1G3DA

Bovine beta-trypsin bound to meta-amidino schiff base copper (ii) chelate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title X-ray crystallographic analyses of complexes between bovine beta-trypsin and Schiff base copper(II) or iron(III) chelates.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3dA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g3dA02
1HDTH 1BITA 1W13U 1GGDC 2OQUA 2XCNA 2FLRH 2JETC 1D6RA 3BTEE 3MO3A 5DP3A 4BXSA 3QTOH 3K6YA 4FUEA 1HJ8A 5T6GA 1PPHE 1C1WH 1MQ5A 1PQ5A 1YKTA 1W7GH 4AFZA 5JB8S 1SPJA 3DA9B 3MNBA 2ZO3H 3MNSA 4AORA 3M61U 4ZKRU 3RXSA 5DP9A 3C27B 9ESTA 3M36A 1H9LB 1LVOA 1UHBA 1YPJH 4CRDA 1FY8E 4DGJA 2ALVA 2ZPSA 1NRQH 3SHCH 3M7TA 3ATLA 1EKBB 1OYTH 1DLKB 3TH2H 2BY8X 1UMAH 2GT8A 3GY7A 2GV6A 1O2QA 1TMUH 1NU7B 3L33A 5LPFA 1QIXB 3SJKA 3GCOA 3L6PA 4R8TB 2GDEH 2BQ6B 4J1YA 1TIOA 2OTVA 3LH3A 3MH6A 1OWDA 9LPRA 3SORA 2ODPA 1ZMNA 1P12E 5IYTA 4DVAU 3F6UH 2VH6A 1V2WT 1ZTLA 2AERH 2BDYA 3M3TA 7LPRA 4DCDA 1E0FD 2FI5E 3BIVH 3HPTB 3IG6B 4A7IB 1WV7H 1TNIA 2GCHG 3PM3A 5F03A 1DWDH 1MQ6A 3SV2H 2VIVA 2EI6A 3TJOA 1FY5A 1OSSA 1CVWH 4VGCC 2F9PA 3BSQA 3RU4E 1RXPA 1QRZA 2QCYA 4I8JA 5E2OA 1P9UA 4JZIA 5C5OA 3KQDA 1XMNB 1V2JT 4Q80A 1HAVB 1ELEE 4KTCA 2CGAA 1O2WA 3ZVFA 4E05H 4DIHH 1ZHPA 1QJ6B 1ABJH 3LJOA 1GVKB 3BTWE 1GJ9B 1UTKA 5EW2H 5K0HA 2QGRA 2LPRA 2QF3A 4ABGA 3SGAE 2V35A 1CT0E 2FOMB 1GBLA 2OBOA 1O2OA 1UTMA 5T6DA 1P2MA 3GY4A 2ZHQH 2VGCC 1HXEH 3TGKE 1LPZB 1FV9A 4MQAA 4BTTB 2BD7A 1NRPH 1BRBE 2WYGA 2TPIZ 1TFXA 3OY6U 1TPOA 4ZHMU 4DY7B 3KQEA 1C2IA 1GI5A 1THRH 1VJ9U 1WQVH 2BOHB 2QY0B 1RGQA 2Z3EA 3OSYA 1SFIA 4FUIA 1NROH 1Z8IB 2HWLB 3UNRA 1N1LA 2GCTB 4LZ4B 1A3EH 2FOAA 1P8VC 3UNSA 1LHCH 1S81A 5JDUB 2J92A 4NIXA 1K22H 6GCHG 3KHVA 3M5NA 1CQQA 1XUJA 4ZH8A 3ZZBA 4KP0A 4KELA 1ZMLA 1AVXA 2HPQH 3G01A 4MG3A 1LO6A 2PUXB 2VJ1A 3IITA 5HYOA 4RSPA 4DG4A 1GBMA 4JYUH 1C1NA 1AQ7A 2PW8H 4CRAA 4WWYA 4UE7H 1JIRA 1QA7A 1BTWA 1YGCH 5A2MH 1PJPA 4R0IA 3O8DA 5A0CA 1LKBA 1SVPA 1P2QA 4UFEH 4MPUA 1AUTC 4WXVA 4TYDA 4B1TA 2Z6BD 2ULLA 2WPJS 1EATA 1HUTH 3GDUA 4CRCA 2CN0H 2CF9H 4CHAC 4JK6A 1O2HA 3A7YA 1AU8A 5AFYH 2IPHA 5GIBA 5HXFA 1GBEA 3LT3A 4O3TA 1TABE 2BXUH 1W3CA 1O2LA 1ID5H 1E35B 1K28D 3UUZA 2VINA 1V2OT 1FDPA 2BB4A 3PTBA 3TVJB 4LZ1H 3M35A 2ZCHP 3SJ9A 2F9OA 1NM6A 1S85A 2J38A 1Z8RA 1QRXA 2C3SA 2PV9B 4IN1A 2PUQH 2PKSC 4D9QA 3RXKA 2GCHF 1TPSA 4YESB 4YOIA 2PSXA 1BMLA 2OQ5A 1A0LA 1AFQB 3MO9A 2PKAB 3ZVCA 4Q7ZA 3MHWU 4TY6A 1EPTB 3MI4A 1O37A 4WVPE 4ZAEA 1SLUB 1KXFA 1UVUH 1GJ4H 4PROA 1KDQB 4RN6A 1V2TT 5L2ZH 1AB9B 5C2ZA 1UVOA 3VB5A 3AAVA 4QT8C 3SUFA 1RTFB 2H5CA 1Y5BT 4JZDH 1IQJA 1UK3A 4HFPB 1DS2E 2J94A 1FPCH 1GDQA 3DFJA 3FANA 1GBAA 2Q1JA 1KXAA 1ZRKA 1LHDH 2SGPE 1Y3XA 1EQ9A 1K1PA 2A5AA 3UNQA 1HLTH 4Y7AA 2BX3A 1FIWA 4GHQA 3RXLA 1TA2A 4AFQA 3MU1A 3TGJE 2CF8H 4GHTA 2BX4A 1SGDE 3DFLA 1Y3UA 1TPPA 2SGFE 3RXRA 1F7ZA 1MMJN 1ZYOA 3GY3A 3KL6A 1L4ZA 1QRWA 4B71A 2C90B 3OY5U 1LHGH 1LKAA 2F83A 1Z6EA 1MTNC 3BIUH 1TLDA 2WPKS 3E0PB 1GBDA 3GYLB 2XYAA 4WXIA 1BBRH 6GCHF 2UWPA 1LPGB 1NO9H 4YOJA 4NFFA 1DXPA 2CMYA 1Q31A 1TPAE 4AN7A 1PPBH 1BRCE 1LTOA 4KGAA 3TJVA 1ZRBA 2GZ9A 4X1QU 2AH4X 1DUAA 1P03A 1IQMA 4NSVA 2ANMH 3M5MA 1SL3A 3ESTA 3MU5A 1KLTA 1QR3E 1DM4B 4ZUHA 2OXSA 2WV4A 3D65E 4WMEA 2Q6GA 1INCA 1T32A 3RMLH 3A87A 1TOCB 2FS9A 2ESTE 1FQ3A 1G9IE 3EQ0H 1MAYA 3LJJA 4Q7YA 3RXDA 3TITA 1O2SA 1UVPA 5JBBS 1A46H 1XXDA 4NIVA 1V2MT 3AW0A 2PSYA 2ZPQA 2BMGB 1B0EA 1CGIE 4WMFA 1K21H 1L2EA 4AFSA 1Y3YA 1W12U 3O8BA 3T5FH 4U01A 1JBUH 3UIRA 1P06A 4NIWA 2XW9A 5CHAB 3PO1C 3SNBA 4NIYA 1TBRH 5FAHA 1A3BH 2G5NA 1G36A 1CE5A 1BTHH 1O2TA 2SGAA 3MNCA 1GJ8B 2BDGA 1XUFA 3MH5A 4JK5A 4I8LA 4CBOA 3A8AA 2AEIH 1CGHA 1E36B 3RC4A 1UVTH 3Q3YA 1K1OA 1P05A 1C4U2 4B73A 1KYNA 1O3KA 3TK5A 5JB9S 3RXMA 2EI8A 3SU0A 5DP8A 1SLXB 1QTFA 1F0TA 3D23A 1G3BA 1BTYA 2AGIX 1HBTH 1ARBA 4KTUA 4B2BA 1SMFE 1C2HA 2ZDLA 4NZLA 3SO3A 2O8MA 1UCYH 2AMQA 1YPHE 1EZUC 1CBWB 3PTNA 3ENSB 3PYHA 3KIDU 1HAZB 1LMWB 3R3GB 3QDZB 1BOQA 4IN2A 3ZZ7A 1QB6A 1KLIH 1SGIB 2J4IA 3V13A 4OS6A 4ZKSU 3LGUA 1AVGH 2ZNKH 1EPTA 2FYQA 2PHBA 3ODFA 1EAWA 1JWTA 1VCWA 3QO6A 1OWHA 2G00A 1KDQA 3SNDA 6CHAB 3MU4A 2QV1A 1MAXA 4IMZA 2D2DA 4X1RU 5LPEA 2P3FH 4AFUA 2ZF0H 3ZYDA 4BAQB 3UPEA 7KMEH 4X8VH 2R0KA 1CT2E 1HAIH 1IQNA 4FU8A 1TNGA 4FUDA 3A89A 2AS9A 3ZZ3A 2FOGA 1GBBA 1C1RA 1GWAA 1UJ1A 1J16A 3MFJA 2C4FH 3ZZ8A 1SI5H 1DY9A 3FZDA 4MNWA 3UOUA 1GHBF 1TNLA 2QYIA 1SOTA 4WH6A 5DP4A 1D4PB 2H2ZA 4FUJA 5TCCA 1TRNA 2ZDAH 4HZHA 4ABBA 3GY8A 3FP6E 1GHAG 1LVBA 1KSNA 3SNAA 1OWJA 2A2XH 2FOBA 2FO9A 1TOMH 1RTKA 1DANH 1FN8A 2Z9KA 3ATKA 2ZI2H 5A8YA 1ACBE 3E16B 4MPVA 3LKWA 2YNAA 1UTJA 1TNHA 1E34B 2R2MB 2ZU3A 1ZTKA 3P17H 2AIQA 3RC5A 1LPKB 4FUHA 1AN1E 1O3LA 4I7YH 5I46H 2NWNA 2XCFA 4MPXA 4HTCH 4BAKB 2GGVB 2ZHDA 1TWXB 3N7OA 1QL8A 2O8UA 2QN5T 4X1PU 1DOJA 2PTNA 3RMNH 1G30B 1FIZA 5L2YH 3DT0H 2FOHA 3T2NA 1S5SA 2A7CA 1XVMA 2P8OB 3MH7A 4Y76A 1NY22 2BZAA 2CXVA 2Z3DA 4E7NA 3MNXA 1ELVA 1KTTB 7GCHG 2QAAA 2FMJA 1GJ5H 1V2ST 1C5MD 1CT4E 1W0YH 1IQFA 3VFEA 4D7FA 1HPGA 3PV4A 1ZPCA 1SGNE 2ZDMA 2QXHA 2XRCA 1N6XA 1GJ7B 4O03A 