1G3DA

Bovine beta-trypsin bound to meta-amidino schiff base copper (ii) chelate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic analyses of complexes between bovine beta-trypsin and Schiff base copper(II) or iron(III) chelates.
pubmed doi rcsb
molecule keywords BETA-TRYPSIN
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3dA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3dA02
2QY0B 1BMLA 5DJ7A 3K6YA 1TAWA 2F83A 5K7RA 1GVKB 3Q77A 3QTOH 2FXRA 2O8TA 1C5MD 1C1MA 4O9VA 5HM2A 1O37A 1C5NH 3LC5A 3TLOA 4E7NA 4FU7A 3KQBA 1UTNA 1HYLA 1YPHC 3SGQE 3SUDA 1SG8B 1MMJN 1C5YB 1BTHH 4H6SB 3TGIE 1GBMA 1SGFG 1QGFA 1P8VC 5C1XA 4DY7B 3SJ8A 1ORFA 1AFQC 2GT8A 3GICB 1SPJA 2EI7A 1A46H 1DY8A 1SGRE 1GDQA 2JH5D 3ATIA 3D62A 1PQAA 4AX9H 4QT8C 1KXEA 3IITA 3TNTA 2WUCA 2PTNA 1BRAA 2BVSH 5DP7A 5BRRE 1C5XB 4KELA 3SU6A 2I6QA 6GCHF 2O9QA 5CE1A 1QFKH 2ZU1A 3HK3B 1HCGA 4AB8A 1YPHE 2STBE 4X1PU 3U98H 3ZVEA 1FPCH 2VIVA 2XRCA 2P3FH 1JMOH 3TH2H 1G32B 1A2CH 1YCPM 2AYWA 4KTCA 1Z8IB 1WCZA 2R9PA 3ZV8A 4ZKSU 1ABIH 1EAWA 2ZDLA 3P17H 3F1SB 3EYDA 4X8VH 2VB0A 3ZZCA 8LPRA 2V3OH 4OS1A 1KLIH 2ALVA 4ABFA 1ZSJA 1YM0A 1JIMA 4MVNA 3JZ1B 2DE9A 1K1PA 1A0LA 3NPSA 5HGGA 1BRUP 1MH0A 2XTTB 2PUXB 2H5CA 3FANA 1TQ0B 2VWLA 2UWOA 3SJIA 5A2MH 1GI0A 7GCHF 1QURH 1HJ8A 1AGJA 1O2XA 1TABE 3GCNA 1KXDA 2HPPH 4WWYA 1DLEA 1TFXA 3M36A 5K0HA 2FOGA 1GMCG 3NZIA 4O3TA 2B5TB 2VGCC 4MTBA 1P2IA 3FP7E 1AB9C 1YP9A 1PQ7A 2ZDKA 3PMJA 1IQIA 3GYLB 3QK1A 2P94A 3EA9A 4DOQA 4FVDA 4XBBA 4Q7YA 1SBWA 2P93A 4OS4A 4YTAA 1OYTH 2HNTF 2W7UA 6CHAC 2BZ6H 1PPCE 2BOHB 1O2GH 3F68H 2O8LA 1HBTH 4F49A 1T8LA 5ESTE 2A0QB 2G81E 4ZAEA 1GBEA 2GKVE 1TGSZ 5G4BA 1GHXH 1V2PT 4UFFH 2HLCA 3RXTA 1GGDB 3NXPA 1GI6A 1S0QA 1F0TA 1OP8A 3MHWU 1QJ7B 1S85A 4AZ2B 2W3IA 2PLXA 2QYIA 4IN2A 1RXPA 2STAE 3VXEH 1F0SA 1JXPA 2GX4A 3RLYH 1NY22 2ZO3H 3TJVA 3B9FH 4R0IA 1P9UA 3BN9A 1OWJA 1O2MA 1W7XH 3SNDA 1SGNE 1O33A 1L4ZA 1CVWH 3GY3A 5J4SA 1BTYA 1WQVH 3BIVH 5F03A 3MNCA 1GI9B 1DWEH 2FX4A 3F9HA 1UO6A 1OP0A 3S9AA 3MNSA 1IHSH 2Q6FA 1FN8A 1HV7A 1NC6A 1Z71A 4BTUB 3SUGA 3LGTA 1AKSA 1D3TB 1P10A 3V0XA 5LPEA 1FLEE 2P95A 1IQFA 1WQSA 5FCKA 4CHAC 2ZKSA 3SJ9A 5C5NA 2WV4A 1JBUH 1ELTA 3KF2A 4LOYH 3SBKA 3Q3YA 1H9IE 1EP6A 2QXIA 1F2SE 4NSVA 1YYY1 1BHXB 1EB1H 2JH6D 4NZQA 1GJ8B 1VITF 3VB6A 2P16A 4XBDA 2ZGCA 3GDVA 4MPWA 2SFAA 1T7CA 1C5TA 1TBRH 1DANH 1C5WB 1PYTC 1RS0A 1JWTA 4Y76A 2FOFA 3SV8A 2BLVA 1SLVB 1LCYA 2FI4E 5H4IB 1ZPCA 4ZMAH 1V2ST 5T6FA 4BAHB 4BTIB 2GVFA 3SUFA 1EJAA 4MNYA 4NA8A 3UUZA 3A7XA 4HGCA 1FAKH 3M3TA 3MO9A 2SGFE 1EP5A 2ZZUH 1C1VH 1G2LA 1EX3A 6GCHG 1N6YA 1NM6A 1P11E 1J14A 4LZ1H 3PWBA 1OKXA 1XKAC 4ZKRU 1O38A 3ZZ6A 3S69A 1CT2E 1FIZA 3KQEA 5I46H 3GY5A 3MO6A 3T62A 1T4UH 1GMHF 1G2MA 3UTUH 1EJNA 2CMYA 4IC6A 3UQVA 4YOJA 2GT7A 4JZDH 5JYIA 1AU8A 1GL1A 2J38A 4I32A 2ZTZA 1CA0C 2ZGBH 4TPIZ 2OC1A 1DWCH 1V2MT 5TCCA 3PROA 3SU0A 3K9XB 7GCHG 2F3CE 1C2IA 5BPEA 2IN2A 1UVSH 3LGVA 2GMTC 4NGAH 4IN1A 1KIGH 1FONA 1KLTA 4CRFA 1A4WH 4Y71A 1JIRA 1WSSH 1TX7A 2ZEBA 2CV3A 1KXAA 3L3TA 1T8NA 1V2LT 1LQDB 4ZUHA 1YPGH 2SGDE 2Z9KA 2PWXA 3QDZB 3D23A 1B0FA 3BG4B 1KYNA 2BD4A 5HM9A 2SNWA 2FDAA 3A85A 1LHFH 4JZFH 4YOGA 1DITH 5DP6A 1O5AB 2CXVA 5GIBA 3BEFB 1S0RA 4FU9A 2BY5X 4INKA 3CS0A 3P92A 1SHHB 3LGUA 3ELAH 1V2QT 5C3NA 3F9EA 2BY6X 5FCRA 4DT7B 2FI3E 4H4FA 1NRSH 4U01A 2WV5A 5CMXH 2A7JA 2ASUB 3AW0A 4OS7A 2XBYA 2YNAA 1CHGA 4K8BA 1NZQH 1JRSA 5A8XA 1D9IA 1EZSC 2BD3A 3GCHB 4UD9H 5GCHF 3HKIB 4K69A 3TH3H 1F5RA 1O2ZA 5GJ4B 1O2IA 5A0BA 1K9OE 1YPKH 2BVXH 1DX5M 4AFZA 3A86A 1ELAA 1ZR0A 1O2OA 4GHTA 4U32A 1GCTB 1L1GA 2OUAA 1TIOA 1UTPA 2OQ5A 3RXVA 3S7KB 1IQMA 3LH1A 3SN8A 3GDUA 1ZOMA 3RXJA 1DT2A 1IQNA 1Z6EA 4X8TH 3BTWE 4B1TA 3FP8E 2TGPZ 1UTQA 2XCFA 4TY6A 1RJXB 3OY5U 1HAPH 2A2QH 1VITG 1UHBA 4FUJA 1A5IA 1G3CA 2BXTH 4ABBA 2HRVA 1INCA 5FBEA 1MAXA 1LKBA 3RXOA 2VIQA 2J9NA 1G9IE 2Z9GA 5DO4H 1AFEH 1GJ4H 3W94A 1UHBB 2ALPA 1C2LA 3M5OA 1OP2A 5C5OA 2B7DH 2SGAA 2AFQB 2FODA 4FUHA 3GDSA 2BX4A 1FAXA 5AF9H 2HGTH 1RTLA 1ZHMA 3T5FH 1FJSA 3RXKA 3O8CA 1C1NA 1M9UA 1Y3UA 4AN7A 3BTME 1WTGH 4ZKOU 2BHGA 3RM2H 2H5DA 1ID5H 1SR5C 1DS2E 3A7WA 3KCGH 2FYRA 4WVPE 3L33A 1TNKA 3BEIB 3U1IB 3M7TA 1Q3XA 1E36B 4FU8A 2G52A 1O3KA 1W0ZU 2ANKH 3SORA 3VEQB 1OYQA 5T6DA 3F9FA 1GMHG 1EOLA 3V3MA 3GISB 2BDGA 1GBJA 4B74A 1YKTA 3SU5A 1ZMJA 2TGDA 3RXGA 2BM2A 4FUDA 5FBIA 1V2NT 2FOHA 1H9HE 1XUHA 2ZGHA 3T29A 1GDNA 1CU1A 1SSXA 3LOXA 1L1JA 2F9UA 4JK5A 5FPYA 1N8OC 1AY6H 1DFPA 2R2WU 2GP9B 1K1OA 1FUJA 3GCHC 4OS6A 2WPHS 3LJOA 2TBSA 1MTUA 1YCPH 2BD9A 4Q7XA 1FNIA 3A80A 1B5GH 3U8OH 1GI5A 3RMOH 1AO5A 4OGXA 1W14U 4BNRA 4UONA 5EPNA 1B7XB 7KMEH 5T6GA 2UUYA 3P6ZB 4K1EA 8ESTE 3MH6A 1TPAE 2FOBA 4Q7ZA 3RXRA 1O5BB 2KAIB 2NU4E 2PTCE 3E8LA 1W0YH 3PLBA 1O3LA 3ZVBA 1AIXH 3SO3A 1C1TA 1TGCA 2AEIH 1P2QA 1C5LH 1C5OH 1AFQB 1KDQB 1BCUH 4ZHMU 1EQ9A 3P70B 2TGTA 4ABIA 1LVBA 1AVXA 1BRCE 3MH4A 5AFZH 1QTFA 4D8NA 1AVWA 1QRZA 4X1RU 4X8SH 2AIQA 2QN5T 3QZQA 1Z7KA 1X7AC 5EW2H 2WPJS 2DUCA 1C4U2 1MCTA 1SGDE 2PKAB 1MBQA 4NA9H 1O3BA 1V2TT 1H9LB 2BLWA 4H42U 5FX5A 2QIQA 1O2SA 1UK4A 1TMTH 3VPKA 1BT7A 1XVMA 2BD5A 