GB 4WXVA 1FY3A 4MNVA 3RXTA 2VVUA 2TPIZ 1YPHC 1Z1IA 1KXDA 1DOJA 1DLKB 1O3FA 4O3UA 1VCPA 2DUCA 1O3GA 1SQAA 3Q3XA 4FOUC 1P11E 7ESTE 1TX8A 3TITA 5GJ4B 2Y5HA 4ABEA 1FAKH 1BHXF 1BIOA 1GHVH 4GSOA 2GZ8A 2CV3A 5B6OA 1AE8H 1GHAF 3B23B 4ABBA 1AO5A 1GHAG 4JZIA 5A0BA 1HAPH 1GI0A 4RSPA 3U1JB 5IYTA 1QJ6B 2FOFA 4YT7H 3PLKA 1GJDB 1P02A 2A45B 2ZKSA 2HRVA 1BTPA 3OTJE 5FCKA 1QA0A 2CN0H 2ZC9H 2XBWA 2IPQX 3TGJE 2BDGA 3GY6A 4I86A 1SL3A 4U2WA 3RXLA 1GGDB 1GG6B 4F55A 2Y6TA 2QXGA 3GY8A 3PTNA 4H6SB 1OYQA 2GCTB 2R0LA 1P0SH 2WUBA 1CVWH 2A7JA 3RXFA 1F0UA 2ZECA 3UWJH 3LDXH 3RXHA 1D3QB 3IITA 2WINI 4X1PU 3BEIB 4YESB 1BZXE 1OWIA 4CRGA 1JRSA 1O2UA 1F7ZA 4CRBA 3A8DA 2ZO3H 4D9QA 2JJ2D 4Q7ZA 3VXFH 5EQQA 1RJXB 4CBNA 5AHGH 1SMFE 1WQSA 3F2GA 2VVVA 1C5VA 1H1BA 3UUZA 3KQBA 4B2CA 4A1VA 1GCTB 3KQEA 5DP8A 3RXDA 2SGFE 1INCA 3FP6E 1QR3E 2ZDAH 1BBRK 2RA3A 5B6LA 3M7UA 2ZP0H 2ZFQH 5F8XA 4ZAEA 4FU9A 1AFEH 1SLUB 1MBMA 2EQNA 1GI7B 4ZKOU 1AKSB 1SR5C 3TJNA 2WHXA 1O36A 4M9FA 1GBCA 2QYIA 4SGAE 1QZ8A 1TPPA 1V2JT 2QV1A 3PTBA 1UVTH 9ESTA 4TT3D 3W94A 3TH2H 2QAAA 2FOBA 1DSUA 1FZZA 4UFGH 1KXFA 3OYPA 1GMCF 2W6JD 4RKJB 1V2OT 1AD8H 1GMCG 1BTZA 1YF4A 1TBZH 3HKJB 2FLRH 2OXSA 2HNTE 1H4WA 1SFQB 3EGKH 1DANH 2A4OA 1C2HA 2FOMB 5C1YA 3RC5A 1GBJA 1H8DH 4LZ4B 1FX0B 2A2XH 1N6YA 1A0LA 1EKBB 2FS9A 1K28D 5CDFE 1C1QA 1P09A 2P8OC 4JYUH 3Q76A 1AIXH 1DWBH 2C8ZB 1D3DB 5KECA 3RXRA 2Z3CA 1MQ6A 1Y59T 3EE0B 4ZKSU 2BDYA 1Y8TA 1G32B 4CRDA 2CF8H 2VH6A 1IQHA 2FX4A 1BTYA 1YPLH 4B76A 4ABHA 2ZGXH 1GVZA 2Z9JA 4KKDA 3S9BA 2XC4A 3UIRA 1T8LA 2RDLA 4BAQB 4B1TA 1V2TT 1QBNA 2OTVA 4JYVH 4R8TB 4B6FA 5EG4A 1GI2A 1CA0B 1HPGA 2ODYB 2A0QB 3U9AH 2O8UA 1ESAA 1V2LT 2VINA 3P8GA 4I33A 5DG6A 4IC5A 2SGDE 1LCYA 3GDUA 5C94A 2RCEA 2Y5FA 3PMAB 5HMAA 2I6SA 1TYNA 3F9GA 1MZDA 3RXCA 2W7UA 1O30A 4OS2A 3I78A 1C2JA 3DFLA 