1ANCA 1RRKA 4FVBA 4UD9H 2QXIA 3NK8A 1FAXA 1ZTJA 1VITH 3H5CB 3FVFB 1C5RA 1TGBA 1F5KU 2Q6DA 1OP0A 1O3MA 1NRRH 2FX6A 1YPGH 2FYRA 1DXWA 1ABIH 3NCLA 2ZU1A 3RDZA 3SOSA 2GVFA 3E1XB 2GCTC 1DVAH 1NRSH 4O9VA 1VR1H 4Q7XA 4MLFB 1Z71A 1XVOA 1TALA 3UWIA 1GG6B 2UWLA 1HAHH 1JXPA 4YZUA 3PLKA 8GCHF 4GAWA 3T28A 3SJIA 1C5ZB 3TNSA 4KKDA 3A8CA 1DSTA 5H4IB 1FXYA 4GCHG 3STIA 1GHYH 3LH1A 1NFXA 1GBJA 1CHGA 1FNIA 1SGQE 2P3UB 3S69A 2SGQE 2LNCA 2JH5D 2WPHS 1OS8A 4AYVB 1HJ9A 1GMHF 1DPOA 1MH0A 4IW4E 3QGJA 1PQAA 1AHTH 2BDCA 3H7TA 1O3AA 1HAOH 3F9FA 1O39A 3PROA 8ESTE 3VB7A 2EEKA 3CS7A 3RXBA 1EJMA 3P95A 3PLBA 1QQ4A 3SBKA 1GHAF 1OP2A 2A5KA 1MKXK 3LGVA 4A6LA 1C1QA 5F8TA 5JBAS 2ODYB 1PPEE 1SGTA 1ZPZA 2ZFSA 2OLGA 1ANDA 4FUCA 1SGEE 1ESTA 1IQIA 4X0WU 1P3EA 2A4OA 1V2QT 5CE1A 1AFQC 1SLWB 1W10U 1XUKA 1ZHRA 2PTCE 3E91A 3B23B 1QHRB 3BF6H 3U8OH 1GI4A 3A81A 4BTIB 1C2GA 1QNJA 1J9CH 1QBNA 2QA9E 3GY6A 4ZHAA 2OD3B 2FIRH 3SJ8A 1AB9C 3DUXH 3O8CA 2R0LA 2ZKSA 1UCYK 1EX3A 1C2FA 1GL0E 1P0SH 2FOCA 5EW1H 1A4WH 3GCNA 1O36A 1GVZA 5A8XA 1UO6A 5F8XA 2XXLA 4CH2B 5A09A 1J15A 2FZZA 2V3OH 5L6NH 2B8OH 4WF8A 4I8KA 2ZGJA 4FU7A 1G3DA 2HNTE 1AKSB 3RXCA 4M7GA 1BA8B 5HGGA 4U2WA 1O2GH 2HALA 2BD5A 4CH8B 1WSSH 3A7WA 1O3CA 3SUGA 5JYIA 1AMHA 1MBMA 4RKJB 5E8EH 1XUGA 1P2OA 2ANYA 3URCA 2QXGA 1SGCA 3SNEA 1TRMA 3MU0A 1GBFA 3OX7U 4NA7A 2A45B 3U69H 3VB3A 3C1KA 6LPRA 5FCKA 1O2ZA 2RDLA 5GCHF 4GUXA 5DP7A 3RXEA 1D3DB 5HM9A 1V2KT 3RU4T 2ZCKP 3Q3KA 1QJ7B 5C1UA 4BAMB 1VZQH 2GD4B 1YPLH 1KTSB 3TLOA 4UFGH 1HV7A 4I33A 4AZ2B 1ZJDA 2C93B 2Y80A 4CR9A 5C5NA 4GCHF 3SZNA 3TK6A 2W3KA 1BQYA 2ZP0H 3U8TH 2GTBA 1DDJA 1WCZA 3GY5A 3U1IB 5JBCS 3HK6B 3NKKA 1P09A 2BDHA 2WUCA 4F49A 3W95A 1GI2A 5E0JA 4B2AA 1GI7B 4H4FA 2OC1A 2UUFB 5IDKA 5FBEA 2P16A 2GX4A 1TE0A 3QX5H 1ELDE 1UTNA 1HJAC 1QURH 3A85A 2BQWB 1C5QA 1GI1A 1G3CA 1K1LA 1C1OA 2A31A 3RU4D 2F9NA 3SQHE 2WUBA 4YO9A 4X1SU 2BY5X 2GP9B 1XKBC 1UK4A 1GMCG 1GI0A 1MZDA 1TMBH 1OOKB 2SNVA 1P04A 1WAYB 2FI4E 4HI3A 4NZQA 1C5UA 2A7HA 1S6FA 5EXLA 1XXFA 1L1NA 4K1TA 4BTUB 4U32A 2EA3A 1J17T 2TGPZ 5SGAE 1BTZA 2ZDVH 3BTME 2GMTC 5DKMA 3BEUA 3VXEH 5G4BA 2WPLS 2GKVE 5EPNA 2F91A 5K7RA 5FXLA 2XWAA 2PWXA 1GGDB 1MU6B 2XNIA 1O3IA 2JETB 3T25A 4ISHH 1O5GH 1GCTC 5A0BA 2F9UA 1H9IE 2XBYA 1TONA 1A7SA 1EAUA 2BYAX 3SUEA 1GI9B 5C20A 1O5FH 4B74A 4FUFA 1QY6A 1UTPA 3SU5A 3B8JA 2NU2E 2HOBA 1EZXC 3LGYA 2ZZUH 2B9LA 5J4SA 3KN2A 1EB2A 1SQOA 1C1SA 1O2YA 2XC4A 4HGCA 1V2VT 4DT7B 1ZHMA 1LHEH 2SGDE 2ZFFH 4ZXXH 3LU9B 1N8OB 3BEIB 2BD4A 4BANB 4Y6DA 1C5NH 5AF9H 3AVZA 5A8ZA 5F6MA 2A0QB 2B0FA 4BOHA 2HRVA 2A4RA 3A7XA 1AGJA 1SBWA 2DE9A 3SV6A 3O8RA 2C8XB 6CHAC 1O3HA 1SSXA 2VIPA 2WPMS 2ZFQH 4ZKOU 2RG3A 5BPEA 2Y82A 3B9FH 2W7SA 3SI4H 2R9PA 3A8DA 4ASHA 5EPYA 1EOJA 1FI8A 4LOYH 1EXFA 2A5IA 2ODQA 1SGFG 1ETRH 1SGRE 2R3UA 4VGCB 3KQCA 2F9VA 2VIWA 2SGEE 3RXOA 4OS5A 1LHFH 3STJA 1C1TA 5ESBA 1DSUA 1HAVA 1YCPH 1C1MA 2Y7ZA 5HMAA 1O3GA 3GICB 3UQVA 3PMBB 2G4TA 4MDSA 4ABAA 5C1YA 1O5CB 3VB4A 4AOQA 4D76A 1O5EH 3PLPA 4DURA 3A86A 2BQ7B 1TGCA 2BY9X 4CRFA 1O2PA 1TX6A 5DK1A 2Y7XA 1J14A 1FN6A 1GDNA 3MMGA 5FCRA 4H6TA 3GCHB 1DUEA 5DJ7A 3ELAH 1D3QB 2F9BH 1GMCF 3UOPA 1PPCE 2OP9A 1SGPE 2P59A 1K1IA 2V3HH 2Z3CA 3K65B 4X2VA 2HVXA 3S9BA 1GBKA 2K1QA 3FAOA 2ANWA 5E2PA 2P94A 4THNH 3QLPH 3BN9A 1WU1A 4Q2KA 4Y8YA 1C2KA 1F5LA 1TQ7B 4GLYA 3SV8A 1EUFA 1C2DA 1C9PA 4A5TS 4DIIH 4IBLH 2VWLA 3E0NB 1ZMJA 3Q00A 1C2JA 1HB0B 4K2YA 1NT1A 3VGCB 3TJNA 3M5OA 1CA8B 2HGTH 1O33A 1NRNH 1C4V2 1B7XB 1G2LA 3QZRA 8KME2 2C8WB 2ZDKA 1YPMH 1K9OE 2OC8A 2GZ8A 2H6MA 3V0XA 1RFNA 3RMMH 1C5VA 3EGKH 1A5GH 1CHOG 3S9CA 1PFXC 3A82A 2G81E 5T3HA 3Q76A 4BAHB 1VGCC 1OX1A 4NCYA 1MKXH 1O3BA 2H9EH 1RIWC 2FOFA 1MTUA 1VITG 2J9NA 1UTLM 4YLUA 1BHXB 1A5IA 2RA0A 3GISB 3EDXB 1V2NT 4AYYB 2BVSH 1ZGVA 3BV9B 3S9AA 2ZGHA 1IHSH 1RS0A 1OP8A 3PMJA 5F8ZA 1O2MA 1NFWA 1TGNA 2ZU4A 1QB9A 4ISNA 2G8TA 4X6NA 5EG4A 3SU3A 3F1SB 5FPSA 5TCAA 1VCQA 4XFQA 3RLYH 3KCGH 4JZ1A 4X1NU 4IS5A 1PQ8A 2VWNA 2FS8A 1EJAA 1ELFA 4Y11E 2ZIQH 3F9EA 1K1MA 2BHGA 1YBWA 4K1SA 4YTAA 1YLCA 2IJOB 1SGFA 1A1RA 1TAWA 1AWFH 3RXPA 2PKAA 1G2MA 1O38A 3ATMA 3P8NA 3A7ZA 3RMOH 2ZTZA 1EP6A 1TGSZ 1YPEH 3P8GA 1IAUA 5T6FA 3PWCA 1HRTH 1O2JA 1BUIA 2XC0A 1PYTD 1TNKA 2ZTYA 3ZVDA 1CA0B 3E90B 3MTYA 4D7GA 1ZSJA 4O97A 2CJIA 2BOKA 4FU9A 1L1JA 1T4VH 2FODA 3E3TA 4DOQA 4CREA 2W26A 1HNEE 4H42U 4E06H 5AFZH 1T4UH 3HGNA 2JH0D 3LONA 4CRGA 4Z6AH 3M37A 1KXBA 4OGXA 4OS7A 5ESTE 1OXGA 1BIOA 2G51A 4B2CA 6ESTA 4X2XA 2RA3A 3OYPA 2ZDNA 1QFKH 1LVMA 1X7AC 1A2CH 1E38B 1FAKH 3NXPA 1C5XB 1MTSA 2ILNA 5EXMA 1SR5C 1PPFE 1ESBA 4UEHH 5L30H 3VB6A 1L0ZA 1MTNB 2TGDA 3SU2A 3GYMA 1DICA 1ARCA 3I78A 1YM0A 3R0FA 1EASA 2D8WA 3PWBA 1QBOA 1S83A 2ZGXH 3ZZAA 4NG9H 4BNRA 1WUNH 4K3JA 3UQOA 3S7HB 3L3TA 3QK1A 4ABFA 5EQQA 1SQTA 2VB0A 1GHVH 3M7QA 4NA9H 1OWKA 4JZEH 3UR9A 4K8YA 1MZAA 1DT2A 1P10A 1FY1A 1JMOH 1G37A 1BMAA 1YPHC 4Z0KA 3ZV9A 3Q77A 4NFEA 3NPSA 1VITF 1FONA 4YT6H 3ZYEA 2ZCLP 2A4GA 4Y7BA 1J8AA 1YCPK 3ZVEA 3MOCA 2FXRA 1EB1H 4CBNA 4X8SH 4AX9H 4ABIA 4XDEA 2G55A 2V0BA 3UTUH 1P57B 1IHTH 1DX5M 2PR3A 3IWMA 5E0HA 1C5TA 3I29A 4GSOA 3K9XB 