2EEKA 3M5LA 2GZ7A 4ISLA 1TRMA 5EU8A 5GCHG 2JETC 2FX6A 3TPIZ 2A7HA 2BYAX 1UVOA 5A09A 2Y81A 1SOZA 1KTTB 2BOKA 2H9EH 3URDA 3ZVGA 1ZTJA 1ELEE 1L2EA 2A5IA 7ESTE 4D7GA 4NIVA 3RXAA 5B6OA 3ZV9A 3NK8A 4X6OA 1TMUH 2ODQA 4D9RA 2M5TA 2ZIQH 5GPIB 4CBNA 1QB9A 1TNLA 3MYWA 2Y6TA 4H6TA 2QF3A 4K3JA 4IW4E 4B75A 1O3AA 2G4UA 2EC9H 3MH5A 1SGIB 3RMMH 6ESTA 2UWPA 4CR9A 1WBGB 2OC7A 4BXSA 2ZC9H 1CE5A 2VIDA 4KGAA 2D2DA 1LPZB 4XOJA 2A4OA 2PV9B 2VGCB 1AB9B 1HLTH 3SQEE 3A8CA 1YBWA 2GV6A 1NESE 1P9SA 2NU2E 2VIWA 1V3XA 3O8BA 3PLKA 1C1SA 1TWXB 2RDLA 2G4TA 4K60A 6CHAB 1HAXB 4ABJA 1QQUA 2ZHWH 3BTKE 3JZ2B 1Y5BT 1J9CH 4WH6A 1HB0B 1W8BH 1HUTH 2ANWA 3AAUA 5SGAE 2WINI 2EI8A 3ZZ5A 4LZ4B 1ZPBA 3SV9A 1LHEH 4Y0ZE 2G8TA 5A8YA 4A1VA 1VJAU 2F9BH 1UTJA 3K6ZA 2XC5A 1AWFH 1DE7H 1O5DH 2H1UA 3Q3KA 4ISOA 1V2VT 1CBWC 2ANYA 9ESTA 1FIWA 4JYTA 1O35A 2QCYA 1TOMH 5EXMA 5F8ZA 1Q2WA 1TX8A 2G51A 1TA2A 1QNJA 1L0ZA 1GJ7B 2Z6BD 4IMZA 2WPIS 3ZYDA 1PJPA 1LHDH 3LGYA 2ZQ1A 1QL7A 4GCHF 2WUBA 2A45B 4NG9H 2AGEX 4XSKU 3O8DA 4X2YA 4JK6A 2C8YB 1A0HB 4J2YB 3SJOA 4CHAB 2W5EA 4JYVH 1UTOA 1MZAA 2FTMA 1LHGH 3FAOA 1GJDB 4Z0KA 3ZZAA 2BTCE 3GY7A 3RMNH 1NU7B 3PYHA 1QB6A 1MKXH 1WYKA 1ACBE 2WYJA 5C20A 2ZDVH 2GZ8A 2FMJA 1L4DA 1WV7H 5L30H 1JRTA 3Q76A 4Y7BA 3H5CB 1TBZH 5FPTA 3OTJE 3SHCH 5FHTA 2GD4B 2QC2A 1NTPA 1DUEA 4AORA 3K2UA 1Z1IA 2FLBH 2GDEH 3SU2A 1AZZA 3MI4A 3SI4H 4RKOB 1P2OA 1VCWA 3UNSA 1HXFH 1P09A 3LH3A 1AQ7A 1MKWK 1QJ1B 1C2FA 1SGCA 1C1OA 2VIPA 4MPXA 1C5ZB 1GI1A 1Q31A 3P8GA 1NFYA 3M7QA 1GI2A 3TGJE 2A4QA 3SV7A 3U1JB 2PHBA 2YNBA 4A92A 1GJ6A 1K28D 5TJXA 4ISNA 3IG6B 4NWKA 3TVJB 3BTEE 4K1SA 1LVOA 1AMHA 2I6SA 3SNBA 2XC4A 4MG3A 2G5NA 5CHAC 2DE8A 1TPPA 3LIWA 1BB0B 1CHOF 1WAYB 2VWNA 1D6WA 3ATLA 5DP9A 5EOKA 1BMNH 4BAKB 2ZFSA 1F92A 4ESTE 1S84A 2XWBI 2HVXA 1J8AA 4FXGH 2PFEA 1BZXE 2GCTC 1CA0B 1SHYA 2FP7B 3U69H 2QXHA 2FIRH 2ZU4A 5AVDA 5JPMH 1FY1A 5GWZA 3QZRA 2P8OC 4GUXA 4FUIA 3RXUA 2CF9H 2GMTB 1DM4B 4I8KA 1IHTH 1BHXF 1XXFA 1Y59T 1TLDA 1FQ3A 1H8DH 3ZZ4A 1MD7A 1ZJKA 4BXWA 4GAWA 1P57B 2J2UA 1E38B 3EE0B 4CH8B 3KEEA 2PW8H 1GBIA 1NU9A 1QIXB 1AKSB 1AUTC 1XKBC 2W7SA 4CRAA 2CHAC 2D1JA 1MTWA 2PR3A 1E0FD 1QRXA 3AAVA 2XBXA 4Y79A 1RIWC 4THNH 1NRQH 1TYNA 4KP0A 3LU9B 4YLQH 2NU1E 1H8IH 1ESTA 4AG1A 1C1RA 3ATMA 2FOCA 1LVMA 2ZG0H 2UUFB 4A7IB 5EXNA 1GHVH 2Q6GA 1SI5H 2Q1JA 1TNIA 4KKDA 3C27B 5TCAA 4IC5A 1IQKA 3LKWA 4A5TS 3LGWA 3SGBE 4Y8ZA 1SQTA 3FVFB 1HAHH 1K21H 1PQ8A 2H9TH 1QR3E 2SNVA 4JZEH 4GHQA 4PROA 1XUIA 1MD8A 1YC0A 1BTWA 4J1YA 2FO9A 3PMBB 3AW1A 4GCHG 1SFQB 2OQUA 3VB3A 1DWDH 4XDEA 4NFEA 2ZFTA 3SU4A 7LPRA 5ABWA 3BIUH 1BQYA 4HZHA 1O2HA 3KQDA 1HIAA 3RU4D 1PPBH 3P8FA 1W12U 1HAOH 1UCYE 1BA8B 2NU0E 1YPJH 2ZU3A 1BBRH 3HPTB 5DP4A 1J16A 1U6QA 2LNCA 4YO9A 2XNIA 2Y7XA 2Y80A 2RCEA 4BANB 2Z3CA 3STJA 1FXYA 2O8MA 3RXMA 1FPHH 2VVCA 2ZPQA 2ZHFH 1G3BA 3ZZ7A 2BY8X 1YPEH 1AE5A 2XW9A 1AD8H 5E0GA 5EG4A 4X6PA 1K1NA 3MH7A 1C2DA 1QRWA 1WUNH 3KHVA 5J4QA 3QTVH 1HJ9A 1P05A 3LGIA 3SV6A 4Y8YA 2AMQA 4RKJB 3MU0A 4IS5A 3A8DA 3GY8A 3ODDA 2P3UB 1O2YA 1C2GA 4ABDA 1NO9H 4K2YA 1QBVH 1GBHA 1Y8TA 4LK4A 1XUKA 2YOLA 1O2JA 1S6HA 5DP5A 1BIOA 1F5LA 1OOKB 2WPMS 3ZVAA 1BTPA 2A7CA 3EQ0H 1HAYB 1OWDA 2ODPA 2ZGJA 3HGNA 4I33A 5A0CA 2HNTE 1CHOG 1IQJA 3K65B 1O3FA 3TIUA 2AH4X 2W26A 3RUOA 1EATA 2HALA 4X1SU 2VH6A 1SLUB 1ZHRA 1N8OB 1Z8GA 1HXEH 1ZGIA 2BQ6B 2OBQA 5F8TA 1P02A 1YF4A 1LO6A 2C90B 3MU1A 1YLDA 3MU4A 5GDSH 3QWCH 1RGQA 1ZYOA 3TNSA 4UFGH 3T26A 1NRPH 1VGCC 3M37A 3TU7H 2ZGXH 1D3QB 3A8BA 4DIIH 1GPZA 1ZPZA 1MQ5A 4B2AA 5DG6A 1HAGE 1KTSB 5JBCS 1ZSLA 3P95A 4ASHA 2A2XH 3RLWH 4WJG2 1GHAF 1O3CA 2VVUA 2HPQH 3I77A 1S6FA 3FZDA 2ZP0H 2ZFFH 1O36A 3ATWA 1UTLM 5JBBS 1O34A 4X1NU 3RXDA 1LKAA 1WOFA 1FDPA 1BTUA 3TITA 5DPAA 4YT6H 1GVLA 1UCYK 1Z1JA 3SZNA 2P59A 4I8JA 2ZPRA 1O3IA 2OCVB 2PSXA 3BF6H 1SQOA 3UNQA 4UFDH 3B8JA 1YGCH 4X1QU 4JYUH 3I29A 3V7TA 2B0FA 2GZ9A 1UMAH 2AGGX 1L1NA 1FY8E 1A61H 1CGJE 1BTZA 1TX6A 2JETB 1TB6H 1ETTH 4ZXYH 2EA3A 4Y11E 1ZMNA 4O97A 3S0NA 4MPUA 1G3DA 2TGAA 5HYOA 1GJAB 4WXIA 2ZFRH 1EZXC 2QXGA 1XM1A 1HNEE 2ZF0H 3C1KA 1NROH 4INHA 2H6MA 4AGKA 4CRCA 1OPHB 1NT1A 1THSH 4ZHAA 3U8TH 4DCDA 1E34B 1C5RA 5FPSA 1B0EA 1HAVA 1W7GH 4CREA 2D8WA 2J92A 1AN1E 1O3GA 1VCQA 8GCHF 2ESTE 2A5AA 1ELGA 5JB8S 4DW2U 3PV4A 3SNCA 3GYMA 2QF0A 1T31A 4JMYA 1W2KH 1SGFA 1T8OA 4B73A 4ZROA 2Z94A 2AERH 2Y82A 1O2VA 1BMMH 4B76A 3QLPH 3RXCA 4ZH8A 1SLXB 2B8OH 2VJ1A 2BVRH 1UTMA 1NRNH 1C5SA 1O5GH 3KIDU 3I78A 4OS5A 4FVBA 1THPB 2AGIX 1FI8A 2F91A 2NWNA 4RSPA 4AFQA 3A83A 2Z9IA 4WMEA 1ARBA 1D3DB 2B9LA 4WMFA 4YT7H 1OWHA 1P2MA 3DT0H 3UOPA 2WYGA 3MWIU 3OSYA 2BLOA 4ISIH 2WPKS 1GI8B 4NSYA 1O2UA 1TBQH 5GXPA 1ZRKA 1ARCA 3FFGA 4CRDA 4Q2KA 2FS9A 4D9QA 3T25A 1CA8B 3D65E 2TRMA 1NPMA 1A3EH 2F9PA 3RXQA 1ZJDA 3PM3A 5AFYH 1XUFA 1MQ6A 4WXVA 1O31A 3MTYA 1CBWB 1C1UH 1XX9A 5A0AE 4MQAA 2R2MB 2VIOA 3V13A 4TPYA 1QA7A 4BAOB 1DSTA 1XMNB 1YPMH 4ABEA 4JZ1A 2TIOA 3SI3H 5EQQA 1YPLH 3MNXA 5JBTA 1GHWH 2BMGB 2Z9JA 3UREA 1GHYH 4Y10E 3LPRA 2JKHA 1J17T 1KY9A 3E3TA 4O03A 1J15A 1GL0E 1FY3A 3T2NA 1G3EA 4X6NA 1HJAC 5E8EH 1UVUH 2FOEA 3PTNA 1P3EA 2GGVB 5F6MA 3ZZDA 