1GHYH 5C17A 1MTVA 2WZQA 1TALA 2JDID 1LKAA 3GCNA 3GCTF 1GBBA 1UVUH 2OC0A 2WPMS 3GCTG 3RXAA 1LPGB 3VXEH 3KIDU 1TNHA 5EODA 2A5AA 2J94A 5EXMA 1T8OA 1WAYB 2ZGHA 1V2MT 2ZDLA 3SI3H 1SGYE 1G3EA 1P04A 2QXHA 2ULLA 5GIBA 1FIZA 3A8BA 3TH3H 3DCLA 4UDWH 3S9AA 1ELFA 1KLIH 1CHGA 1PQ8A 1J14A 3FOAA 1O5GH 1RGQA 3ZVCA 3OAAD 2LELA 1KY9A 3IG6B 3RXVA 3TK5A 3VGCC 2SGQE 1W0KD 1OKXA 3BTHE 1C5PA 3W95A 4DIIH 5C5NA 1ZSJA 1GPZA 6CHAB 1WOFA 4ACBA 6LPRA 3ATWA 1E36B 3ZZCA 3GISB 1NS3A 2STAE 4UD9H 2H1UA 3E90B 5E8EH 2WYJA 1EPTA 2PTNA 1MKWH 1QJ7B 2RA0A 3C1KA 4DGJA 3ESTA 2Q6FA 1HCGA 1KYNA 3KQ5A 5HM2A 5DP5A 1KMHB 4WMFA 4X1RU 8KME2 1HJAC 3RU4T 2HNTF 1NRPH 2OQ5A 5A09A 5E2PA 1NU7B 2ZFPH 1VCQA 5LPFA 2AERH 2AS9A 2PSXA 1OHHD 1AU8A 1MKWK 5JBTA 3GY7A 2JETC 1NRRH 4NIXA 3A85A 1W11U 1ZPCA 3RMOH 4Z6AH 3LGUA 4VGCB 3D65E 4IBLH 2UUJB 2HGTH 1C5MD 1AHTH 2ZU3A 3AAUA 1SGDE 5T6FA 2DE8A 2VWLA 5CE1A 4E05H 4YOGA 4K8BA 5GNDA 1AVGH 5DP4A 4MG3A 2HVYB 1C1NA 1S0QA 2GT7A 2BZ6H 1UCYH 2BQWB 4TYDA 3BEUA 5F8TA 1QBVH 1WBGB 4TSFD 3ZZ9A 3KN2A 1TAWA 1DY8A 2JH0D 3H7OA 1O3LA 3NCLA 2QN5T 1KLTA 1PQAA 1LQDB 2AMDA 1VZQH 3LH1A 2XNDD 4D9RA 1QJ1B 1W0ZU 2AGEX 1O5DH 2FS8A 1UMAH 5DKMA 3A86A 5EPNA 2C8YB 1YPHE 4NA9H 1BMNH 1J17T 1BITA 3PMHB 1Y5BT 2AIPA 4NSVA 3V13A 4A5TS 5L6NH 1ZRBA 4HI3A 2V7QD 4J1YA 1ZMNA 3UOPA 4YLUA 4K1SA 1ZPBA 3BTKE 4IW4E 1GBEA 5DP3A 1MU8B 2C4FH 2V0BA 1CE5A 4YXWD 5SGAE 4THNH 3O8CA 2AHME 3BV9B 1HAHH 1DM4B 1MD7A 3MNCA 4Q80A 3V7TA 1QFKH 2M5TA 1J15A 1C1OA 2I6QA 1HYLA 1K2I1 1B0FA 4KP0A 3TK9A 1PJPA 4X1QU 1Z8RA 3DA9B 2R3UA 1OP0A 1TE0A 4F49A 1S0RA 2C90B 2OQUA 2YMSB 2ZU5A 1W0YH 2IPHA 4KTCA 4O03A 3SU0A 4JMYA 3EA7A 1TRMA 2ZTXA 1T4VH 1P57B 3ZVAA 3M3VA 3ZIAD 1DX5M 2Y80A 3TK6A 3EA8A 3QZQA 4ISLA 2WV9A 1ELGA 1PPEE 1S82A 1S6LA 3MWIU 4FUDA 4AN7A 3O8BA 1BRBE 1GMHF 3T5FH 1XMNB 2FI3E 1GMHG 