3SNCA

Crystal structure of sars coronavirus main protease complexed with ac-nstsq-h (soaking)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 78
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3sncA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sncA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sncA02
2ZGHA 2BX3A 1BMLA 2G00A 3ZVEA 1PPEE 1ARBA 3SHAH 2ESTE 3VB3A 1PPFE 2WPIS 3SNAA 2C8WB 1TWXB 1V2VT 4ABJA 1O3AA 1SLWB 4FUBA 1IHSH 1DT2A 4FUGA 4UFDH 5ABWA 1KXEA 5FBEA 5T6DA 4BXSA 1L1NA 1GJ6A 2BVRH 3HGPA 3S9BA 1YM0A 1AU8A 4IBLH 3VEQB 3VGCC 3GCNA 1TALA 1PFXC 2Q6GA 1IHTH 3T5FH 1CA0B 3P17H 1C5UA 4ISOA 1KXCA 2IPHA 2UUYA 1MAYA 2ZF0H 4D7FA 1V2KT 2XYAA 4DVAU 3GCTG 3RMOH 4B75A 5JDUB 3LU9B 1CT2E 1Q2WA 3KF2A 4DIHH 1SGNE 3KNXA 2O8WA 1GHBG 1GHAG 2ZDAH 3SW2B 1HAGE 1A46H 1P2KA 4KKDA 2BZAA 2WV5A 2XC0A 1K28D 1AGJA 1AKSA 3LGIA 3N7OA 4ISHH 1HCGA 2GDEH 3O8RA 3RLYH 2BQWB 3RXQA 1B0FA 2SFAA 1ZJKA 4A1VA 1ESAA 1QRZA 4NSVA 2FOHA 1UHBA 1EATA 3TJNA 3H7TA 3GYLB 2GV6A 3ELAH 1FY3A 1TONA 1SHHB 4K1TA 4YESB 1RTFB 1O3JA 1S82A 4I8KA 5DP3A 2PUQH 3D23A 2VVCA 2OBOA 3MWIU 2G51A 1SFQB 5DJ7A 1LHDH 5GPIB 1KLIH 2GKVE 3MOCA 1AVGH 4K2YA 5EQSA 3FP7E 3EDXB 4CBNA 1ZHRA 3KQDA 2R3YA 2SGAA 3U69H 3PWBA 1SGFA 1WTGH 1OP2A 1BBRE 2Y5GA 1Z8GA 3ZVFA 4NIXA 3ZVCA 3UWJH 3RU4E 2VWOA 4AX9H 2A4QA 1YYY1 2BOHB 1UTNA 2AGEX 1GJ9B 3BG4B 3E91A 4KTSA 4NIVA 5L30H 1GHYH 1EAXA 3RXFA 1GHZA 1QBVH 2DE8A 4DGJA 3RXSA 1BRCE 1J9CH 1MU6B 1PPGE 2A45B 4YT7H 1OWEA 4NA7A 2V3OH 5GJ4B 4CREA 1MUEB 2A2XH 2H9HA 1QFKH 1O3CA 2OXSA 3RUOA 1LMWB 4U01A 1MZAA 1QJ7B 4ABHA 2VVVA 1KDQB 5FPSA 1L4ZA 4CHAB 1OWJA 5EXNA 1O2RA 2J95A 1AUJA 4QT8C 4YLUA 1A0HB 2WYGA 3RC6A 1E37B 3DHKH 2ZP0H 2VVUA 2ZFTA 1VCQA 1O2MA 1SSXA 1GBAA 2ALPA 4BTIB 3UOUA 1GBDA 3AVZA 1FMGA 2FOCA 1EP6A 1O3KA 4X6MA 1AWHB 4Y0ZE 1V2QT 2SNVA 1CT0E 2FODA 1LHFH 2FYQA 2GGVB 1Y3WA 4OGXA 1K22H 3GCOA 1S6HA 3P8FA 4H6TA 1UK3A 1LPGB 1QBNA 4IC6A 2VGCB 1K1MA 4D9RA 1GI0A 1NS3A 2Z9JA 2FXRA 1OX1A 3PO1C 2VIPA 4KELA 4WMFA 1FY1A 1EAUA 2Z9IA 3M7QA 1AO5A 1ABIH 4VGCC 2PKSC 1LPZB 4NA8A 5DP7A 2FOGA 1ZMNA 3SU6A 2BXTH 2F9UA 3PMHB 1P8VC 3U1IB 1FZZA 1TNIA 3BF6H 5E0GA 4Z6AH 2ZHDA 3RC4A 1AIXH 1SHYA 1O3NA 1ZYOA 1Y3UA 1TGSZ 1O34A 2FO9A 2WPJS 1CHOF 4A1TA 1NY22 3DFLA 4E05H 9ESTA 3VXEH 1V2TT 3SV8A 3ODDA 3NWUA 3PMAB 1BTPA 2UUFB 1QB9A 1AD8H 2HGTH 2FS9A 3BIUH 3ZZ9A 1D3TB 1SQTA 2P94A 1CBWC 2ZWLH 3SORA 1H4WA 5JPMH 2WV4A 1NFWA 3SGBE 1LPKB 3VB6A 1BHXB 4K8YA 1BOQA 1BJVA 2V6NA 1TX6A 2J92A 1GI2A 3TITA 3QO6A 4K69A 5LGOA 2I6SA 1N1LA 1WYKA 1XMNB 2THFB 3T25A 1VR1H 1ZPCA 4ESTE 1MQ5A 2F9OA 4BXWA 1V2WT 3LGWA 2ZFPH 4FUJA 1NFYA 1OWIA 2WPKS 3SO3A 2QYIA 1O3EA 1W14U 2Y82A 3E0NB 4AORA 1C2HA 3AAUA 5A8ZA 1O31A 3OY6U 2BTCE 1WTHD 1CT4E 1YC0A 2Z9GA 1D4PB 1TNLA 1C1UH 2J38A 1GBEA 1IQMA 4AFUA 1C2GA 1WU1A 1EB2A 4MVNA 5EQRA 1GBMA 2RCEA 2GP9B 3RU4D 2O9QA 3MH7A 1Y3YA 1QGFA 1A3BH 5C5NA 1FN8A 3HKJB 1UVTH 4MNYA 2Z3EA 3ODFA 1T8MA 4BAHB 1YPHE 2CGAA 1TNHA 1O35A 3LGYA 3EA8A 1FDPA 4OS4A 3RXJA 3TJOA 3ZZBA 3U98H 1HJAB 1TIOA 1DUEA 4UDWH 1Z7KA 1W10U 3QUMP 3K6YA 4JCNA 4WWYA 3AAVA 1GCDA 2ODQA 4JYVH 2ANMH 1D3DB 2FLBH 2O8TA 1FI8A 1C2KA 3FAOA 1V3XA 1P09A 1ZOMA 4FUDA 2A5KA 4UE7H 1G37A 1W0YH 2W7UA 7GCHG 2BY9X 1N8OB 5B6OA 1O3GA 1ZSLA 4AFQA 4GSOA 4FXGH 2C4FH 5A2MH 3SV6A 1HDTH 2F9VA 3M35A 3GY7A 1CVWH 4BAKB 4X2XA 4UONA 1TRNA 4O3UA 3A85A 1OWHA 1ELDE 4Q7XA 1AFEH 3SHCH 3D62A 1K1NA 2ILNA 3MO3A 1V2MT 1C5RA 1BBRH 1MD8A 1TOMH 2ASUB 3MU4A 5I25A 2DE9A 2AYWA 3SJ8A 1UCYH 1DLKB 1NRRH 1LVBA 4FVDA 3M5OA 3IG6B 1G3BA 4YLQH 4MQAA 3SNBA 4JZDH 1QQUA 3LKWA 3Q3KA 2P93A 2R2WU 3RU4T 3SI4H 1BUIA 1D3QB 1GBFA 1TNGA 4YTAA 1G3CA 3T29A 3E8LA 7KMEH 2H2ZA 1EB1H 1B0EA 3BTEE 1UJ1A 4ZXYH 5CMXH 1Y3XA 1O2JA 5A8XA 3BTFE 2BD2A 3QGNB 5E8EH 1ANDA 1UVSH 2ZDVH 3GDSA 1C2IA 1C1RA 3E6PH 4X8TH 2EC9H 3BTME 4BNRA 4KTCA 3UUZA 3LOXA 1MTWA 1S0RA 2XCNA 3A7TA 5FHTA 1C5OH 2C90B 3HK3B 5AHGH 3CP7A 1GGDB 2ANKH 3PO1B 3F9HA 1HIAB 1JIMA 4H4FA 3U9AH 1YLCA 1ZTKA 2QN5T 3BTQE 3RXAA 1C5ZB 2GZ8A 4ABBA 3KIDU 2BD7A 1XUFA 5F6MA 2NU0E 1BTXA 3RXHA 1GI6A 4AG2A 2ZEBA 3UQVA 1E0FD 1IOEA 1CHGA 1ZSJA 2CMYA 2BY5X 4Y11E 1GDQA 5GWZA 1GBHA 1NRSH 1UK4A 5ESBA 2P8OB 4BANB 1ZR0A 5TJXA 1XX9A 3JZ2B 2FOMB 2HNTE 1O0DH 1O3LA 1J16A 3R0FA 1BTZA 2UUKB 3BEUA 4CR5A 1EZQA 2QGRA 3RXEA 3A8AA 4D76A 2BXUH 4WMDA 1C2LA 2WUCA 4KGAA 1C5QA 2O8UA 1O2KA 2OC1A 5GXPA 2OQUA 3BTGE 1FQ3A 1KXFA 1ZRKA 4CRDA 1XXFA 3PTNA 5L2ZH 3TK5A 2HNTF 1KSNA 1HJ8A 1C5YB 1P2MA 1C1WH 1SGCA 1TNJA 2Q1JA 5EU8A 2BDGA 1HIAA 1GBJA 4IN2A 2GTBA 3TNSA 3GYMA 7ESTE 3RXRA 1DANH 2TGAA 1AZZA 2BDBA 3F6UH 4FUFA 3UNQA 4NCYA 1HAZB 1MH0A 2BM2A 1SI5H 1SOTA 1GMDG 2BD3A 4ZKNU 1KXDA 4SGAE 3SJ9A 2P16A 1TLDA 2RA3A 1C5SA 3MU5A 3KEEA 5DK1A 1VJAU 3RMNH 2A0QB 1GI1A 1C5MD 5F8ZA 1TA6A 1RD3B 1T4VH 5DP4A 1N8OC 1W2KH 2PTNA 1FPHH 1HXEH 2ZHQH 4ZAEA 2OP9A 4JZEH 3SUFA 3LC5A 3LH3A 4FUEA 2ZC9H 3SJOA 1AWFH 1OS8A 2AH4X 2ZTZA 2ULLA 4YM9A 5SGAE 2GMTC 3ZZ3A 2OTVA 2NU3E 3LT3A 1LQEA 3SGQE 8GCHF 2EI8A 1EAIA 3AW0A 1SQAA 1XUKA 3UFAA 2GVFA 2QIQA 2ZQ2A 1FNIA 1Z8IB 4AYVB 2P8OC 3QK1A 3LC3A 3RXIA 1BRAA 4JK5A 