4CR5A 3SW2B 3BV9B 4ABAA 3ZZ9A 1BJUA 3KGPA 4NWLA 2GCHF 1PPGE 2IPHA 3Q00A 1C2EA 4AYVB 1GHAG 1GJ5H 1EB2A 1XVOA 1QY6A 1Z8JB 2G00A 3AASA 3D49H 5LPRA 3BTHE 1O32A 4IGDA 1GBLA 3L6PA 4OS2A 1SMFE 3EA7A 2OP9A 1TGBA 3ZVDA 4Y0YE 1BOQA 2C3SA 1K2I1 2J95A 3ZZ3A 3OYPA 3F9GA 1ANCA 3M3VA 2XWAA 1A3BH 1DWBH 4SGAE 3PB1E 3M35A 4Y6DA 4FUEA 2VVVA 4YOIA 1CT0E 1D3PB 1LPGB 1GHBF 1A5GH 1SGTA 1HAZB 1EPTA 3A81A 1K22H 2GDDA 2VNTA 1FMGA 3MOCA 3BSQA 1WU1A 3T27A 5I25A 2ZA5A 4ZHLU 3NKKA 3SU3A 1O2KA 3P8OA 4TY7A 5CHAB 2VH0A 3IWMA 4UDWH 1W13U 3GY2A 1UVPA 2BDAA 3BTDE 1LTOA 3S9BA 5AHGH 2OC0A 4DG4A 4DURA 1LMWB 1ESAA 1TRNA 1GJ9B 1NN6A 2TPIZ 4NFFA 3GCOA 1ELFA 2GCTB 1ANEA 1QJ6B 1MU8B 1RRKA 3AVZA 3KQCA 2C8WB 3RXIA 1BITA 1P2NA 8GCHG 1E37B 3RMLH 2UWLA 2OXSA 4F4OC 3DFLA 1MUEB 3SQHE 2P8OB 4Z6AH 3NCLA 4Y7AA 3URCA 4ABGA 3HKJB 5E2PA 3SHAH 1C2JA 3UNRA 2VU8E 3BG8A 2RA0A 2A4GA 2FOMB 3SUEA 3RXLA 2PKSC 2P3TB 5LH8A 1A0JA 3A87A 3EDXB 1MTNB 1GG6C 1EOJA 3MO3A 3N7OA 3ZZ8A 1PPFE 2CHAB 1UK3A 2LPRA 1GMDG 3LC3A 3ZZBA 4CRBA 2RG3A 4ISHH 5L6NH 1C5UA 5C67A 1RIWB 3TJUA 3UOUA 1IAUA 2BD2A 3VGCB 2AS9A 2FI5E 3SU1A 4NA7A 3PO1B 2AMDA 2WPLS 1VJ9U 2C4FH 2QAAA 2QA9E 2A5KA 4X0WU 4A1TA 1OXGA 2BY9X 3GY4A 2G5VA 1HPGA 1MZDA 9LPRA 3M5NA 3S9CA 1UCYH 1XUGA 4ZXXH 2BDHA 1GCDA 1QBOA 1V2RT 1QA0A 5DP8A 2BDCA 2R0KA 2D26C 3VFEA 5FX6A 2FEQH 4E05H 1SC8U 2CGAA 2BY7X 4XFQA 3RP2A 5EPYA 1V2UT 3RDZA 3FP6E 3U9AH 1XXDA 4AFSA 1SVPA 3VB5A 3EA8A 3E91A 1EPTC 3E6PH 3RXHA 1DXPA 3E0PB 1IQHA 1C1QA 1EUFA 1P04A 1ZMLA 2BB4A 3ZVFA 5FXLA 2V0BA 1F0UA 3RU4E 3PTBA 1FV9A 4K5ZA 3RC6A 2GCHG 1GI3A 2OTVA 1FZZA 2ZDAH 4E7RG 1G30B 2ZFPH 4LXBH 3DA9B 5ETXA 4MDSA 2Y5GA 3RXSA 1P3CA 3A88A 4M7GA 3RXBA 1O3HA 4TWWA 1CT4E 1O30A 2SGQE 2Z3DA 3KN2A 4NZLA 5E2OA 4YLUA 1ZHPA 3SNAA 5LPFA 3MU5A 1F0RA 1MBMA 3FZZA 2HWLB 4WH8A 2QXJA 1HFDA 1SGEE 1IQLA 1W11U 3Q3XA 2SGEE 1FY5A 1C9TA 3A7YA 1T8MA 1SGYE 1T32A 2ODYB 1IQEA 3SOSA 1LQEA 4X2XA 4B2CA 1G36A 1OWEA 2ZU2A 2ZTXA 3VB4A 4B71A 2W3KA 1GHBG 1GBBA 1Z8RA 1YCPK 4O3UA 1C4Y2 1MCVA 3H7TA 2A4RA 1O2WA 1AHTH 1TE0A 1T4VH 1ZSKA 1QHRB 1TPSA 1TRYA 2RA3A 3M7UA 1EXFA 4AYYB 1QQ4A 3SNEA 3NUMA 5EQSA 4BOHA 3MNBA 1LPKB 1C1WH 3ENSB 3BTTE 1MTNC 1V6DA 4MNWA 5HMAA 4DIHH 2THFB 2OD3B 2ZTYA 1A7SA 4FUGA 5HXFA 4BTTB 1C4V2 3E0NB 5L2ZH 1TONA 3A89A 5C1YA 1OSSA 1THRH 1QBNA 1TPOA 3LDXH 2ZHEH 1PPZA 4YESB 1F5KU 3VGCC 2F9NA 2ZCHP 3UFAA 5EXLA 3SGAE 3PO1C 3GOVB 2FTLE 2VINA 3GCTF 2F9VA 2OC8A 1ELCA 4Y8XA 1QCPA 1BMAA 1ELVA 4AOQA 4JZIA 3KL6A 4TWYA 2FLRH 4SGBE 2JH0D 1QL9A 3VB7A 1C1PA 1SB1H 1O3NA 1CO7E 1OWKA 2F9OA 3GY6A 1RTKA 2HOBA 2Z3EA 1EASA 3ESTA 3SV2H 1C5QA 1C2HA 1EZUC 1VGCB 4INLA 2BD8A 4GPGA 4WF8A 3A7VA 2CJIA 4IBLH 1ELDE 1UVTH 1GWAA 1MTVA 3EGKH 1VITH 4NIWA 3MFJA 2Z9LA 1O2TA 1NFUA 2Y5FA 2J94A 1A1RA 2H2ZA 1TGNA 1DDJA 3R3GB 1O3DA 2V35A 1K1LA 2FM2A 1O39A 1IOEA 1C5VA 2BD7A 1JOUB 1ESBA 1GDUA 3RXFA 5EGMA 1CGHA 1K1MA 1AI8H 5LGOA 4HTCH 3TGKE 3QUMP 1KXFA 3HGPA 3RM0H 4K1TA 1BJVA 1AUJA 1HIAB 1O3EA 1GGDC 2R3YA 2BLQA 1GHZA 3PWCA 2HNTC 1TMBH 5FAHA 2IJOB 3F6UH 1SFIA 2XCNA 1O2PA 5DKMA 1QL8A 1DPOA 2VWOA 4I8HA 2OINA 2XBWA 2CN0H 3TK6A 3UR9A 1DICA 2FYQA 2A31A 4I8GA 2ULLA 2ZDNA 3BTFE 4Q80A 4AGJA 1PFXC 3QO6A 3RXEA 1O3OA 1ZGVA 3BTGE 2ZWLH 4MLFB 2ZPSA 1KXCA 1W3CA 3SJKA 3TK9A 1EKBB 1FY4A 1H1BA 1SGPE 4U30A 4KTUA 1SL3A 1MU6B 1H4WA 4NIYA 1LVYA 2ZI2H 8KME2 2QV1A 4I8LA 1TGTA 1GBTA 1RFNA 1GI4A 1HDTH 3RC5A 3A8AA 2H9HA 3RXPA 3G01A 3TK5A 3PMAB 4X6MA 1E35B 3DHKH 1BRBE 1DUAA 1NS3A 5EW1H 1Y3VA 2OBOA 3UQOA 1HRTH 1KXBA 1O5FH 2OLGA 1EZQA 1RTFB 4D7FA 1S82A 1GJCB 1Y3XA 4UFEH 1O3PB 5C1UA 3M3SA 3W95A 5PTPA 1KSNA 4DGJA 1Y5UT 1GBDA 1OX1A 1ZTLA 1V2WT 4MNVA 4NIXA 2ZECA 5JDUB 1K1JA 3UIRA 2GTBA 4FUCA 1DVAH 3ODFA 1O5EH 4NCYA 2FESH 4IMQA 4CH2B 3T28A 3PMHB 1VCPA 3H7OA 3VXFH 1MAYA 1QB1A 5DK1A 1UK2A 4FUFA 1BTXA 5EODA 4WY3A 1GBAA 2PUQH 1D4PB 2BDBA 1ANDA 4VGCB 2FPZA 1OS8A 4ABHA 1NRRH 1C9PA 2ZDMA 2PGQB 3A82A 2ZCLP 2FZZA 4CRGA 4GSOA 1MKXK 1O2LA 3UY9A 1PYTD 4I31A 3BTQE 2SGPE 2BZAA 3HK6B 1VR1H 2FWWA 3RC4A 5F8XA 1TNGA 3TH4H 4HI3A 1D6RA 1LHCH 2V6NA 3GCTG 1GVZA 1SQAA 4K8YA 2ZQ2A 3BEUA 1O2RA 1O3MA 4TYDA 1O2QA 1KLJH 3B23B 1TNHA 5JBAS 5E0HA 3A7ZA 3LT3A 1GI7B 4FUBA 4A1XA 1K1IA 1CSOE 1S83A 2QGRA 2J34A 1W10U 2C93B 1HJAB 1MKWH 5A8ZA 1PPHE 4MNXA 3DUXH 1EAXA 1VZQH 4CBOA 1P01A 2XC0A 1P03A 2ZFQH 3CP7A 3ITIA 4B2BA 2C8XB 4X8UH 3TJOA 4I7YH 1ABJH 2R3UA 5L2YH 1O0DH 4RN6A 1BUIA 1DOJA 4WMDA 2ZCKP 4DJZB 4DVAU 2ANMH 1ZRBA 1CGIE 3E90B 4GVUA 1BBRE 1BDAA 4YM9A 5IDKA 2FS8A 2V3HH 5ESBA 3BG4C 4XE4A 2UUKB 1DY9A 3DD2H 1HAIH 1PPEE 1HAVB 3KNXA 2GV7A 2BDYA 4UE7H 2BQ7B 1HGTH 5E0JA 1P06A 5IYTA 3V12A 3OX7U 1Z6JH 1Y3YA 1CQQA 5DGJA 1RD3B 2O8UA 3QX5H 1WTHD 1O3JA 2CF8H 1Y3WA 4R8TB 3QN7A 1N1LA 3TJNA 3O8RA 1UJ1A 4D76A 1GMDF 1TOCB 3QGNB 1N6XA 4VGCC 3ATKA 4BAQB 1GJBB 4U2WA 3HATH 3E1XB 3MMGA 1MTSA 1AE8H 3U8RH 2KAIA 1GCTC 1ZZZA 1P12E 2Q6DA 3CENA 4A6LA 1EAIA 1ETRH 2R0LA 1UTKA 3OU0A 1KDQA 4GLYA 2A32A 4BAMB 1O5CB 2ZU5A 3A84A 1F7ZA 2BXUH 2NU3E 2C8ZB 1FN6A 2AIPA 4UEHH 3EAJA 1P2JA 4KTSA 4YZUA 3UWJH 1ZLRA 2PKAA 3LJJA 1O2NA 1EJMA 2Y7ZA 1DSUA 4ZKNU 1C2KA 3M61U 1C5PA 1GMCF 4MPVA 3P8NA 4AB9A 1EAUA 3NWUA 3A7TA 2ZHDA 1G37A 2PKSB 1OWIA 1DXWA 3S7HB 1LDTT 1IQGA 1NFXA 1P0SH 1SGQE 3DFJA 1GG6B 1A5HA 3WY8A 5EQRA 2PSYA 5C2ZA 2XYAA 1AVGH 2Y5HA 3UR6A 2BQWB 4JCNA 1TNJA 1GBFA 1S5SA 2IOTA 2ILNA 5DP3A 5T3HA 4AG2A 2FOAA 3OY6U 1TALA 3M5MA 3ZYEA 1BBRK 1V2KT 6LPRA 2BDIA 4OGYA 1ELBA 2A1DB 2K1QA 2XBVA 1TA6A 1TQ7B 3STIA 1SLWB 1YLCA 3CS7A 2G55A 2VWMA 4E06H 1DLKB 1XUJA 2UUJB 4XBCA 2PGBB 4X2VA 3ZVCA 2O8WA 2XXLA 3QGJA 1Y5AT 3E16B 2ZHQH 1S81A 1NFWA 2ZNKH 1GBCA 1GBKA 1ETSH 1ZTKA 3RU4T 2J4IA 1V2JT 2Z7FE 3UPEA 1C2MA 2BX3A 2EI6A 5JB9S 4HFPB 3PLPA 3R0FA 1PQ5A 1EPTB 1AZ8A 1P2KA 2AMPA 1AWHB 3LONA 3MU8A 1SOTA 3UWIA 1ANBA 4AFUA 1V2OT 4X2WA