1A7SA 1C4U2 1TNLA 3GS9A 2K7XA 1SGIB 3KNXA 1TRNA 3SJ8A 4DCDA 1IQFA 4ZKRU 1EXFA 2VIOA 3TPIZ 3TNTA 1ELAA 1QURH 1PPHE 1P2OA 2AYWA 1A3EH 4IC6A 1GI6A 1GI1A 1G3DA 3VB7A 4E06H 4WWYA 4X1NU 4RN6A 3K9XB 2ZFRH 1V3XA 2H9HA 3ZYEA 1C5LH 1NROH 5C0TA 2Q6DA 3P92A 2GZ7A 1EX3A 2WPLS 1XXDA 4WMEA 2BLVA 3ATKA 4RI0A 2BY7X 2CHAB 4NFEA 3ITIA 2QF3A 3AW1A 4XD7D 4DT4A 1EAUA 5TCAA 4K3JA 1O2KA 2XBXA 1RS0A 3FANA 1Q2WA 1ZJDA 1E0FD 2BM2A 2PKSC 1TPSA 2O8LA 4U30A 1A0JA 3FZDA 2BD3A 3S0NA 3UFAA 3ATIA 3PMJA 1GVKB 1LHEH 1DDJA 3I29A 2FO9A 1DY9A 1D6WA 1PPFE 4Q7YA 5TJXA 1O3CA 4YO9A 1W7GH 4XFQA 1F5RA 1Z8IB 4P00A 5DN6D 1GBMA 1O5CB 1O35A 1C5QA 1LPKB 2ZDMA 3A87A 2O8MA 1HFDA 4UFFH 1AY6H 1UVOA 4AORA 1BRUP 4YOJA 1ORFA 1LTOA 2B7DH 1ZLRA 1K1LA 1BOQA 2WPDD 3N7DA 4HFPB 1ELTA 1HIAB 5DSFA 1UO6A 3ENSB 3A7YA 2W3IA 2PKAA 1VJAU 5F8ZA 3F9EA 2GCHF 2UUKB 3BIVH 4QT8C 2Z3DA 5J4SA 2PSYA 2GCHG 3TJUA 3PM3A 4ZCNA 3OY5U 1A0HB 5I25A 3TGKE 4AGJA 3U69H 3KEEA 2PWXA 1BMAA 2FOAA 2QE7D 3EBNA 1XUGA 1HBTH 1SQTA 2ZA5A 5HGGA 3RDZA 3SU6A 1LPZB 1L1JA 3FKSD 3N7OA 4NZLA 5FBIA 3STJA 1JWTA 5EQRA 3MU1A 3T28A 2H9TH 1FV9A 3BTEE 4GVUA 2R3YA 3PV5A 3SV8A 4B73A 2STBE 4FUFA 1XKBC 1K22H 1SGPE 2HPQH 2F9BH 1GBTA 1A2CH 3A7XA 4UONA 3EE7A 1LQEA 3BTWE 2TGPZ 3SGAE 1C5ZB 1NFUA 2NU3E 3BEFB 5HXFA 2F9PA 3AK5A 1O3MA 4JK5A 5T3HA 2KCAA 2Z94A 3SV9A 4BTUB 1F0RA 1ZSLA 4I8LA 4DIHH 3MO9A 4XBDA 2UWPA 3URDA 2HLDD 5GXPA 2W7SA 2P3UB 1AQ7A 1UW7A 2V3OH 5ETXA 3ZV9A 3D23A 2XWBI 4BXWA 3QGNB 1FUJA 1U6QA 1OXGA 5FX5A 2XBVA 4NGAH 1O5EH 1ETTH 3CNRA 3GOVB 1A1RA 3UB0A 1TBQH 1V2WT 1TNKA 1AZ8A 1TLDA 5AF9H 1MTNC 1TIOA 2P3FH 1ZTJA 2SGPE 1AVXA 4X0WU 3LGVA 2CF9H 1XXFA 3L6PA 1DICA 1IQEA 1O5BB 1GI8B 1LHCH 4NG9H 1OX1A 1OYTH 2J2UA 4OS4A 4YM9A 3GY5A 1AFQC 1GCDA 1GHXH 1IQNA 1O3AA 5A0CA 2ZQ1A 1C2EA 1Z71A 2A1DB 1F0TA 4X6PA 1NN6A 1UTNA 1IQJA 