1EZXC

Crystal structure of a serpin:protease complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
199
structure length
140
Chain Sequence
CGGSLINSQWVVSAAHCYKSASKSIVHPSYNSNTLNNDIMLIKLKISLPTSCASAGTQCLICLKAPILSDSSCKSAYPGQITSNMFCAGYLCQGDSGGPVVCSGKLQGIVSWGSGCAQKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-1-ANTITRYPSIN
publication title Structure of a serpin-protease complex shows inhibition by deformation.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 140
sequence length 199
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ezxC00
2CF9H 5C1UA 1C5OH 1BCUH 2CHAB 2GDDA 5I25A 3M36A 3RXVA 3RDZA 2FO9A 1ELFA 1UK4A 3HK3B 1PPEE 2CV3A 1YLCA 1QRZA 3DHKH 4KGAA 1NPMA 2J95A 1JRTA 1TRYA 3LKWA 1TNKA 1S5SA 3ZZAA 1PPGE 4YT7H 3P95A 2F9UA 2JETC 2G4TA 3NUMA 1ZTJA 5K7RA 1WQVH 2A0QB 2ANMH 2PGBB 2V3HH 1S84A 2R3UA 3TGJE 2V0BA 1DLEA 4NWKA 1YPKH 3E8LA 4NIWA 4IN2A 2VIOA 3LPRA 1FPHH 1O2WA 1OWDA 1UK2A 1LHFH 2SGEE 4MPWA 4AYVB 4Y8YA 1QB1A 1P06A 4ABEA 5JB9S 1HXEH 5AFZH 2A2QH 3DA9B 3RXKA 1BTXA 1TRMA 4K8BA 4Q80A 5GJ4B 3VXEH 1HIAB 1KDQA 1FY3A 3D65E 4D9RA 1XM1A 3RU4D 2A4OA 2Y5HA 2ZU5A 3MU4A 1J17T 4X2XA 5JYIA 3U1JB 3STIA 1B5GH 2DUCA 1MTNC 1FXYA 4UDWH 3H7OA 3RXHA 4ASHA 5IDKA 3SJKA 2H1UA 2C8XB 1TPOA 2STBE 4ZH8A 1DFPA 1GDNA 3ZVDA 1UTMA 1FPCH 2A1DB 2QAAA 1SGEE 2THFB 4A1TA 3U8OH 5JB8S 1CBWB 1O2LA 2XBXA 3T5FH 1A0JA 3ZVBA 2C93B 3FZDA 1TNHA 1TNJA 2HLCA 1C1MA 3GYMA 5AF9H 1GMDF 2P3UB 2VIWA 2XC0A 1O5CB 1AHTH 1UTKA 3E0NB 1WU1A 3EA7A 5DP4A 1ELDE 2QXGA 1BT7A 1QURH 4X1RU 4CRAA 1EQ9A 4BTTB 1ANBA 3SUEA 1Q3XA 2G00A 1F0UA 8ESTE 1TQ0B 1WYKA 3I29A 4ABIA 4FUGA 4CR9A 1SGFG 2C8WB 2PKAA 4JK5A 4K1SA 1Z7KA 3GY5A 1UTQA 2ZDKA 1WSSH 4HFPB 1GI6A 1ZSLA 2Z9JA 3SO3A 3LT3A 1DM4B 1GBAA 3FP7E 3E91A 2BXTH 4XBCA 4DIHH 3KIDU 1GJDB 1V3XA 3VGCB 4CR5A 3ZZ6A 1ACBE 1GBTA 1DXPA 1P3EA 3ZZ4A 2O8LA 1C2FA 3RC5A 3K6ZA 1IOEA 3MH4A 3RXCA 1LPKB 5C2ZA 4CHAC 5HM2A 1RGQA 1DVAH 1G37A 3ESTA 1PPZA 2BQWB 1FLEE 3P6ZB 5FCKA 2AMQA 1TA2A 1AVWA 3IWMA 3GCTF 3MH6A 1ZHRA 2H9TH 5A8YA 3MWIU 1CT0E 1LHDH 2B0FA 1NFWA 5DP3A 1K9OE 1OPHB 2XCNA 3DD2H 1GI0A 5TJXA 3TIUA 1Z8RA 1IQMA 3KEEA 2CHAC 4FU8A 5DKMA 4CBNA 5L6NH 3P8FA 5LH8A 3KQCA 1UHBA 9LPRA 2W7SA 1LKAA 4FU7A 2ZCLP 4NZLA 1GI9B 