chains in the Genus database with same CATH superfamily
2QY0B 5C0UA 1BMLA 5DJ7A 3K6YA 1TAWA 2F83A 5K7RA 1GVKB 3Q77A 3QTOH 2FXRA 2O8TA 1C5MD 1C1MA 4O9VA 5HM2A 1O37A 1C5NH 3LC5A 3TLOA 4E7NA 4FU7A 3KQBA 1UTNA 1HYLA 1YPHC 3WW7A 3SGQE 3SUDA 1SG8B 2LP6A 1MMJN 1C5YB 1BTHH 4H6SB 3TGIE 1GBMA 1SGFG 1QGFA 1P8VC 3GS9A 5C1XA 4DY7B 3SJ8A 1ORFA 1AFQC 2GT8A 3GICB 1SPJA 4Z1MD 2EI7A 1A46H 1DY8A 1SGRE 1GDQA 2JH5D 3ATIA 3D62A 1PQAA 4AX9H 4QT8C 1KXEA 3IITA 3TNTA 2WUCA 2PTNA 1BRAA 2BVSH 5DP7A 5BRRE 1C5XB 4KELA 3SU6A 2I6QA 6GCHF 2O9QA 5CE1A 4F48B 1QFKH 2ZU1A 3HK3B 1HCGA 4AB8A 1YPHE 2STBE 4X1PU 3U98H 3ZVEA 1FPCH 2VIVA 2XRCA 2P3FH 1JMOH 1K0HA 3TH2H 1G32B 1A2CH 1YCPM 2AYWA 4KTCA 1Z8IB 1WCZA 2R9PA 3ZV8A 4ZKSU 1ABIH 1EAWA 2ZDLA 3P17H 3F1SB 3EYDA 4X8VH 2VB0A 3ZZCA 8LPRA 2V3OH 4OS1A 1KLIH 2ALVA 4ABFA 3U28C 1ZSJA 1YM0A 1JIMA 4MVNA 2F43B 3JZ1B 2DE9A 1K1PA 4Q63A 1A0LA 3NPSA 5HGGA 1BRUP 1MH0A 2XTTB 2PUXB 5EJ1A 2H5CA 3FANA 1TQ0B 2VWLA 2UWOA 3SJIA 5A2MH 1GI0A 7GCHF 1QURH 1HJ8A 1AGJA 1O2XA 1TABE 3GCNA 1KXDA 2HPPH 4WWYA 1DLEA 1TFXA 3M36A 5K0HA 2FOGA 1GMCG 3NZIA 4O3TA 2B5TB 2VGCC 4MTBA 1P2IA 3FP7E 1AB9C 1YP9A 1PQ7A 2ZDKA 3PMJA 1IQIA 3GYLB 3QK1A 2QF5A 2P94A 3EA9A 4DOQA 4FVDA 4XBBA 4Q7YA 1SBWA 2P93A 4OS4A 4YTAA 1OYTH 2HNTF 2W7UA 6CHAC 2BZ6H 1PPCE 2BOHB 1O2GH 3F68H 2O8LA 1HBTH 4F49A 1T8LA 5ESTE 2A0QB 2G81E 2L74A 1GBEA 4ZAEA 2GKVE 1TGSZ 5G4BA 1GHXH 1V2PT 4UFFH 2HLCA 3RXTA 1GGDB 3NXPA 1GI6A 1S0QA 1F0TA 1OP8A 3MHWU 1QJ7B 1S85A 4AZ2B 2W3IA 2PLXA 2QYIA 4IN2A 1RXPA 2STAE 3VXEH 1F0SA 1JXPA 2GX4A 3RLYH 1NY22 2ZO3H 3TJVA 3B9FH 4R0IA 1P9UA 3BN9A 1OWJA 1O2MA 1W7XH 3SNDA 1SGNE 1O33A 1L4ZA 1CVWH 3GY3A 4TT3D 1BTYA 1WQVH 3BIVH 5F03A 5IK2D 5KGOA 4X2WA 3MNCA 1GI9B 1DWEH 2FX4A 3F9HA 1UO6A 1OP0A 3S9AA 3MNSA 1IHSH 2Q6FA 3OFND 1FN8A 1HV7A 1NC6A 1Z71A 4BTUB 3SUGA 3LGTA 1AKSA 1D3TB 1P10A 2L6OA 3V0XA 5LPEA 1FLEE 2P95A 1IQFA 1WQSA 5FCKA 4CHAC 2ZKSA 3SJ9A 5C5NA 2WV4A 1JBUH 1ELTA 3KF2A 4LOYH 3SBKA 3Q3YA 1H9IE 2V3MA 1EP6A 3H09A 2QXIA 1F2SE 4NSVA 1YYY1 1BHXB 1EB1H 2JH6D 4NZQA 1GJ8B 1VITF 3VB6A 2P16A 4XBDA 2ZGCA 3GDVA 4MPWA 2SFAA 1T7CA 1C5TA 1TBRH 1DANH 1C5WB 1PYTC 1RS0A 1JWTA 4Y76A 2FOFA 3SV8A 2BLVA 1SLVB 1LCYA 2FI4E 5C17A 5H4IB 1ZPCA 4ZMAH 1V2ST 5T6FA 4BAHB 4BTIB 2GVFA 3SUFA 1EJAA 4MNYA 4NA8A 3UUZA 3A7XA 4HGCA 1FAKH 3M3TA 3MO9A 2SGFE 1EP5A 2ZZUH 1C1VH 1G2LA 1EX3A 6GCHG 1N6YA 1NM6A 1P11E 1J14A 4LZ1H 2KM0A 3PWBA 2V7QD 1OKXA 1XKAC 4ZKRU 1O38A 3ZZ6A 3S69A 1CT2E 1FIZA 3KQEA 4OM9A 3UAIC 5I46H 3GY5A 3MO6A 3T62A 1T4UH 1GMHF 1G2MA 3UTUH 1EJNA 2CMYA 4IC6A 3UQVA 4YOJA 2GT7A 4JZDH 5JYIA 1AU8A 1GL1A 2J38A 4I32A 2ZTZA 1CA0C 2ZGBH 3SYJA 4TPIZ 2OC1A 1DWCH 1V2MT 2K0QA 3PROA 5TCCA 3SU0A 3K9XB 7GCHG 2F3CE 1C2IA 5BPEA 2IN2A 1UVSH 2WV9A 3CNRA 3LGVA 2GMTC 4NGAH 4IN1A 1KIGH 1FONA 1KLTA 4CRFA 1A4WH 4Y71A 1JIRA 1WSSH 1TX7A 2ZEBA 2CV3A 1KXAA 3L3TA 1T8NA 1V2LT 1LQDB 4ZUHA 1YPGH 2SGDE 2Z9KA 2PWXA 3QDZB 3D23A 1B0FA 3BG4B 1KYNA 2BD4A 5HM9A 2SNWA 2FDAA 3A85A 1LHFH 4JZFH 4YOGA 1DITH 5DP6A 1O5AB 2CXVA 5GIBA 3BEFB 1S0RA 4FU9A 2BY5X 4INKA 3CS0A 3P92A 1SHHB 3LGUA 3ELAH 1V2QT 5C3NA 3F9EA 2BY6X 5FCRA 1E1QD 4DT7B 2FI3E 4H4FA 1NRSH 4U01A 2WV5A 5CMXH 2A7JA 2QE7D 2ASUB 2HLDD 3AW0A 4OS7A 2XBYA 2YNAA 1CHGA 4K8BA 1NZQH 1JRSA 5A8XA 1D9IA 1EZSC 2BD3A 3GCHB 3OEHD 4UD9H 5GCHF 3HKIB 4K69A 3TH3H 1F5RA 1O2ZA 5GJ4B 1O2IA 5A0BA 1K9OE 1YPKH 5T1VA 2BVXH 1DX5M 4AFZA 3A86A 1ELAA 1ZR0A 1O2OA 4GHTA 4U32A 1GCTB 1L1GA 2OUAA 1TIOA 1UTPA 2OQ5A 3RXVA 3S7KB 1IQMA 2KX4A 3LH1A 3SN8A 3GDUA 1ZOMA 3RXJA 1DT2A 4ACAA 1IQNA 1Z6EA 4X8TH 3BTWE 5HIZA 4B1TA 3FP8E 2TGPZ 1UTQA 2XCFA 4TY6A 1RJXB 3OY5U 1HAPH 2A2QH 1VITG 1UHBA 4FUJA 1A5IA 1G3CA 2BXTH 4ABBA 2HRVA 1INCA 5FBEA 1MAXA 1LKBA 3RXOA 2VIQA 2J9NA 1G9IE 2Z9GA 5DO4H 1AFEH 1GJ4H 3W94A 1UHBB 2ALPA 1C2LA 3M5OA 1OP2A 5C5OA 2B7DH 2SGAA 2AFQB 4XRNA 2FODA 4FUHA 3GDSA 3DSOA 2BX4A 1FAXA 5AF9H 2HGTH 1RTLA 5DSFA 1ZHMA 3N7DA 1FJSA 3RXKA 3T5FH 1C1NA 3O8CA 1M9UA 1Y3UA 4AN7A 3BTME 1WTGH 4ZKOU 2BHGA 3RM2H 2H5DA 1ID5H 1SR5C 1DS2E 3A7WA 3KCGH 2FYRA 4WVPE 3L33A 1TNKA 3BEIB 3U1IB 3M7TA 1Q3XA 1E36B 4FU8A 2G52A 1O3KA 1W0ZU 2ANKH 3SORA 3VEQB 2KCOA 1OYQA 5T6DA 3F9FA 1GMHG 1EOLA 3V3MA 3GISB 2BDGA 2KCYA 3DSPA 1GBJA 2RDEA 4B74A 1YKTA 3SU5A 1ZMJA 2TGDA 3RXGA 2BM2A 4FUDA 5FBIA 1V2NT 2FOHA 1H9HE 1XUHA 2ZGHA 3T29A 1GDNA 1CU1A 1SSXA 3LOXA 1L1JA 2F9UA 4JK5A 5FPYA 1N8OC 1AY6H 1DFPA 2R2WU 2GP9B 1K1OA 1FUJA 3GCHC 4OS6A 