1TA2A 2QF0A 1N8OC 1K1JA 2ANYA 1MTWA 1SKYE 2AMPA 1C5RA 2P8OB 2H6MA 1AZZA 3SQEE 1SB1H 2JH5D 1H8HD 1RXPA 1SHHB 2TGDA 4AFUA 1C5YB 3K6YA 3A7TA 1KXCA 2ALPA 1O2OA 4MPXA 3OY6U 4CH8B 3STIA 4GCHF 1EJNA 3BG8A 1PPBH 2GJGA 4JZ1A 4GCHG 2Z9IA 1L4DA 2ZIQH 1EP6A 1RIWC 2ZDNA 4X1SU 1HLTH 2FIRH 3RM2H 2UUYA 3U1IB 1A4WH 1PYTC 1Z6EA 1BHXB 1EOLA 1TWXB 3UQOA 1LVMA 2SNWA 1AB9C 1F92A 3H7TA 2BDAA 3NK8A 3EYDA 1T32A 1TGCA 2EC9H 5E0JA 2FODA 2FESH 3TU7H 1P9SA 1IQGA 1ZOMA 1V6DA 2ANKH 2LPRA 4FUEA 3ZV8A 1NM6A 1PYTD 4X8SH 4YLQH 3U8RH 1FY1A 2F9UA 3SOSA 1T8MA 4Y76A 1P2IA 1O3DA 5GCHF 1C1TA 4BAMB 1QHRB 4Y6DA 5GCHG 3LPRA 5E0GA 4AFSA 1TMTH 1F5LA 2ZFSA 1GJ6A 4TWWA 5H4IB 1O32A 3OTPA 3F6UH 2NU1E 4DW2U 1NZQH 2FZZA 1OPHB 3ZVBA 3BTME 4HTCH 2R2MB 3WWFA 5CHAC 1FY4A 3BTGE 2HOBA 2C8XB 1BBRH 5A8YA 1EZUC 1DFPA 7GCHF 3UAIC 1D9IA 1K21H 5FPTA 3MO3A 1CBWB 4E7RG 1XVMA 2HVXA 1C1VH 3SYJA 2JIZD 3KQCA 3DFJA 5C67A 3PO1B 3U28C 2GTBA 5ABWA 3VGCB 1NC6A 5JPMH 1DUAA 2Z9KA 2F43B 2G5NA 3A83A 2TGTA 3HKIB 1XUKA 2EEKA 1DSTA 4I7YH 2A32A 3A8CA 4OM9A 1GL1A 2AMQA 1P05A 3F1SB 1VGCC 3RM0H 5KGOA 2D26C 3RXQA 1KTSB 2UWLA 3M35A 3AVZA 1QCPA 3LH3A 3Q77A 1VITF 1HJAB 2GDEH 3RXSA 1RTKA 3UNQA 4Y8ZA
chains in the Genus database with same CATH topology
5A8ZA 1ZGIA 2VH0A 1NFYA 2J92A 4MLFB 1EUFA 2BMGB 4Y71A 2C3SA 2LNCA 5A8XA 3FP8E 4ABIA 1LO6A 1TQ7B 1UVSH 3SV2H 2BDIA 2SGAA 1C1SA 1S83A 1XUFA 3UQVA 2QXIA 1O2ZA 3DD2H 1V2UT 2ZHQH 4X2WA 2ZPQA 1OP8A 2IN2A 2ANWA 3HATH 2D1JA 5T6DA 3SU4A 4GHQA 1G37A 1YGCH 4X2YA 4CBOA 1G2LA 1P10A 1UTKA 3VPKA 3HGNA 4X6OA 1NFXA 4AG2A 4LK4A 4NFFA 1ELEE 1TX6A 1RTLA 2ZPSA 4BAOB 3M3TA 2BLQA 2GP9B 4WH8A 1GJ8B 1PPCE 1BT7A 2XCNA 3K2UA 3SHCH 3FP7E 2BD4A 2BOHB 1EOJA 1A3BH 4GHTA 1T31A 4ABGA 2VIVA 2W26A 4NA7A 5DK1A 1LHFH 1LKBA 3ZZ7A 1QL7A 2VVCA 1F5KU 2UUFB 2XC5A 1TPAE 5E0HA 2FLBH 