3SHCH 1SLXB 1HAGE 1N8OB 3M7TA 2IOTA 1GMCF 1W14U 3DFLA 2QXHA 1F0RA 1XUIA 1CT2E 1EKBB 1ZGVA 3ZZCA 3SNCA 5BRRE 1DY9A 3SV9A 2UWPA 5F03A 4D9QA 2YNBA 1AKSB 1O2UA 1NRRH 3LGTA 2FWWA 4UEHH 4GPGA 3RC6A 1GMDG 2PSYA 2ZGBH 1FY4A 4FUEA 1O3BA 4ABJA 2PSXA 5A8XA 3RMOH 2OINA 4BAMB 2J9NA 4TYDA 2PKSB 3Q3KA 1GHBF 1JXPA 1YC0A 2UUKB 3GY3A 2WUCA 3BG4C 2J38A 1IQFA 4ZXXH 3V0XA 1YPEH 1O3OA 3RXQA 1NZQH 3A7WA 1C5SA 2FIRH 3LJOA 1HB0B 3NZIA 5AFYH 3E90B 3UUZA 1GCTB 1TX6A 2VIVA 2BZ6H 2P3FH 3S7HB 1GI3A 3TJUA 1NFXA 2GT8A 2AIQA 1NRPH 3UNQA 1P9SA 6GCHF 1SGPE 1DWDH 3PMAB 1EZXC 1F5RA 1L1NA 2XWAA 1ZR0A 3SV7A 2VNTA 1FQ3A 1OYTH 4WMFA 1YLDA 5JBAS 2FM2A 1QTFA 1IAUA 4XDEA 1DICA 1O3HA 1QNJA 2ZU4A 3A88A 4WY3A 5CE1A 4XSKU 1NM6A 2BQ7B 1AY6H 3RU4E 5LPFA 1C1OA 1IQGA 1XKAC 1ESTA 3GCHB 1EB1H 3UNRA 2BDYA 1QCPA 4J1YA 1QQUA 2ANWA 3OX7U 1O2IA 1AD8H 1C2GA 1BIOA 2OD3B 3F9EA 4K8YA 4ZAEA 3SGQE 5JBTA 1QL9A 2HGTH 3A7ZA 4FUJA 4K5ZA 3V13A 1JOUB 4KELA 1HRTH 1UK3A 2A4GA 2SGQE 4LXBH 1V2QT 2Y5GA 2ZI2H 1SG8B 3TJOA 4E06H 3HATH 2G51A 4THNH 1O2MA 1DLKB 4X1NU 1A61H 3O8RA 1C5NH 5SGAE 1A0LA 1O2PA 1C1NA 4AOQA 5A09A 3UR9A 3BF6H 5B6OA 1EJNA 3VGCC 1QJ7B 1ZLRA 2QV1A 1OP0A 2Z6BD 2Z7FE 2BXUH 1VJ9U 4Z6AH 3SGBE 1AZZA 2QF3A 1F5LA 1C1WH 1ELAA 4ISLA 3D49H 1BTZA 3SNEA 2O8TA 1ESAA 2A5AA 3SJIA 4ZHAA 3PLKA 3M5NA 1HNEE 1GHBG 3PMHB 3A8AA 1PPFE 3PMBB 1DDJA 1ZPZA 3RP2A 4CRBA 3A80A 1HPGA 1SPJA 1EX3A 1FI8A 2ZHDA 1AFQB 1C5QA 2O8UA 3DT0H 2Y7ZA 4CRDA 3L33A 1SOZA 1C5UA 8GCHG 2WPKS 3TVJB 1H9HE 1UVOA 4Y10E 2J4IA 1ID5H 6GCHG 5A0BA 1QB6A 1Z1JA 1UTJA 4K1EA 4K1TA 5TCAA 1WTGH 3JZ1B 1VGCC 2FOHA 2ZQ1A 3UPEA 1TMBH 1N8OC 4RKOB 4YM9A 7GCHF 1O2KA 1GJ9B 2R2WU 1AN1E 1WOFA 2P95A 2OTVA 4NG9H 4BAOB 4HGCA 3S9BA 1THRH 1O3CA 4GLYA 1MUEB 1MQ5A 6LPRA 1A3EH 2VB0A 1BRBE 1NFUA 1K1JA 1V2WT 2SGPE 3A83A 4JZFH 1C4U2 1H9LB 1Z8IB 1L4ZA 4AX9H 1L1JA 2PKSC 3EDXB 3P8OA 1D3PB 3NK8A 6CHAC 1OOKB 1FN6A 3PYHA 1IQIA 1G9IE 1HAYB 1GHXH 1O2TA 1SLUB 1DUEA 3K65B 1ZRBA 1SGDE 1BZXE 2P93A 4B2BA 1HYLA 2FYRA 3EE0B 1O2HA 1O35A 1EPTA 2BMGB 3LH1A 1GCTC 3D23A 3CS0A 1NTPA 4MLFB 2RCEA 3GY2A 1NN6A 2R0KA 3RXAA 1B0FA 5EODA 1GBEA 1GHZA 4ABBA 1GL0E 4FUHA 5EW1H 3KL6A 1MZDA 1Q2WA 1Z1IA 4RN6A 1BMMH 1H8DH 3GISB 1C5VA 1FY1A 4ISNA 2QIQA 2OCVB 1B0EA 2I6SA 