1BMNH 1P3EA 4X6PA 2ZU1A 4INKA 2W7SA 4FU7A 3M5MA 2Y5FA 4HFPB 1ZHPA 1MTUA 4MNWA 1ETTH 3QGJA 2C3SA 1GJ5H 2QF3A 2ZGCA 4O3TA 3TU7H 2TGPZ 3QX5H 1DY8A 4AB9A 1GHWH 2FP7B 1K21H 2ALVA 2SGFE 4ISNA 3OY5U 5EW2H 4LZ1H 1SL3A 1QR3E 1GJCB 3Q3YA 2O8MA 3A80A 3QLPH 2AS9A 3MO9A 4OGYA 3GDVA 4X1NU 4DW2U 1GJAB 3STJA 2NU4E 1O2UA 1C9PA 4MNVA 1LQDB 1THRH 1A0JA 2ANWA 1GBCA 3M5LA 4Y6DA 2SGDE 2A4GA 3M3SA 1C5WB 2HVXA 3QTOH 3GY8A 1UTLM 2AIQA 1BBRK 3SJKA 5JBBS 1O2YA 1WQSA 2ZU3A 4WH8A 1C5TA 5F8XA 2H1UA 4AB8A 1LHEH 1PJPA 1EASA 1UTKA 3RXBA 2C8ZB 3IWMA 3GISB 1QL7A 2CXVA 1P9UA 1FY5A 1ORFA 1O2ZA 1G2MA 2HALA 2Y7XA 4X2YA 2XRCA 4I8JA 4XDEA 4OS5A 1NFUA 1WOFA 2PGQB 4NA9H 2TGDA 2P95A 2GDDA 3GCTF 1CHOG 4LK4A 1Q31A 5A0CA 1RTLA 3D49H 4NSYA 3LONA 5A8YA 1UTMA 3STIA 3SZNA 4X1PU 3S7KB 1IQHA 2CF9H 4CH2B 4LOYH 3QTVH 3Q3XA 4X1RU 4HI3A 1OWKA 3MI4A 1QB6A 2G52A 1DX5M 1YPKH 5FX6A 2C8XB 2OUAA 4I8GA 3V0XA 1UVPA 1T8NA 1XUJA 1EX3A 1BMMH 1AB9C 1ABJH 2H5DA 2H9EH 4JZFH 1QB1A 2Q6DA 1WCZA 3UIRA 3ZV9A 5HYOA 1ZMLA 5I46H 3TGKE 3S7HB 1KTSB 4Q7YA 4B2BA 1P05A 1HAYB 1NPMA 1DDJA 3RM0H 5LPEA 1C5VA 3NK8A 1TX8A 2XWAA 1EQ9A 3M36A 4FUHA 3I77A 3A88A 2BLQA 2FX4A 4I31A 4IMQA 2VH0A 2RDLA 5GDSH 3P92A 1ZGVA 1DICA 5TCCA 1HBTH 4BAMB 2KAIA 2TPIZ 3ZV8A 2A2QH 1TBZH 4CRGA 1CGIE 4CHAC 2ZGBH 4MDSA 1MU8B 3AW1A 1S5SA 1SMFE 3P8NA 1ESTA 1VITG 3A7VA 1U6QA 1K9OE 1N6YA 2EI6A 1SC8U 2EA3A 1C5XB 1FAXA 1IQKA 4Q7ZA 3RMLH 4ISLA 2P3UB 1O3PB 5C5OA 5EG4A 5BPEA 3SU2A 3ENSB 3LGVA 3VB4A 4YOIA 5C3NA 1ETSH 2ZDLA 4A6LA 4B73A 2A7JA 1EPTB 3A8CA 1UMAH 1C5NH 1W0ZU 5FCKA 2QCYA 5DKMA 2V3HH 3BTKE 4AN7A 2J4IA 2KAIB 4U30A 3A86A 1XKBC 3V3MA 4GPGA 5F8TA 2FI5E 1C1MA 3PLBA 1SGQE 1DWEH 2BD9A 1PQ5A 1WUNH 2FIRH 1ELBA 2W5EA 1CA0C 3VPKA 1CSOE 4WH6A 3ATLA 4HTCH 1GVKB 3S9AA 3S9CA 3A7YA 3MU0A 2GZ7A 4AFSA 4WMEA 2K7XA 1PPHE 2VGCC 3RXOA 1RGQA 5EXMA 4TPYA 3HKIB 2BDAA 2Z6BD 1PPBH 4WF8A 2FWWA 4IN1A 4UFEH 5TCAA 3ZVAA 1GCTC 1SGFG 1DFPA 1F5LA 2Z9KA 2A7HA 4Y79A 1G9IE 4F4OC 2PWXA 1VCWA 3VXFH 1A4WH 1GL0E 3PV4A 3A82A 3UY9A 2BVSH 2ZCKP 2R3UA 1GI5A 9LPRA 3IITA 1F5RA 4YOJA 2ANYA 4U2WA 5FX5A 4K1EA 1C1PA 1G3DA 2ZDMA 1BDAA 2WINI 1V2RT 2FTLE 8ESTE 2B7DH 3HPTB 5F03A 2BD8A 2OC7A 4K1SA 2D26C 1GMCF 3MH6A 1K1JA 1UTJA 1P03A 3A84A 1C2MA 1DXPA 4ZKOU 3FANA 4GLYA 1HJ9A 3SV9A 4CRAA 1TPOA 3MU1A 3GDUA 1XXDA 1H9LB 3WY8A 1GBIA 5GIBA 1LCYA 2PFEA 3L33A 2Y5HA 5DO4H 4CR9A 1C4U2 3DA9B 4INHA 1FIZA 2TBSA 4Y8YA 1BQYA 4RKOB 3U1JB 5C20A 1WAYB 4WXVA 3SQEE 2FI4E 3TH2H 5DGJA 4E7RG 3MYWA 2ZKSA 4ABDA 2UWLA 2G81E 3TK6A 3V7TA 1GCTB 2A1DB 5FPYA 1WSSH 4R8TB 4DT7B 1ANBA 1T32A 1G36A 3M3TA 3MNBA 3L3TA 2QA9E 1PYTD 1A5HA 4Y10E 1AVWA 1YPHC 1C2FA 1GDUA 1FPCH 1Z6JH 2BQ6B 3KL6A 3RMMH 1LVOA 1EJNA 2Z7FE 1BITA 3TGJE 1KDQA 1TA2A 3MMGA 1AI8H 1HB0B 1XVOA 4Y7AA 3GICB 2G5VA 3R3GB 1H9IE 2ZO3H 2BOKA 4ZMAH 1P01A 1MKXK 2F91A 4OS6A 2D2DA 3RDZA 1BZXE 5J4SA 1UVUH 3FVFB 3EAJA 3MNSA 3M7TA 1ELCA 4ZXXH 3TPIZ 2ZHWH 4B1TA 3LDXH 3QWCH 2OCVB 4NWLA 5T6FA 1T31A 1YBWA 2HLCA 1V2NT 4JZ1A 4OS7A 2UWOA 4H42U 2ZCHP 1HFDA 1W7XH 2PTCE 1GBBA 1A5GH 1Y5BT 1OOKB 1P06A 4XE4A 3SU3A 1O5DH 1DWDH 2FYRA 2ODYB 2R0LA 4F49A 5ETXA 1WV7H 1HAXB 3NUMA 1VGCC 1L0ZA 1MZDA 1FJSA 1O3BA 3S69A 5L6NH 2FDAA 5FCRA 4ZHAA 1ZLRA 2Y81A 3PB1E 1CQQA 4TPIZ 2ZHEH 3UTUH 1BHXF 1OXGA 1UVOA 4XBCA 4MG3A 1GHVH 1Z8RA 2Q6FA 4D9QA 1AE5A 3EGKH 4B71A 4WVPE 3ZZ5A 1KLJH 2B5TB 3BIVH 5HGGA 5T3HA 2VIQA 1BT7A 1TABE 5K0HA 7LPRA 1AUTC 2FPZA 1VZQH 3QZRA 1O3IA 1SGEE 1P3CA 1Y3VA 1V2JT 2BMGB 2CN0H 1IQEA 4X0WU 1O38A 4WY3A 1NRQH 1GPZA 1GI4A 3M7UA 1FONA 5E2PA 2VNTA 1GHBF 2H5CA 1ELVA 1QA7A 2FI3E 1FN6A 1O30A 1WQVH 1O5CB 2BDYA 3DUXH 4X6NA 4UEHH 1MBMA 3DT0H 4K5ZA 1O2NA 1XKAC 1O5AB 3FZDA 3RXUA 3UNRA 1TRYA 1HNEE 1SGRE 1A5IA 1ZMJA 4Y8ZA 2CF8H 1O2LA 3CENA 3P70B 5AVDA 1HGTH 2ZGXH 2D8WA 3A87A 4WJG2 4AFZA 1F2SE 1EKBB 1YP9A 8GCHG 2YNBA 1QBOA 1ZPBA 3M5NA 1PPCE 5FAHA 2A4OA 3L6PA 4K8BA 2ZA5A 3T28A 2Y80A 1G30B 4I32A 1H9HE 2ZNKH 1GBLA 4YZUA 2ZFRH 1F0SA 3NPSA 1TMBH 1LO6A 3VB5A 3K6ZA 4Z0KA 3ZYEA 2Y6TA 3ZZ7A 1TQ0B 2PV9B 1LTOA 1J14A 1D6RA 5EOKA 1SG8B 3JZ1B 1SLVB 4X8SH 2FOAA 1S81A 1MTVA 1UTPA 3ESTA 4ISIH 4NZLA 2GCHF 1SFIA 4RSPA 1QJ1B 3SU0A 5CHAC 3U8OH 4CBOA 1T7CA 1ELAA 3NXPA 1OSSA 5JBAS 3SNCA 1JWTA 3ZZ8A 1ZGIA 1ANEA 3VB7A 4MPUA 1H1BA 1X7AC 2J94A 3FP8E 4DURA 2BY6X 2QXJA 2QXIA 5IDKA 2J34A 1K1IA 1ELFA 1O32A 2XCFA 1J15A 4K60A 5HXFA 1YGCH 2VH6A 2JH5D 1OKXA 4A7IB 1HAIH 3MH4A 1BRBE 1O5FH 2GCTB 4DOQA 1V2ST 1HAVB 2ZDKA 1IAUA 1O2WA 2PLXA 3KQCA 4X2VA 1O5BB 2HNTC 1F92A 1PQ7A 2R9PA 1NM6A 4Y76A 3ZZDA 2QXHA 4GAWA 1TBRH 1NZQH 1P04A 4J2YB 1ID5H 2QV1A 1QJ6B 2ZU2A 1TYNA 2VB0A 1L1JA 3EQ0H 2Y7ZA 2RG3A 3TNTA 2JH0D 1YPEH 3BTHE 3RM2H 1JIRA 4YO9A 1PPZA 1TB6H 2GZ9A 1THSH 2OC8A 4TYDA 3OU0A 1AMHA 1DPOA 1UCYE 3O8DA 2SGQE 4I8LA 1W13U 4DJZB 5AFYH 2AGGX 1ZRBA 1KXBA 1NO9H 3PLKA 3RLWH 1FY8E 3Q00A 1O33A 1VCPA 6CHAC 4I33A 5DG6A 3MU8A 2CJIA 1TE0A 4NIWA 1SGYE 1FV9A 1EPTC 5A0BA 1MTSA 1NN6A 3CS0A 3DFJA 3LH1A 1AN1E 2ZCLP 1TMTH 4CRBA 4PROA 1UTOA 1A0LA 3EE0B 1C2JA 1D6WA 3AASA 1QHRB 1HPGA 1MAXA 3ZVDA 3F9FA 2SGPE 3T62A 2GV7A 2UUJB 3TLOA 1MQ6A 2FLRH 1NESE 4IC5A 