1KXBA 1GI3A 3K6ZA 5L2YH 1NFWA 4O3TA 3KL6A 5LH8A 2VGCB 4TPIZ 1IQMA 1Y5AT 4K60A 3SUGA 3GY3A 1L1GA 2GGVB 4OS6A 4NIWA 1O2NA 1S81A 4CR9A 2AFQB 3ZYDA 1XM1A 1W13U 5BRRE 4I31A 4FVDA 2A4QA 4JK6A 1S6HA 4FU8A 4DJZB 4D76A 5FPSA 4KTSA 1MTSA 3HK3B 3PWCA 3ZZ8A 3O8RA 5C5OA 2BVRH 3MI4A 1EPTB 1HAXB 3KGPA 3MU4A 3U8TH 1QL9A 4H6TA 3MH6A 4UFDH 1GGDC 2BDHA 3ATLA 4AB9A 2GCTC 1HDTH 2OCVB 3BIUH 1NT1A 5EGMA 4NWLA 3LONA 1GJ4H 4K2YA 1GMDF 3M37A 1A61H 2O9QA 1GMDG 1GBDA 4NSYA 4Y79A 4CRAA 1P2JA 2EI8A 1O34A 1G2MA 1Z8JB 1O2VA 4CRCA 1EB1H 1OWKA 4CHAC 1P8VC 4WVPE 3UWIA 1TBRH 4FUBA 1CT2E 4CR5A 4AYYB 2Z6BD 1VJ9U 1JIMA 2J95A 4U01A 3LJJA 3SUDA 2GD4B 1EZXC 4ZUHA 4FUJA 8LPRA 2ESTE 5A2MH 3SBKA 1THSH 3V3MA 4MDSA 1PQ5A 4ZXYH 3KHVA 1YKTA 1O5AB 4JCNA 1MAXA 2ZPRA 3PWBA 3LC5A 2BY5X 2GMTC 2IJOB 2HALA 1ZYOA 4KELA 1W7XH 3D62A 1C1UH 1O2SA 2QIQA 1WSSH 3BG4C 5LPRA 1LMWB 3QZRA 3E0PB 1SFIA 1BDAA 2ZU2A 1A46H 1PQ7A 3T26A 1ETSH 4BAHB 1MKXK 4CRFA 1AGJA 4AX9H 1UHBA 2ZCKP 1TOCB 2FYRA 1O2JA 2BVSH 1TGBA 4Y0YE 3RXOA 3BTTE 2UWOA 3PROA 3PB1E 3MU8A 1QQUA 3QUMP 2ZHDA 2PUXB 3T2NA 4CREA 4M7GA 3A7ZA 3A88A 3SI4H 2G4TA 1LHDH 2A7CA 3QX5H 1THRH 1O2HA 1YPJH 2FOGA 5JB8S 5F6MA 1FMGA 1UTQA 7LPRA 1J9CH 3E8LA 3AW0A 3SNAA 1GBAA 3M5NA 1W12U 5LPEA 3TNSA 1GHZA 1Y5UT 1SVPA 1HNEE 3LGYA 2BQ7B 1MMJN 4WF8A 4DURA 2B9LA 1B7XB 4WY3A 3M7QA 3S69A 2XTTB 4INKA 3RXMA 1IQIA 1DXPA 2Y7XA 3QGJA 3URCA 1RRKA 3SJKA 3SV7A 1Y3UA 1C1PA 1C5XB 1CGJE 5ESTE 2ZCLP 2EA3A 3RXKA 3LGWA 4J2YB 2PHBA 3MH4A 3KQDA 2J38A 3ZVEA 1O2TA 1S6FA 4ZHLU 4D8NA 4MVNA 3SQHE 1YPMH 4BTTB 2GDDA 2F83A 2P93A 1DLEA 4X8TH 4ZXXH 1SHYA 3UR9A 1MAYA 4JZDH 1HV7A 1O3KA 1AE5A 1H8IH 1V2QT 4FU7A 3M36A 5I46H 1QB9A 2JKHA 2O8WA 1MTUA 3U8OH 2WPJS 3SU3A 1BTHH 1DWCH 5DO4H 3RXBA 4BANB 1OOKB 1E34B 1BJUA 1WUNH 3E6PH 1FIWA 2ZNKH 3VFEA 3PLPA 1MTNB 2XCFA 2Y5GA 