1P2JA 3VEQB 1SG8B 5GPIB 1SOZA 3NWUA 1NPMA 3RXGA 1BB0B 1QB1A 1SGYE 2FTMA 3Q3XA 3HKIB 5LGOA 3T62A 5AHGH 2Y5GA 1P11E 1YYY1 4MNVA 1HFDA 2Y5HA 5ABWA 4CR5A 1HIAB 4WJG2 4NWKA 1TB6H 5C3NA 1O2RA 2VIQA 5GWZA 3ATIA 4XSKU 1IQEA 1YC0A 3UREA 1NC6A 4F4OC 3FP7E 1W7XH 1V6DA 4MNYA 5GXPA 1F0RA 4JYTA 1S0RA 1F0UA 4TWYA 2ZA5A 1C5WB 1EZQA 2G52A 2XC5A 3U1JB 3RXUA 4ZROA 1H4WA 1Z1JA 1Y59T 3BTGE 2ZECA 2DUCA 3EA9A 3FP8E 1E37B 3KNXA 2OUAA 1P2KA 5EOKA 2AGEX 2IOTA 3TK9A 3HGPA 2VIOA 2TGAA 2UUKB 2UUJB 3A7TA 1OKXA 1XX9A 5JPMH 3TGIE 3BG4B 2AIPA 3ZZ5A 2YNBA 1HAXB 1SHHB 4ABEA 1XUHA 5FPTA 1FJSA 1GJAB 3E8LA 2FX4A 2ZFTA 4AGJA 1O2KA 3LGWA 1WQSA 3RLWH 3URDA 1MTWA 2Z94A 2FWWA 2QXJA 1ESAA 2P93A 3ZVAA 1O35A 1O32A 5EQRA 3F9HA 5BRRE 2OCVB 1P3CA 2QC2A 4NGAH 2XWBI 1G3EA 4ZHLU 1EPTC 7ESTE 3K6ZA 1UTQA 2GZ7A 1V2RT 1Z6JH 4FVDA 1W14U 2W7UA 3ZVGA 1GCDA 4XBDA 2ZHFH 5DP5A 1WBGB 4X8UH 4Y8XA 4ZMAH 1L4DA 3JZ2B 3EE0B 1JIMA 4JCNA 1GBCA 3ATWA 1N8OC 1RD3B 1LCYA 1AD8H 4J2YB 1O3JA 4YT7H 7GCHF 2PGBB 1EP5A 3U8RH 3KEEA 3NUMA 3ZZ9A 1OWIA 2BDAA 2BLOA 3TPIZ 3LPRA 3DHKH 1A0HB 1F5RA 1RTLA 1O3OA 1P01A 2G4UA 3TH3H 1D3TB 2H5DA 1ELTA 2Q6FA 2VVUA 3P8OA 1DFPA 2O8WA 1V2UT 1GJCB 1O3FA 1HXFH 1ELAA 3F9GA 1BDAA 3RXQA 2ZG0H 4AG2A 3BTTE 3D49H 4NSYA 1T8NA 1QQUA 3MYWA 2WV5A 1NZQH 4A1TA 3A84A 1MCVA 1BTUA 1BTXA 2WINI 2VVCA 2BY7X 2FEQH 1C2LA 1AZZA 1DE7H 4TPYA 2G5VA 3LDXH 1C9TA 1XUIA 4MPWA 3DD2H 1DY8A 4GVUA 2J2UA 1CO7E 5EU8A 4WH8A 3GCHC 4GPGA 4XE4A 1AUJA 4D8NA 4D9RA 2J34A 1KXCA 2BY6X 1HAPH 2AGGX 1D9IA 4UDWH 3VPKA 2V6NA 3P92A 3FFGA 3SU1A 3RM2H 2QF0A 2JKHA 1L1GA 1C2MA 2C8YB 3RXFA 3QTVH 2AMDA 1JOUB 3TNTA 1P2NA 4A1XA 2OINA 5DPAA 1CGJE 1JRSA 1GHWH 2UWOA 1Y3WA 1TGTA 3M7UA 3K2UA 1KIGH 2FOEA 1THPB 3LGIA 1Y8TA 2W3IA 5FBIA 4KTSA 2ZTXA 4IGDA 1QL7A 2OBQA 4X8TH 3GDVA 3S0NA 2VVVA 1GHXH 5A0AE 3VGCC 3CS0A 1H8DH 2VU8E 5GJ4B 1BMNH 1P2IA 1HIAA 1BRUP 2CHAB 4AG1A 1ZGIA 3D62A 1T8MA 2BD3A 4UFDH 1MKWH 1T8LA 5CHAC 2F3CE 1S6HA 1TYNA 5DP6A 1S84A 2PLXA 2Z9IA 4MTBA 4NA8A 5FX5A 3RXHA 3OU0A 3QGNB 1GPZA 1P02A 1C5YB 2TIOA 3A7VA 2HNTC 1NTPA 4INLA 1V3XA 3SV7A 1GJDB 2O9QA 4LK4A 3TU7H 2BXTH 4OS4A 1GBIA 2FP7B 4TWWA 1O2UA 1B5GH 4FXGH 3P70B 4A92A 1IQLA 2BLQA 1MD7A 2ZHEH 3F68H 5FHTA 1D6WA 1O5AB 3BEFB 5EXNA 1EZSC 1ELCA 2BM2A 1A61H 2JH6D 1NN6A 2Z9JA 1C1PA 2H1UA 1O3PB 1PPGE 3KF2A 4U30A 2BVRH 5FX6A 1C5PA 1YP9A 4OGYA 4K69A 1RJXB 2SNWA 3V3MA 1CSOE 1O31A 2A2QH 1CBWC 1C5OH 2J95A 4IC6A 4Y71A 4UFFH 3UR6A 1O3NA 4B76A 3MWIU 1UK2A 1Y5AT 1T8OA 1ZPBA 2I6SA 3LGTA 1AWHB 1G32B 1EAIA 1S82A 3ZVBA 5EQSA 2XBXA 3BTQE 3GOVB 4WY3A 2ANKH 1EOLA 3EA7A 1GJBB 4LXBH 1CA0C 2XTTB 1O3DA 2BLWA 2Z9GA 3UWJH 2HPPH 5ETXA 4BAOB 3SUDA 2PGQB 3M3VA 2UUYA 2ZU5A 3PB1E 4I32A 4ISOA 1NS3A 1BCUH 4I31A 3P8FA 1LVYA 1O3EA 2FM2A 2TGTA 5EODA 1A0JA 2FDAA 1A5HA 5B6OA 2P3TB 1CU1A 2BTCE 3A80A 1AKSA 1H8IH 5FPYA 5J4QA 2FTLE 1MU8B 1MUEB 1F92A 1Z8JB 2R2WU 3ZZ4A 1SHYA 2EC9H 1FZZA 1ELGA 1S0QA 4BXWA 1KY9A 2SFAA 1FPHH 1K2I1 3A88A 4DJZB 1YCPM 2FESH 1NFYA 2ZPRA 1OWEA 5DO4H 2BDIA 3ZZDA 1YPKH 4X6OA 3UY9A 4X2WA 5AVDA 1V2PT 1SB1H 2VWMA 3SV9A 4FUGA 1XKAC 2VGCB 1BTPA 2CV3A 4TPIZ 5GDSH 2O8TA 3RC6A 4K60A 1HYLA 2VIDA 1Z8GA 4TY7A 1HCGA 5EGMA 2Y81A 4K1EA 1QJ1B 1LDTT 1WYKA 3SW2B 2P8OC 4K8BA 4XBCA 3ITIA 3TIUA 1ZSKA 2OC7A 3RP2A 3M5LA 1TBZH 1QCPA 3S7KB 1O34A 1GHBG 2Z7FE 2VWOA 1DLEA 2H9TH 3SGQE 2XBWA 4O3UA 1ZR0A 3ZZ6A 4ABHA 3E6PH 2O8LA 3BTKE 2R3YA 4H6SB 1KLJH 1ZJKA 2KAIB 2ZEBA 2FPZA 1WTGH 4X6MA 1GJ6A 3V12A 4YM9A 3QZQA 1O0DH 2STAE 2DE8A 1H1BA 4RKOB 2A4QA 1TQ0B 1M9UA 2ZWLH 1HAGE 1ELBA 1HJAB 2D26C 3JZ1B 3VXFH 1GVLA 3PMHB 1T7CA 3RXJA 3V7TA 4I8GA 3A83A 3ZZCA 4MVNA 3KGPA 1PQ7A 1GI6A 3QWCH 2C8ZB 1GMDG 2ZQ1A 4CHAB 1B0FA 4K5ZA 3RXAA 1OYQA 1HAYB 1O2VA 5CMXH 1AZ8A 1THSH 1GG6C 1TNJA 1Z1IA 1H9HE 2ZGCA 4Y0YE 1EAXA 1IOEA 1GDUA 1KXDA 2WPIS 5LPRA 1BMMH 2GMTB 2W5EA 2Y5FA 1AFEH 5E0GA 3HATH 4FUBA 3GCTG 4X6PA 1BBRE 5DGJA 1ETTH 1GBTA 3QN7A 4E7RG 2PFEA 2A32A 2YOLA 4X2YA 1HGTH 1O2XA 2AFQB 1GI3A 4JYVH 1K1NA 2ZHWH 1VJAU 1UTOA 3SN8A 1W2KH 3ODDA 2PKSB 1GCTB 3SU4A 2BVXH 3GY2A 1O2NA 2A7JA 3I77A 1QBVH 5LH8A 1ORFA 3A8BA 1TRYA 2Y6TA 2GT7A 1W0ZU 2VH0A 4ABJA 1DWCH 1AI8H 1MKWK 4ZXYH 3BG4C 5DG6A 5JBTA 1KXEA 2BDBA 4ISIH 1BJUA 3MH4A 4ISLA 1Q2WA 1DWBH 2XBVA 1W8BH 1QGFA 4INHA 2ZFPH 4UONA 3RXVA 1NU9A 4DW2U 3AW1A 3BTFE 1AO5A 1Q3XA 1T31A 1UHBB 1IQGA 3P6ZB 1GHZA 1WTHD 5PTPA 1O30A 2GV7A 3T26A 3UFAA 4IC5A 1BJVA 1C5LH 1ZLRA 2B7DH 3T29A 8GCHG 1PYTC 1QA0A 1Y5UT 1P9SA 3U98H 2QIQA 5C1XA 1GI8B 2ZU2A 2ZQ2A 1BRAA 1VCPA 1O2IA 1O5BB 2STBE 3CENA 2NU0E 1BZXE 3BTDE 4CRBA 5C67A 1ANEA 1FY4A 1NESE 3LOXA 1AY6H 3WY8A 3SU6A 1LQDB 3RXIA 2Z9LA 1DITH 1GMHG 4INKA 1JRTA 3EA8A 4Y8ZA 2BZ6H 3TJUA 2BD2A 2ASUB 3HK3B 2FLBH 4JZFH 3SJOA 2RCEA 3PMAB 1LQEA 1NFUA 1MBQA 1MD8A 1K1JA 1GL1A 1FMGA 2BLVA 3SI3H 2ZC9H 1DWEH 1FUJA 1BT7A 1IQKA 4ABDA 3KQBA 1C4Y2 1TA6A 3H7OA 2A1DB 2BD9A 1CHOF 1YF4A 1TBQH 1ZZZA 2I6QA 2AMPA 1U6QA 1PPZA 1SQAA 4XOJA 3SNCA 1QL9A 3NZIA 4Y10E 3W94A 5TJXA 2HLCA 1C1VH 1SC8U 4NWLA 1UCYE 1IQHA 3T27A 2ZFRH 1MTVA 1GMDF 3LC5A 3SHAH 4ZKNU 3RUOA 1D3PB 1C1UH 3MU8A 1N6YA 8LPRA 3AAUA 1ANBA 3SQEE 1ZOMA 2NU1E 2GDDA 2AYWA 2TRMA 2THFB 4MNXA 4WMDA 4YOGA 1WOFA 3GCTF 3EYDA 3QUMP 4ESTE 1ZSLA 3ZV8A 1F0SA 2ZGBH 2OC0A 2IN2A 5I25A 3GDSA 1YLDA 1MCTA 1OPHB 1C2EA 2KAIA 2M5TA 3RM0H 1V2LT 1EJNA 4XBBA 3RXTA 4A1VA 1GBHA 1BBRK 4Y79A 1W11U 4I8HA 3M3SA 4AB8A 3TH4H 3LIWA 4YLQH 3PO1B 2B5TB 1TMTH 3MO6A 4B75A 2HNTF 1AE5A 4OS2A 4JMYA 1Y3VA 1FLEE 4Y0ZE 1SFQB 2P95A 2D1JA 1VGCB 2EI7A 3LC3A 1AVWA 4AB9A 1AIXH 3AASA 5HM2A 1UVSH 1RIWB 1C5SA 1AE8H 3HKJB 4OS1A 1F2SE 1XM1A 1BHXF 2NU4E 2CHAC 1ETSH 2NU3E 2FI3E 1TX7A 1TX8A 3OTJE 4SGBE 2H9HA 5GCHG 4AGKA 3BTHE 1SLVB 4IMQA 2VNTA 4SGAE 3CP7A 3EAJA 1Z7KA 3BG8A 1FY3A 2TBSA 3FZZA 1O5DH 2BD8A 2WYJA 3U9AH 2ALPA 3SGBE