4X8UH 6GCHG 3KHVA 3EA9A 3UREA 2D1JA 5JB9S 2Z94A 3OSYA 5C67A 3ZZCA 5DP5A 4XSKU 1GHAF 3Q77A 1O2VA 1IQIA 1E35B 1O2SA 2WPMS 1DSUA 5AF9H 1DXWA 8LPRA 1Z71A 4IW4E 3A81A 2OBQA 2F9PA 1XUIA 1GDNA 2FESH 1GJDB 1VITH 4XFQA 3TK9A 2BYAX 5GCHG 1SB1H 2Z9LA 4B74A 4UD9H 3MO6A 4VGCB 1TBQH 3E0PB 1O5GH 1O37A 3GOVB 2OD3B 3MNXA 3ZVBA 1Z1JA 1FXYA 3H7OA 3TGIE 3PMBB 4X1SU 4X8VH 4AYYB 1SR5C 4BAOB 3ZZ6A 3HK6B 3RXCA 1Y5AT 2QC2A 3P6ZB 3Q76A 1C2EA 2R0KA 2FTMA 1EAWA 1KIGH 1GJ7B 1EUFA 4K3JA 2F83A 3M61U 4IGDA 3SU1A 2FX6A 2P3FH 3RXDA 2F9NA 4B76A 1AE8H 4ABAA 3C1KA 4KTUA 2CHAC 4X1QU 2G8TA 3O8CA 3TVJB 3I78A 6LPRA 2FEQH 2ZPSA 1QCPA 1P9SA 4AGJA 1KLTA 4NGAH 3URDA 4FU8A 1DY9A 5JBTA 2CV3A 1RFNA 3ATIA 1HLTH 1O3HA 2ODPA 2TIOA 2NWNA 3U8RH 1TPPA 2BX4A 1CBWB 4DCDA 4NG9H 3SU5A 3SNEA 1O2XA 1H8IH 1ESBA 1DWBH 1RRKA 2C93B 2A31A 4GCHG 4NWKA 1A2CH 1S0QA 1NRNH 2VIDA 5AFZH 1F5KU 1TMUH 1OYQA 3A8DA 3KQEA 1SLXB 4Y7BA 3KQBA 2AMDA 3SUEA 2ZU4A 2VWMA 2ZZUH 3RC5A 3RXLA 1UTQA 4CRFA 3E16B 5LH8A 1C1TA 3OX7U 1YCPM 1RXPA 4DIIH 4X6OA 1ZHMA 3KGPA 2ZDNA 1MTNB 2WYJA 1C2DA 1W7GH 1YCPH 1SGPE 2SGEE 3BG8A 2Z3DA 1JOUB 4AG1A 2GX4A 3ITIA 1DITH 2VU8E 1MKWH 3QN7A 1ANCA 2PW8H 1O2GH 3LPRA 4TWYA 3A83A 3VGCB 3MTYA 2BDHA 3P95A 2R2MB 2JETC 4Q80A 1JRSA 2FOBA 3MNCA 1RIWB 1WBGB 2QY0B 1PQAA 2NU1E 2PKAB 3F68H 1ZSKA 1GJ4H 1W12U 1KXAA 2PSXA 5E2OA 1F0RA 2ZFFH 1YPMH 4NFFA 3SV7A 2XTTB 2ZPRA 1A61H 1HUTH 3SQHE 1Y8TA 2FOFA 2OC0A 3MFJA 1F0TA 4GHQA 2XBWA 2XNIA 3RXTA 5HMAA 1F0UA 2XW9A 1QA0A 2PUXB 2CHAB 1ELGA 3K2UA 1F7ZA 3B8JA 5JBCS 2PHBA 4LZ4B 1C1VH 3B9FH 4OS1A 5BRRE 5EQQA 1OP0A 2YNAA 3UNSA 1FY4A 2RA0A 1O36A 1CO7E 4ZROA 1BIOA 1ETRH 1FUJA 4U32A 4BOHA 2AFQB 2B9LA 1V2OT 1HXFH 3BSQA 1EP5A 4AZ2B 1OWDA 3PM3A 1HAPH 4IS5A 5FPTA 1K1LA 4CH8B 6ESTA 4A5TS 1Q3XA 1INCA 1AKSB 1BCUH 2BDCA 5JB8S 2PR3A 2NU2E 1UK2A 1TRMA 4O9VA 3T2NA 4THNH 3BTTE 3S0NA 5DP8A 1NROH 2HPPH 2YOLA 3SGAE 1O3OA 1ELTA 4O97A 3SBKA 3TIUA 2GT8A 2BB4A 1ZZZA 4A1XA 1E34B 3PWCA 3EA7A 1P2IA 2FZZA 3W95A 1LHGH 2AEIH 2DUCA 2HOBA 1EJMA 1JMOH 1GMDF 1YPJH 5C1UA 1NFXA 4Y71A 1GI9B 4J1YA 1CGJE 1SVPA 4LXBH 2ZGJA 1QRXA 4H6SB 2ZIQH 1C9TA 1NT1A 1SPJA 1BJUA 1TGTA 5E0HA 3RP2A 2ZHFH 4FU9A 1AVXA 1YF4A 1S84A 2BHGA 1O3FA 3G01A 1TX7A 1ACBE 1LDTT 2M5TA 1O39A 4Q2KA 1TGNA 4B2AA 4MNXA 2EEKA 5K7RA 1AFQC 2IOTA 4IMZA 2SNWA 1E38B 1EOJA 1T8LA 1EZXC 1IQNA 2WPLS 3A7WA 3OYPA 3T26A 1TPAE 1TGCA 2GT7A 1GMHF 5L2YH 1ZJDA 5A0AE 1O2IA 4SGBE 3E90B 2ZTYA 1P2QA 1Y5UT 2PGBB 4O03A 3O8BA 3I29A 1HAHH 3UR6A 4BTUB 1J17T 5EXLA 2JETB 3SNDA 1TNKA 1L1GA 1EXFA 2ZECA 1QL9A 3PYHA 1CGHA 2ZPQA 7GCHF 1GBKA 2IJOB 4B2CA 1P02A 1TQ7B 1K1OA 3URCA 3V12A 1IQFA 1MBQA 2F9BH 2BQ7B 1KYNA 4HZHA 2A32A 4ABIA 2BLOA 1AZ8A 1BRUP 1NU9A 1O2HA 2G55A 1GI3A 2HPQH 2ZU5A 2AIPA 3GCHC 4ASHA 3BTWE 5PTPA 1A1RA 5FXLA 4I8HA 3SV2H 2VWLA 1RIWC 5EW1H 4TWWA 1A7SA 1L2EA 3PMJA 6GCHF 2HWLB 1UO6A 4ABGA 2ZG0H 1XUHA 5FBIA 2G5NA 1S85A 3E1XB 2WPHS 2I6QA 1JXPA 1SOZA 1NTPA 1HYLA 5C2ZA 3GY4A 1C1QA 1DM4B 1VGCB 1GVZA 3BG4C 3A8BA 1C5PA 2PKSB 2ZI2H 3H5CB 4JYTA 3QDZB 1LKBA 4FVBA 1G3EA 1OPHB 3RXPA 2B8OH 4ZUHA 2XBVA 1N6XA 1MCVA 1M9UA 5LPRA 1GMHG 1PYTC 2BZ6H 3VFEA 4Y0YE 2BVXH 2AGIX 2G4UA 2QAAA 3RXVA 3F9GA 1K2I1 3U8TH 4E7NA 3A7XA 4RN6A 1TPSA 5EPYA 3B23B 2GCTC 3UWIA 1GGDC 1QL8A 1W3CA 2JKHA 3GY3A 5C1XA 5A09A 1B7XB 1VJ9U 2TRMA 1FLEE 4A92A 1MKXH 1AHTH 3OTJE 2A4RA 1UHBB 1Y59T 1CE5A 3HATH 3HGNA 4GVUA 4YOGA 1MCTA 5E0JA 1C1SA 1C4V2 1SLUB 2BY7X 3FZZA 2W3IA 1C1NA 2K1QA 3TJUA 1C5LH 3LGUA 1QY6A 4INLA 3D65E 4Y8XA 2VIOA 2XC5A 3T27A 4JK6A 4XOJA 2AMPA 3UQOA 2LNCA 2FMJA 4FUIA 1YLDA 3BTDE 5H4IB 4JZIA 4BAQB 2FM2A 3PTBA 4M7GA 4AGKA 1ZPZA 3NZIA 1AQ7A 2PSYA 1ZTJA 1J8AA 2STAE 1QURH 4MTBA 1V6DA 1BTHH 2F3CE 4KP0A 4AOQA 3ZVGA 1KY9A 4FUCA 3ZZAA 3RXMA 2WUBA 1GI8B 2Z3CA 1QTFA 4NFEA 2LIZA 1T4UH 4GHTA 2EI7A 2XXLA 3CS7A 1XVMA 3GY5A 1XUGA 3ATMA 1OP8A 1Z6EA 2FOEA 1YCPK 3GCHB 1P10A 1LHCH 2BDIA 1O3DA 2UWPA 1DS2E 1GBTA 5DPAA 3MH5A 1EOLA 2JH6D 1DSTA 2VJ1A 2VWNA 3KN2A 1FAKH 3W94A 2GD4B 5IYTA 1P11E 4JYUH 1GJ8B 4ZKRU 2B0FA 1MMJN 1VITF 5CE1A 1NC6A 1LKAA 1IQJA 2ZFSA 2VINA 4ZKSU 1P0SH 4R0IA 1GVLA 1A3EH 1DOJA 3A7ZA 5HM2A 1CU1A 5JYIA 1G32B 5EGMA 1V2LT 2IN2A 1RJXB 1TOCB 1D3PB 1THPB 2V35A 2LPRA 1NU7B 2H6MA 2O8LA 1YKTA 3P8OA 2OLGA 3GY2A 3BV9B 4XBDA 3SI3H 2XBYA 1JRTA 2QXGA 2P59A 2GMTB 1O2OA 2VIWA 3NCLA 1GHXH 1HAVA 1BTUA 1LVMA 4HGCA 1W8BH 2A5IA 3ATWA 3SJIA 1SGTA 1EZSC 3SOSA 4RKJB 1HV7A 1SBWA 3EYDA 1NRPH 2BY8X 3P8GA 4DY7B 1FIWA 1QQ4A 1XM1A 4NZQA 1DE7H 1T8OA 5DP9A 4D7GA 1DLEA 1ARCA 2ZQ1A 2H9TH 1D9IA 2TGTA 2VIVA 3RXGA 5HM9A 2BLVA 1SGDE 2J9NA 4DG4A 2PKAA 5EPNA 2FS8A 1S83A 1CA8B 1GG6B 3PLPA 1G2LA 1ZTLA 1P2OA 1GG6C 3C27B 4XBBA 1QNJA 3UPEA 3NKKA 3E3TA 1JBUH 1PQ8A 3FFGA 3KCGH 1H8DH 3BEIB 3BN9A 5DP6A 1AB9B 1BB0B 1YPLH 8KME2 4MPWA 3SUGA 1DWCH 2STBE 2A5AA 2G4TA 4YT6H 4WXIA 2XC4A 3DD2H 1AY6H 1DVAH 1EPTA 1TFXA 1B5GH 4MPXA 1TAWA 5ESTE 2BD4A 3M37A 1SQOA 2ZTXA 1Z8JB 1YPGH 1C1OA 1S6FA 5J4QA 1EZUC 5C1YA 4OS2A 1BTWA 3MHWU 1AFQB 1O2TA 1BA8B 1P2NA 1QIXB 4X2WA 5T6GA 5LPFA 1O2QA 3SUDA 1E36B 3UOPA 4MLFB 1P12E 4TY6A 1RTKA 4GCHF 1HAOH 2ZFQH 4UFGH 1P2JA 4ABEA 1UCYK 4JMYA 1OYTH 4ZHLU 3FP6E 3F9EA 4BTTB 4E06H 2W26A 3LJOA 3LGTA 1KTTB 3ZZ4A 4ZHMU 1GMCG 2P3TB 5EODA 3LJJA 2AERH 4NIYA 1O2PA 5G4BA 1EJAA 3M3VA 1O5EH 1LVYA 3ZYDA 3F1SB 4MPVA 2GCHG 4TY7A 3SU4A 1L4DA 4CRCA 2OQ5A 3SN8A 4I7YH 2V0BA 1V2UT 1DUAA 3QZQA 1GI7B 1BTYA 2J2UA 4ZH8A 1V2PT 1MKWK 3TH3H 2C8YB 2XBXA 1HJAC 1SGIB 3K65B 3GY6A 1IQGA 1HRTH 1IQLA 1RS0A 2OINA 4D8NA 1W11U 3RXKA 3V13A 3K9XB 2W3KA 1K1PA 3PROA 1GWAA 1TGBA 1MTNC 3LIWA 3TJVA 2AMQA 1GJBB 1GL1A 1MD7A 1P57B 4ABFA 3ATKA 5GCHF 2QF0A 3EBNA 2A7CA 1QRWA 3A89A 3TH4H 3UR9A 1ELEE 3BEFB 2HRVA 1Z1IA 4GUXA 1BMAA 1O3MA 1C4Y2 4UFFH 2XWBI 5CHAB 2BD5A 2BLWA 6CHAB