1L0ZA 7KMEH 1C5TA 1D3PB 1KXEA 4Y0ZE 1QRWA 6CHAC 2XC0A 1HAOH 1SC8U 3OU0A 2DE9A 4CH2B 1YPGH 1AFQB 2B0FA 1N1LA 2FYQA 1QTFA 1GL0E 1KTTB 4MPVA 3NZIA 2V35A 3LJOA 1HAVB 2ZU4A 2G4UA 1GBFA 3NXPA 1GWAA 3LKWA 1LVYA 2XXLA 3AASA 1QQ4A 1C2KA 1EZQA 1BUIA 3IWMA 3MU0A 3CS7A 1S85A 1DITH 2PW8H 5DJ7A 3CENA 2EI6A 1GHBF 1Y3YA 2PKAB 5DP9A 1GHBG 1TNGA 3MO6A 1BTWA 1CU1A 2Z7FE 2H2ZA 1HAVA 2PV9B 5AFZH 5G4BA 2W3KA 1P2NA 2A5IA 3TGIE 4D7GA 1EASA 4FUHA 2BXUH 1GJCB 1TGTA 3B8JA 1S84A 4MNYA 3BSQA 1KLJH 3U98H 3RXUA 1ANCA 4XE4A 3M5LA 1C1WH 4ZMAH 3SGQE 3B9FH 1SGFG 1KDQA 4O97A 3CS0A 1TPOA 4FXGH 1C5OH 4ZKNU 2KAIA 1UVPA 1BJVA 4B74A 2A2QH 3UY9A 1FONA 2A4GA 1L4ZA 4ASHA 1O2GH 2WUCA 3ZZ6A 5BPEA 3ZZBA 5T6GA 4JZFH 2ILNA 5DGJA 1ELBA 1Z1JA 2WPIS 1A5HA 1ZMJA 1ZZZA 2CGAA 1KIGH 1GVLA 3QN7A 3P8FA 4FUCA 4MNXA 1SGFA 1V2VT 5CHAB 3E0NB 3QDZB 1OWEA 4B2BA 1C4Y2 1DWDH 1ESBA 2F9OA 2OBQA 2BYAX 1GJ7B 2BD2A 1Z6JH 4NIVA 1ZJKA 3GCHC 5DPAA 5EXNA 1FPHH 4IS5A 1XUIA 1JXPA 5J4QA 5EOKA 3RC6A 1ANBA 2HPPH 3RU4D 1L2EA 5CMXH 3OX7U 2BY6X 5C20A 2BTCE 1P9UA 3RMLH 4K8YA 1SGNE 1VGCB 2P3TB 4ZROA 1ESTA 1CT0E 3O8DA 4ISNA 4INLA 4K5ZA 3SN8A 2F9NA 1CO7E 3MH5A 1EAIA 4X6NA 3TVJB 1GJ9B 2CJIA 1UK2A 1GJAB 2PGBB 2F3CE 2HWLB 1SOZA 2GVFA 1XVOA 1EAWA 2FDAA 4K1EA 1O5FH 1ETRH 1UJ1A 5FAHA 3DHKH 2H9EH 1PFXC 8GCHF 1WCZA 3MYWA 3EQ0H 4ABAA 3MFJA 2Q6GA 1HB0B 2FMJA 2XWAA 3PYHA 2GZ9A 3RLYH 1Z8GA 1K1PA 1F0SA 1O3NA 4Y8YA 2G5VA 1ARBA 1EB2A 2R9PA 1V2RT 4TY7A 1FN6A 4B71A 2TBSA 3RXIA 2TRMA 1O3JA 3P6ZB 1O33A 2ZQ2A 2A5KA 1QRXA 1YPEH 1UK3A 3T29A 2CHAC 2GV7A 1W3CA 1DE7H 5FXLA 4DG4A 5C1UA 1YC0A 1O31A 3A8AA 5TCCA 3E16B 4I8JA 1TMBH 1GI9B 2J34A 5F03A 4H4FA 1TMUH 2BY8X 3T62A 4AFQA 3ZZ5A 1QY6A 3RXEA 1FDPA 1DS2E 5FHTA 5C3NA 1O3IA 1W2KH 1O2XA 2A4RA 4DVAU 4XOJA 1WV7H 1QB6A 4NZQA 1H9HE 3ZZAA 1BCUH 1UTPA 3DT0H 1BTXA 3ATMA 