chains in the Genus database with same CATH superfamily
1HDTH 1BITA 1W13U 1GGDC 2OQUA 2XCNA 2FLRH 2JETC 1D6RA 3BTEE 3MO3A 5DP3A 4BXSA 3QTOH 3K6YA 4FUEA 1K0HA 1HJ8A 5T6GA 1PPHE 1C1WH 1MQ5A 1PQ5A 1YKTA 1W7GH 4AFZA 5JB8S 1SPJA 3DA9B 3MNBA 2ZO3H 3MNSA 4AORA 3M61U 4ZKRU 3RXSA 5DP9A 3C27B 9ESTA 3M36A 1H9LB 1LVOA 1UHBA 1YPJH 4CRDA 1FY8E 4DGJA 2ALVA 2ZPSA 1NRQH 3SHCH 2HVYB 4AC9A 3M7TA 3ATLA 1EKBB 1OYTH 1DLKB 3TH2H 2BY8X 1UMAH 2GT8A 3GY7A 2GV6A 1O2QA 1TMUH 2KCYA 1NU7B 3L33A 3DSOA 5LPFA 2KR7A 1QIXB 3SJKA 3GCOA 3L6PA 4R8TB 4FOUC 2GDEH 2BQ6B 4J1YA 1TIOA 2OTVA 5FL7D 3LH3A 3MH6A 1OWDA 5CDFE 2LP6A 3SORA 9LPRA 2ODPA 1ZMNA 1P12E 5IYTA 4DVAU 3F6UH 2VH6A 1V2WT 1ZTLA 2AERH 2BDYA 3M3TA 7LPRA 4DCDA 1E0FD 2FI5E 3BIVH 3HPTB 3IG6B 4A7IB 1WV7H 1TNIA 2GCHG 3PM3A 5F03A 1DWDH 1MQ6A 3SV2H 2VIVA 2EI6A 3TJOA 1FY5A 1OSSA 1CVWH 4VGCC 2J98B 2F9PA 3BSQA 3RU4E 1RXPA 1QRZA 2QCYA 4I8JA 5E2OA 1P9UA 4JZIA 5C5OA 3KQDA 1XMNB 1V2JT 4Q80A 1HAVB 1ELEE 4KTCA 2CGAA 1O2WA 3ZVFA 4E05H 4DIHH 1ZHPA 1QJ6B 1ABJH 3LJOA 3DSGA 1GVKB 3BTWE 1GJ9B 1UTKA 5EW2H 5K0HA 2QGRA 2LPRA 2QF3A 4ABGA 3SGAE 2IPQX 2V35A 1CT0E 2FOMB 1GBLA 2OBOA 1O2OA 1UTMA 5T6DA 1P2MA 3GY4A 2ZHQH 2VGCC 1HXEH 3TGKE 1LPZB 3DCLA 1FV9A 4MQAA 4BTTB 2BD7A 1NRPH 1BRBE 2WYGA 2TPIZ 1TFXA 3OY6U 1TPOA 4ZHMU 4DY7B 3KQEA 1C2IA 1GI5A 1THRH 1VJ9U 1WQVH 2BOHB 2QY0B 1RGQA 2Z3EA 3OSYA 1SFIA 4FUIA 1NROH 1Z8IB 2HWLB 3UNRA 2HLDD 1N1LA 2GCTB 4LZ4B 1A3EH 2FOAA 1P8VC 3UNSA 1LHCH 1S81A 5JDUB 2J92A 4NIXA 1K22H 6GCHG 3KHVA 3M5NA 1CQQA 1XUJA 4ZH8A 3ZZBA 4KP0A 4KELA 1ZMLA 1AVXA 2HPQH 3G01A 4MG3A 1LO6A 2PUXB 2VJ1A 3IITA 5HYOA 4RSPA 4DG4A 1GBMA 4JYUH 1C1NA 1AQ7A 2PW8H 4CRAA 4WWYA 4UE7H 1JIRA 1QA7A 1BTWA 1YGCH 5A2MH 1PJPA 4R0IA 3O8DA 5A0CA 1LKBA 1SVPA 1P2QA 4UFEH 4MPUA 1AUTC 4WXVA 4TYDA 2YMSB 4B1TA 2Z6BD 2ULLA 2WPJS 1EATA 1HUTH 3GDUA 4CRCA 2CN0H 2CF9H 4CHAC 4JK6A 1O2HA 3A7YA 1AU8A 5AFYH 2IPHA 5GIBA 5HXFA 1GBEA 3LT3A 4O3TA 1TABE 2BXUH 1W3CA 1O2LA 1ID5H 4ZCNA 1E35B 1K28D 3UUZA 2VINA 1V2OT 1FDPA 2BB4A 3PTBA 3TVJB 4LZ1H 3M35A 2ZCHP 3SJ9A 2F9OA 3SYJA 1NM6A 1S85A 2J38A 1Z8RA 1QRXA 2C3SA 2PV9B 4IN1A 2PUQH 2PKSC 4D9QA 3RXKA 2GCHF 1TPSA 4YESB 4YOIA 2PSXA 1BMLA 2OQ5A 1A0LA 4M9FA 3PRDA 4XD7D 2VBCA 1AFQB 3MO9A 2PKAB 3ZVCA 3DSPA 5EJLA 4Q7ZA 3MHWU 4TY6A 1EPTB 3MI4A 1O37A 4WVPE 4ZAEA 1SLUB 1KXFA 1UVUH 1GJ4H 4PROA 1KDQB 2GJGA 1V2TT 4RN6A 5L2ZH 1AB9B 5C2ZA 1UVOA 3VB5A 3AAVA 4QT8C 3SUFA 1RTFB 2H5CA 1Y5BT 4JZDH 1IQJA 1UK3A 4HFPB 1DS2E 2J94A 3MQKC 1FPCH 1GDQA 3DFJA 3FANA 5EJ1A 1GBAA 2Q1JA 1KXAA 1ZRKA 1LHDH 2SGPE 1Y3XA 1EQ9A 1K1PA 2A5AA 3UNQA 1HLTH 4Y7AA 2BX3A 1FIWA 4GHQA 3RXLA 1TA2A 4AFQA 3MU1A 3TGJE 2CF8H 2V3MA 4GHTA 2BX4A 1SGDE 3DFLA 1Y3UA 1TPPA 2SGFE 3RXRA 1F7ZA 1MMJN 1ZYOA 3GY3A 3KL6A 1L4ZA 1QRWA 4B71A 2C90B 3OY5U 1LHGH 1LKAA 2F83A 1Z6EA 1MTNC 3BIUH 1TLDA 2WPKS 3E0PB 1GBDA 3GYLB 2XYAA 4WXIA 1BBRH 6GCHF 2UWPA 1LPGB 1NO9H 4YOJA 4NFFA 1DXPA 2CMYA 1Q31A 1TPAE 4AN7A 1PPBH 1BRCE 1LTOA 4KGAA 3TJVA 1ZRBA 2GZ9A 4X1QU 2AH4X 1DUAA 1P03A 1IQMA 4NSVA 2ANMH 3M5MA 1SL3A 3ESTA 3MU5A 1KLTA 1QR3E 1DM4B 4ZUHA 2OXSA 2WV4A 3D65E 4WMEA 2Q6GA 1INCA 1T32A 3RMLH 3A87A 1TOCB 2FS9A 2KCOA 2ESTE 1FQ3A 1G9IE 2OK5A 5HIYA 3EQ0H 1MAYA 3LJJA 4Q7YA 3RXDA 3TITA 1O2SA 1UVPA 5JBBS 1A46H 3PRBA 1XXDA 4NIVA 1V2MT 3AW0A 2PSYA 2KM0A 2ZPQA 2BMGB 1B0EA 1CGIE 4WMFA 1K21H 1L2EA 4AFSA 1Y3YA 1W12U 1NBMD 3O8BA 4YXWD 3T5FH 4ACAA 4U01A 1JBUH 3UIRA 1P06A 4NIWA 2XW9A 5CHAB 3PO1C 3SNBA 4NIYA 5T1VA 1TBRH 5FAHA 1A3BH 2G5NA 1G36A 1CE5A 1BTHH 1O2TA 2SGAA 3MNCA 1GJ8B 2BDGA 1XUFA 3MH5A 4JK5A 1H8ED 4I8LA 4CBOA 3A8AA 2AEIH 1CGHA 1E36B 3RC4A 1UVTH 3Q3YA 1K1OA 1P05A 1C4U2 4B73A 1KYNA 1O3KA 3TK5A 5JB9S 3RXMA 2EI8A 3SU0A 5DP8A 1SLXB 1QTFA 1F0TA 3D23A 1G3BA 1BTYA 2AGIX 1HBTH 1ARBA 4KTUA 4B2BA 1SMFE 1C2HA 2ZDLA 4NZLA 3SO3A 2O8MA 4B6EA 1UCYH 3F2FA 2AMQA 1YPHE 1EZUC 1CBWB 3PTNA 3ENSB 3PYHA 3KIDU 1HAZB 1LMWB 3R3GB 3QDZB 1BOQA 4IN2A 3ZZ7A 1QB6A 1KLIH 1SGIB 2J4IA 1QZ8A 3V13A 4OS6A 4ZKSU 3LGUA 1AVGH 2ZNKH 1EPTA 2FYQA 2PHBA 3ODFA 1EAWA 1JWTA 1VCWA 3QO6A 1OWHA 2G00A 1KDQA 3SNDA 2F4LA 6CHAB 3MU4A 2QV1A 1MAXA 4IMZA 2D2DA 4X1RU 2W6JD 5LPEA 2P3FH 2WHXA 4AFUA 2ZF0H 3ZYDA 4BAQB 3UPEA 7KMEH 4X8VH 2R0KA 1CT2E 1HAIH 1IQNA 4FU8A 1TNGA 4FUDA 3A89A 2AS9A 3ZZ3A 2FOGA 1GBBA 1C1RA 1GWAA 1UJ1A 1J16A 3MFJA 2C4FH 3PV5A 3ZZ8A 1SI5H 1DY9A 3FZDA 4MNWA 3UOUA 1GHBF 1TNLA 2QYIA 1SOTA 4WH6A 2L74A 5DP4A 1D4PB 2H2ZA 4FUJA 5TCCA 1TRNA 2ZDAH 