2WPHS 3LJOA 2TBSA 1MTUA 1YCPH 2BD9A 2YMSB 4Q7XA 1FNIA 3A80A 1B5GH 3U8OH 1GI5A 3RMOH 1AO5A 4OGXA 1W14U 4BNRA 4UONA 5EPNA 1B7XB 7KMEH 5T6GA 2UUYA 3P6ZB 4K1EA 8ESTE 3MH6A 1TPAE 2FOBA 4Q7ZA 3RXRA 1O5BB 2KAIB 2NU4E 2PTCE 3E8LA 1W0YH 3PLBA 1O3LA 3ZVBA 4FOUC 1AIXH 3SO3A 1C1TA 1TGCA 2AEIH 1P2QA 1C5LH 1C5OH 1AFQB 1KDQB 1BCUH 4ZHMU 1EQ9A 3P70B 2TGTA 4ABIA 1LVBA 1AVXA 1BRCE 3MH4A 5AFZH 1WXRA 1QTFA 4D8NA 1AVWA 1QRZA 4X1RU 4X8SH 2AIQA 2QN5T 3QZQA 1Z7KA 1X7AC 5EW2H 2WPJS 2DUCA 1C4U2 1MCTA 1SGDE 2PKAB 2LELA 3F2GA 1MBQA 4NA9H 1O3BA 1V2TT 1H9LB 2BLWA 4H42U 5FX5A 2WPDD 2QIQA 1O2SA 1UK4A 2JDID 1TMTH 3VPKA 1BT7A 1XVMA 2BD5A 2EEKA 2JJ2D 2GZ7A 3M5LA 1TRMA 4ISLA 5EU8A 2JETC 2FX6A 5GCHG 3TPIZ 2A7HA 2BYAX 1UVOA 5A09A 5CDFE 2Y81A 1SOZA 1KTTB 2BOKA 2H9EH 3URDA 3ZVGA 1ZTJA 1ELEE 1L2EA 5HIYA 2A5IA 7ESTE 4D7GA 4NIVA 3RXAA 5B6OA 3ZV9A 3NK8A 4X6OA 1TMUH 2ODQA 4D9RA 2M5TA 2ZIQH 5GPIB 4CBNA 1QB9A 1TNLA 3MYWA 2Y6TA 4H6TA 2QF3A 4K3JA 4IW4E 4B75A 1O3AA 2G4UA 2EC9H 3MH5A 1SGIB 3RMMH 6ESTA 2UWPA 4CR9A 1WBGB 2OC7A 2KFWA 4BXSA 2ZC9H 1CE5A 2VIDA 4DT4A 4KGAA 1VKYA 2KCPA 2D2DA 1LPZB 4XOJA 2A4OA 2PV9B 2VGCB 1AB9B 1HLTH 3SQEE 3A8CA 1YBWA 2GV6A 1NESE 1P9SA 2NU2E 5EIYA 2VIWA 1V3XA 3O8BA 3PLKA 5C94A 1C1SA 1TWXB 2RDLA 2G4TA 4K60A 6CHAB 1HAXB 4ABJA 1QQUA 2ZHWH 3BTKE 3JZ2B 1Y5BT 1J9CH 4WH6A 1HB0B 1W8BH 1HUTH 2ANWA 3AAUA 5SGAE 2WINI 2EI8A 3ZZ5A 4LZ4B 1ZPBA 3SV9A 1LHEH 4Y0ZE 2G8TA 3WWFA 5A8YA 4A1VA 1VJAU 2F9BH 1UTJA 3K6ZA 2XC5A 1AWFH 1DE7H 1O5DH 2H1UA 3Q3KA 4ISOA 1V2VT 1CBWC 2ANYA 9ESTA 1FIWA 4JYTA 1O35A 2QCYA 1TOMH 5EXMA 3PRDA 5F8ZA 1Q2WA 1TX8A 2G51A 1TA2A 1QNJA 1L0ZA 1GJ7B 2Z6BD 4IMZA 2WPIS 3ZYDA 1PJPA 1LHDH 3LGYA 2ZQ1A 1QL7A 4GCHF 2WUBA 2A45B 4NG9H 2AGEX 4XSKU 3O8DA 1W0KD 3F2HA 4X2YA 4JK6A 2C8YB 1A0HB 3F2FA 4J2YB 3SJOA 4CHAB 2W5EA 4JYVH 5HKKD 1UTOA 1MZAA 2FTMA 1LHGH 3FAOA 1GJDB 4Z0KA 3ZZAA 3F0OA 2BTCE 3GY7A 4I86A 3RMNH 1NU7B 3PYHA 1QB6A 1MKXH 1WYKA 1ACBE 2WYJA 5C20A 2ZDVH 2GZ8A 2FMJA 1L4DA 1WV7H 5L30H 1JRTA 3Q76A 4Y7BA 3H5CB 1COWD 1TBZH 5FPTA 3OTJE 3SHCH 5FHTA 2GD4B 2QC2A 1NTPA 1DUEA 3KQ5A 4AORA 3K2UA 1Z1IA 2FLBH 2GDEH 3FN8A 3SU2A 1AZZA 3MI4A 4Q4LA 3SI4H 4RKOB 1P2OA 1VCWA 3UNSA 1HXFH 3FO8D 1P09A 3LH3A 2XNDD 1AQ7A 1MKWK 1QJ1B 1C2FA 1SGCA 2VBCA 1C1OA 2VIPA 4MPXA 1C5ZB 1GI1A 1Q31A 3P8GA 1NFYA 3M7QA 1GI2A 3TGJE 2A4QA 2KR7A 3SV7A 3U1JB 2PHBA 2YNBA 4A92A 1GJ6A 1K28D 5TJXA 4ISNA 3IG6B 4NWKA 3TVJB 3BTEE 4K1SA 1LVOA 1AMHA 2I6SA 3SNBA 2XC4A 4MG3A 1SQRA 2G5NA 5CHAC 2DE8A 1TPPA 3LIWA 1BB0B 1CHOF 1WAYB 2VWNA 1NBMD 1D6WA 3ATLA 5DP9A 5EOKA 1BMNH 4BAKB 2ZFSA 1F92A 4ESTE 1S84A 2XWBI 2HVXA 1J8AA 4FXGH 2IJD1 2PFEA 1BZXE 3FKSD 2GCTC 1CA0B 1SHYA 2FP7B 3U69H 2QXHA 2FIRH 2ZU4A 5AVDA 5JPMH 1FY1A 5GWZA 3QZRA 2P8OC 4GUXA 4FUIA 3RXUA 2CF9H 2GMTB 1DM4B 4I8KA 1IHTH 1BHXF 1XXFA 1Y59T 1TLDA 1FQ3A 1H8DH 3ZZ4A 1MD7A 1ZJKA 4BXWA 2HVYB 4GAWA 1P57B 2J2UA 1E38B 3EE0B 4CH8B 3KEEA 2PW8H 1GBIA 4B6EA 1NU9A 2OK5A 1QIXB 1SKYE 1AKSB 1AUTC 1XKBC 2W7SA 4CRAA 2CHAC 2D1JA 1MTWA 2PR3A 1E0FD 1QRXA 3AAVA 2XBXA 4Y79A 1RIWC 4THNH 1NRQH 1TYNA 4KP0A 3LU9B 4YLQH 3F0PA 2NU1E 1H8IH 1ESTA 4AG1A 1C1RA 3ATMA 2FOCA 1LVMA 2ZG0H 2UUFB 4A7IB 5EXNA 1GHVH 2Q6GA 1SI5H 2Q1JA 1TNIA 4KKDA 3C27B 5TCAA 4IC5A 2K8IA 1IQKA 3LKWA 4A5TS 3LGWA 3SGBE 4Y8ZA 4P02A 1SQTA 3FVFB 1HAHH 1K21H 1PQ8A 2H9TH 1QR3E 2SNVA 4JZEH 4GHQA 4PROA 1XUIA 1MD8A 1YC0A 1BTWA 4J1YA 2FO9A 3PMBB 3AW1A 4GCHG 4AC9A 1SFQB 2OQUA 3VB3A 1DWDH 4XDEA 4NFEA 2ZFTA 3SU4A 7LPRA 5ABWA 3BIUH 1BQYA 4HZHA 1O2HA 3MQKC 5C0TA 3KQDA 1HIAA 3RU4D 1PPBH 3P8FA 1W12U 1HAOH 1UCYE 2J5UA 1BA8B 2NU0E 1YPJH 2ZU3A 1BBRH 3HPTB 5DP4A 1J16A 1U6QA 2LNCA 3NRLA 4YO9A 3WWBA 2XNIA 2Y7XA 2Y80A 2RCEA 4BANB 2Z3CA 3STJA 1FXYA 2O8MA 3RXMA 1FPHH 2VVCA 2ZPQA 2XOKD 2ZHFH 1G3BA 3ZZ7A 2BY8X 1YPEH 1AE5A 2XW9A 3PRBA 1AD8H 5E0GA 5EG4A 4X6PA 1K1NA 3MH7A 1C2DA 1QRWA 1WUNH 3KHVA 5J4QA 3QTVH 1HJ9A 1P05A 3LGIA 3SV6A 4Y8YA 2AMQA 4RKJB 3MU0A 4IS5A 3A8DA 3GY8A 3ODDA 2P3UB 1O2YA 1C2GA 4ABDA 1NO9H 4K2YA 1QBVH 1GBHA 1Y8TA 4LK4A 1XUKA 2YOLA 1O2JA 1S6HA 5DP5A 1BIOA 1F5LA 1OOKB 2W6JD 2WPMS 3ZVAA 1BTPA 2A7CA 3EQ0H 1HAYB 1OWDA 2ODPA 2ZGJA 3HGNA 4I33A 5A0CA 1W0JD 2HNTE 1CHOG 1IQJA 3K65B 1O3FA 3KYGA 3TIUA 2AH4X 2W26A 3RUOA 1EATA 2HALA 4X1SU 2VH6A 1SLUB 1ZHRA 1N8OB 1Z8GA 1HXEH 1ZGIA 2BQ6B 2OBQA 5F8TA 1P02A 1YF4A 1LO6A 2C90B 3MU1A 2WHXA 1YLDA 3MU4A 5GDSH 1QZ8A 3QWCH 1RGQA 1ZYOA 3TNSA 4UFGH 3T26A 1NRPH 1VGCC 3M37A 3TU7H 2ZGXH 1D3QB 3A8BA 4DIIH 1GPZA 1ZPZA 1MQ5A 4B2AA 5DG6A 4TSFD 1HAGE 1KTSB 5JBCS 1ZSLA 3P95A 4ASHA 2A2XH 3RLWH 4WJG2 1GHAF 1O3CA 2VVUA 2HPQH 3I77A 1S6FA 3FZDA 2ZP0H 2ZFFH 1O36A 3ATWA 1UTLM 5JBBS 1FX0B 1O34A 4X1NU 3RXDA 1LKAA 1WOFA 1FDPA 1BTUA 3TITA 5DPAA 4YT6H 1GVLA 1UCYK 1Z1JA 3SZNA 2P59A 4I8JA 2ZPRA 1O3IA 2OCVB 2PSXA 3BF6H 1SQOA 3UNQA 4UFDH 2WSSD 3B8JA 1KMHB 5CHBA 1YGCH 4X1QU 4JYUH 3I29A 3V7TA 2EQNA 2B0FA 2GZ9A 3N7EA 1UMAH 2AGGX 1L1NA 1FY8E 1A61H 1YWUA 1CGJE 1BTZA 1TX6A 2JETB 1TB6H 1ETTH 4ZXYH 2EA3A 4Y11E 1ZMNA 4O97A 3S0NA 4MPUA 1G3DA 2TGAA 5HYOA 1GJAB 4WXIA 2ZFRH 1EZXC 2QXGA 5EJLA 1XM1A 3AK5A 1HNEE 2ZF0H 3C1KA 1NROH 4INHA 2H6MA 