2Z94A 3U69H 1ZGIA 1A2CH 2BDIA 1OWEA 3SV8A 3GCHC 2EI8A 1EXFA 4INKA 3MYWA 4ZROA 5FPSA 2HWLB 4ISHH 3ZVEA 1Y5UT 4YOJA 3T29A 4B2CA 3TK9A 5EOKA 2GX4A 2BLOA 2UWOA 1QGFA 2ZTZA 4FUBA 3GCNA 5FX6A 1HGTH 4MPUA 5TCCA 4CH2B 2ZFRH 4GVUA 1ELCA 1JBUH 1GBHA 2ZC9H 1MH0A 1FIWA 1V2JT 5LPEA 3A7TA 1UVPA 2F9VA 2TGPZ 3QUMP 1OP2A 4I32A 5E2OA 2P59A 1MTNB 3HPTB 5L2ZH 1V2OT 2Z9IA 7GCHG 5F8ZA 5CHAB 1VITF 4OGYA 2OC1A 3UY9A 1K1MA 3BV9B 4OGXA 2ZU3A 2GV7A 2ZTYA 4J2YB 3SUDA 1W8BH 1ZHPA 2P94A 3S0NA 1SLVB 1WTHD 1H9IE 4OS6A 4X1PU 5DP6A 1O5AB 2FYQA 1TNGA 5JDUB 3A8DA 2Y81A 2G5VA 5EPNA 3FAOA 5C5OA 4DOQA 3M5LA 2GGVB 4Y7AA 3Q77A 1SQAA 1W7XH 3RXSA 1UCYE 3AASA 1W13U 2A32A 2EI7A 4NZQA 2TGDA 3QZRA 4VGCC 1AFQC 4ZKRU 1F0SA 2P16A 4NIXA 1GBDA 2KAIA 2XC4A 1MKXK 1UMAH 1D9IA 1A5IA 4B73A 1AUJA 3HGNA 1O38A 1WV7H 1W3CA 2EI6A 1LMWB 3F6UH 1QBNA 2OP9A 2H2ZA 1TA6A 1P10A 4ABDA 2FS9A 1T8LA 1KXAA 2YNAA 1TONA 3PTNA 1WAYB 1KY9A 1PFXC 3ATLA 3RXBA 3W95A 3GICB 3SUGA 3Q00A 1OWIA 1TMUH 1O3NA 4ABAA 3SV6A 4UONA 1W0ZU 4DIIH 1Y59T 3FFGA 3SV2H 2BOKA 1HJAC 1EUFA 5AHGH 3W94A 2TIOA 3F9GA 5ETXA 4X1QU 1VCQA 1D3DB 2BY9X 1K1NA 1IQLA 1SLWB 5J4SA 1W12U 1C1SA 3K6YA 2AGEX 3UFAA 3MI4A 1TGCA 2NU4E 5C20A 1EPTB 3EGKH 3UNSA 4JYUH 3KQDA 4A5TS 1NT1A 3TJVA 4GAWA 1MU8B 2V35A 4NA7A 1RD3B 4CH8B 2GDEH 1QBVH 1QL8A 2XYAA 5BPEA 4B71A 2C8ZB 3RM0H 1P8VC 1BMLA 4E7RG 1DE7H 1UO6A 4BAHB 1VITG 3T2NA 3GDUA 1TFXA 3QO6A 3LGUA 2C4FH 3ATIA 3M61U 1HAVB 3QK1A 1LO6A 5T6GA 2HPPH 7KMEH 1XUGA 2G55A 1ELGA 1FY5A 1V2NT 2G52A 3UOPA 3A8CA 1O5DH 1QQ4A 1O0DH 2BD3A 1TPSA 1H8IH 3VXFH 4KTUA 1C5LH 1GPZA 1HBTH 2PUQH 5JPMH 4Y0YE 2ALPA 2AGIX 1P2QA 3MU8A 1ETSH 2DE9A 4HI3A 2PTCE 2RG3A 1TX8A 2ZTXA 2FS8A 2J94A 3BG4B 5CMXH 1O2OA 3U8RH 4ISIH 4WVPE 1SMFE 3C27B 1W10U 2BM2A 4X8UH 5I46H 1W11U 1TGSZ 2ZHWH 1AMHA 2G8TA 2OC8A 2GV6A 2VVUA 2Z3EA 3BIVH 4MTBA 3A89A 2W3IA 4WWYA 1HDTH 1RIWC 1EJAA 1MQ6A 1GJ5H 2DE8A 2Z3DA 2BQ6B 4O3TA 5DJ7A 2A2XH 3SU0A 3O8DA 2BY8X 2AMDA 3ZVCA 3F68H 1TLDA 3RLWH 4JCNA 3DFJA 5HXFA 5J4QA 3A85A 4XE4A 1AFEH 1GDQA 1GI7B 5CHAC 2GD4B 2ESTE 1BMAA 2ALVA 4YTAA 1BRAA 5FBEA 3ZZ5A 1KTSB 2W3KA 1TNIA 5C5NA 2Z9KA 2WYJA 1C1UH 1GBLA 1LTOA 4D7FA 2V6NA 3ATMA 3E16B 2VVVA 1P2OA 1V2ST 2UWLA 1PYTD 2SNWA 4GSOA 4HZHA 1NFYA 4TWYA 