chains in the Genus database with same CATH superfamily
2ZGHA 2BX3A 1BMLA 2G00A 3ZVEA 1PPEE 1ARBA 3SHAH 2ESTE 3VB3A 1PPFE 2WPIS 3SNAA 2C8WB 1TWXB 1V2VT 4ABJA 1O3AA 1SLWB 4FUBA 1IHSH 1DT2A 4FUGA 4UFDH 5ABWA 1KXEA 2YMSC 5FBEA 5T6DA 4BXSA 1L1NA 1GJ6A 2BVRH 3HGPA 3S9BA 1YM0A 1AU8A 4IBLH 3VEQB 3VGCC 3GCNA 1TALA 1PFXC 2Q6GA 5EJ1A 1IHTH 3T5FH 1CA0B 3P17H 1C5UA 4ISOA 1KXCA 2IPHA 3KQ5A 2UUYA 1MAYA 2ZF0H 4D7FA 1V2KT 2XYAA 4DVAU 3GCTG 3RMOH 4B75A 5JDUB 3LU9B 1CT2E 2K0QA 1Q2WA 3KF2A 4DIHH 1SGNE 3KNXA 2O8WA 1GHBG 1GHAG 2ZDAH 3SW2B 1HAGE 1A46H 1P2KA 4KKDA 2BZAA 2WV5A 2XC0A 1K28D 1AGJA 1AKSA 3LGIA 3N7OA 4ISHH 1HCGA 2GDEH 3O8RA 3RLYH 2BQWB 3RXQA 1B0FA 2SFAA 1ZJKA 4A1VA 1ESAA 1QRZA 4NSVA 2FOHA 1UHBA 1EATA 3TJNA 3H7TA 3GYLB 2GV6A 3ELAH 1FY3A 1TONA 1SHHB 4K1TA 4YESB 1RTFB 1O3JA 1S82A 4I8KA 5DP3A 2PUQH 1OHHD 3D23A 2VVCA 2OBOA 3MWIU 2G51A 1SFQB 4FETA 5DJ7A 1LHDH 5GPIB 1KLIH 2GKVE 3MOCA 1AVGH 4K2YA 5EQSA 3FP7E 3EDXB 4CBNA 1ZHRA 5DSFA 3KQDA 2R3YA 2SGAA 3U69H 3PWBA 1MABB 1SGFA 1WTGH 1OP2A 1BBRE 2Y5GA 1Z8GA 3ZVFA 4NIXA 3ZVCA 5EIYA 3UWJH 3RU4E 2VWOA 4YXWD 4AX9H 2A4QA 1YYY1 2BOHB 1UTNA 2AGEX 1GJ9B 3BG4B 3E91A 4KTSA 4NIVA 5L30H 1GHYH 1EAXA 5C94A 3RXFA 1GHZA 1QBVH 2DE8A 1E1QD 4DGJA 3RXSA 1BRCE 1J9CH 1MU6B 1E79D 1PPGE 2A45B 4YT7H 1OWEA 4NA7A 2V3OH 5GJ4B 4CREA 1MUEB 2A2XH 2H9HA 1QFKH 1O3CA 2OXSA 3RUOA 1LMWB 4U01A 1MZAA 1QJ7B 4ABHA 2VVVA 1KDQB 5FPSA 1L4ZA 4CHAB 1OWJA 5EXNA 1O2RA 2J95A 1AUJA 4QT8C 4YLUA 1A0HB 2WYGA 1WXRA 3RC6A 1E37B 3DHKH 2ZP0H 2VVUA 2ZFTA 1VCQA 1O2MA 1SSXA 1GBAA 2ALPA 4BTIB 3UOUA 1GBDA 3AVZA 1FMGA 2FOCA 1EP6A 1O3KA 4X6MA 1AWHB 4Y0ZE 1V2QT 2SNVA 1CT0E 2FODA 1LHFH 2FYQA 2GGVB 1Y3WA 4OGXA 1K22H 3GCOA 1S6HA 3P8FA 4H6TA 1UK3A 1LPGB 1QBNA 4IC6A 2VGCB 1K1MA 4D9RA 1GI0A 1NS3A 2Z9JA 2FXRA 1OX1A 3PO1C 2VIPA 4FOUC 4KELA 3SZEA 4WMFA 1FY1A 1EAUA 2Z9IA 3M7QA 1AO5A 1ABIH 4VGCC 2PKSC 1LPZB 4NA8A 5DP7A 2FOGA 1ZMNA 3SU6A 2BXTH 2F9UA 3PMHB 1P8VC 3U1IB 2IJD1 1FZZA 1TNIA 3BF6H 5KGOA 5E0GA 4Z6AH 2ZHDA 3RC4A 1AIXH 1SHYA 1O3NA 1ZYOA 3WWFA 1Y3UA 2YMSB 1TGSZ 1O34A 2FO9A 2WPJS 1CHOF 4A1TA 1NY22 3DFLA 4E05H 9ESTA 1S6LA 3VXEH 1V2TT 3SV8A 3ODDA 3NWUA 3PMAB 1BTPA 2UUFB 4ZCNA 1QB9A 1AD8H 2HGTH 2FS9A 3BIUH 3ZZ9A 1D3TB 1SQTA 2P94A 1CBWC 2ZWLH 3SORA 1H4WA 3NRLA 5JPMH 2WV4A 1NFWA 3SGBE 1LPKB 3VB6A 1BHXB 4K8YA 1BOQA 2JIZD 1BJVA 2V6NA 1TX6A 2J92A 1GI2A 3TITA 3QO6A 4K69A 5LGOA 4F55A 2I6SA 1N1LA 1WYKA 1XMNB 2THFB 3T25A 1VR1H 1ZPCA 4ESTE 1MQ5A 2F9OA 4BXWA 1V2WT 3LGWA 2ZFPH 4FUJA 1NFYA 1OWIA 2WPKS 3SO3A 3DSPA 2QYIA 1O3EA 1W14U 2Y82A 3E0NB 4AORA 1C2HA 3AAUA 5A8ZA 1O31A 2L6OA 3OY6U 2BTCE 1WTHD 1CT4E 1YC0A 2Z9GA 1D4PB 1TNLA 1C1UH 2J38A 1GBEA 1IQMA 4AFUA 1C2GA 1WU1A 1EB2A 4MVNA 5EQRA 1GBMA 2RCEA 1K0HA 2GP9B 3RU4D 2O9QA 3MH7A 1Y3YA 1QGFA 1A3BH 1QZ8A 5C5NA 1FN8A 3HKJB 1UVTH 4MNYA 2Z3EA 3ODFA 1T8MA 4BAHB 1YPHE 2CGAA 1TNHA 1O35A 3LGYA 3EA8A 1FDPA 4OS4A 3RXJA 3TJOA 3ZZBA 3U98H 1HJAB 1TIOA 1DUEA 4UDWH 1Z7KA 1W10U 3QUMP 3K6YA 4JCNA 4WWYA 3AAVA 1GCDA 2ODQA 4JYVH 2ANMH 1D3DB 2FLBH 2O8TA 1FI8A 1C2KA 3FAOA 1V3XA 1SQRA 4XRNA 2KCYA 1P09A 1ZOMA 4FUDA 2A5KA 4UE7H 1G37A 1W0YH 2W7UA 2L74A 7GCHG 2BY9X 1N8OB 5B6OA 1O3GA 1ZSLA 4HG6A 4AFQA 4GSOA 4FXGH 2C4FH 5A2MH 3SV6A 1HDTH 2F9VA 3M35A 3GY7A 1CVWH 4BAKB 4X2XA 4UONA 1TRNA 4O3UA 3A85A 1OWHA 1YY3A 1ELDE 4Q7XA 1AFEH 3SHCH 3D62A 1K1NA 2ILNA 3MO3A 1V2MT 1C5RA 1BBRH 1MD8A 1TOMH 2EQNA 2ASUB 3MU4A 5I25A 3AK5A 2DE9A 2AYWA 3H09A 3SJ8A 1UCYH 1DLKB 1NRRH 1LVBA 4FVDA 3M5OA 3IG6B 1G3BA 4YLQH 4MQAA 3SNBA 4JZDH 1QQUA 2KR7A 3LKWA 3Q3KA 2P93A 2R2WU 3RU4T 3SI4H 1BUIA 1D3QB 1GBFA 1TNGA 4YTAA 1G3CA 3T29A 3E8LA 7KMEH 2H2ZA 1EB1H 1B0EA 3BTEE 1UJ1A 4ZXYH 5CMXH 1Y3XA 1O2JA 5A8XA 3BTFE 2BD2A 3QGNB 5E8EH 1ANDA 1UVSH 2ZDVH 3GDSA 5GNDA 1C2IA 1C1RA 3E6PH 4X8TH 2EC9H 3BTME 4BNRA 2RFKC 4KTCA 3UUZA 3LOXA 1MTWA 1S0RA 2XCNA 3A7TA 4ASUD 5FHTA 1C5OH 2C90B 3HK3B 5AHGH 3CP7A 1GGDB 2ANKH 3PO1B 3F9HA 1HIAB 1JIMA 4H4FA 3U9AH 1YLCA 1ZTKA 2QN5T 3BTQE 3RXAA 1C5ZB 4TT3D 2GZ8A 4ABBA 3KIDU 2HVYB 2BD7A 1XUFA 2CK3D 5F6MA 2NU0E 3ZIAD 1BTXA 3RXHA 1GI6A 4AG2A 2ZEBA 3UQVA 1E0FD 1IOEA 1CHGA 1ZSJA 2CMYA 2BY5X 4Y11E 1GDQA 5GWZA 1GBHA 2WHXA 1NRSH 3F2FA 1UK4A 5ESBA 2P8OB 4BANB 1ZR0A 5TJXA 1XX9A 3JZ2B 2FOMB 2HNTE 1O0DH 1O3LA 1J16A 3R0FA 1BTZA 2UUKB 3BEUA 4CR5A 1EZQA 2QGRA 3RXEA 3A8AA 4D76A 2BXUH 4WMDA 1C2LA 2WUCA 4KGAA 1C5QA 2O8UA 1O2KA 2OC1A 5GXPA 2OQUA 3BTGE 1FQ3A 1KXFA 1ZRKA 4CRDA 1XXFA 