4AGKA 4CRCA 1OPHB 1NT1A 1THSH 4ZHAA 3U8TH 5GNDA 4DCDA 1E34B 1C5RA 5FPSA 1B0EA 1HAVA 1W7GH 2J98A 4CREA 2D8WA 2J92A 1AN1E 1O3GA 1VCQA 8GCHF 2ESTE 2A5AA 1ELGA 5JB8S 4DW2U 3PV4A 3SNCA 3GYMA 3SZEA 2QF0A 1T31A 4JMYA 5DN6D 1W2KH 1SGFA 1T8OA 4B73A 4ZROA 2Z94A 2AERH 2Y82A 1O2VA 1BMMH 4B76A 3QLPH 3RXCA 4ZH8A 1SLXB 2B8OH 2VJ1A 2BVRH 1UTMA 1NRNH 1C5SA 1O5GH 3KIDU 3I78A 4OS5A 4FVBA 1THPB 2AGIX 1FI8A 2F91A 2NWNA 4RSPA 4AFQA 3A83A 2Z9IA 4WMEA 1ARBA 1D3DB 2B9LA 4WMFA 4YT7H 5KEDA 1OWHA 1P2MA 3DT0H 3UOPA 2WYGA 3MWIU 3OSYA 2BLOA 4ISIH 2WPKS 1GI8B 4NSYA 1O2UA 1TBQH 5GXPA 1ZRKA 1ARCA 3FFGA 4CRDA 4Q2KA 2FS9A 4D9QA 3T25A 1CA8B 3D65E 2TRMA 1NPMA 1A3EH 2F9PA 3RXQA 1ZJDA 3PM3A 5AFYH 1XUFA 1MQ6A 4WXVA 1O31A 3MTYA 1CBWB 1C1UH 1XX9A 5A0AE 4MQAA 2R2MB 2VIOA 3V13A 4TPYA 1QA7A 4BAOB 1DSTA 1XMNB 1S6LA 1YPMH 4ABEA 4JZ1A 2TIOA 3SI3H 5EQQA 1YPLH 3MNXA 5JBTA 1GHWH 2BMGB 2Z9JA 3UREA 1GHYH 4Y10E 3LPRA 2JKHA 1J17T 1KY9A 3E3TA 4O03A 1J15A 1GL0E 1FY3A 3T2NA 1G3EA 4X6NA 1HJAC 5E8EH 1UVUH 2FOEA 3PTNA 1P3EA 2GGVB 5F6MA 3ZZDA 4CR5A 4RI0A 3SW2B 3BV9B 4ABAA 3ZZ9A 1BJUA 3KGPA 4NWLA 2GCHF 1PPGE 2IPHA 3Q00A 1C2EA 4AYVB 1GHAG 1GJ5H 1EB2A 1XVOA 1QY6A 1Z8JB 2G00A 3AASA 3D49H 2WZQA 5LPRA 3BTHE 1O32A 4IGDA 1GBLA 3KYFA 3L6PA 4OS2A 1SMFE 3EA7A 2OP9A 1H8ED 1TGBA 3ZVDA 4Y0YE 1BOQA 2C3SA 1K2I1 2J95A 3ZZ3A 3OYPA 3F9GA 1ANCA 1MABB 3M3VA 2XWAA 1A3BH 1DWBH 4SGAE 2KZ4A 3PB1E 3M35A 4Y6DA 4FUEA 2VVVA 4YOIA 1CT0E 1D3PB 1LPGB 1GHBF 1A5GH 1SGTA 1YY3A 1HAZB 1EPTA 3A81A 1K22H 2GDDA 2VNTA 1FMGA 3MOCA 3BSQA 1WU1A 3T27A 5I25A 2ZA5A 4ZHLU 3NKKA 3SU3A 1O2KA 3P8OA 4TY7A 5CHAB 2VH0A 3IWMA 4UDWH 1W13U 3GY2A 1UVPA 2BDAA 3BTDE 1LTOA 3S9BA 1NBME 5AHGH 2OC0A 4DG4A 4DURA 1LMWB 2M2AA 5EJZA 1ESAA 1TRNA 1GJ9B 1NN6A 2TPIZ 4NFFA 3GCOA 1ELFA 2GCTB 3PV2A 1ANEA 1QJ6B 1MU8B 1RRKA 3AVZA 3KQCA 2C8WB 3RXIA 1BITA 1P2NA 8GCHG 1E37B 3RMLH 2UWLA 2OXSA 4F4OC 3DFLA 1MUEB 3SQHE 2P8OB 4Z6AH 3NCLA 4Y7AA 3URCA 4ABGA 3HKJB 5E2PA 3DCLA 3SHAH 1C2JA 3UNRA 2VU8E 3BG8A 2RA0A 2A4GA 2RFKC 2FOMB 3SUEA 2F4LA 3RXLA 2PKSC 2P3TB 5LH8A 1A0JA 3A87A 3EDXB 3N99A 1MTNB 1GG6C 1EOJA 3MO3A 3N7OA 3ZZ8A 1PPFE 2CHAB 1UK3A 2LPRA 1GMDG 3LC3A 3ZZBA 4CRBA 2RG3A 4ISHH 5L6NH 1C5UA 5C67A 1RIWB 3TJUA 3UOUA 1IAUA 2BD2A 3VGCB 2AS9A 2FI5E 4F55A 3SU1A 4NA7A 3PO1B 2AMDA 2WPLS 1VJ9U 2C4FH 2QAAA 4FETA 2QA9E 2A5KA 2KCAA 4X0WU 4A1TA 1OXGA 2BY9X 2AHME 2G5VA 3GY4A 1HPGA 1MZDA 9LPRA 3M5NA 3S9CA 1UCYH 1XUGA 4ZXXH 2BDHA 1GCDA 1QBOA 1V2RT 1QA0A 5DP8A 2BDCA 2R0KA 2D26C 3VFEA 5FX6A 2FEQH 4E05H 2JJ1D 1SC8U 2CGAA 2BY7X 4XFQA 3RP2A 5EPYA 1V2UT 3RDZA 3FP6E 3U9AH 1XXDA 4AFSA 1SVPA 3VB5A 3EA8A 3E91A 1EPTC 3E6PH 3RXHA 1DXPA 3E0PB 1IQHA 1C1QA 1EUFA 1P04A 1OHHD 1ZMLA 2BB4A 3ZVFA 5FXLA 1UW7A 2V0BA 1F0UA 3RU4E 3PTBA 1FV9A 4K5ZA 3RC6A 2GCHG 1GI3A 2OTVA 1FZZA 2ZDAH 4E7RG 1G30B 2ZFPH 4LXBH 3DA9B 4RT1A 4MDSA 5ETXA 2Y5GA 3RXSA 1P3CA 3A88A 1YLNA 4M7GA 3RXBA 1O3HA 4TWWA 1CT4E 1O30A 2SGQE 2Z3DA 3KN2A 4NZLA 5E2OA 4YLUA 1ZHPA 3SNAA 3UB0A 5LPFA 3MU5A 1F0RA 1MBMA 3FZZA 2HWLB 1WDIA 4WH8A 2QXJA 1HFDA 1SGEE 1IQLA 1W11U 3Q3XA 2SGEE 1FY5A 1C9TA 3A7YA 1T8MA 1SGYE 1T32A 2ODYB 1IQEA 3SOSA 1LQEA 4X2XA 5B6LA 4B2CA 1G36A 1OWEA 2ZU2A 5F53A 2YMSD 2ZTXA 3VB4A 4B71A 2W3KA 1GHBG 1GBBA 1Z8RA 1YCPK 4O3UA 1C4Y2 1MCVA 3H7TA 2A4RA 1O2WA 1AHTH 1TE0A 1T4VH 1ZSKA 1QHRB 1TPSA 1TRYA 2RA3A 3M7UA 1EXFA 4AYYB 1QQ4A 3SNEA 3NUMA 5EQSA 4BOHA 3MNBA 1LPKB 2JIZD 1C1WH 3ENSB 3BTTE 1MTNC 5FL7D 1V6DA 4MNWA 5HMAA 4DIHH 3OAAD 2THFB 2OD3B 2ZTYA 1A7SA 4FUGA 5HXFA 4BTTB 1C4V2 3E0NB 5L2ZH 1TONA 3A89A 5C1YA 1OSSA 1THRH 1QBNA 1TPOA 3LDXH 2ZHEH 3DSGA 1PPZA 4YESB 1F5KU 3VGCC 2F9NA 3W1EA 2ZCHP 3UFAA 5EXLA 3SGAE 3PO1C 3GOVB 2FTLE 2VINA 3GCTF 2F9VA 2OC8A 1ELCA 4Y8XA 1QCPA 1BMAA 1ELVA 4AOQA 4JZIA 3KL6A 4TWYA 2FLRH 4YXWD 4SGBE 2JH0D 1QL9A 3VB7A 1C1PA 1SB1H 1O3NA 1CO7E 1OWKA 2F9OA 3GY6A 3OE7D 1RTKA 2HOBA 2Z3EA 1EASA 3ESTA 3SV2H 1C5QA 1C2HA 1EZUC 1VGCB 4INLA 2BD8A 4GPGA 4WF8A 3A7VA 2CJIA 4IBLH 1ELDE 1UVTH 1GWAA 1MTVA 3EGKH 1VITH 4NIWA 3VG8A 3MFJA 2Z9LA 1O2TA 1NFUA 2Y5FA 2J94A 1A1RA 5J4SA 2H2ZA 1TGNA 1DDJA 3EE7A 3R3GB 1O3DA 2V35A 1K1LA 2FM2A 1O39A 1IOEA 1C5VA 2BD7A 1JOUB 1ESBA 1GDUA 3RXFA 5EGMA 1CGHA 1K1MA 1AI8H 5LGOA 4HTCH 3TGKE 3QUMP 1KXFA 3HGPA 3RM0H 4K1TA 1BJVA 1AUJA 1HIAB 1O3EA 1GGDC 2R3YA 2BLQA 1GHZA 3OTPA 2HNTC 3PWCA 1TMBH 3PV5A 5FAHA 2IJOB 3F6UH 1SFIA 2GJGA 1O2PA 2XCNA 5DKMA 1QL8A 1DPOA 2VWOA 4I8HA 2EY4C 2OINA 1E1RD 2CN0H 2XBWA 3TK6A 3UR9A 1DICA 2FYQA 2A31A 4I8GA 2ULLA 2ZDNA 3BTFE 4Q80A 4AGJA 1PFXC 3QO6A 3RXEA 1O3OA 1ZGVA 3BTGE 2ZWLH 4MLFB 2ZPSA 1KXCA 1W3CA 3SJKA 3TK9A 1EKBB 1FY4A 1H1BA 1SGPE 4U30A 4KTUA 1SL3A 1MU6B 1H4WA 4NIYA 1LVYA 2ZI2H 8KME2 2QV1A 4I8LA 1TGTA 1GBTA 1RFNA 1GI4A 1HDTH 3RC5A 3A8AA 2H9HA 3RXPA 3G01A 3TK5A 3PMAB 4X6MA 1E35B 3DHKH 1BRBE 1DUAA 1NS3A 5EW1H 4XD7D 4B6FA 3OEED 1Y3VA 2OBOA 3UQOA 1HRTH 1KXBA 1O5FH 2OLGA 1EZQA 1RTFB 4D7FA 1S82A 1GJCB 1Y3XA 4UFEH 1O3PB 5C1UA 3M3SA 3W95A 5PTPA 1KSNA 4DGJA 1Y5UT 1GBDA 1OX1A 1ZTLA 1V2WT 4MNVA 4NIXA 2ZECA 5JDUB 1K1JA 3UIRA 2GTBA 4FUCA 3F3BA 1DVAH 3ODFA 1O5EH 4NCYA 2FESH 4IMQA 4CH2B 3T28A 