1G3EA 4ABGA 4OS5A 1T7CA 3P8GA 4Y71A 1MAYA 3TJNA 4IMQA 1GBIA 2FOGA 1NRSH 2PHBA 3QN7A 1IQNA 1O2SA 4Y11E 3E3TA 2FPZA 3SU2A 2ANKH 3RC4A 1Y3WA 1YP9A 1O3FA 1NU9A 3PTBA 5A2MH 4IW4E 1GVLA 3VFEA 3MMGA 3C1KA 1BBRE 1XX9A 3AW1A 1EZUC 3IG6B 1T8OA 4FU9A 1TABE 4DVAU 1EASA 1P2KA 1C5WB 2VWOA 1C1RA 4X2VA 4ZHLU 1O31A 1C4Y2 2FOCA 3MO3A 1OKXA 1N6XA 1H1BA 2WPIS 3SJ9A 1ANCA 3A87A 3M37A 1YBWA 2ZFSA 5FHTA 2GZ8A 1ZYOA 4QT8C 4IBLH 3PM3A 1O5BB 3QTOH 1PQAA 4U30A 2GMTB 1DANH 2B7DH 4O3UA 1LVOA 1EPTC 1TGTA 1UCYH 3GY4A 4FUCA 1TX7A 1B7XB 3F1SB 1TBZH 4I8KA 2HALA 2PGQB 3BTHE 1RJXB 5DPAA 1KYNA 2GTBA 4CRGA 5DK1A 1BHXF 1TOMH 1CVWH 2XCFA 1O39A 3SQHE 4FUDA 3G01A 1T31A 4CRFA 1CGHA 1O34A 2BD4A 1VGCB 1F2SE 2F3CE 4ABHA 3QZQA 1Z8JB 4F4OC 2Y80A 1TALA 1NESE 2FX4A 2W26A 2ZP0H 3ZVGA 1OXGA 4BAKB 3P70B 1C5PA 1S6HA 3GDVA 5A8ZA 4K3JA 2ZPQA 5F8XA 2ZPRA 1LVMA 2BX4A 4X2WA 2A31A 7ESTE 4Q7XA 4ABFA 2VGCB 1EB2A 1EAIA 1ORFA 1BA8B 3NPSA 2BDHA 1OYQA 3GY6A 1KDQB 1O5EH 4UFDH 6CHAB 1Y3YA 3M7QA 4TY7A 5EU8A 4JZEH 1KLIH 4R8TB 1IHTH 2WPJS 3OY5U 4GUXA 4MDSA 1GBBA 2ZA5A 2B5TB 3KN2A 1A0HB 3O8CA 1ESBA 1UCYK 3PROA 1MTVA 3LONA 3TK5A 3F9HA 1SB1H 2BD7A 4U2WA 4NFFA 2ZECA 1SC8U 3QGJA 3H5CB 3U8TH 2P8OB 2JH6D 3KQBA 1KXDA 1GJ7B 4MPXA 3ZZ9A 2IPHA 3RXMA 2TGTA 1RTKA 2NU0E 5FPYA 1IQKA 5EQRA 1D3QB 1EATA 3M3SA 1KXFA 4ZHMU 4OS2A 3SNDA 2BTCE 2BOHB 2VIPA 1TB6H 1ZJDA 2PW8H 1SHHB 1KIGH 5EXLA 3RXLA 1D4PB 2QXIA 4MNVA 1O3DA 3PWCA 1OSSA 1TBRH 1TOCB 2SGFE 4YLQH 2ZU1A 2PTNA 3GCTG 3SOSA 2ZGHA 1BRCE 2PKAB 1P2JA 1V6DA 1YPMH 1MD7A 1Y3UA 2ASUB 2FI4E 2XC5A 4TPYA 3OU0A 1LHGH 1V2MT 3SQEE 1O3GA 4F49A 5A0CA 1TNLA 4BTIB 4E7NA 2D26C 3A8BA 3ATKA 2WPLS 3N7OA 1PQ5A 1RTLA 2Q6GA 1YGCH 4ZKNU 4AGJA 3T25A 1D3TB 1O5GH 3SGAE 3LC3A 1AGJA 3PB1E 3TLOA 1YYY1 3QWCH 3M7UA 4NFEA 1A7SA 1GMCG 2C8YB 3GOVB 2GCHF 1VCWA 3RLYH 3PO1B 3U1IB 5T6DA 4NCYA 2WV4A 3GDSA 4WH6A 1A46H 3MHWU 1S85A 4K2YA 4ZKSU 2VU8E 1QHRB 2AIPA 3T26A 1SFIA 2A5IA 2FODA 5ABWA 4BANB 2CMYA 4H4FA 2FEQH 1DXWA 2EA3A 1JMOH 4IN1A 4ZUHA 1P2MA 3VB5A 4BTUB 3GY8A 1K28D 9ESTA 2GMTC 4INHA 1CO7E 2BVSH 4VGCB 1UTPA 5EXNA 3R0FA 1ELEE 1GI5A 1AQ7A 5DP7A 1OWHA 1UHBB 1O2GH 1QIXB 1PPBH 1ZTKA 5G4BA 2ZHEH 2GCTB 2M5TA 2QCYA 3BN9A 3OTJE 4JYVH 4YO9A 3SZNA 1BHXB 2C3SA 2VIDA 2CF8H 