3PTNA 5L2ZH 3TK5A 5CHBA 2HNTF 1KSNA 1HJ8A 1C5YB 1P2MA 1C1WH 1SGCA 1TNJA 2Q1JA 5EU8A 2BDGA 1HIAA 1GBJA 4IN2A 2GTBA 3TNSA 3GYMA 7ESTE 3RXRA 1DANH 2TGAA 1AZZA 2BDBA 3F6UH 4FUFA 3UNQA 4NCYA 1HAZB 1MH0A 2BM2A 1SI5H 1SOTA 1GMDG 2BD3A 4ZKNU 1KXDA 4SGAE 3SJ9A 2P16A 1TLDA 2RA3A 1C5SA 3MU5A 3KEEA 5DK1A 1VJAU 3F2GA 3RMNH 2A0QB 3F2HA 1GI1A 1C5MD 5F8ZA 1TA6A 1RD3B 1T4VH 5DP4A 1N8OC 1W2KH 2PTNA 1FPHH 1HXEH 2ZHQH 4ZAEA 2OP9A 4JZEH 3SUFA 3LC5A 3LH3A 4FUEA 1H8ED 2ZC9H 3SJOA 1AWFH 2AHME 1OS8A 2AH4X 2ZTZA 2ULLA 4YM9A 5SGAE 2GMTC 3ZZ3A 2OTVA 2NU3E 3LT3A 1LQEA 3SGQE 8GCHF 2EI8A 1EAIA 3AW0A 1SQAA 1XUKA 3UFAA 2GVFA 2QIQA 2ZQ2A 1FNIA 1Z8IB 4AYVB 2P8OC 3QK1A 3LC3A 3RXIA 1BRAA 4JK5A 1BMNH 1P3EA 4X6PA 2ZU1A 4INKA 2W7SA 4FU7A 1WDIA 3M5MA 2Y5FA 4HFPB 1ZHPA 1MTUA 4MNWA 1ETTH 3QGJA 2C3SA 1GJ5H 2QF3A 2ZGCA 4O3TA 3TU7H 2TGPZ 3QX5H 1DY8A 4AB9A 1GHWH 2FP7B 2J98A 1K21H 2K8IA 2ALVA 2SGFE 4ISNA 3OY5U 5EW2H 4LZ1H 1SL3A 1QR3E 1GJCB 2VBCA 3Q3YA 2O8MA 3A80A 3QLPH 2AS9A 3MO9A 4OGYA 3GDVA 4X1NU 4DW2U 1GJAB 3STJA 2NU4E 1O2UA 1C9PA 4MNVA 3N99A 1LQDB 1THRH 1A0JA 2ANWA 1GBCA 3M5LA 4Y6DA 2SGDE 3W1EA 2A4GA 3M3SA 4I86A 1C5WB 2HVXA 3QTOH 5HIZA 3GY8A 1UTLM 2AIQA 1BBRK 3SJKA 5JBBS 1O2YA 1WQSA 2ZU3A 4WH8A 1C5TA 5F8XA 2H1UA 4AB8A 1LHEH 1PJPA 1EASA 1UTKA 3RXBA 2C8ZB 3IWMA 3GISB 2JJ2D 1QL7A 4F48B 2CXVA 1P9UA 1FY5A 1ORFA 1O2ZA 1G2MA 2HALA 2Y7XA 4X2YA 2XRCA 4I8JA 4XDEA 4OS5A 1NFUA 1WOFA 2PGQB 4NA9H 2TGDA 2P95A 2GDDA 3GCTF 1CHOG 4LK4A 1Q31A 5A0CA 1RTLA 3D49H 3N7DA 4NSYA 3LONA 5A8YA 1UTMA 3STIA 3SZNA 4X1PU 3S7KB 1IQHA 2CF9H 4CH2B 4LOYH 3QTVH 3Q3XA 4X1RU 4HI3A 1OWKA 3MI4A 1QB6A 2G52A 1DX5M 1SKYE 1YPKH 5FX6A 2C8XB 2OUAA 4I8GA 3V0XA 1UVPA 1T8NA 1XUJA 1EX3A 1BMMH 1AB9C 1ABJH 2H5DA 1FX0B 2H9EH 4JZFH 1QB1A 2Q6DA 1WCZA 3UIRA 3ZV9A 5HYOA 1ZMLA 5I46H 3TGKE 3S7HB 1KTSB 4Q7YA 4B2BA 1P05A 1HAYB 1NPMA 1DDJA 3RM0H 5LPEA 1C5VA 3NK8A 1TX8A 2XWAA 3UAIC 1EQ9A 3M36A 4FUHA 3I77A 3A88A 2BLQA 2FX4A 4I31A 4IMQA 2VH0A 3FO8D 2RDLA 5GDSH 3P92A 1ZGVA 1DICA 5TCCA 1HBTH 4BAMB 2KAIA 2TPIZ 3ZV8A 2A2QH 1TBZH 4CRGA 1CGIE 4CHAC 2ZGBH 4MDSA 1MU8B 3AW1A 1S5SA 1SMFE 3P8NA 1ESTA 1VITG 3A7VA 1U6QA 1K9OE 1N6YA 2EI6A 1SC8U 2EA3A 1C5XB 1FAXA 1IQKA 4Q7ZA 3RMLH 4ISLA 2P3UB 1O3PB 5C5OA 5EG4A 5BPEA 3SU2A 3ENSB 3LGVA 3VB4A 4YOIA 5C3NA 1ETSH 2ZDLA 4A6LA 4B73A 2A7JA 1EPTB 3A8CA 1UMAH 2M2AA 1C5NH 3DSGA 1W0ZU 5FCKA 2QCYA 5DKMA 2V3HH 3BTKE 4AN7A 5HKKD 3U28C 2J4IA 2KAIB 4U30A 3A86A 1XKBC 3V3MA 4GPGA 5F8TA 2FI5E 1C1MA 3PLBA 1SGQE 1DWEH 2BD9A 1PQ5A 1WUNH 2FIRH 1ELBA 2W5EA 1CA0C 3VPKA 1CSOE 4WH6A 3ATLA 4HTCH 1GVKB 3S9AA 3S9CA 3A7YA 3MU0A 2GZ7A 4AFSA 4WMEA 2K7XA 1PPHE 2VGCC 3RXOA 1RGQA 5EXMA 4TPYA 3HKIB 2BDAA 2Z6BD 1PPBH 4WF8A 2FWWA 4IN1A 3UB0A 4UFEH 5TCAA 3ZVAA 1GCTC 1SGFG 1DFPA 1F5LA 3WW7A 4DT4A 2Z9KA 2A7HA 4Y79A 1G9IE 4F4OC 2V3MA 2PWXA 1VCWA 3VXFH 1A4WH 3CNRA 1GL0E 3PV4A 3A82A 3UY9A 2BVSH 2ZCKP 2R3UA 3OE7D 5EJLA 1GI5A 3OAAD 9LPRA 3IITA 1F5RA 4YOJA 2ANYA 4U2WA 2PP6A 5FX5A 4Q63A 4K1EA 1C1PA 1G3DA 2ZDMA 1BDAA 2WINI 1V2RT 2FTLE 8ESTE 2B7DH 3HPTB 5F03A 2BD8A 2OC7A 4K1SA 2D26C 1GMCF 3MH6A 1K1JA 1UTJA 1P03A 3A84A 1C2MA 1DXPA 4ZKOU 3FANA 4GLYA 1HJ9A 3SV9A 4Q4LA 4CRAA 1TPOA 3MU1A 3GDUA 1XXDA 1H9LB 3WY8A 1GBIA 5GIBA 1LCYA 2PFEA 3L33A 2Y5HA 4XD7D 5DO4H 4CR9A 1C4U2 3DA9B 4INHA 1FIZA 2TBSA 4Y8YA 1BQYA 4RKOB 3U1JB 5C20A 1WAYB 4WXVA 3SQEE 1YWUA 2FI4E 3TH2H 5DGJA 4E7RG 3MYWA 2ZKSA 4ABDA 2UWLA 2G81E 3TK6A 3V7TA 1GCTB 2A1DB 5FPYA 1WSSH 4R8TB 3DSOA 4DT7B 1ANBA 1T32A 1G36A 5CDFE 3M3TA 3MNBA 3L3TA 2QA9E 1PYTD 1A5HA 4Y10E 1AVWA 1YPHC 2WPDD 1C2FA 1GDUA 1FPCH 2RDEA 1Z6JH 2F4LA 2BQ6B 1EFRD 3KL6A 3RMMH 1LVOA 1EJNA 2Z7FE 1BITA 3TGJE 1KDQA 1TA2A 3MMGA 1AI8H 1HB0B 1XVOA 4Y7AA 3GICB 2G5VA 3R3GB 1H9IE 2ZO3H 2BOKA 4ZMAH 1P01A 1MKXK 3F0PA 2F91A 4OS6A 2D2DA 2GJGA 3RDZA 1BZXE 5J4SA 1UVUH 3FVFB 3EAJA 3MNSA 3M7TA 1ELCA 4ZXXH 3TPIZ 2ZHWH 4B1TA 3LDXH 3PRBA 3QWCH 2OCVB 4NWLA 5T6FA 1T31A 1YBWA 2HLCA 1V2NT 4JZ1A 4OS7A 2JJ1D 2UWOA 4H42U 1KMHB 2JDID 2ZCHP 1H8HD 1HFDA 1W7XH 5KECA 2PTCE 1GBBA 1A5GH 1Y5BT 1OOKB 1P06A 4XE4A 3SU3A 1O5DH 1DWDH 2FYRA 2ODYB 2R0LA 4F49A 5ETXA 1WV7H 1HAXB 3NUMA 1VGCC 5IK2D 1L0ZA 1MZDA 1FJSA 1O3BA 3S69A 5L6NH 2FDAA 5FCRA 4ZHAA 1ZLRA 2Y81A 3PB1E 1CQQA 2KZ4A 4TPIZ 2ZHEH 3UTUH 1BHXF 1OXGA 1UVOA 4XBCA 1NBME 4MG3A 1GHVH 1Z8RA 2Q6FA 4D9QA 1AE5A 3EGKH 4B71A 4WVPE 3ZZ5A 1KLJH 2B5TB 3BIVH 5HGGA 5T3HA 2VIQA 1BT7A 1TABE 5K0HA 7LPRA 1AUTC 2FPZA 1VZQH 3QZRA 1O3IA 1SGEE 1P3CA 3OEED 1Y3VA 1V2JT 2BMGB 2CN0H 1IQEA 4X0WU 1O38A 4WY3A 1NRQH 1GPZA 3OEHD 1GI4A 3M7UA 1FONA 5E2PA 2VNTA 1GHBF 2H5CA 1ELVA 1QA7A 2FI3E 1FN6A 1O30A 1NBMD 1WQVH 1O5CB 2BDYA 5FL7D 3DUXH 4X6NA 4UEHH 1MBMA 3DT0H 4K5ZA 1O2NA 1XKAC 2WSSD 1O5AB 3FZDA 5B6LA 3RXUA 3UNRA 1TRYA 1HNEE 1SGRE 1A5IA 1ZMJA 4Y8ZA 2CF8H 4OM9A 1O2LA 3CENA 3P70B 5AVDA 1HGTH 2ZGXH 2D8WA 3A87A 4WJG2 4AFZA 1F2SE 1EKBB 1YP9A 8GCHG 2YNBA 1QBOA 1ZPBA 3M5NA 1PPCE 5FAHA 2A4OA 3L6PA 4K8BA 2ZA5A 3T28A 2Y80A 1G30B 4I32A 1H9HE 2ZNKH 1GBLA 4YZUA 2ZFRH 1F0SA 3NPSA 1TMBH 1LO6A 3VB5A 3K6ZA 4P00A 4Z0KA 3ZYEA 2Y6TA 4B6FA 3ZZ7A 1TQ0B 2PV9B 