3PMHB 1VCPA 3H7OA 3VXFH 1MAYA 1QB1A 5DK1A 1UK2A 4FUFA 1BTXA 5EODA 4WY3A 1GBAA 2PUQH 1D4PB 2BDBA 1ANDA 4VGCB 2FPZA 1OS8A 4ABHA 1NRRH 1C9PA 2ZDMA 2PGQB 3A82A 2ZCLP 2FZZA 4CRGA 4GSOA 1MKXK 1O2LA 3UY9A 4M9FA 1PYTD 4I31A 3BTQE 2SGPE 2BZAA 3HK6B 1VR1H 2FWWA 3RC4A 5F8XA 1TNGA 3TH4H 4HI3A 3ZIAD 1D6RA 1LHCH 2V6NA 3GCTG 5KECA 4P00A 1GVZA 1SQAA 4K8YA 2ZQ2A 3BEUA 1O2RA 1O3MA 4TYDA 1O2QA 1KLJH 3B23B 1TNHA 5JBAS 5E0HA 3A7ZA 3LT3A 1GI7B 4FUBA 4A1XA 1K1IA 1CSOE 1S83A 4ACBA 2QGRA 2J34A 1W10U 2C93B 1HJAB 1MKWH 5A8ZA 1PPHE 4MNXA 3DUXH 1EAXA 1VZQH 4CBOA 1P01A 2XC0A 1P03A 2ZFQH 3CP7A 3ITIA 4B2BA 2C8XB 4X8UH 3TJOA 4I7YH 1ABJH 2R3UA 5L2YH 1O0DH 4RN6A 1BUIA 1DOJA 4WMDA 2ZCKP 4DJZB 4DVAU 2ANMH 1ZRBA 1CGIE 3E90B 4GVUA 1BBRE 1BDAA 4YM9A 5IDKA 2FS8A 2V3HH 5ESBA 3BG4C 4XE4A 2UUKB 1DY9A 3FOAA 3DD2H 1HAIH 1PPEE 1HAVB 3KNXA 2GV7A 2BDYA 2J98B 4UE7H 2BQ7B 1HGTH 5E0JA 1P06A 5IYTA 3V12A 3OX7U 1Z6JH 1Y3YA 1CQQA 5DGJA 1RD3B 2O8UA 3QX5H 1WTHD 1O3JA 2CF8H 1Y3WA 4R8TB 3QN7A 1N1LA 3TJNA 3O8RA 1UJ1A 4RT0A 4D76A 1GMDF 1TOCB 2J97A 3QGNB 1N6XA 4VGCC 3ATKA 4BAQB 1GJBB 4U2WA 3HATH 4HG6A 3E1XB 3MMGA 1MTSA 1AE8H 3U8RH 2KAIA 1GCTC 1ZZZA 2IPQX 1P12E 2Q6DA 3CENA 4A6LA 1EAIA 1ETRH 2R0LA 1UTKA 3OU0A 1KDQA 4ZCNA 4GLYA 2A32A 4BAMB 1O5CB 2ZU5A 3A84A 1F7ZA 2BXUH 2NU3E 2C8ZB 1FN6A 2AIPA 2W6ID 4UEHH 3EAJA 1P2JA 4KTSA 2CK3D 4YZUA 3UWJH 1ZLRA 2QF4A 2PKAA 3LJJA 1O2NA 1EJMA 2Y7ZA 1DSUA 4ZKNU 1C2KA 3M61U 1C5PA 1GMCF 4MPVA 3P8NA 4AB9A 1EAUA 3NWUA 3A7TA 2ZHDA 1G37A 2PKSB 1OWIA 1E79D 3S7HB 1LDTT 1DXWA 1IQGA 1NFXA 1P0SH 1SGQE 3DFJA 1GG6B 1A5HA 3WY8A 5EQRA 2PSYA 5C2ZA 2XYAA 1AVGH 2Y5HA 3UR6A 2BQWB 4JCNA 1EFRD 1TNJA 1GBFA 1S5SA 2IOTA 2ILNA 5DP3A 5T3HA 4AG2A 2FOAA 3OY6U 1TALA 1BMFD 3M5MA 3ZYEA 1BBRK 1V2KT 6LPRA 2BDIA 4OGYA 1ELBA 2A1DB 2K1QA 2XBVA 2PP6A 1TA6A 1TQ7B 3STIA 1SLWB 1YLCA 3CS7A 2G55A 2VWMA 4E06H 1DLKB 1XUJA 2UUJB 4XBCA 2PGBB 4X2VA 3ZVCA 2O8WA 2XXLA 4ASUD 3QGJA 1Y5AT 3E16B 2ZHQH 1S81A 1NFWA 2ZNKH 1GBCA 1GBKA 1H8HD 1ETSH 1ZTKA 3RU4T 2J4IA 1V2JT 2Z7FE 3UPEA 1C2MA 2BX3A 2EI6A 5JB9S 4HFPB 3PLPA 3R0FA 1PQ5A 1EPTB 1AZ8A 1P2KA 2AMPA 1AWHB 3LONA 3MU8A 1SOTA 3UWIA 1ANBA 4AFUA 1V2OT 2YMSC
chains in the Genus database with same CATH topology
2QY0B 1BMLA 5DJ7A 3K6YA 1TAWA 2F83A 5K7RA 1GVKB 3Q77A 3QTOH 2FXRA 2O8TA 1C5MD 1C1MA 4O9VA 5HM2A 1O37A 1C5NH 3LC5A 3TLOA 4E7NA 4FU7A 3KQBA 1UTNA 1HYLA 1YPHC 3SGQE 3SUDA 1SG8B 1MMJN 1C5YB 1BTHH 4H6SB 3TGIE 1GBMA 1SGFG 1QGFA 1P8VC 5C1XA 4DY7B 3SJ8A 1ORFA 1AFQC 2GT8A 3GICB 1SPJA 2EI7A 1A46H 1DY8A 1SGRE 1GDQA 2JH5D 3ATIA 3D62A 1PQAA 4AX9H 4QT8C 1KXEA 3IITA 3TNTA 2WUCA 2PTNA 1BRAA 2BVSH 5DP7A 5BRRE 1C5XB 4KELA 3SU6A 2I6QA 6GCHF 2O9QA 5CE1A 1QFKH 2ZU1A 3HK3B 1HCGA 4AB8A 1YPHE 2STBE 4X1PU 3U98H 3ZVEA 1FPCH 2VIVA 2XRCA 2P3FH 1JMOH 3TH2H 1G32B 1A2CH 1YCPM 2AYWA 4KTCA 1Z8IB 1WCZA 2R9PA 3ZV8A 4ZKSU 1ABIH 1EAWA 2ZDLA 3P17H 3F1SB 3EYDA 4X8VH 2VB0A 3ZZCA 8LPRA 2V3OH 4OS1A 1KLIH 2ALVA 4ABFA 1ZSJA 1YM0A 1JIMA 4MVNA 3JZ1B 2DE9A 1K1PA 1A0LA 3NPSA 5HGGA 1BRUP 1MH0A 2XTTB 2PUXB 2H5CA 3FANA 1TQ0B 2VWLA 2UWOA 3SJIA 5A2MH 1GI0A 7GCHF 1QURH 1HJ8A 1AGJA 1O2XA 1TABE 3GCNA 1KXDA 2HPPH 4WWYA 1DLEA 1TFXA 3M36A 5K0HA 2FOGA 1GMCG 3NZIA 4O3TA 2B5TB 2VGCC 4MTBA 1P2IA 3FP7E 1AB9C 1YP9A 1PQ7A 2ZDKA 3PMJA 1IQIA 3GYLB 3QK1A 2P94A 3EA9A 4DOQA 4FVDA 4XBBA 4Q7YA 1SBWA 2P93A 4OS4A 4YTAA 1OYTH 2HNTF 2W7UA 6CHAC 2BZ6H 1PPCE 2BOHB 1O2GH 3F68H 2O8LA 1HBTH 4F49A 1T8LA 5ESTE 2A0QB 2G81E 4ZAEA 1GBEA 2GKVE 1TGSZ 5G4BA 1GHXH 1V2PT 4UFFH 2HLCA 3RXTA 1GGDB 3NXPA 1GI6A 1S0QA 1F0TA 1OP8A 3MHWU 1QJ7B 1S85A 4AZ2B 2W3IA 2PLXA 2QYIA 4IN2A 1RXPA 2STAE 3VXEH 1F0SA 1JXPA 2GX4A 3RLYH 1NY22 2ZO3H 3TJVA 3B9FH 4R0IA 1P9UA 3BN9A 1OWJA 1O2MA 1W7XH 3SNDA 1SGNE 1O33A 1L4ZA 1CVWH 3GY3A 5J4SA 1BTYA 1WQVH 3BIVH 5F03A 3MNCA 1GI9B 1DWEH 2FX4A 3F9HA 1UO6A 1OP0A 3S9AA 3MNSA 1IHSH 2Q6FA 1FN8A 1HV7A 1NC6A 1Z71A 4BTUB 3SUGA 3LGTA 1AKSA 1D3TB 1P10A 3V0XA 5LPEA 1FLEE 2P95A 1IQFA 1WQSA 5FCKA 4CHAC 2ZKSA 3SJ9A 5C5NA 2WV4A 1JBUH 1ELTA 3KF2A 4LOYH 3SBKA 3Q3YA 1H9IE 1EP6A 2QXIA 1F2SE 4NSVA 1YYY1 1BHXB 1EB1H 2JH6D 4NZQA 1GJ8B 1VITF 3VB6A 2P16A 4XBDA 2ZGCA 3GDVA 4MPWA 2SFAA 1T7CA 1C5TA 1TBRH 1DANH 1C5WB 1PYTC 1RS0A 1JWTA 4Y76A 2FOFA 3SV8A 2BLVA 1SLVB 1LCYA 2FI4E 5H4IB 1ZPCA 4ZMAH 1V2ST 5T6FA 4BAHB 4BTIB 2GVFA 3SUFA 1EJAA 4MNYA 4NA8A 3UUZA 3A7XA 4HGCA 1FAKH 3M3TA 3MO9A 2SGFE 1EP5A 2ZZUH 1C1VH 1G2LA 1EX3A 6GCHG 1N6YA 1NM6A 1P11E 1J14A 4LZ1H 3PWBA 1OKXA 1XKAC 4ZKRU 1O38A 3ZZ6A 3S69A 1CT2E 1FIZA 3KQEA 5I46H 3GY5A 3MO6A 3T62A 1T4UH 1GMHF 1G2MA 3UTUH 1EJNA 2CMYA 4IC6A 3UQVA 4YOJA 2GT7A 4JZDH 5JYIA 1AU8A 1GL1A 2J38A 4I32A 2ZTZA 1CA0C 2ZGBH 4TPIZ 2OC1A 1DWCH 1V2MT 5TCCA 3PROA 3SU0A 3K9XB 7GCHG 2F3CE 1C2IA 5BPEA 2IN2A 1UVSH 3LGVA 2GMTC 4NGAH 4IN1A 1KIGH 1FONA 1KLTA 4CRFA 1A4WH 4Y71A 1JIRA 1WSSH 1TX7A 2ZEBA 2CV3A 1KXAA 3L3TA 1T8NA 1V2LT 1LQDB 4ZUHA 1YPGH 2SGDE 2Z9KA 2PWXA 3QDZB 3D23A 1B0FA 3BG4B 1KYNA 2BD4A 5HM9A 2SNWA 2FDAA 3A85A 1LHFH 4JZFH 4YOGA 1DITH 5DP6A 1O5AB 2CXVA 5GIBA 3BEFB 1S0RA 4FU9A 2BY5X 4INKA 3CS0A 3P92A 1SHHB 3LGUA 3ELAH 1V2QT 5C3NA 