4HZHA 4ABBA 2CK3D 3GY8A 3FP6E 1GHAG 1LVBA 1KSNA 3SNAA 1OWJA 2A2XH 2FOBA 2FO9A 1TOMH 1RTKA 1DANH 1FN8A 2Z9KA 3ATKA 2ZI2H 5A8YA 1ACBE 3E16B 4MPVA 2JIZD 3LKWA 2YNAA 1UTJA 1TNHA 3CNRA 5C0UA 1E34B 2R2MB 2ZU3A 1ZTKA 5HKKD 3P17H 2AIQA 3RC5A 1LPKB 4FUHA 1AN1E 1O3LA 4I7YH 5I46H 2NWNA 2XCFA 3NRLA 4MPXA 4HTCH 4BAKB 2GGVB 2ZHDA 1TWXB 2M2AA 3N7OA 1QL8A 2O8UA 2QN5T 4X1PU 1DOJA 2PTNA 3RMNH 1G30B 1FIZA 5L2YH 3DT0H 2FOHA 3T2NA 1S5SA 2A7CA 1XVMA 2P8OB 3MH7A 4Y76A 1NY22 2BZAA 2CXVA 2Z3DA 4E7NA 3MNXA 1ELVA 1KTTB 7GCHG 2QAAA 2FMJA 1GJ5H 1V2ST 1C5MD 1CT4E 1W0YH 1IQFA 3VFEA 4D7FA 2QF4A 1HPGA 3PV4A 1ZPCA 1SGNE 2ZDMA 2QXHA 2XRCA 1N6XA 1GJ7B 5GNDA 4O03A 1ANCA 1RRKA 4FVBA 4UD9H 2QXIA 3NK8A 1FAXA 1ZTJA 1VITH 3H5CB 3FVFB 1C5RA 1TGBA 1F5KU 2Q6DA 1OP0A 1O3MA 1NRRH 2FX6A 1YPGH 2FYRA 1DXWA 1ABIH 3NCLA 2ZU1A 3RDZA 3SOSA 2GVFA 3E1XB 2GCTC 1DVAH 1NRSH 4O9VA 1VR1H 4Q7XA 4MLFB 1Z71A 1XVOA 1TALA 3UWIA 1GG6B 2YMSD 2UWLA 1HAHH 1JXPA 3PV2A 4YZUA 3PLKA 8GCHF 4GAWA 3T28A 3SJIA 1C5ZB 3TNSA 4KKDA 3A8CA 1DSTA 5H4IB 1W0KD 2YMSC 1FXYA 4GCHG 3STIA 1GHYH 3LH1A 1NFXA 1GBJA 1CHGA 1FNIA 1SGQE 2P3UB 3S69A 2SGQE 2LNCA 2JH5D 2WPHS 1OS8A 4AYVB 1HJ9A 1GMHF 1DPOA 1MH0A 4IW4E 3QGJA 1PQAA 1SKYE 1AHTH 2BDCA 3H7TA 1O3AA 1HAOH 3F9FA 1O39A 3PROA 8ESTE 3VB7A 2EEKA 3CS7A 3RXBA 5IK2D 1E1RD 1EJMA 3P95A 3PLBA 1QQ4A 3SBKA 1GHAF 1OP2A 2A5KA 1MKXK 3LGVA 4A6LA 1C1QA 5F8TA 5JBAS 2ODYB 1PPEE 1SGTA 1ZPZA 2ZFSA 2OLGA 1ANDA 3U28C 4FUCA 5DN6D 1SGEE 1ESTA 1IQIA 4X0WU 1P3EA 2A4OA 1V2QT 5CE1A 1AFQC 1SLWB 1W10U 1XUKA 1ZHRA 2PTCE 3E91A 3B23B 1QHRB 3BF6H 3U8OH 1GI4A 3A81A 4BTIB 1C2GA 1QNJA 1J9CH 1QBNA 2QA9E 3GY6A 4ZHAA 2OD3B 2FIRH 3SJ8A 1AB9C 3DUXH 3O8CA 2R0LA 2ZKSA 1UCYK 1EX3A 1C2FA 1GL0E 1P0SH 2FOCA 5EW1H 1A4WH 3GCNA 1O36A 1GVZA 5A8XA 1UO6A 5F8XA 2XXLA 4CH2B 5A09A 1J15A 5C0TA 2FZZA 2V3OH 5L6NH 3UAIC 2B8OH 4WF8A 4I8KA 2ZGJA 4FU7A 1G3DA 2HNTE 1AKSB 3RXCA 4M7GA 1BA8B 5HGGA 4U2WA 1O2GH 2HALA 2BD5A 2K8IA 4CH8B 1WSSH 3A7WA 1O3CA 3SUGA 5JYIA 1AMHA 1MBMA 4RKJB 5E8EH 1XUGA 1P2OA 2ANYA 3URCA 2QXGA 1SGCA 3SNEA 1TRMA 3MU0A 1GBFA 3OX7U 5KEDA 4NA7A 3KYFA 3F2HA 2A45B 3GS9A 3U69H 3VB3A 3C1KA 6LPRA 5FCKA 5B6LA 1O2ZA 2RDLA 3FN8A 5GCHF 4GUXA 5DP7A 3RXEA 1D3DB 5HM9A 1V2KT 3RU4T 2ZCKP 3Q3KA 1QJ7B 5C1UA 4BAMB 1VZQH 2GD4B 1YPLH 1KTSB 3TLOA 4UFGH 1HV7A 4I33A 4AZ2B 1ZJDA 2C93B 2Y80A 4CR9A 5C5NA 4GCHF 3SZNA 3TK6A 3F0PA 2W3KA 1BQYA 2ZP0H 3U8TH 2GTBA 1DDJA 1WCZA 3GY5A 3U1IB 5JBCS 3HK6B 3NKKA 1P09A 2BDHA 2WUCA 3OTPA 4F49A 3W95A 1GI2A 5E0JA 4B2AA 1GI7B 4H4FA 2OC1A 2UUFB 5IDKA 3AK5A 5FBEA 2P16A 2GX4A 1TE0A 3QX5H 1E79D 1ELDE 1UTNA 1HJAC 1QURH 3A85A 2BQWB 1C5QA 1GI1A 1G3CA 1K1LA 1C1OA 2A31A 3RU4D 2F9NA 3SQHE 2WUBA 4YO9A 4X1SU 2BY5X 2GP9B 1XKBC 1UK4A 1GMCG 1GI0A 1MZDA 1TMBH 1OOKB 2SNVA 1P04A 1WAYB 2FI4E 4HI3A 4NZQA 1C5UA 2A7HA 1S6FA 5EXLA 1XXFA 1L1NA 4K1TA 4BTUB 4U32A 2EA3A 1J17T 2TGPZ 5SGAE 1BTZA 2ZDVH 3BTME 2GMTC 5DKMA 3BEUA 3VXEH 5G4BA 2WPLS 2GKVE 5EPNA 2F91A 5K7RA 5FXLA 2XWAA 2PWXA 1GGDB 1MU6B 2XNIA 1O3IA 2JETB 3T25A 4ISHH 1O5GH 1GCTC 5A0BA 2F9UA 1H9IE 2XBYA 1TONA 1A7SA 3EE7A 1EAUA 2BYAX 3SUEA 1GI9B 5C20A 1O5FH 5C17A 4B74A 4FUFA 1QY6A 1UTPA 3SU5A 3B8JA 2NU2E 4P00A 2HOBA 1EZXC 3WWFA 3LGYA 2ZZUH 2B9LA 2AHME 5J4SA 3KN2A 1EB2A 1SQOA 1C1SA 1O2YA 2XC4A 4HGCA 1V2VT 4DT7B 1ZHMA 1LHEH 2SGDE 2ZFFH 2EQNA 4ZXXH 3LU9B 1N8OB 3BEIB 2BD4A 3FKSD 4BANB 4Y6DA 1C5NH 5AF9H 3AVZA 5A8ZA 5F6MA 2A0QB 2B0FA 4BOHA 2HRVA 2A4RA 3A7XA 4I86A 1AGJA 3F0OA 1SBWA 2DE9A 3SV6A 3O8RA 2C8XB 6CHAC 1O3HA 1SSXA 2VIPA 2WPMS 2ZFQH 4ZKOU 2RG3A 5BPEA 2Y82A 3OFND 3B9FH 2W7SA 3SI4H 2R9PA 3A8DA 4ASHA 5EPYA 1FI8A 1EOJA 4LOYH 4B6FA 1EXFA 2A5IA 2ODQA 2WPDD 3WWBA 1SGFG 1ETRH 1SGRE 2J98A 2R3UA 4VGCB 3KQCA 2F9VA 2VIWA 2SGEE 4FETA 3RXOA 4OS5A 1LHFH 3STJA 1C1TA 5ESBA 1DSUA 1HAVA 1YCPH 1C1MA 2Y7ZA 5HMAA 1O3GA 3GICB 3UQVA 3PMBB 2G4TA 4MDSA 4ABAA 5C1YA 1O5CB 3VB4A 4AOQA 4D76A 1O5EH 3PLPA 4DURA 3A86A 2BQ7B 1TGCA 2BY9X 4CRFA 1O2PA 1TX6A 5DK1A 2Y7XA 1J14A 1FN6A 1GDNA 2J5UA 3MMGA 5FCRA 4H6TA 4F48B 3GCHB 1DUEA 5DJ7A 3ELAH 1D3QB 2F9BH 1GMCF 3UOPA 1PPCE 2OP9A 1SGPE 2P59A 1K1IA 2V3HH 2Z3CA 3K65B 4X2VA 2HVXA 3S9BA 1GBKA 2F43B 2K1QA 3FAOA 2ANWA 5E2PA 2P94A 4THNH 3QLPH 1YWUA 1YY3A 3BN9A 1WU1A 4Q2KA 4Y8YA 1C2KA 1F5LA 1TQ7B 4GLYA 3SV8A 1EUFA 1C2DA 1C9PA 4A5TS 4DIIH 4IBLH 2VWLA 3E0NB 1ZMJA 3Q00A 1C2JA 1HB0B 4K2YA 1NT1A 3VGCB 4RI0A 3TJNA 3SZEA 3M5OA 1CA8B 2HGTH 1O33A 1NRNH 2KFWA 1C4V2 1B7XB 1G2LA 3QZRA 1FX0B 3OE7D 2WV9A 8KME2 2C8WB 1VKYA 1YPMH 1K9OE 2OC8A 2ZDKA 2GZ8A 2H6MA 3V0XA 1RFNA 3RMMH 1C5VA 3EGKH 1A5GH 1CHOG 1H8HD 3S9CA 1PFXC 3A82A 2G81E 5T3HA 2EY4C 3Q76A 4BAHB 1VGCC 1OX1A 4NCYA 1MKXH 1O3BA 2H9EH 1RIWC 2XNDD 2FOFA 1MTUA 1VITG 2J9NA 1UTLM 4YLUA 1BHXB 1A5IA 2RA0A 3GISB 3EDXB 1V2NT 4AYYB 2BVSH 1ZGVA 3BV9B 4HG6A 3S9AA 2ZGHA 1IHSH 1RS0A 1OP8A 3PMJA 5F8ZA 1O2MA 1NFWA 1TGNA 2ZU4A 1QB9A 4ISNA 2G8TA 4X6NA 5EG4A 3SU3A 3F1SB 5FPSA 5TCAA 1VCQA 4XFQA 3RLYH 3KCGH 4JZ1A 4X1NU 4IS5A 1PQ8A 2VWNA 2FS8A 1EJAA 1ELFA 4Y11E 2ZIQH 3F9EA 1K1MA 2BHGA 1YBWA 4K1SA 4YTAA 1E1QD 1YLCA 2IJOB 1SGFA 1A1RA 1TAWA 1AWFH 3RXPA 