1LTOA 1J14A 1D6RA 5EOKA 1SG8B 3JZ1B 1SLVB 4X8SH 2FOAA 2LELA 1S81A 1MTVA 1UTPA 3ESTA 4ISIH 4NZLA 2GCHF 1SFIA 4RSPA 1QJ1B 3SU0A 5CHAC 3U8OH 4CBOA 1T7CA 1ELAA 3NXPA 1OSSA 5JBAS 2LP6A 3SNCA 1JWTA 3ZZ8A 1ZGIA 1ANEA 3VB7A 4MPUA 1H1BA 1X7AC 2J94A 3FP8E 4DURA 2BY6X 2QXJA 2QXIA 5IDKA 2W6JD 2J34A 1K1IA 1ELFA 1O32A 2XCFA 1J15A 4K60A 5HXFA 1YGCH 2VH6A 2JH5D 1OKXA 4A7IB 1HAIH 3MH4A 1BRBE 1O5FH 2GCTB 4DOQA 1V2ST 2YMSD 1HAVB 2ZDKA 1IAUA 1O2WA 2PLXA 1VKYA 3KQCA 4X2VA 1O5BB 2HNTC 1F92A 1PQ7A 2R9PA 1NM6A 4Y76A 3ZZDA 2QXHA 4GAWA 1TBRH 1NZQH 1P04A 4J2YB 1ID5H 2QV1A 1QJ6B 2ZU2A 1TYNA 2VB0A 1L1JA 3EQ0H 1COWD 2Y7ZA 2RG3A 3TNTA 2JH0D 1YPEH 3BTHE 3RM2H 1JIRA 4YO9A 1PPZA 2WV9A 1TB6H 2GZ9A 1THSH 2W6ID 2OC8A 4TYDA 3OU0A 1AMHA 1DPOA 1UCYE 3O8DA 2SGQE 4I8LA 1W13U 4DJZB 5AFYH 2AGGX 1ZRBA 1KXBA 1NO9H 3PLKA 3RLWH 1FY8E 3Q00A 1O33A 1VCPA 6CHAC 4I33A 5DG6A 3MU8A 2CJIA 1TE0A 4NIWA 1SGYE 1FV9A 1EPTC 5A0BA 1MTSA 1NN6A 3CS0A 3DFJA 3LH1A 1AN1E 2ZCLP 1TMTH 4CRBA 4PROA 1UTOA 1A0LA 3EE0B 1C2JA 1D6WA 3AASA 1QHRB 1HPGA 1MAXA 3ZVDA 3F9FA 2SGPE 3T62A 2GV7A 2UUJB 3TLOA 1MQ6A 2FLRH 1NESE 4IC5A 4X8UH 6GCHG 3KHVA 3EA9A 3UREA 2D1JA 5JB9S 2Z94A 3OSYA 5C67A 3ZZCA 5DP5A 4XSKU 1GHAF 3Q77A 1O2VA 1IQIA 1E35B 1O2SA 2WPMS 1DSUA 5AF9H 1DXWA 8LPRA 1Z71A 4IW4E 3A81A 2OBQA 2F9PA 1XUIA 1GDNA 2FESH 1GJDB 1VITH 4XFQA 3TK9A 2BYAX 5GCHG 4M9FA 1SB1H 2Z9LA 4B74A 4UD9H 3MO6A 4VGCB 1TBQH 3E0PB 1O5GH 1O37A 3GOVB 2OD3B 3MNXA 3VG8A 3ZVBA 1Z1JA 1FXYA 3H7OA 3TGIE 3PMBB 4X1SU 4X8VH 4AYYB 1SR5C 4BAOB 2F43B 3ZZ6A 3HK6B 3RXCA 1Y5AT 2QC2A 3P6ZB 3Q76A 1C2EA 2R0KA 2FTMA 1EAWA 1KIGH 1GJ7B 1EUFA 4K3JA 2F83A 3FOAA 3M61U 4IGDA 3SU1A 2FX6A 2P3FH 3RXDA 2F9NA 4B76A 1AE8H 4ABAA 3C1KA 4KTUA 2CHAC 4X1QU 2G8TA 3O8CA 3TVJB 1E1RD 3I78A 6LPRA 2FEQH 2ZPSA 1QCPA 1P9SA 4AGJA 1KLTA 4NGAH 3URDA 4FU8A 1DY9A 5JBTA 2CV3A 4RT0A 1RFNA 3ATIA 1HLTH 1O3HA 2ODPA 2TIOA 2NWNA 3U8RH 1TPPA 2BX4A 1CBWB 3GS9A 4DCDA 4NG9H 3SU5A 3SNEA 2QE7D 3SYJA 1O2XA 1H8IH 1ESBA 1DWBH 1RRKA 2C93B 2A31A 4GCHG 4NWKA 1A2CH 1S0QA 1NRNH 2VIDA 5AFZH 1F5KU 1TMUH 1OYQA 3A8DA 3KQEA 1SLXB 4Y7BA 3KQBA 3WWBA 2AMDA 3SUEA 2ZU4A 2VWMA 5T1VA 2ZZUH 3RC5A 3RXLA 1UTQA 4CRFA 3E16B 5LH8A 1C1TA 3OX7U 1YCPM 1RXPA 4DIIH 4X6OA 1ZHMA 3KGPA 2ZDNA 1MTNB 2WYJA 1C2DA 1W7GH 1YCPH 1SGPE 2SGEE 3BG8A 2Z3DA 1JOUB 4AG1A 2GX4A 3ITIA 1DITH 2KCPA 2VU8E 1MKWH 3QN7A 1ANCA 2PW8H 1O2GH 3LPRA 4TWYA 3A83A 3VGCB 3MTYA 2BDHA 3P95A 2R2MB 2JETC 4Q80A 4P02A 1JRSA 2FOBA 3MNCA 3PV2A 1RIWB 1WBGB 1PQAA 2QY0B 2NU1E 2PKAB 3F68H 1ZSKA 1GJ4H 1W12U 1KXAA 2PSXA 5E2OA 1F0RA 2ZFFH 1YPMH 4NFFA 3SV7A 2XTTB 2ZPRA 1A61H 1HUTH 3SQHE 1Y8TA 2FOFA 3FN8A 2OC0A 3MFJA 1F0TA 4GHQA 2XBWA 2XNIA 3RXTA 5HMAA 1F0UA 2XW9A 1QA0A 2PUXB 2CHAB 5HIYA 1ELGA 3K2UA 1F7ZA 3B8JA 5JBCS 2PHBA 4LZ4B 1C1VH 3B9FH 4OS1A 5BRRE 5EQQA 1OP0A 2YNAA 3UNSA 1FY4A 2RA0A 1O36A 1CO7E 4ZROA 1BIOA 1ETRH 1FUJA 4U32A 5KEDA 4BOHA 2AFQB 2B9LA 1V2OT 1HXFH 3BSQA 1EP5A 4AZ2B 1OWDA 3PM3A 1HAPH 4IS5A 5FPTA 1K1LA 4CH8B 2IPQX 6ESTA 4A5TS 2J98B 1Q3XA 1INCA 1AKSB 1BCUH 2BDCA 5JB8S 2PR3A 2NU2E 1UK2A 1TRMA 4O9VA 3T2NA 4THNH 3BTTE 3S0NA 2V7QD 5DP8A 1NROH 2HPPH 2YOLA 3SGAE 1O3OA 1ELTA 4O97A 3SBKA 3TIUA 2GT8A 2BB4A 1ZZZA 4A1XA 1E34B 3PWCA 3EA7A 1P2IA 2FZZA 2J5UA 3W95A 1LHGH 2AEIH 2DUCA 2HOBA 1EJMA 1JMOH 3F0OA 3N7EA 3DCLA 1GMDF 1YPJH 1W0JD 2J97A 5C1UA 1NFXA 4Y71A 1GI9B 4J1YA 1CGJE 1SVPA 4LXBH 2ZGJA 1QRXA 4H6SB 2ZIQH 1C9TA 1NT1A 1SPJA 1BJUA 1TGTA 5E0HA 3RP2A 2ZHFH 4FU9A 1AVXA 1YF4A 1S84A 2BHGA 1O3FA 3G01A 1TX7A 1ACBE 1LDTT 2M5TA 1O39A 4Q2KA 1TGNA 4B2AA 4MNXA 2EEKA 1W0KD 5K7RA 1AFQC 2IOTA 4IMZA 2SNWA 1E38B 1EOJA 1T8LA 1EZXC 1IQNA 2WPLS 3A7WA 3OYPA 3T26A 1TPAE 1TGCA 2GT7A 1GMHF 5L2YH 1ZJDA 5A0AE 1O2IA 4SGBE 3E90B 2ZTYA 1P2QA 1Y5UT 2PGBB 4O03A 3O8BA 3I29A 1HAHH 3UR6A 4BTUB 1J17T 5EXLA 2JETB 3SNDA 1TNKA 1L1GA 1EXFA 4RT1A 2ZECA 1QL9A 3PYHA 1CGHA 2ZPQA 7GCHF 1GBKA 2IJOB 4B2CA 1P02A 1TQ7B 1K1OA 3URCA 3V12A 2OK5A 1IQFA 1MBQA 2F9BH 2BQ7B 1KYNA 4HZHA 2A32A 3KYFA 4ABIA 2BLOA 1AZ8A 1BRUP 1NU9A 1O2HA 2G55A 1GI3A 2HPQH 2ZU5A 2AIPA 3GCHC 4ASHA 3BTWE 5PTPA 5C0TA 1A1RA 5FXLA 4I8HA 3SV2H 2VWLA 1RIWC 5EW1H 4TWWA 1A7SA 1L2EA 3PMJA 6GCHF 2HWLB 1UO6A 4ABGA 2ZG0H 1XUHA 5FBIA 2G5NA 4ACBA 1S85A 3E1XB 2WPHS 4RI0A 2I6QA 1JXPA 1SOZA 1NTPA 1HYLA 5C2ZA 3GY4A 2HLDD 4ACAA 1C1QA 1DM4B 1VGCB 1GVZA 3BG4C 3A8BA 5F53A 1C5PA 2PKSB 2ZI2H 3H5CB 4JYTA 5C17A 3QDZB 1LKBA 4FVBA 1G3EA 1OPHB 3RXPA 2B8OH 4ZUHA 2XBVA 2QF4A 1N6XA 1MCVA 1M9UA 5LPRA 2KFWA 1GMHG 1PYTC 2BZ6H 3VFEA 4Y0YE 2BVXH 2AGIX 2G4UA 2QAAA 3RXVA 3F9GA 1K2I1 3U8TH 4E7NA 3A7XA 4RN6A 1TPSA 5EPYA 3B23B 2GCTC 3UWIA 1GGDC 1QL8A 1W3CA 2JKHA 3GY3A 5C1XA 5A09A 1B7XB 1VJ9U 2TRMA 1FLEE 2WZQA 4A92A 1MKXH 1AHTH 3OTJE 2A4RA 1UHBB 1Y59T 1CE5A 3HATH 3HGNA 4GVUA 2XOKD 4YOGA 1MCTA 5E0JA 1C1SA 1C4V2 1SLUB 2BY7X 3FZZA 2W3IA 1C1NA 2K1QA 5DN6D 3TJUA 1C5LH 3LGUA 1QY6A 4INLA 3D65E 4Y8XA 2VIOA 2XC5A 3EE7A 3T27A 4JK6A 4XOJA 2AMPA 3UQOA 2LNCA 2FMJA 4FUIA 1YLDA 3BTDE 5H4IB 4JZIA 4BAQB 2FM2A 3PTBA 4M7GA 4AGKA 1ZPZA 3NZIA 2KCOA 1AQ7A 2PSYA 1ZTJA 1J8AA 2STAE 1QURH 4MTBA 1V6DA 