3F9EA 2BY6X 5FCRA 4DT7B 2FI3E 4H4FA 1NRSH 4U01A 2WV5A 5CMXH 2A7JA 2ASUB 3AW0A 4OS7A 2XBYA 2YNAA 1CHGA 4K8BA 1NZQH 1JRSA 5A8XA 1D9IA 1EZSC 2BD3A 3GCHB 4UD9H 5GCHF 3HKIB 4K69A 3TH3H 1F5RA 1O2ZA 5GJ4B 1O2IA 5A0BA 1K9OE 1YPKH 2BVXH 1DX5M 4AFZA 3A86A 1ELAA 1ZR0A 1O2OA 4GHTA 4U32A 1GCTB 1L1GA 2OUAA 1TIOA 1UTPA 2OQ5A 3RXVA 3S7KB 1IQMA 3LH1A 3SN8A 3GDUA 1ZOMA 3RXJA 1DT2A 1IQNA 1Z6EA 4X8TH 3BTWE 4B1TA 3FP8E 2TGPZ 1UTQA 2XCFA 4TY6A 1RJXB 3OY5U 1HAPH 2A2QH 1VITG 1UHBA 4FUJA 1A5IA 1G3CA 2BXTH 4ABBA 2HRVA 1INCA 5FBEA 1MAXA 1LKBA 3RXOA 2VIQA 2J9NA 1G9IE 2Z9GA 5DO4H 1AFEH 1GJ4H 3W94A 1UHBB 2ALPA 1C2LA 3M5OA 1OP2A 5C5OA 2B7DH 2SGAA 2AFQB 2FODA 4FUHA 3GDSA 2BX4A 1FAXA 5AF9H 2HGTH 1RTLA 1ZHMA 3T5FH 1FJSA 3RXKA 3O8CA 1C1NA 1M9UA 1Y3UA 4AN7A 3BTME 1WTGH 4ZKOU 2BHGA 3RM2H 2H5DA 1ID5H 1SR5C 1DS2E 3A7WA 3KCGH 2FYRA 4WVPE 3L33A 1TNKA 3BEIB 3U1IB 3M7TA 1Q3XA 1E36B 4FU8A 2G52A 1O3KA 1W0ZU 2ANKH 3SORA 3VEQB 1OYQA 5T6DA 3F9FA 1GMHG 1EOLA 3V3MA 3GISB 2BDGA 1GBJA 4B74A 1YKTA 3SU5A 1ZMJA 2TGDA 3RXGA 2BM2A 4FUDA 5FBIA 1V2NT 2FOHA 1H9HE 1XUHA 2ZGHA 3T29A 1GDNA 1CU1A 1SSXA 3LOXA 1L1JA 2F9UA 4JK5A 5FPYA 1N8OC 1AY6H 1DFPA 2R2WU 2GP9B 1K1OA 1FUJA 3GCHC 4OS6A 2WPHS 3LJOA 2TBSA 1MTUA 1YCPH 2BD9A 4Q7XA 1FNIA 3A80A 1B5GH 3U8OH 1GI5A 3RMOH 1AO5A 4OGXA 1W14U 4BNRA 4UONA 5EPNA 1B7XB 7KMEH 5T6GA 2UUYA 3P6ZB 4K1EA 8ESTE 3MH6A 1TPAE 2FOBA 4Q7ZA 3RXRA 1O5BB 2KAIB 2NU4E 2PTCE 3E8LA 1W0YH 3PLBA 1O3LA 3ZVBA 1AIXH 3SO3A 1C1TA 1TGCA 2AEIH 1P2QA 1C5LH 1C5OH 1AFQB 1KDQB 1BCUH 4ZHMU 1EQ9A 3P70B 2TGTA 4ABIA 1LVBA 1AVXA 1BRCE 3MH4A 5AFZH 1QTFA 4D8NA 1AVWA 1QRZA 4X1RU 4X8SH 2AIQA 2QN5T 3QZQA 1Z7KA 1X7AC 5EW2H 2WPJS 2DUCA 1C4U2 1MCTA 1SGDE 2PKAB 1MBQA 4NA9H 1O3BA 1V2TT 1H9LB 2BLWA 4H42U 5FX5A 2QIQA 1O2SA 1UK4A 1TMTH 3VPKA 1BT7A 1XVMA 2BD5A 2EEKA 3M5LA 2GZ7A 4ISLA 1TRMA 5EU8A 5GCHG 2JETC 2FX6A 3TPIZ 2A7HA 2BYAX 1UVOA 5A09A 2Y81A 1SOZA 1KTTB 2BOKA 2H9EH 3URDA 3ZVGA 1ZTJA 1ELEE 1L2EA 2A5IA 7ESTE 4D7GA 4NIVA 3RXAA 5B6OA 3ZV9A 3NK8A 4X6OA 1TMUH 2ODQA 4D9RA 2M5TA 2ZIQH 5GPIB 4CBNA 1QB9A 1TNLA 3MYWA 2Y6TA 4H6TA 2QF3A 4K3JA 4IW4E 4B75A 1O3AA 2G4UA 2EC9H 3MH5A 1SGIB 3RMMH 6ESTA 2UWPA 4CR9A 1WBGB 2OC7A 4BXSA 2ZC9H 1CE5A 2VIDA 4KGAA 2D2DA 1LPZB 4XOJA 2A4OA 2PV9B 2VGCB 1AB9B 1HLTH 3SQEE 3A8CA 1YBWA 2GV6A 1NESE 1P9SA 2NU2E 2VIWA 1V3XA 3O8BA 3PLKA 1C1SA 1TWXB 2RDLA 2G4TA 4K60A 6CHAB 1HAXB 4ABJA 1QQUA 2ZHWH 3BTKE 3JZ2B 1Y5BT 1J9CH 4WH6A 1HB0B 1W8BH 1HUTH 2ANWA 3AAUA 5SGAE 2WINI 2EI8A 3ZZ5A 4LZ4B 1ZPBA 3SV9A 1LHEH 4Y0ZE 2G8TA 5A8YA 4A1VA 1VJAU 2F9BH 1UTJA 3K6ZA 2XC5A 1AWFH 1DE7H 1O5DH 2H1UA 3Q3KA 4ISOA 1V2VT 1CBWC 2ANYA 9ESTA 1FIWA 4JYTA 1O35A 2QCYA 1TOMH 5EXMA 5F8ZA 1Q2WA 1TX8A 2G51A 1TA2A 1QNJA 1L0ZA 1GJ7B 2Z6BD 4IMZA 2WPIS 3ZYDA 1PJPA 1LHDH 3LGYA 2ZQ1A 1QL7A 4GCHF 2WUBA 2A45B 4NG9H 2AGEX 4XSKU 3O8DA 4X2YA 4JK6A 2C8YB 1A0HB 4J2YB 3SJOA 4CHAB 2W5EA 4JYVH 1UTOA 1MZAA 2FTMA 1LHGH 3FAOA 1GJDB 4Z0KA 3ZZAA 2BTCE 3GY7A 3RMNH 1NU7B 3PYHA 1QB6A 1MKXH 1WYKA 1ACBE 2WYJA 5C20A 2ZDVH 2GZ8A 2FMJA 1L4DA 1WV7H 5L30H 1JRTA 3Q76A 4Y7BA 3H5CB 1TBZH 5FPTA 3OTJE 3SHCH 5FHTA 2GD4B 2QC2A 1NTPA 1DUEA 4AORA 3K2UA 1Z1IA 2FLBH 2GDEH 3SU2A 1AZZA 3MI4A 3SI4H 4RKOB 1P2OA 1VCWA 3UNSA 1HXFH 1P09A 3LH3A 1AQ7A 1MKWK 1QJ1B 1C2FA 1SGCA 1C1OA 2VIPA 4MPXA 1C5ZB 1GI1A 1Q31A 3P8GA 1NFYA 3M7QA 1GI2A 3TGJE 2A4QA 3SV7A 3U1JB 2PHBA 2YNBA 4A92A 1GJ6A 1K28D 5TJXA 4ISNA 3IG6B 4NWKA 3TVJB 3BTEE 4K1SA 1LVOA 1AMHA 2I6SA 3SNBA 2XC4A 4MG3A 2G5NA 5CHAC 2DE8A 1TPPA 3LIWA 1BB0B 1CHOF 1WAYB 2VWNA 1D6WA 3ATLA 5DP9A 5EOKA 1BMNH 4BAKB 2ZFSA 1F92A 4ESTE 1S84A 2XWBI 2HVXA 1J8AA 4FXGH 2PFEA 1BZXE 2GCTC 1CA0B 1SHYA 2FP7B 3U69H 2QXHA 2FIRH 2ZU4A 5AVDA 5JPMH 1FY1A 5GWZA 3QZRA 2P8OC 4GUXA 4FUIA 3RXUA 2CF9H 2GMTB 1DM4B 4I8KA 1IHTH 1BHXF 1XXFA 1Y59T 1TLDA 1FQ3A 1H8DH 3ZZ4A 1MD7A 1ZJKA 4BXWA 4GAWA 1P57B 2J2UA 1E38B 3EE0B 4CH8B 3KEEA 2PW8H 1GBIA 1NU9A 1QIXB 1AKSB 1AUTC 1XKBC 2W7SA 4CRAA 2CHAC 2D1JA 1MTWA 2PR3A 1E0FD 1QRXA 3AAVA 2XBXA 4Y79A 1RIWC 4THNH 1NRQH 1TYNA 4KP0A 3LU9B 4YLQH 2NU1E 1H8IH 1ESTA 4AG1A 1C1RA 3ATMA 2FOCA 1LVMA 2ZG0H 2UUFB 4A7IB 5EXNA 1GHVH 2Q6GA 1SI5H 2Q1JA 1TNIA 4KKDA 3C27B 5TCAA 4IC5A 1IQKA 3LKWA 4A5TS 3LGWA 3SGBE 4Y8ZA 1SQTA 3FVFB 1HAHH 1K21H 1PQ8A 2H9TH 1QR3E 2SNVA 4JZEH 4GHQA 4PROA 1XUIA 1MD8A 1YC0A 1BTWA 4J1YA 2FO9A 3PMBB 3AW1A 4GCHG 1SFQB 2OQUA 3VB3A 1DWDH 4XDEA 4NFEA 2ZFTA 3SU4A 7LPRA 5ABWA 3BIUH 1BQYA 4HZHA 1O2HA 3KQDA 1HIAA 3RU4D 1PPBH 3P8FA 1W12U 1HAOH 1UCYE 1BA8B 2NU0E 1YPJH 2ZU3A 1BBRH 3HPTB 5DP4A 1J16A 1U6QA 2LNCA 4YO9A 2XNIA 2Y7XA 2Y80A 2RCEA 4BANB 2Z3CA 3STJA 1FXYA 2O8MA 3RXMA 1FPHH 2VVCA 2ZPQA 2ZHFH 1G3BA 3ZZ7A 2BY8X 1YPEH 1AE5A 2XW9A 1AD8H 5E0GA 5EG4A 4X6PA 1K1NA 3MH7A 1C2DA 1QRWA 1WUNH 3KHVA 5J4QA 3QTVH 1HJ9A 1P05A 3LGIA 3SV6A 4Y8YA 2AMQA 4RKJB 3MU0A 4IS5A 3A8DA 3GY8A 3ODDA 2P3UB 1O2YA 1C2GA 4ABDA 1NO9H 4K2YA 1QBVH 1GBHA 1Y8TA 4LK4A 1XUKA 2YOLA 1O2JA 1S6HA 5DP5A 1BIOA 1F5LA 1OOKB 2WPMS 3ZVAA 1BTPA 2A7CA 3EQ0H 1HAYB 1OWDA 2ODPA 2ZGJA 3HGNA 4I33A 5A0CA 2HNTE 1CHOG 1IQJA 3K65B 1O3FA 3TIUA 2AH4X 2W26A 3RUOA 1EATA 2HALA 4X1SU