2PKAA 1G2MA 1O38A 3ATMA 3P8NA 3A7ZA 3RMOH 2ZTZA 1EP6A 1TGSZ 1YPEH 3P8GA 1IAUA 5T6FA 3PWCA 1HRTH 1O2JA 1BUIA 2XC0A 1PYTD 1TNKA 2ZTYA 3ZVDA 1CA0B 3E90B 3MTYA 4D7GA 1ZSJA 4O97A 2CJIA 2BOKA 4FU9A 3ZIAD 1L1JA 1T4VH 2FODA 3E3TA 4DOQA 4CREA 2W26A 1HNEE 4H42U 4TSFD 4E06H 5AFZH 1WDIA 1T4UH 3HGNA 2JH0D 3LONA 4CRGA 4Z6AH 2KZ4A 1KXBA 3M37A 4OGXA 4OS7A 5ESTE 1OXGA 1BIOA 2G51A 4B2CA 6ESTA 4X2XA 2RA3A 3OYPA 2ZDNA 1QFKH 1LVMA 1X7AC 2LELA 1A2CH 1E38B 1FAKH 3NXPA 1C5XB 1MTSA 2ILNA 5EXMA 1SR5C 1PPFE 1ESBA 4UEHH 3OEED 5L30H 3VB6A 1L0ZA 1MTNB 2TGDA 3SU2A 3GYMA 5HIZA 1DICA 1ARCA 3I78A 1YM0A 3R0FA 1EASA 2D8WA 3PWBA 1QBOA 1S83A 2ZGXH 3ZZAA 4NG9H 4BNRA 1WUNH 4K3JA 2JJ1D 4Z1MD 3UQOA 2WZQA 3S7HB 3L3TA 3QK1A 4ABFA 5EQQA 2JDID 1SQTA 2VB0A 1GHVH 3M7QA 4NA9H 1OWKA 4JZEH 3UR9A 4K8YA 1MZAA 1DT2A 2RFKC 1P10A 1FY1A 5EIYA 1KMHB 1JMOH 1G37A 1BMAA 1YPHC 4Z0KA 3ZV9A 3Q77A 4NFEA 3NPSA 1VITF 1FONA 4TT3D 4YT6H 3ZYEA 4P02A 4XRNA 2ZCLP 2A4GA 4Y7BA 1J8AA 1YCPK 3ZVEA 3MOCA 2FXRA 1EB1H 4CBNA 4X8SH 4AX9H 4ABIA 4XDEA 2G55A 2V0BA 3UTUH 1P57B 1IHTH 1DX5M 2PR3A 3IWMA 5E0HA 1C5TA 3I29A 4GSOA 3K9XB 1P2JA 3VEQB 1SG8B 5GPIB 1SOZA 3NWUA 1NPMA 3RXGA 3UB0A 1BB0B 1QB1A 1SGYE 2FTMA 3Q3XA 3HKIB 5LGOA 3T62A 5AHGH 2Y5GA 1P11E 1YYY1 4MNVA 1HFDA 2Y5HA 5ABWA 4CR5A 1HIAB 4WJG2 4NWKA 1TB6H 5C3NA 1O2RA 2VIQA 5GWZA 2K0QA 3ATIA 4XSKU 1IQEA 1YC0A 3UREA 1NC6A 4F4OC 3FP7E 1W7XH 2KCAA 1V6DA 4MNYA 5GXPA 1F0RA 4JYTA 1S0RA 1F0UA 4TWYA 2ZA5A 1C5WB 1EZQA 2G52A 2XC5A 5CHBA 3RXUA 4ZROA 1H4WA 1Z1JA 1Y59T 3U1JB 3BTGE 2ZECA 2DUCA 3EA9A 3FP8E 1E37B 3KNXA 2OUAA 1P2KA 5EOKA 2AGEX 2IOTA 3TK9A 3HGPA 2VIOA 2TGAA 2UUKB 2UUJB 3A7TA 1OKXA 1XX9A 5JPMH 3TGIE 3BG4B 2XOKD 2AIPA 3ZZ5A 2YNBA 1HAXB 1SHHB 4ABEA 1XUHA 5FPTA 1FJSA 1GJAB 3E8LA 2FX4A 2ZFTA 4AGJA 1O2KA 3OEHD 3LGWA 1WQSA 3RLWH 3URDA 1MTWA 2Z94A 2FWWA 5KGOA 5KECA 2QXJA 1ESAA 2P93A 3ZVAA 1O35A 1O32A 5EQRA 3F9HA 5BRRE 2OCVB 1P3CA 2QC2A 4NGAH 2XWBI 1G3EA 4ZHLU 1EPTC 7ESTE 3K6ZA 1UTQA 2GZ7A 1V2RT 1Z6JH 4FVDA 1W14U 2W7UA 3ZVGA 1GCDA 4XBDA 2ZHFH 5DP5A 1WBGB 4X8UH 4Y8XA 4ZMAH 1L4DA 3JZ2B 3EE0B 1JIMA 4JCNA 1GBCA 3ATWA 1N8OC 1RD3B 1LCYA 1AD8H 4J2YB 1O3JA 4YT7H 7GCHF 2PGBB 1EP5A 3U8RH 3KEEA 3NUMA 3ZZ9A 1OWIA 2BDAA 2BLOA 3TPIZ 3LPRA 3DHKH 1A0HB 1F5RA 1RTLA 1MABB 1O3OA 1P01A 2G4UA 3TH3H 1D3TB 2H5DA 1ELTA 2Q6FA 2VVUA 3P8OA 1DFPA 2O8WA 1V2UT 1GJCB 1SQRA 1O3FA 1HXFH 1ELAA 3F9GA 1BDAA 3RXQA 2ZG0H 4AG2A 3BTTE 3D49H 4NSYA 1T8NA 1QQUA 2QF5A 3MYWA 2IJD1 1NZQH 2WV5A 4A1TA 3A84A 1MCVA 1BTUA 1BTXA 2WINI 2VVCA 2BY7X 2FEQH 1C2LA 1AZZA 1DE7H 4TPYA 2G5VA 3LDXH 1C9TA 1XUIA 4MPWA 3DD2H 1DY8A 4GVUA 2J2UA 1CO7E 5EU8A 4WH8A 3GCHC 4GPGA 4XE4A 1AUJA 4D8NA 4D9RA 2J34A 1KXCA 2BY6X 1HAPH 2AGGX 1D9IA 4UDWH 3VPKA 2V6NA 3P92A 3FFGA 3SU1A 3RM2H 2QF0A 2JKHA 1L1GA 1C2MA 2C8YB 3RXFA 3QTVH 2AMDA 1JOUB 3TNTA 1P2NA 4A1XA 2OINA 5DPAA 1CGJE 1JRSA 1GHWH 2UWOA 1Y3WA 1TGTA 3M7UA 3K2UA 2RDEA 1KIGH 1W0JD 2FOEA 1THPB 3LGIA 1Y8TA 2W3IA 5FBIA 4KTSA 2ZTXA 4IGDA 1QL7A 2OBQA 4X8TH 3W1EA 3GDVA 3S0NA 2VVVA 1GHXH 5A0AE 3VGCC 3CS0A 1H8DH 2VU8E 5GJ4B 1BMNH 1P2IA 1HIAA 1BRUP 2CHAB 1YLNA 4AG1A 1ZGIA 3D62A 1T8MA 2BD3A 4UFDH 1MKWH 1T8LA 5CHAC 2F3CE 1S6HA 1TYNA 5DP6A 1S84A 2PLXA 2Z9IA 4MTBA 4NA8A 5FX5A 3RXHA 3OU0A 3QGNB 1GPZA 1P02A 1C5YB 2TIOA 3A7VA 2HNTC 1NTPA 4INLA 1V3XA 3SV7A 1GJDB 2O9QA 4LK4A 3TU7H 3N7DA 2BXTH 4OS4A 1GBIA 2FP7B 4TWWA 1O2UA 1B5GH 4FXGH 3P70B 3KYGA 4A92A 1IQLA 2BLQA 1MD7A 2ZHEH 3F68H 5FHTA 1D6WA 1O5AB 3N99A 3BEFB 5EXNA 1EZSC 1ELCA 2BM2A 1A61H 2JH6D 1NN6A 2Z9JA 1C1PA 2H1UA 1O3PB 1PPGE 3KF2A 4U30A 2BVRH 5FX6A 1C5PA 1YP9A 4OGYA 4K69A 1RJXB 4ACBA 2SNWA 3V3MA 1CSOE 1O31A 2A2QH 4DT4A 1CBWC 1C5OH 2J95A 4IC6A 4Y71A 4UFFH 3UR6A 1O3NA 4B76A 3MWIU 1UK2A 1Y5AT 1T8OA 1ZPBA 2I6SA 3LGTA 1COWD 3WW7A 1AWHB 1G32B 1EAIA 1S82A 3ZVBA 5EQSA 2XBXA 3BTQE 3GOVB 4WY3A 2ANKH 1EOLA 3EA7A 1GJBB 4LXBH 1CA0C 2XTTB 1O3DA 2BLWA 2Z9GA 3UWJH 2HPPH 5ETXA 5F53A 4BAOB 3SUDA 2PGQB 3M3VA 2UUYA 3F3BA 2ZU5A 3PB1E 4I32A 4ISOA 1NS3A 1BCUH 4I31A 3P8FA 1LVYA 1O3EA 2FM2A 2TGTA 5EODA 1A0JA 2FDAA 1A5HA 5B6OA 3FOAA 2P3TB 1CU1A 2BTCE 3A80A 1AKSA 1H8IH 5FPYA 5J4QA 2FTLE 2WSSD 1MU8B 1MUEB 1NBME 3H09A 1F92A 1Z8JB 2R2WU 3ZZ4A 1SHYA 2EC9H 1FZZA 1ELGA 1S0QA 4BXWA 1KY9A 2SFAA 1FPHH 1K2I1 3A88A 4DJZB 1YCPM 2FESH 1NFYA 2ZPRA 1OWEA 5DO4H 2BDIA 3ZZDA 1YPKH 4X6OA 3UY9A 4X2WA 5AVDA 1V2PT 1SB1H 2VWMA 3SV9A 4FUGA 1XKAC 2VGCB 2QE7D 1BTPA 2CV3A 4TPIZ 5GDSH 2O8TA 3RC6A 4K60A 1HYLA 2KCPA 2VIDA 4Q4LA 1Z8GA 4TY7A 1HCGA 5EGMA 2Y81A 4K1EA 1QJ1B 1LDTT 1WYKA 3SW2B 2P8OC 4K8BA 4XBCA 3ITIA 3TIUA 1ZSKA 2OC7A 3RP2A 1S6LA 3M5LA 1TBZH 1QCPA 3S7KB 1O34A 1GHBG 2Z7FE 5DSFA 2VWOA 1DLEA 2H9TH 3SGQE 2XBWA 4O3UA 1ZR0A 3ZZ6A 4ABHA 3E6PH 2O8LA 3BTKE 2R3YA 4H6SB 1KLJH 1ZJKA 2KAIB 2ZEBA 2FPZA 1WTGH 4X6MA 1GJ6A 3V12A 4Q63A 4YM9A 3QZQA 1O0DH 2STAE 2DE8A 1H1BA 4RKOB 2A4QA 1TQ0B 1M9UA 2ZWLH 1HAGE 1ELBA 1HJAB 2D26C 3JZ1B 3VXFH 1GVLA 4ASUD 3PMHB 1T7CA 3RXJA 3V7TA 4I8GA 3A83A 3ZZCA 4MVNA 3KGPA 1PQ7A 1GI6A 3QWCH 3F2GA 2C8ZB 1GMDG 2ZQ1A 4CHAB 1B0FA 4K5ZA 3RXAA 1OYQA 1HAYB 1O2VA 5CMXH 1AZ8A 1THSH 1GG6C 1TNJA 