1SGRE 4TY6A 4ESTE 5EW2H 4Q7ZA 1AWFH 2ZFTA 2ZO3H 1CT4E 1P0SH 5DP8A 1AE5A 4CBOA 3LGWA 4X2YA 1BBRH 1FZZA 1Z8GA 2JH0D 2ZEBA 3NWUA 1PPCE 2J2UA 3A7XA 1GBKA 1O3PB 1MTSA 4I8JA 4I33A 1NO9H 1O36A 3K9XB 1HJAB 2F9PA 4NIYA 3LIWA 2ZNKH 1ZOMA 1QFKH 2VGCC 5JBBS 2UUYA 1E38B 1MBMA 3BTWE 2ZIQH 1AE8H 1G30B 1QB9A 1YPGH 1GHAF 3ELAH 2Y82A 1ETRH 1O37A 4A6LA 1TPPA 1BTUA 1OWJA 1M9UA 1SQTA 2BY7X 1LQDB 2PLXA 3ZZ7A 2GT7A 3TGIE 4FXGH 2QA9E 1ELVA 2LPRA 1VITH 2Y6TA 6ESTA 3BIUH 1F92A 2H9EH 2NU2E 4BXWA 3S9CA 4KKDA 5PTPA 3T27A 3NXPA 2A4RA 1P2IA 5DO4H 1LKBA 2RDLA 3UTUH 2GCHG 1C5RA 2C90B 2P8OC 1T4VH 2AMPA 3MNSA 3RXTA 1C2DA 4DGJA 2FTLE 2RA0A 1XXDA 1BQYA 3RU4T 1ANEA 1SGYE 1WQSA 3MU5A 1VR1H 1SSXA 1UVTH 4WH8A 2SFAA 1CE5A 2G5NA 2FZZA 2BLWA 1YCPH 4HTCH 4SGAE 5ESBA 3SU3A 1EAXA 3QX5H 1TWXB 2ZDAH 1L0ZA 2CN0H 3Q3YA 1HJ8A 4TWWA 1EAWA 4DT7B 2FX6A 1RTFB 4JK6A 4WXVA 4XOJA 2FI5E 1HJ9A 1MCVA 3BG8A 1HAXB 1MZAA 3ZV9A 1RIWB 3WY8A 5IYTA 3BTKE 4TPIZ 3A82A 3VEQB 1P02A 4AFQA 1T8NA 2CJIA 3NKKA 1QRWA 3GY7A 1K2I1 3MH7A 3A86A 1O33A 3VPKA 1GG6B 1LVYA 2QY0B 5E0HA 1BOQA 1N1LA 2VINA 3BTQE 2AEIH 2O8WA 3QLPH 1K21H 1FJSA 3PO1C 5DGJA 4GHTA 5EG4A 2BD9A 1IQJA 1L4DA 2BX3A 1C2EA 2R9PA 1P3CA 2UUJB 3QGNB 4KTSA 1O2YA 2FOFA 1J16A 2OUAA 2ZDVH 1HIAA 2BVRH 3KF2A 4KP0A 3MO9A 2TPIZ 2BVXH 2Z3CA 1MD8A 1XUKA 4NIVA 1GHAG 2ZHFH 1SR5C 2ODYB 2YOLA 3VB6A 1V2VT 3BTFE 4Y6DA 2OLGA 5T3HA 2I6QA 3H7TA 3UOUA 1AB9C 1AI8H 1YCPK 1MTWA 1V2PT 4X1SU 3RXUA 3UQOA 1FNIA 4Q7YA 1P57B 1NS3A 1DSUA 1K1PA 1HAHH 2ZCHP 1C5ZB 3S9AA 4MNXA 1ZSKA 1O3EA 2A7JA 1KLTA 1FUJA 2GCTC 3TH3H 4B74A 1DWCH 1TE0A 4IC5A 1A5GH 4AB9A 3ZV8A 2J34A 4A7IB 1KXCA 1SOTA 4IMZA 1XXFA 3LGYA 1C5MD 4YOIA 3SU4A 2V3OH 4E05H 1AVXA 3ZVFA 5GWZA 5ESTE 4JZDH 1DSTA 3RXDA 4AN7A 3LGVA 1E0FD 3P17H 4AORA 1ZHMA 3AAVA 3MU0A 1SGQE 1Y3VA 4XFQA 4BXSA 2ZFQH 1UVUH 1K22H 2ZDNA 1C2IA 1JWTA 2XW9A 2Q6FA 3M35A 2FOBA 1FIZA 4CRCA 2XBVA 2OC7A 1GHYH 4ZMAH 1Y5AT 1ARBA 3A7VA 3L3TA 2R3YA 4K60A 4CREA 3O8BA 1O32A 3STJA 3ITIA 5EPYA 3ODFA 1N6YA 2BLQA 4XBBA 4MPVA 3FP6E 5E0GA 1AIXH 2AYWA 5FXLA 4AGKA 3BEUA 1UTLM 1AVGH 4FVDA 1CQQA 3V12A 5DP9A 4X8SH 3ODDA 4LZ1H 2EEKA 2H6MA 1G3BA 2HVXA 2QGRA 4X8VH 1O5FH 5GPIB 4X0WU 1DITH 1JIRA 1E35B 1EAUA 1HFDA 2BY5X 1AWHB 2FOMB 1GHWH 4I8HA 