1BTHH 2F3CE 4KP0A 4AOQA 3MQKC 3ZVGA 1KY9A 4FUCA 3ZZAA 3RXMA 2WUBA 1GI8B 2Z3CA 1QTFA 4NFEA 2LIZA 1T4UH 4GHTA 2EI7A 2XXLA 3CS7A 5EJZA 1XVMA 3GY5A 1XUGA 3ATMA 1OP8A 1Z6EA 2FOEA 1YCPK 3GCHB 1P10A 1LHCH 2BDIA 1O3DA 2UWPA 2XNDD 1DS2E 1GBTA 5DPAA 3MH5A 1EOLA 2JH6D 1DSTA 2VJ1A 2VWNA 3KN2A 1FAKH 3W94A 2GD4B 5IYTA 1P11E 4JYUH 1GJ8B 4ZKRU 2B0FA 1MMJN 3OFND 1VITF 5CE1A 1NC6A 1LKAA 1IQJA 2ZFSA 2VINA 4ZKSU 1P0SH 4R0IA 1GVLA 1A3EH 1DOJA 3A7ZA 5HM2A 1CU1A 5JYIA 1G32B 5EGMA 1V2LT 3OTPA 2IN2A 1RJXB 1TOCB 1D3PB 1THPB 2V35A 2LPRA 1NU7B 2H6MA 2O8LA 1YKTA 3P8OA 2OLGA 3F3BA 3BV9B 3GY2A 4XBDA 3SI3H 2XBYA 1JRTA 2QXGA 2P59A 2GMTB 1O2OA 2VIWA 3NCLA 1GHXH 1HAVA 1BTUA 1LVMA 4HGCA 3KYGA 1W8BH 2A5IA 3ATWA 3SJIA 1SGTA 1EZSC 3SOSA 4RKJB 1HV7A 2QF5A 1SBWA 3EYDA 3FKSD 1NRPH 2BY8X 3P8GA 4DY7B 1FIWA 4B6EA 1QQ4A 1XM1A 4NZQA 1DE7H 1T8OA 5DP9A 4D7GA 1DLEA 1ARCA 2ZQ1A 2H9TH 1D9IA 2TGTA 2VIVA 3RXGA 5HM9A 2BLVA 1SGDE 2J9NA 4DG4A 2PKAA 5EPNA 1YLNA 2FS8A 1S83A 1CA8B 1GG6B 3PLPA 1G2LA 1ZTLA 1P2OA 1GG6C 3C27B 4XBBA 1QNJA 3UPEA 3NKKA 3E3TA 1JBUH 1PQ8A 3FFGA 3KCGH 1H8DH 3BEIB 3BN9A 5DP6A 1AB9B 1BB0B 1YPLH 8KME2 4MPWA 3SUGA 1DWCH 2STBE 2A5AA 2G4TA 4YT6H 4WXIA 2XC4A 3DD2H 1AY6H 1DVAH 1EPTA 1TFXA 1B5GH 5C0UA 4MPXA 1TAWA 5ESTE 2BD4A 4AC9A 3M37A 1SQOA 2ZTXA 1Z8JB 1YPGH 1C1OA 3PV5A 1S6FA 5J4QA 1EZUC 2EY4C 2KCAA 5C1YA 4OS2A 1BTWA 1BMFD 3MHWU 1AFQB 1O2TA 1BA8B 1P2NA 1QIXB 4X2WA 5T6GA 5LPFA 1O2QA 3SUDA 1E36B 3UOPA 4MLFB 1P12E 4TY6A 1RTKA 4GCHF 1HAOH 2ZFQH 4UFGH 1UW7A 1P2JA 4ABEA 1UCYK 4JMYA 4Z1MD 1OYTH 4ZHLU 3FP6E 3F9EA 4BTTB 4E06H 2W26A 3LJOA 3LGTA 1KTTB 3ZZ4A 4ZHMU 1GMCG 2P3TB 5EODA 3LJJA 2AERH 4NIYA 2KM0A 1O2PA 5G4BA 1EJAA 3M3VA 1O5EH 1LVYA 3ZYDA 3F1SB 4MPVA 2GCHG 4TY7A 3SU4A 1L4DA 4CRCA 2OQ5A 3SN8A 4I7YH 2V0BA 1V2UT 1DUAA 3QZQA 1GI7B 1BTYA 2J2UA 4ZH8A 1V2PT 1MKWK 3TH3H 2C8YB 2XBXA 1HJAC 1SGIB 3K65B 3GY6A 1IQGA 1HRTH 1IQLA 1RS0A 2OINA 4D8NA 1W11U 3RXKA 3V13A 3PRDA 3K9XB 2W3KA 1K1PA 3PROA 1GWAA 1TGBA 4TSFD 2KX4A 1MTNC 3LIWA 3TJVA 2AMQA 1GJBB 1GL1A 1MD7A 1P57B 4ABFA 3ATKA 5GCHF 2QF0A 3EBNA 2A7CA 1QRWA 3A89A 3TH4H 3UR9A 1ELEE 3BEFB 2HRVA 1Z1IA 4GUXA 1BMAA 1O3MA 1C4Y2 4UFFH 2XWBI 5CHAB 2BD5A 2BLWA 6CHAB
chains in the Genus database with same CATH topology
2ZGHA 2BX3A 1BMLA 2G00A 3ZVEA 1PPEE 1ARBA 3SHAH 2ESTE 3VB3A 1PPFE 2WPIS 3SNAA 2C8WB 1TWXB 1V2VT 4ABJA 1O3AA 1SLWB 4FUBA 1IHSH 1DT2A 4FUGA 4UFDH 5ABWA 1KXEA 5FBEA 5T6DA 4BXSA 1L1NA 1GJ6A 2BVRH 3HGPA 3S9BA 1YM0A 1AU8A 4IBLH 3VEQB 3VGCC 3GCNA 1TALA 1PFXC 2Q6GA 1IHTH 3T5FH 1CA0B 3P17H 1C5UA 4ISOA 1KXCA 2IPHA 2UUYA 1MAYA 2ZF0H 4D7FA 1V2KT 2XYAA 4DVAU 3GCTG 3RMOH 4B75A 5JDUB 3LU9B 1CT2E 1Q2WA 3KF2A 4DIHH 1SGNE 3KNXA 2O8WA 1GHBG 1GHAG 2ZDAH 3SW2B 1HAGE 1A46H 1P2KA 4KKDA 2BZAA 2WV5A 2XC0A 1K28D 1AGJA 1AKSA 3LGIA 3N7OA 4ISHH 1HCGA 2GDEH 3O8RA 3RLYH 2BQWB 3RXQA 1B0FA 2SFAA 1ZJKA 4A1VA 1ESAA 1QRZA 4NSVA 2FOHA 1UHBA 1EATA 3TJNA 3H7TA 3GYLB 2GV6A 3ELAH 1FY3A 1TONA 1SHHB 4K1TA 4YESB 1RTFB 1O3JA 1S82A 4I8KA 5DP3A 2PUQH 3D23A 2VVCA 2OBOA 3MWIU 2G51A 1SFQB 5DJ7A 1LHDH 5GPIB 1KLIH 2GKVE 3MOCA 1AVGH 4K2YA 5EQSA 3FP7E 3EDXB 4CBNA 1ZHRA 3KQDA 2R3YA 2SGAA 3U69H 3PWBA 1SGFA 1WTGH 1OP2A 1BBRE 2Y5GA 1Z8GA 3ZVFA 4NIXA 3ZVCA 3UWJH 3RU4E 2VWOA 4AX9H 2A4QA 1YYY1 2BOHB 1UTNA 2AGEX 1GJ9B 3BG4B 3E91A 4KTSA 4NIVA 5L30H 1GHYH 1EAXA 3RXFA 1GHZA 1QBVH 2DE8A 4DGJA 3RXSA 1BRCE 1J9CH 1MU6B 1PPGE 2A45B 4YT7H 1OWEA 4NA7A 2V3OH 5GJ4B 4CREA 1MUEB 2A2XH 2H9HA 1QFKH 1O3CA 2OXSA 3RUOA 1LMWB 4U01A 1MZAA 1QJ7B 4ABHA 2VVVA 1KDQB 5FPSA 1L4ZA 4CHAB 1OWJA 5EXNA 1O2RA 2J95A 1AUJA 4QT8C 4YLUA 1A0HB 2WYGA 3RC6A 1E37B 3DHKH 2ZP0H 2VVUA 2ZFTA 1VCQA 1O2MA 1SSXA 1GBAA 2ALPA 4BTIB 3UOUA 1GBDA 3AVZA 1FMGA 2FOCA 1EP6A 1O3KA 4X6MA 1AWHB 4Y0ZE 1V2QT 2SNVA 1CT0E 2FODA 1LHFH 2FYQA 2GGVB 1Y3WA 4OGXA 1K22H 3GCOA 1S6HA 3P8FA 4H6TA 1UK3A 1LPGB 1QBNA 4IC6A 2VGCB 1K1MA 4D9RA 1GI0A 1NS3A 2Z9JA 2FXRA 1OX1A 3PO1C 2VIPA 4KELA 4WMFA 1FY1A 1EAUA 2Z9IA 3M7QA 1AO5A 1ABIH 4VGCC 2PKSC 1LPZB 4NA8A 5DP7A 2FOGA 1ZMNA 3SU6A 2BXTH 2F9UA 3PMHB 1P8VC 3U1IB 1FZZA 1TNIA 3BF6H 5E0GA 4Z6AH 2ZHDA 3RC4A 1AIXH 1SHYA 1O3NA 1ZYOA 1Y3UA 1TGSZ 1O34A 2FO9A 2WPJS 1CHOF 4A1TA 1NY22 3DFLA 4E05H 9ESTA 3VXEH 1V2TT 3SV8A 3ODDA 3NWUA 3PMAB 1BTPA 2UUFB 1QB9A 1AD8H 2HGTH 2FS9A 3BIUH 3ZZ9A 1D3TB 1SQTA 2P94A 1CBWC 2ZWLH 3SORA 1H4WA 5JPMH 2WV4A 1NFWA 3SGBE 1LPKB 3VB6A 1BHXB 4K8YA 1BOQA 1BJVA 2V6NA 1TX6A 2J92A 1GI2A 3TITA 3QO6A 4K69A 5LGOA 2I6SA 1N1LA 1WYKA 1XMNB 2THFB 3T25A 1VR1H 1ZPCA 4ESTE 1MQ5A 2F9OA 4BXWA 1V2WT 3LGWA 2ZFPH 4FUJA 1NFYA 1OWIA 2WPKS 3SO3A 2QYIA 1O3EA 1W14U 2Y82A 3E0NB 4AORA 1C2HA 3AAUA 5A8ZA 1O31A 3OY6U 2BTCE 1WTHD 1CT4E 1YC0A 2Z9GA 1D4PB 1TNLA 1C1UH 2J38A 1GBEA 1IQMA 4AFUA 1C2GA 1WU1A 1EB2A 4MVNA 5EQRA 1GBMA 2RCEA 2GP9B 3RU4D 2O9QA 3MH7A 1Y3YA 1QGFA 1A3BH 5C5NA 1FN8A 3HKJB 1UVTH 4MNYA 2Z3EA 3ODFA 1T8MA 4BAHB 1YPHE 2CGAA 1TNHA 1O35A 3LGYA 3EA8A 1FDPA 4OS4A 3RXJA 3TJOA 3ZZBA 3U98H 1HJAB 1TIOA 1DUEA 4UDWH 1Z7KA 1W10U 3QUMP 3K6YA 4JCNA 4WWYA 3AAVA 1GCDA 2ODQA 4JYVH 2ANMH 1D3DB 2FLBH 2O8TA 1FI8A 1C2KA 3FAOA 1V3XA 