1Z1IA 2J97A 1H9HE 2ZGCA 4Y0YE 1EAXA 1IOEA 1GDUA 1KXDA 2WPIS 5LPRA 1BMMH 2GMTB 2W5EA 2Y5FA 1AFEH 5E0GA 3HATH 4FUBA 3GCTG 4X6PA 1BBRE 5DGJA 1ETTH 1GBTA 3QN7A 4E7RG 2PFEA 2A32A 2YOLA 4X2YA 1HGTH 1O2XA 2AFQB 1GI3A 4JYVH 1K1NA 1UW7A 2L6OA 1VJAU 2ZHWH 1UTOA 3SN8A 1W2KH 3ODDA 2PKSB 2JJ2D 1GCTB 3SU4A 2BVXH 3GY2A 1O2NA 2A7JA 3I77A 1QBVH 1OHHD 5LH8A 1ORFA 3A8BA 1TRYA 2Y6TA 2GT7A 1W0ZU 1BMFD 2VH0A 4ABJA 1DWCH 1AI8H 1MKWK 4ZXYH 3BG4C 5DG6A 5JBTA 3N7EA 1KXEA 2BDBA 4ISIH 1BJUA 3MH4A 4ISLA 1Q2WA 1DWBH 2XBVA 1W8BH 3OAAD 1QGFA 4INHA 2ZFPH 4UONA 3RXVA 1NU9A 4DW2U 3AW1A 3FO8D 3BTFE 1AO5A 1Q3XA 1T31A 1UHBB 1IQGA 3P6ZB 1GHZA 1WTHD 5PTPA 1O30A 2GV7A 3T26A 3UFAA 4IC5A 1BJVA 1C5LH 1ZLRA 2B7DH 3T29A 8GCHG 1PYTC 1QA0A 1Y5UT 3VG8A 1P9SA 3U98H 2QIQA 5C1XA 1GI8B 2ZU2A 2ZQ2A 1BRAA 1VCPA 1O2IA 1O5BB 2STBE 3CENA 2NU0E 4OM9A 1BZXE 3BTDE 4CRBA 5C67A 1ANEA 1FY4A 1NESE 3LOXA 1AY6H 3WY8A 3SU6A 1LQDB 3RXIA 2Z9LA 1DITH 1GMHG 4INKA 1JRTA 3EA8A 4Y8ZA 2BZ6H 3TJUA 2BD2A 2ASUB 4F55A 3HK3B 2FLBH 4JZFH 3SJOA 2RCEA 3PMAB 1LQEA 1NFUA 1MBQA 1MD8A 2V7QD 1K1JA 1GL1A 1FMGA 2BLVA 3SI3H 2PP6A 2ZC9H 1DWEH 1FUJA 1BT7A 1IQKA 4ABDA 4RT0A 3KQBA 1C4Y2 1TA6A 3H7OA 2A1DB 2BD9A 1CHOF 2W6ID 1YF4A 1TBQH 1ZZZA 2I6QA 2AMPA 1U6QA 1PPZA 1SQAA 4XOJA 3SNCA 1QL9A 3NZIA 4Y10E 3W94A 5TJXA 2HLCA 1C1VH 1SC8U 4NWLA 1UCYE 1IQHA 3T27A 2ZFRH 1MTVA 1GMDF 3LC5A 3SHAH 4ZKNU 3RUOA 1D3PB 1C1UH 3MU8A 1N6YA 8LPRA 3AAUA 1ANBA 3SQEE 1ZOMA 2NU1E 2GDDA 2AYWA 2TRMA 2THFB 4MNXA 4WMDA 4YOGA 1WOFA 3GCTF 3EYDA 3QUMP 4ESTE 3KQ5A 1ZSLA 3ZV8A 1F0SA 2ZGBH 2OC0A 2IN2A 5I25A 3GDSA 1YLDA 1MCTA 1OPHB 1C2EA 2KAIA 2M5TA 3RM0H 1V2LT 1EJNA 4XBBA 3RXTA 4A1VA 1GBHA 1BBRK 4RT1A 4Y79A 1W11U 4I8HA 3M3SA 4AB8A 3TH4H 3LIWA 4YLQH 3PO1B 2B5TB 1TMTH 3MO6A 4B75A 2HNTF 1AE5A 4OS2A 4JMYA 1Y3VA 1FLEE 4Y0ZE 1EFRD 1SFQB 2P95A 1WXRA 2D1JA 1VGCB 2EI7A 3LC3A 1AVWA 4AB9A 1AIXH 5C94A 3AASA 5HM2A 1UVSH 1RIWB 1C5SA 1AE8H 3HKJB 4OS1A 1F2SE 1XM1A 1BHXF 2NU4E 2CHAC 1ETSH 2NU3E 2FI3E 1TX7A 1TX8A 3OTJE 4SGBE 2H9HA 2KX4A 5GCHG 4AGKA 3BTHE 1SLVB 4IMQA 2VNTA 4SGAE 3CP7A 5EJZA 3EAJA 1Z7KA 3BG8A 1FY3A 2TBSA 3FZZA 1O5DH 2BD8A 2WYJA 3U9AH 2ALPA 3SGBE
chains in the Genus database with same CATH topology
1HDTH 1BITA 1W13U 1GGDC 2OQUA 2XCNA 2FLRH 2JETC 1D6RA 3BTEE 3MO3A 5DP3A 4BXSA 3QTOH 3K6YA 4FUEA 1HJ8A 5T6GA 1PPHE 1C1WH 1MQ5A 1PQ5A 1YKTA 1W7GH 4AFZA 5JB8S 1SPJA 3DA9B 3MNBA 2ZO3H 3MNSA 4AORA 3M61U 4ZKRU 3RXSA 5DP9A 3C27B 9ESTA 3M36A 1H9LB 1LVOA 1UHBA 1YPJH 4CRDA 1FY8E 4DGJA 2ALVA 2ZPSA 1NRQH 3SHCH 3M7TA 3ATLA 1EKBB 1OYTH 1DLKB 3TH2H 2BY8X 1UMAH 2GT8A 3GY7A 2GV6A 1O2QA 1TMUH 1NU7B 3L33A 5LPFA 1QIXB 3SJKA 3GCOA 3L6PA 4R8TB 2GDEH 2BQ6B 4J1YA 1TIOA 2OTVA 3LH3A 3MH6A 1OWDA 9LPRA 3SORA 2ODPA 1ZMNA 1P12E 5IYTA 4DVAU 3F6UH 2VH6A 1V2WT 1ZTLA 2AERH 2BDYA 3M3TA 7LPRA 4DCDA 1E0FD 2FI5E 3BIVH 3HPTB 3IG6B 4A7IB 1WV7H 1TNIA 2GCHG 3PM3A 5F03A 1DWDH 1MQ6A 3SV2H 2VIVA 2EI6A 3TJOA 1FY5A 1OSSA 1CVWH 4VGCC 2F9PA 3BSQA 3RU4E 1RXPA 1QRZA 2QCYA 4I8JA 5E2OA 1P9UA 4JZIA 5C5OA 3KQDA 1XMNB 1V2JT 4Q80A 1HAVB 1ELEE 4KTCA 2CGAA 1O2WA 3ZVFA 4E05H 4DIHH 1ZHPA 1QJ6B 1ABJH 3LJOA 1GVKB 3BTWE 1GJ9B 1UTKA 5EW2H 5K0HA 2QGRA 2LPRA 2QF3A 4ABGA 3SGAE 2V35A 1CT0E 2FOMB 1GBLA 2OBOA 1O2OA 1UTMA 5T6DA 1P2MA 3GY4A 2ZHQH 2VGCC 1HXEH 3TGKE 1LPZB 1FV9A 4MQAA 4BTTB 2BD7A 1NRPH 1BRBE 2WYGA 2TPIZ 1TFXA 3OY6U 1TPOA 4ZHMU 4DY7B 3KQEA 1C2IA 1GI5A 1THRH 1VJ9U 1WQVH 2BOHB 2QY0B 1RGQA 2Z3EA 3OSYA 1SFIA 4FUIA 1NROH 1Z8IB 2HWLB 3UNRA 1N1LA 2GCTB 4LZ4B 1A3EH 2FOAA 1P8VC 3UNSA 1LHCH 1S81A 5JDUB 2J92A 4NIXA 1K22H 6GCHG 3KHVA 3M5NA 1CQQA 1XUJA 4ZH8A 3ZZBA 4KP0A 4KELA 1ZMLA 1AVXA 2HPQH 3G01A 4MG3A 1LO6A 2PUXB 2VJ1A 3IITA 5HYOA 4RSPA 4DG4A 1GBMA 4JYUH 1C1NA 1AQ7A 2PW8H 4CRAA 4WWYA 4UE7H 1JIRA 1QA7A 1BTWA 1YGCH 5A2MH 1PJPA 4R0IA 3O8DA 5A0CA 1LKBA 1SVPA 1P2QA 4UFEH 4MPUA 1AUTC 4WXVA 4TYDA 4B1TA 2Z6BD 2ULLA 2WPJS 1EATA 1HUTH 3GDUA 4CRCA 2CN0H 2CF9H 4CHAC 4JK6A 1O2HA 3A7YA 1AU8A 5AFYH 2IPHA 5GIBA 5HXFA 1GBEA 3LT3A 4O3TA 1TABE 2BXUH 1W3CA 1O2LA 1ID5H 1E35B 1K28D 3UUZA 2VINA 1V2OT 1FDPA 2BB4A 3PTBA 3TVJB 4LZ1H 3M35A 2ZCHP 3SJ9A 2F9OA 1NM6A 1S85A 2J38A 1Z8RA 1QRXA 2C3SA 2PV9B 4IN1A 2PUQH 2PKSC 4D9QA 3RXKA 2GCHF 1TPSA 4YESB 4YOIA 2PSXA 1BMLA 2OQ5A 1A0LA 1AFQB 3MO9A 2PKAB 3ZVCA 4Q7ZA 3MHWU 4TY6A 1EPTB 3MI4A 1O37A 4WVPE 4ZAEA 1SLUB 1KXFA 1UVUH 1GJ4H 4PROA 1KDQB 4RN6A 1V2TT 5L2ZH 1AB9B 5C2ZA 1UVOA 3VB5A 3AAVA 4QT8C 3SUFA 1RTFB 2H5CA 1Y5BT 4JZDH 1IQJA 1UK3A 4HFPB 1DS2E 2J94A 1FPCH 1GDQA 3DFJA 3FANA 1GBAA 2Q1JA 1KXAA 1ZRKA 1LHDH 2SGPE 1Y3XA 1EQ9A 1K1PA 2A5AA 3UNQA 1HLTH 4Y7AA 2BX3A 1FIWA 4GHQA 3RXLA 1TA2A 4AFQA 3MU1A 3TGJE 2CF8H 4GHTA 2BX4A 1SGDE 3DFLA 1Y3UA 1TPPA 2SGFE 3RXRA 1F7ZA 1MMJN 1ZYOA 3GY3A 3KL6A 1L4ZA 1QRWA 4B71A 2C90B 3OY5U 1LHGH 1LKAA 2F83A 1Z6EA 1MTNC 3BIUH 1TLDA 2WPKS 3E0PB 1GBDA 3GYLB 2XYAA 4WXIA 1BBRH 6GCHF 2UWPA 1LPGB 1NO9H 4YOJA 4NFFA 1DXPA 2CMYA 1Q31A 1TPAE 4AN7A 1PPBH 1BRCE 1LTOA 4KGAA 3TJVA 1ZRBA 2GZ9A 4X1QU 2AH4X 1DUAA 1P03A 1IQMA 4NSVA 2ANMH 3M5MA 1SL3A 3ESTA 3MU5A 1KLTA 1QR3E 1DM4B 4ZUHA 2OXSA 2WV4A 3D65E 