1O3MA 2XRCA 3MU1A 3RXFA 1PJPA 2ZFPH 3I78A 2GVFA 3SHAH 5T6FA 4LZ4B 4INLA 1SGFA 2P3TB 3K2UA 4WXIA 1GBMA 2BDAA 1ABIH 1KLJH 2BDCA 1O3AA 1GI1A 3TH4H 1FY8E 2F9OA 1WCZA 2ZU2A 2SGDE 1ANDA 1GBJA 4ISOA 5FAHA 5DP5A 1ELTA 4Y7BA 1BTPA 3RM2H 1HCGA 1C5XB 1ZTLA 1AKSA 1BTWA 1ABJH 5EGMA 4ZKOU 1RRKA 1A1RA 1BMNH 2A4QA 5HYOA 4AFZA 1GG6C 2BY6X 4OS4A 1YCPM 2J92A 3PV4A 4MG3A 3Q3XA 4NWLA 1ZRKA 2XTTB 2FESH 1C1VH 1NRNH 2ODPA 4JZ1A 5C1YA 1ELBA 1S0RA 2BD2A 3M3VA 4BNRA 1EP6A 2AERH 3BEFB 3ZZ8A 1C2LA 4U01A 2GZ9A 3S7KB 1C2MA 3RMMH 2KAIB 1THSH 1OP8A 3M3TA 1MKWH 1E37B 2BHGA 3A81A 1UVSH 2TGAA 1VCPA 5FBIA 2D2DA 1O2ZA 1FDPA 5H4IB 1ZMNA 3R3GB 1FN8A 2FOEA 1EOLA 1C5TA 1SGIB 4IS5A 1O3IA 1GL1A 2HNTF 3BSQA 4GHQA 1D6RA 2VH6A 1CA0C 1UTNA 3P8NA 1G2MA 4X6OA 7LPRA 2FLBH 4FUFA 4JMYA 1E34B 1FMGA 2LNCA 5L2YH 4UFEH 1G3DA 1ZMLA 1SL3A 2XWBI 1TGBA 1ZSJA 1HAZB 2FMJA 1MAXA 1NU7B 1JRSA 1XVMA 3V3MA 3FANA 3MH5A 5E2PA 4Q2KA 1GI8B 2CGAA 3EAJA 4WMDA 1BJUA 4YESB 2FI3E 3UWIA 2XBYA 2OXSA 3DUXH 1BTHH 1Z71A 2FLRH 1KSNA 1LCYA 1W0YH 3TITA 4D76A 2PR3A 4O03A 3E6PH 1QA0A 2SGAA 1DY8A 2ZZUH 2IJOB 1SVPA 1K1IA 1GJCB 1TRNA 1DS2E 1HXFH 3MNBA 1IHSH 1MKWK 3HKJB 1G2LA 2D8WA 5HM9A 5DG6A 1MU6B 1K1LA 1QJ6B 1O2NA 4I7YH 1C2KA 4FUIA 2WPMS 1HAOH 2QYIA 4NGAH 1O3JA 2VIQA 2IN2A 1YM0A 3UR6A 1EZSC 3BTTE 3CP7A 1J8AA 1O2XA 5GDSH 1GBFA 4UE7H 2ZCKP 1AO5A 3RXJA 1HLTH 2AFQB 2XBWA 2VWLA 2Z9LA 3UIRA 3HKIB 2D1JA 4AB8A 3EA9A 3TH2H 3OY6U 2ZGJA 2B9LA 1DT2A 5C67A 3FP8E 1J14A 4Y0ZE 3FVFB 1O3KA 5GXPA 4MNWA 2Q6DA 3U98H 5K0HA 3CS7A 2ODQA 1LHCH 3LDXH 3SU6A 1FONA 5HGGA 3P92A 4ZXYH 3SN8A 3T62A 2ZWLH 4AFSA 3GCOA 5F8TA 1ARCA 1EOJA 4LOYH 1BTYA 5E8EH 3BTEE 1O2JA 3V7TA 1SGNE 1VZQH 4NSVA 3LOXA 3SNBA 3EYDA 3EQ0H 1C9TA 1NC6A 1DPOA 1T8MA 3E1XB 3TPIZ 1PQ8A 1W2KH 3UQVA 3MTYA 4X6MA 3S69A 2CXVA 2UUFB 3MFJA 1S83A 4KTCA 4IC6A 1Y8TA 4Z0KA 5EQQA 3GYLB 5F6MA 1G3CA 3ZZBA 4PROA 3RMNH 1SGCA 1LDTT 2VVCA 4O9VA 2VJ1A 8GCHF 4R0IA 5EXMA 1XUJA 1Z6EA 4YLUA 2GZ7A 2Z9GA 1J15A 1TGNA 2R2MB 1MBQA 4YOGA 1BUIA 4BAQB 1MMJN 1GI4A 3TNSA 5LPRA 3KQEA 2ZG0H 1GJ8B 3ZYEA 4DY7B 3RXGA 1O3LA 1YPLH 3PMJA 1GDUA 1BITA 1T4UH 2ZGXH 4FVBA 1RXPA 3BTME 1GJ6A 2XXLA 1A3BH 1CBWC 3RXOA 1S82A 1WBGB 3URDA 1CHOF 3ZVAA 4LK4A 1P03A 4A92A 4B2AA 2G4UA 1C5YB 1YPJH 