1P09A 1ZOMA 4FUDA 2A5KA 4UE7H 1G37A 1W0YH 2W7UA 7GCHG 2BY9X 1N8OB 5B6OA 1O3GA 1ZSLA 4AFQA 4GSOA 4FXGH 2C4FH 5A2MH 3SV6A 1HDTH 2F9VA 3M35A 3GY7A 1CVWH 4BAKB 4X2XA 4UONA 1TRNA 4O3UA 3A85A 1OWHA 1ELDE 4Q7XA 1AFEH 3SHCH 3D62A 1K1NA 2ILNA 3MO3A 1V2MT 1C5RA 1BBRH 1MD8A 1TOMH 2ASUB 3MU4A 5I25A 2DE9A 2AYWA 3SJ8A 1UCYH 1DLKB 1NRRH 1LVBA 4FVDA 3M5OA 3IG6B 1G3BA 4YLQH 4MQAA 3SNBA 4JZDH 1QQUA 3LKWA 3Q3KA 2P93A 2R2WU 3RU4T 3SI4H 1BUIA 1D3QB 1GBFA 1TNGA 4YTAA 1G3CA 3T29A 3E8LA 7KMEH 2H2ZA 1EB1H 1B0EA 3BTEE 1UJ1A 4ZXYH 5CMXH 1Y3XA 1O2JA 5A8XA 3BTFE 2BD2A 3QGNB 5E8EH 1ANDA 1UVSH 2ZDVH 3GDSA 1C2IA 1C1RA 3E6PH 4X8TH 2EC9H 3BTME 4BNRA 4KTCA 3UUZA 3LOXA 1MTWA 1S0RA 2XCNA 3A7TA 5FHTA 1C5OH 2C90B 3HK3B 5AHGH 3CP7A 1GGDB 2ANKH 3PO1B 3F9HA 1HIAB 1JIMA 4H4FA 3U9AH 1YLCA 1ZTKA 2QN5T 3BTQE 3RXAA 1C5ZB 2GZ8A 4ABBA 3KIDU 2BD7A 1XUFA 5F6MA 2NU0E 1BTXA 3RXHA 1GI6A 4AG2A 2ZEBA 3UQVA 1E0FD 1IOEA 1CHGA 1ZSJA 2CMYA 2BY5X 4Y11E 1GDQA 5GWZA 1GBHA 1NRSH 1UK4A 5ESBA 2P8OB 4BANB 1ZR0A 5TJXA 1XX9A 3JZ2B 2FOMB 2HNTE 1O0DH 1O3LA 1J16A 3R0FA 1BTZA 2UUKB 3BEUA 4CR5A 1EZQA 2QGRA 3RXEA 3A8AA 4D76A 2BXUH 4WMDA 1C2LA 2WUCA 4KGAA 1C5QA 2O8UA 1O2KA 2OC1A 5GXPA 2OQUA 3BTGE 1FQ3A 1KXFA 1ZRKA 4CRDA 1XXFA 3PTNA 5L2ZH 3TK5A 2HNTF 1KSNA 1HJ8A 1C5YB 1P2MA 1C1WH 1SGCA 1TNJA 2Q1JA 5EU8A 2BDGA 1HIAA 1GBJA 4IN2A 2GTBA 3TNSA 3GYMA 7ESTE 3RXRA 1DANH 2TGAA 1AZZA 2BDBA 3F6UH 4FUFA 3UNQA 4NCYA 1HAZB 1MH0A 2BM2A 1SI5H 1SOTA 1GMDG 2BD3A 4ZKNU 1KXDA 4SGAE 3SJ9A 2P16A 1TLDA 2RA3A 1C5SA 3MU5A 3KEEA 5DK1A 1VJAU 3RMNH 2A0QB 1GI1A 1C5MD 5F8ZA 1TA6A 1RD3B 1T4VH 5DP4A 1N8OC 1W2KH 2PTNA 1FPHH 1HXEH 2ZHQH 4ZAEA 2OP9A 4JZEH 3SUFA 3LC5A 3LH3A 4FUEA 2ZC9H 3SJOA 1AWFH 1OS8A 2AH4X 2ZTZA 2ULLA 4YM9A 5SGAE 2GMTC 3ZZ3A 2OTVA 2NU3E 3LT3A 1LQEA 3SGQE 8GCHF 2EI8A 1EAIA 3AW0A 1SQAA 1XUKA 3UFAA 2GVFA 2QIQA 2ZQ2A 1FNIA 1Z8IB 4AYVB 2P8OC 3QK1A 3LC3A 3RXIA 1BRAA 4JK5A 1BMNH 1P3EA 4X6PA 2ZU1A 4INKA 2W7SA 4FU7A 3M5MA 2Y5FA 4HFPB 1ZHPA 1MTUA 4MNWA 1ETTH 3QGJA 2C3SA 1GJ5H 2QF3A 2ZGCA 4O3TA 3TU7H 2TGPZ 3QX5H 1DY8A 4AB9A 1GHWH 2FP7B 1K21H 2ALVA 2SGFE 4ISNA 3OY5U 5EW2H 4LZ1H 1SL3A 1QR3E 1GJCB 3Q3YA 2O8MA 3A80A 3QLPH 2AS9A 3MO9A 4OGYA 3GDVA 4X1NU 4DW2U 1GJAB 3STJA 2NU4E 1O2UA 1C9PA 4MNVA 1LQDB 1THRH 1A0JA 2ANWA 1GBCA 3M5LA 4Y6DA 2SGDE 2A4GA 3M3SA 1C5WB 2HVXA 3QTOH 3GY8A 1UTLM 2AIQA 1BBRK 3SJKA 5JBBS 1O2YA 1WQSA 2ZU3A 4WH8A 1C5TA 5F8XA 2H1UA 4AB8A 1LHEH 1PJPA 1EASA 1UTKA 3RXBA 2C8ZB 3IWMA 3GISB 1QL7A 2CXVA 1P9UA 1FY5A 1ORFA 1O2ZA 1G2MA 2HALA 2Y7XA 4X2YA 2XRCA 4I8JA 4XDEA 4OS5A 1NFUA 1WOFA 2PGQB 4NA9H 2TGDA 2P95A 2GDDA 3GCTF 1CHOG 4LK4A 1Q31A 5A0CA 1RTLA 3D49H 4NSYA 3LONA 5A8YA 1UTMA 3STIA 3SZNA 4X1PU 3S7KB 1IQHA 2CF9H 4CH2B 4LOYH 3QTVH 3Q3XA 4X1RU 4HI3A 1OWKA 3MI4A 1QB6A 2G52A 1DX5M 1YPKH 5FX6A 2C8XB 2OUAA 4I8GA 3V0XA 1UVPA 1T8NA 1XUJA 1EX3A 1BMMH 1AB9C 1ABJH 2H5DA 2H9EH 4JZFH 1QB1A 2Q6DA 1WCZA 3UIRA 3ZV9A 5HYOA 1ZMLA 5I46H 3TGKE 3S7HB 1KTSB 4Q7YA 4B2BA 1P05A 1HAYB 1NPMA 1DDJA 3RM0H 5LPEA 1C5VA 3NK8A 1TX8A 2XWAA 1EQ9A 3M36A 4FUHA 3I77A 3A88A 2BLQA 2FX4A 4I31A 4IMQA 2VH0A 2RDLA 5GDSH 3P92A 1ZGVA 1DICA 5TCCA 1HBTH 4BAMB 2KAIA 2TPIZ 3ZV8A 2A2QH 1TBZH 4CRGA 1CGIE 4CHAC 2ZGBH 4MDSA 1MU8B 3AW1A 1S5SA 1SMFE 3P8NA 1ESTA 1VITG 3A7VA 1U6QA 1K9OE 1N6YA 2EI6A 1SC8U 2EA3A 1C5XB 1FAXA 1IQKA 4Q7ZA 3RMLH 4ISLA 2P3UB 1O3PB 5C5OA 5EG4A 5BPEA 3SU2A 3ENSB 3LGVA 3VB4A 4YOIA 5C3NA 1ETSH 2ZDLA 4A6LA 4B73A 2A7JA 1EPTB 3A8CA 1UMAH 1C5NH 1W0ZU 5FCKA 2QCYA 5DKMA 2V3HH 3BTKE 4AN7A 2J4IA 2KAIB 4U30A 3A86A 1XKBC 3V3MA 4GPGA 5F8TA 2FI5E 1C1MA 3PLBA 1SGQE 1DWEH 2BD9A 1PQ5A 1WUNH 2FIRH 1ELBA 2W5EA 1CA0C 3VPKA 1CSOE 4WH6A 3ATLA 4HTCH 1GVKB 3S9AA 3S9CA 3A7YA 3MU0A 2GZ7A 4AFSA 4WMEA 2K7XA 1PPHE 2VGCC 3RXOA 1RGQA 5EXMA 4TPYA 3HKIB 2BDAA 2Z6BD 1PPBH 4WF8A 2FWWA 4IN1A 4UFEH 5TCAA 3ZVAA 1GCTC 1SGFG 1DFPA 1F5LA 2Z9KA 2A7HA 4Y79A 1G9IE 4F4OC 2PWXA 1VCWA 3VXFH 1A4WH 1GL0E 3PV4A 3A82A 3UY9A 2BVSH 2ZCKP 2R3UA 1GI5A 9LPRA 3IITA 1F5RA 4YOJA 2ANYA 4U2WA 5FX5A 4K1EA 1C1PA 1G3DA 2ZDMA 1BDAA 2WINI 1V2RT 2FTLE 8ESTE 2B7DH 3HPTB 5F03A 2BD8A 2OC7A 4K1SA 2D26C 1GMCF 3MH6A 1K1JA 1UTJA 1P03A 3A84A 1C2MA 1DXPA 4ZKOU 3FANA 4GLYA 1HJ9A 3SV9A 4CRAA 1TPOA 3MU1A 3GDUA 1XXDA 1H9LB 3WY8A 1GBIA 5GIBA 1LCYA 2PFEA 3L33A 2Y5HA 5DO4H 4CR9A 1C4U2 3DA9B 4INHA 1FIZA 2TBSA 4Y8YA 1BQYA 4RKOB 3U1JB 5C20A 1WAYB 4WXVA 3SQEE 2FI4E 3TH2H 5DGJA 4E7RG 3MYWA 2ZKSA 4ABDA 2UWLA 2G81E 3TK6A 3V7TA 1GCTB 2A1DB 5FPYA 1WSSH 4R8TB 4DT7B 1ANBA 1T32A 1G36A 3M3TA 3MNBA 3L3TA 2QA9E 1PYTD 1A5HA 4Y10E 1AVWA 1YPHC 1C2FA 1GDUA 1FPCH 1Z6JH 2BQ6B 3KL6A 3RMMH 1LVOA 1EJNA 2Z7FE 1BITA 3TGJE 1KDQA 1TA2A 3MMGA 1AI8H 1HB0B 1XVOA 4Y7AA 3GICB 2G5VA 3R3GB 1H9IE 2ZO3H 2BOKA 4ZMAH 1P01A 1MKXK 2F91A 4OS6A 2D2DA 3RDZA 1BZXE 5J4SA 1UVUH 3FVFB 3EAJA 3MNSA 3M7TA 1ELCA 4ZXXH 3TPIZ 2ZHWH 4B1TA 3LDXH 3QWCH 2OCVB 4NWLA 5T6FA 1T31A 1YBWA 2HLCA 1V2NT 4JZ1A 4OS7A 2UWOA 4H42U 2ZCHP 1HFDA 1W7XH 2PTCE 1GBBA 1A5GH 1Y5BT 1OOKB 1P06A 4XE4A 3SU3A 1O5DH 1DWDH 2FYRA 2ODYB 2R0LA 4F49A 5ETXA 1WV7H 1HAXB 3NUMA 1VGCC 1L0ZA 1MZDA 1FJSA 1O3BA