5A0AE 1O2IA 1IQLA 3ZVGA 1TX7A 2AH4X 5JBCS 3CP7A 2GKVE 4H42U 1SSXA 1O2QA 1JOUB 2OP9A 1TA6A 3QTOH 3I77A 3M5MA 4IN1A 5IDKA 1FPCH 3TJOA 1XX9A 3RXPA 5ESBA 1XUHA 2WV4A 3UPEA 3F9HA 2BDBA 1YLDA 1JMOH 1GI5A 5JB9S 4RKOB 1QNJA 4I8GA 3MNBA 3GDSA 1ELDE 4LXBH 1BTUA 3RXJA 1C2MA 2FX6A 1O2LA 1F2SE 7GCHG 3SGBE 3M7TA 3ODDA 1P06A 4OS5A 1C2LA 2R0KA 4XSKU 2J9NA 3QTVH 4X2XA 1FQ3A 1K9OE 1VR1H 1SGCA 1QL8A 1ARCA 1G3CA 3L3TA 1ZR0A 5HYOA 3VB5A 1ACBE 1HAZB 1Y3WA 2C93B 3MH7A 5FPYA 3SZNA 1THPB 4ZH8A 3SNBA 2AEIH 5EQSA 2YNBA 4CHAB 3JZ1B 3E1XB 2P95A 4IMZA 4Q7XA 4WH6A 3SU2A 2A7HA 4I8KA 1ZHMA 2FEQH 2ZTZA 2CMYA 5JBBS 1YM0A 4MPUA 1VITG 3LU9B 2H5DA 3NUMA 1TB6H 1P3EA 4A92A 2OC1A 1C2FA 1UK4A 1UTLM 4YTAA 2HLCA 2YOLA 1FNIA 5GDSH 3ZVFA 1L1NA 4XDEA 1P2QA 3SHAH 2JETB 2GMTB 2PTCE 1FAXA 1C2DA 3T27A 2BHGA 2LIZA 3P95A 4GAWA 3BG4B 2ZEBA 3AAVA 1TOMH 1GI4A 2BZAA 2BX3A 3VEQB 1OWDA 1IHTH 3VB6A 4TPYA 3GY4A 3QK1A 2H5CA 4FUGA 4Y11E 4I32A 2G81E 5EU8A 4PROA 5EPYA 3SJIA 2NWNA 1BMMH 4AZ2B 3MMGA 1CQQA 3V0XA 1AKSA 2QC2A 2Z3EA 1D4PB 1P2KA 4LOYH 3BN9A 2ZWLH 1EP5A 2RG3A 3F9FA 1TQ0B 3MNXA 1T8NA 4I8HA 1FJSA 3M61U 2G55A 2FTLE 1B0EA 2FWWA 2V6NA 1DXWA 4R0IA 4HZHA 2ASUB 3BF6H 5K7RA 2BLWA 2B8OH 1GHWH 1FLEE 1FY8E 1O3PB 1BA8B 1QRZA 2ZGBH 1CSOE 1M9UA 1NRNH 4WXIA 2F91A 1Q31A 2VIPA 2AGGX 4MTBA 1K1NA 1ZRKA 4Y7BA 3ZZDA 1YCPM 1NU9A 2SNVA 1HJ9A 1SLVB 1QBOA 4AGKA 1DT2A 4AFZA 5JDUB 5DP7A 3T25A 4BAKB 1C5WB 1C9PA 2ZCHP 2F9VA 1NY22 3GYLB 3GCOA 1GDQA 4FUIA 4O9VA 1GBKA 4FVBA 2Y7ZA 1G30B 1NRSH 1GG6C 1O3BA 5LGOA 1KXAA 1OWJA 1QB1A 1SQOA 3GYMA 5FX6A 2G51A 2ODQA 3RU4E 4YZUA 4SGBE 1BBRE 2WV5A 4YT6H 3RP2A 1MUEB 4ABJA 2BLOA 3FZZA 1ELCA 2FXRA 4IN2A 3A81A 1MBQA 2PR3A 3SU1A 4BXSA 3MNSA 4GLYA 4TY6A 1NTPA 2ZDKA 3BTDE 2VU8E 5EXLA 3EDXB 1EQ9A 1MQ5A 4UEHH 5GPIB 2QCYA 2OINA 4AOQA 1ZSKA 3TIUA 3A82A 1C5NH 