1GJBB 3B9FH 5E0JA 3A7YA 3B23B 1V2RT 1TIOA 3BEIB 3SU1A 4OS7A 3CENA 1KTTB 1S6FA 3KGPA 1LPZB 2A45B 3B8JA 2ZKSA 1F0TA 1WUNH 4X6PA 3TGKE 1C2JA 1GVZA 1QR3E 1ETTH 3MOCA 1UJ1A 3LC5A 2ULLA 3TK6A 1LVBA 4GCHF 4X6NA 2GKVE 3TNTA 1A4WH 3PLBA 2ZHQH 1YPHE 1SGTA 1CA8B 1BDAA 1AB9B 1AZ8A 3BTGE 1CGIE 2BDGA 4AG2A 1V2KT 1G36A 2K1QA 1LPGB 1QBOA 1V2LT 4H6TA 3ZYDA 1GCDA 3KNXA 1C9PA 1SQOA 4DCDA 1L1GA 3U9AH 4Y8ZA 3RXEA 3M5OA 3UREA 1P09A 3F9FA 2WV5A 2R0LA 2QXJA 3QTVH 2VWMA 1UTOA 1OS8A 2ZFFH 1GVKB 2STAE 4DJZB 1W7GH 2QN5T 2PUXB 3KHVA 4XBDA 1BB0B 1S81A 1YF4A 3SBKA 3MNCA 2F9BH 1TMTH 4DG4A 1O2VA 1P01A 1C4V2 1P9UA 2WUBA 2B8OH 2F91A 2QC2A 4D8NA 1OWKA 2Y5FA 2HNTE 1ZPBA 3BTDE 1PYTC 2ZGCA 2SNVA 3AVZA 1X7AC 1GWAA 1P05A 1CU1A 1GMHF 1TPAE 2FTMA 1VJAU 2BZAA 4B1TA 1GGDB 1QA7A 1CHOG 1XVOA 3MNXA 3RUOA 3E0PB 1P04A 2ZDMA 3ATWA 2RA3A 4NSYA 3SW2B 1C1QA 1XUFA 4WMEA 1QRXA 3ZZDA 3RXPA 3OSYA 3OYPA 1A5HA 1ZPCA 2NWNA 4MQAA 1RFNA 2AS9A 5HMAA 4Y76A 1YPHC 2WPHS 4NA9H 2PV9B 2TRMA 1E36B 4MNYA 2A7CA 2FOAA 1EJMA 1TBQH 1GBCA 1Y5BT 3A84A 4I31A 1C1PA 1FAXA 1SBWA 2OQUA 3LJJA 3UWJH 3ZZ3A 4B75A 4DURA 3SORA 1BBRK 3ENSB 4GCHG 4YZUA 1EZQA 1Y3XA 1NY22 2H5CA 1BJVA 4SGBE 3MO6A 1XKBC 3SNAA 1DWEH 1SFQB 2ILNA 2JETB 3HK6B 3AAUA 1S0QA 5EQSA 1HUTH 2F9NA 3PWBA 1IQEA 1C2HA 1HAVA 2QF0A 2BB4A 5A0AE 4MVNA 2XNIA 3AW0A 2AH4X 1MKXH 1HV7A 3LGIA 1TQ7B 1O2RA 3L6PA 2ANYA 1GI2A 3LU9B 3SU5A 3EA8A 1MCTA 4B76A 2HNTC 3FZZA 4JZIA 4RKJB 1P2NA 1CHGA 2EC9H 3RMLH 1IQHA 1XMNB 1ZZZA 1DX5M 1PPHE 2TBSA 1H4WA 2ZQ2A 1NROH 8KME2 1FAKH 4O97A 1PQ7A 3M5MA 5JBCS 2H9HA 4UD9H 2NU1E 4AFUA 5GCHF 2WYGA 1P11E 3QDZB 3HGPA 1SI5H 4H6SB 3RXIA 4I8GA 4WF8A 5GIBA 1O2QA 4JYTA 4DW2U 4IGDA 2HPQH 4UFGH 2W5EA 2ZF0H 1GMHG 1F7ZA 2OQ5A 1G32B 1J9CH 1JIMA 1GHVH 2G81E 4Y79A 2BD5A 1L2EA 3TU7H 2HRVA 2FP7B 2W7UA 3IITA 2VWNA 4A1VA 1QL7A 2OBQA 5FPTA 3JZ2B 1V2UT 4X8TH 1AU8A 1CA0B 3Q76A 1QJ1B 4RSPA 4A1XA 1BRUP 4AZ2B 2FDAA 2PFEA 1KXEA 3RXRA 2ZPSA 2BYAX 1Q31A 2BD8A 1CSOE 1D6WA 5FX5A 3D62A 4YT6H 5C1XA 1HAPH 2F83A 1MTUA 1KXBA 1U6QA 3VB3A 1THPB 4BOHA 3T28A 2AGGX 4H42U 2O8MA 1P12E 2GP9B 1ZMJA 3LH3A 4AG1A 5C3NA 3SUFA 3SI3H 1DUAA 1DWBH 2O9QA 4Y8XA 2A5KA 1V2TT 3I77A 4K69A 1GJAB 3URCA 1EP5A 2OBOA 2Y7XA 2JKHA 1LQEA 1RS0A 1CGJE 2ZDLA 1T32A 