4WMEA 2Q6GA 1INCA 1T32A 3RMLH 3A87A 1TOCB 2FS9A 2ESTE 1FQ3A 1G9IE 3EQ0H 1MAYA 3LJJA 4Q7YA 3RXDA 3TITA 1O2SA 1UVPA 5JBBS 1A46H 1XXDA 4NIVA 1V2MT 3AW0A 2PSYA 2ZPQA 2BMGB 1B0EA 1CGIE 4WMFA 1K21H 1L2EA 4AFSA 1Y3YA 1W12U 3O8BA 3T5FH 4U01A 1JBUH 3UIRA 1P06A 4NIWA 2XW9A 5CHAB 3PO1C 3SNBA 4NIYA 1TBRH 5FAHA 1A3BH 2G5NA 1G36A 1CE5A 1BTHH 1O2TA 2SGAA 3MNCA 1GJ8B 2BDGA 1XUFA 3MH5A 4JK5A 4I8LA 4CBOA 3A8AA 2AEIH 1CGHA 1E36B 3RC4A 1UVTH 3Q3YA 1K1OA 1P05A 1C4U2 4B73A 1KYNA 1O3KA 3TK5A 5JB9S 3RXMA 2EI8A 3SU0A 5DP8A 1SLXB 1QTFA 1F0TA 3D23A 1G3BA 1BTYA 2AGIX 1HBTH 1ARBA 4KTUA 4B2BA 1SMFE 1C2HA 2ZDLA 4NZLA 3SO3A 2O8MA 1UCYH 2AMQA 1YPHE 1EZUC 1CBWB 3PTNA 3ENSB 3PYHA 3KIDU 1HAZB 1LMWB 3R3GB 3QDZB 1BOQA 4IN2A 3ZZ7A 1QB6A 1KLIH 1SGIB 2J4IA 3V13A 4OS6A 4ZKSU 3LGUA 1AVGH 2ZNKH 1EPTA 2FYQA 2PHBA 3ODFA 1EAWA 1JWTA 1VCWA 3QO6A 1OWHA 2G00A 1KDQA 3SNDA 6CHAB 3MU4A 2QV1A 1MAXA 4IMZA 2D2DA 4X1RU 5LPEA 2P3FH 4AFUA 2ZF0H 3ZYDA 4BAQB 3UPEA 7KMEH 4X8VH 2R0KA 1CT2E 1HAIH 1IQNA 4FU8A 1TNGA 4FUDA 3A89A 2AS9A 3ZZ3A 2FOGA 1GBBA 1C1RA 1GWAA 1UJ1A 1J16A 3MFJA 2C4FH 3ZZ8A 1SI5H 1DY9A 3FZDA 4MNWA 3UOUA 1GHBF 1TNLA 2QYIA 1SOTA 4WH6A 5DP4A 1D4PB 2H2ZA 4FUJA 5TCCA 1TRNA 2ZDAH 4HZHA 4ABBA 3GY8A 3FP6E 1GHAG 1LVBA 1KSNA 3SNAA 1OWJA 2A2XH 2FOBA 2FO9A 1TOMH 1RTKA 1DANH 1FN8A 2Z9KA 3ATKA 2ZI2H 5A8YA 1ACBE 3E16B 4MPVA 3LKWA 2YNAA 1UTJA 1TNHA 1E34B 2R2MB 2ZU3A 1ZTKA 3P17H 2AIQA 3RC5A 1LPKB 4FUHA 1AN1E 1O3LA 4I7YH 5I46H 2NWNA 2XCFA 4MPXA 4HTCH 4BAKB 2GGVB 2ZHDA 1TWXB 3N7OA 1QL8A 2O8UA 2QN5T 4X1PU 1DOJA 2PTNA 3RMNH 1G30B 1FIZA 5L2YH 3DT0H 2FOHA 3T2NA 1S5SA 2A7CA 1XVMA 2P8OB 3MH7A 4Y76A 1NY22 2BZAA 2CXVA 2Z3DA 4E7NA 3MNXA 1ELVA 1KTTB 7GCHG 2QAAA 2FMJA 1GJ5H 1V2ST 1C5MD 1CT4E 1W0YH 1IQFA 3VFEA 4D7FA 1HPGA 3PV4A 1ZPCA 1SGNE 2ZDMA 2QXHA 2XRCA 1N6XA 1GJ7B 4O03A 1ANCA 1RRKA 4FVBA 4UD9H 2QXIA 3NK8A 1FAXA 1ZTJA 1VITH 3H5CB 3FVFB 1C5RA 1TGBA 1F5KU 2Q6DA 1OP0A 1O3MA 1NRRH 2FX6A 1YPGH 2FYRA 1DXWA 1ABIH 3NCLA 2ZU1A 3RDZA 3SOSA 2GVFA 3E1XB 2GCTC 1DVAH 1NRSH 4O9VA 1VR1H 4Q7XA 4MLFB 1Z71A 1XVOA 1TALA 3UWIA 1GG6B 2UWLA 1HAHH 1JXPA 4YZUA 3PLKA 8GCHF 4GAWA 3T28A 3SJIA 1C5ZB 3TNSA 4KKDA 3A8CA 1DSTA 5H4IB 1FXYA 4GCHG 3STIA 1GHYH 3LH1A 1NFXA 1GBJA 1CHGA 1FNIA 1SGQE 2P3UB 3S69A 2SGQE 2LNCA 2JH5D 2WPHS 1OS8A 4AYVB 1HJ9A 1GMHF 1DPOA 1MH0A 4IW4E 3QGJA 1PQAA 1AHTH 2BDCA 3H7TA 1O3AA 1HAOH 3F9FA 1O39A 3PROA 8ESTE 3VB7A 2EEKA 3CS7A 3RXBA 1EJMA 3P95A 3PLBA 1QQ4A 3SBKA 1GHAF 1OP2A 2A5KA 1MKXK 3LGVA 4A6LA 1C1QA 5F8TA 5JBAS 2ODYB 1PPEE 1SGTA 1ZPZA 2ZFSA 2OLGA 1ANDA 4FUCA 1SGEE 1ESTA 1IQIA 4X0WU 1P3EA 2A4OA 1V2QT 5CE1A 1AFQC 1SLWB 1W10U 1XUKA 1ZHRA 2PTCE 3E91A 3B23B 1QHRB 3BF6H 3U8OH 1GI4A 3A81A 4BTIB 1C2GA 1QNJA 1J9CH 1QBNA 2QA9E 3GY6A 4ZHAA 2OD3B 2FIRH 3SJ8A 1AB9C 3DUXH 3O8CA 2R0LA 2ZKSA 1UCYK 1EX3A 1C2FA 1GL0E 1P0SH 2FOCA 5EW1H 1A4WH 3GCNA 1O36A 1GVZA 5A8XA 1UO6A 5F8XA 2XXLA 4CH2B 5A09A 1J15A 2FZZA 2V3OH 5L6NH 2B8OH 4WF8A 4I8KA 2ZGJA 4FU7A 1G3DA 2HNTE 1AKSB 3RXCA 4M7GA 1BA8B 5HGGA 4U2WA 1O2GH 2HALA 2BD5A 4CH8B 1WSSH 3A7WA 1O3CA 3SUGA 5JYIA 1AMHA 1MBMA 4RKJB 5E8EH 1XUGA 1P2OA 2ANYA 3URCA 2QXGA 1SGCA 3SNEA 1TRMA 3MU0A 1GBFA 3OX7U 4NA7A 2A45B 3U69H 3VB3A 3C1KA 6LPRA 5FCKA 1O2ZA 2RDLA 5GCHF 4GUXA 5DP7A 3RXEA 1D3DB 5HM9A 1V2KT 3RU4T 2ZCKP 3Q3KA 1QJ7B 5C1UA 4BAMB 1VZQH 2GD4B 1YPLH 1KTSB 3TLOA 4UFGH 1HV7A 4I33A 4AZ2B 1ZJDA 2C93B 2Y80A 4CR9A 5C5NA 4GCHF 3SZNA 3TK6A 2W3KA 1BQYA 2ZP0H 3U8TH 2GTBA 1DDJA 1WCZA 3GY5A 3U1IB 5JBCS 3HK6B 3NKKA 1P09A 2BDHA 2WUCA 4F49A 3W95A 1GI2A 5E0JA 4B2AA 1GI7B 4H4FA 2OC1A 2UUFB 5IDKA 5FBEA 2P16A 2GX4A 1TE0A 3QX5H 1ELDE 1UTNA 1HJAC 1QURH 3A85A 2BQWB 1C5QA 1GI1A 1G3CA 1K1LA 1C1OA 2A31A 3RU4D 2F9NA 3SQHE 2WUBA 4YO9A 4X1SU 2BY5X 2GP9B 1XKBC 1UK4A 1GMCG 1GI0A 1MZDA 1TMBH 1OOKB 2SNVA 1P04A 1WAYB 2FI4E 4HI3A 4NZQA 1C5UA 2A7HA 1S6FA 5EXLA 1XXFA 1L1NA 4K1TA 4BTUB 4U32A 2EA3A 1J17T 2TGPZ 5SGAE 1BTZA 2ZDVH 3BTME 2GMTC 5DKMA 3BEUA 3VXEH 5G4BA 2WPLS 2GKVE 5EPNA 2F91A 5K7RA 5FXLA 2XWAA 2PWXA 1GGDB 1MU6B 2XNIA 1O3IA 2JETB 3T25A 4ISHH 1O5GH 1GCTC 5A0BA 2F9UA 1H9IE 2XBYA 1TONA 1A7SA 1EAUA 2BYAX 3SUEA 1GI9B 5C20A 1O5FH 4B74A 4FUFA 1QY6A 1UTPA 3SU5A 3B8JA 2NU2E 2HOBA 1EZXC 3LGYA 2ZZUH 2B9LA 5J4SA 3KN2A 1EB2A 1SQOA 1C1SA 1O2YA 2XC4A 4HGCA 1V2VT 4DT7B 1ZHMA 1LHEH 2SGDE 2ZFFH 4ZXXH 3LU9B 1N8OB 3BEIB 2BD4A 4BANB 4Y6DA 1C5NH 5AF9H 3AVZA 5A8ZA 5F6MA 2A0QB 2B0FA 4BOHA 2HRVA 2A4RA 3A7XA 1AGJA 1SBWA 2DE9A 3SV6A 3O8RA 2C8XB 6CHAC 1O3HA 1SSXA 2VIPA 2WPMS 2ZFQH 4ZKOU 2RG3A 5BPEA 2Y82A 3B9FH 2W7SA 3SI4H 2R9PA 3A8DA 4ASHA 5EPYA 1EOJA 1FI8A 4LOYH 1EXFA 2A5IA 2ODQA 1SGFG 1ETRH 1SGRE 2R3UA 4VGCB 3KQCA 2F9VA 2VIWA 2SGEE 3RXOA 4OS5A 1LHFH 3STJA 1C1TA 5ESBA 1DSUA 1HAVA 1YCPH 1C1MA 2Y7ZA 5HMAA 1O3GA 3GICB 3UQVA 3PMBB 2G4TA 4MDSA 4ABAA 5C1YA 1O5CB 3VB4A 4AOQA 4D76A 1O5EH 3PLPA 4DURA 3A86A 2BQ7B 1TGCA 2BY9X 4CRFA 1O2PA 1TX6A 5DK1A 2Y7XA 1J14A 1FN6A 1GDNA 3MMGA 5FCRA 4H6TA 3GCHB 1DUEA 5DJ7A 3ELAH 1D3QB 2F9BH 1GMCF 3UOPA 1PPCE 2OP9A 1SGPE 2P59A 1K1IA 2V3HH 2Z3CA 3K65B 4X2VA 2HVXA 3S9BA 1GBKA 2K1QA 3FAOA 2ANWA 5E2PA 2P94A 4THNH