1ANDA 2BD9A 3P17H 2OLGA 1CBWC 1C9TA 1HAIH 4K69A 2THFB 1EAXA 3SNEA 3KF2A 1MU6B 3PO1C 2G8TA 3M3SA 1UTJA 5K0HA 2BD7A 3LGIA 3EA9A 1XKAC 2ZFTA 1GCTC 4X6MA 3K65B 2ALVA 2Z9GA 2G00A 1BQYA 5E2OA 2BD8A 1ZGVA 2XW9A 1JRTA 4NCYA 1EJMA 3Q00A 2AIQA 2BXTH 3A7VA 5L2ZH 2YNAA 1ELVA 3RXGA 2OD3B 2OUAA 1MKXH 3A89A 4Z0KA 1AWFH 1UHBB 1S5SA 2D2DA 1Y3XA 2VWOA 1GBIA 1QIXB 1TRYA 2PKSB 4XBBA 1P03A 3E91A 1SI5H 2C8WB 3P70B 4B75A 1OWHA 1Z7KA 2ZU1A 3GICB 4OS1A 2FOCA 1ID5H 1V2KT 1SBWA 2BB4A 3DUXH 2AGIX 4NWKA 2BDCA 1MCTA 4E7NA 3F68H 2OBOA 3EAJA 4MQAA 1O3OA 1C5SA 1MH0A 1YPKH 1EZSC 2D8WA 1E38B 4DOQA 4A1XA 5HM9A 1O38A 4DT7B 1MCVA 1ANEA 4Y8XA 3MU5A 1AUJA 1B5GH 1HXFH 1FN8A 1ZHPA 1HGTH 2FPZA 1W8BH 3ELAH 3JZ2B 3M5OA 4OS7A 1W10U 4IGDA 3P8NA 1D6RA 5JYIA 1TONA 1GBHA 2BY9X 3SO3A 1P01A 4BTIB 3UNSA 2Z9LA 5GWZA 1SLXB 1AWHB 1GJBB 1G3BA 3UR6A 3GDVA 1UCYK 1FY5A 1IHSH 2NU2E 3RUOA 1WU1A 1KSNA 1W14U 1CA0C 1CT4E 1J16A 1O2RA 4ZHAA 3S7HB 6ESTA 2ZZUH 1IAUA 2Y82A 3HK6B 2ZHFH 4WMDA 3A80A 1JBUH 3LGTA 1D3TB 1LVOA 1GJ5H 4X8VH 2EI7A 2VGCC 4ESTE 1MZAA 2O8TA 3Q3YA 3LC3A 1HXEH 1X7AC 3GCHB 1WTGH 4IMQA 4MPWA 2OC7A 3A84A 4DY7B 3R0FA 2FOEA 4U32A 1T4UH 3SUFA 1O3EA 2IOTA 1K1IA 2ZGCA 1GBLA 8ESTE 2PUQH 5PTPA 2BVXH 2ZHWH 3HGPA 1EPTC 2VWNA 4ISIH 4D7FA 1AN1E 1O2MA 2ZFFH 4GUXA 1G9IE 1O39A 3VB4A 1SGEE 2BD5A 4HGCA 2JH6D 3SJ9A 5C1XA 4X2VA 1XUJA 3RLWH 2ZF0H 2J4IA 1BRAA 2TGAA 2QA9E 2B5TB 2A31A 1TABE 4WJG2 3RC4A 1YP9A 1SOTA 1ZHRA 1CGHA 1NRQH 1CA8B 1DWEH 3SNCA 1DUEA 2FP7B 1AUTC 1K1OA 5AFYH 1CHOF 3Q3KA 1O2PA 1CHOG 3V12A 1G36A 1SLWB 1TFXA 4JYTA 3PMBB 1TNJA 3H5CB 4ZHMU 1N8OB 1TNIA 1YLCA 2XBYA 3QWCH 3NWUA 1NO9H 1NPMA 1FI8A 1VITH 2FM2A 1TGNA 2XNIA 1T7CA 2BOKA 3SUEA 2VJ1A 2BQ6B 2HNTC 1HAYB 1IOEA 4MNWA 2QY0B 1AVWA 2K1QA 1C2GA 1IQKA 1H9IE 3FAOA 4UFEH 1QA7A 2WPHS 1VCWA 3SU5A 1P2MA 3SNDA 2FTMA<