1QY6A 4OS1A 2PWXA 5AVDA 4WJG2 3PLPA 4NA8A 5FCRA 1HAIH 1ZJKA 2BDBA 4I8LA 3VB4A 2JH5D 1GGDC 3VB7A 8LPRA 1AUTC 2FXRA 4CHAB 2A7HA 2NU3E 3NCLA 1XUHA 1F5KU 2OC0A 5LGOA 3SJOA 4D7GA 5L30H 1Z6JH 1OX1A 2WINI 4AYYB 1TYNA 2VH0A 1FV9A 1TAWA 1GJ4H 4U32A 2BLVA 1O30A 1NRQH 1SHYA 2H5DA 1LHEH 3SJ8A 4M7GA 3SI4H 1INCA 1C1TA 2Q1JA 1YKTA 1DOJA 5GCHG 2HOBA 1K1OA 3KCGH 4UFFH
chains in the Genus database with same CATH superfamily
2CF9H 5C1UA 1C5OH 1BCUH 2CHAB 2GDDA 5I25A 3M36A 3RXVA 3RDZA 2FO9A 1ELFA 1UK4A 3HK3B 1PPEE 4B6EA 2CV3A 1NBME 1YLCA 1QRZA 3DHKH 4KGAA 1NPMA 2J95A 1JRTA 1TRYA 3LKWA 1TNKA 1S5SA 3ZZAA 1PPGE 4YT7H 3P95A 2F9UA 2JETC 2G4TA 3NUMA 3ZIAD 1ZTJA 5K7RA 1WQVH 2A0QB 2ANMH 2PGBB 2V3HH 1S84A 2R3UA 3TGJE 1OHHD 2V0BA 1DLEA 4NWKA 1YPKH 3E8LA 4F48B 4NIWA 4IN2A 2VIOA 3LPRA 1FPHH 1O2WA 1OWDA 1UK2A 1LHFH 2SGEE 4MPWA 4AYVB 4Y8YA 2HVYB 1QB1A 1P06A 4ABEA 5JB9S 1HXEH 5AFZH 2A2QH 3DA9B 3RXKA 1BTXA 1TRMA 4K8BA 4Q80A 5GJ4B 3VXEH 1HIAB 1KDQA 1FY3A 3D65E 4D9RA 1XM1A 3RU4D 2A4OA 2Y5HA 2ZU5A 3MU4A 1J17T 4X2XA 5JYIA 3U1JB 3STIA 4RT0A 1B5GH 2DUCA 1MTNC 1FXYA 4UDWH 3H7OA 3RXHA 4ASHA 5IDKA 3SJKA 2H1UA 2C8XB 1TPOA 2STBE 4ZH8A 1DFPA 1GDNA 3ZVDA 2EQNA 1UTMA 1FPCH 1E1RD 2A1DB 2QAAA 1SGEE 2THFB 4A1TA 3U8OH 5JB8S 1CBWB 1O2LA 2XBXA 3T5FH 1A0JA 3ZVBA 2C93B 3FZDA 1TNHA 1TNJA 2HLCA 1C1MA 3GYMA 5AF9H 1GMDF 2P3UB 2VIWA 2XC0A 2OK5A 1O5CB 1AHTH 1UTKA 3E0NB 1WU1A 3EA7A 5DP4A 1ELDE 2QXGA 1BT7A 1QURH 4X1RU 4CRAA 1EQ9A 4BTTB 1ANBA 3SUEA 1Q3XA 2G00A 1F0UA 8ESTE 1TQ0B 1WYKA 3I29A 4ABIA 4FUGA 4CR9A 1SGFG 2C8WB 2PKAA 4JK5A 4K1SA 1Z7KA 3GY5A 1UTQA 2ZDKA 1WSSH 4HFPB 1GI6A 1ZSLA 2Z9JA 3SO3A 3LT3A 1DM4B 1GBAA 3FP7E 3E91A 2BXTH 1BMFD 4XBCA 4DIHH 3KIDU 1GJDB 1V3XA 3VGCB 4CR5A 4ACAA 3ZZ6A 1ACBE 1GBTA 1DXPA 1P3EA 3ZZ4A 2O8LA 1C2FA 2WZQA 3RC5A 3K6ZA 1IOEA 3MH4A 3RXCA 1LPKB 5C2ZA 4CHAC 5HM2A 1RGQA 1DVAH 1G37A 3ESTA 1PPZA 2BQWB 1FLEE 3P6ZB 5FCKA 2AMQA 1TA2A 1AVWA 3IWMA 3GCTF 3MH6A 1ZHRA 2H9TH 5A8YA 3MWIU 1CT0E 1LHDH 2B0FA 1NFWA 5DP3A 1K9OE 1OPHB 2XCNA 3DD2H 1GI0A 5TJXA 3TIUA 1Z8RA 1IQMA 3KEEA 2CHAC 4FU8A 5DKMA 4CBNA 5L6NH 3P8FA 5LH8A 3KQCA 1UHBA 9LPRA 2W7SA 1LKAA 4FU7A 2ZCLP 4NZLA 1GI9B 3SHCH 1SLXB 1HAGE 1N8OB 3M7TA 2IOTA 1GMCF 1W14U 3DFLA 2QXHA 1F0RA 1XUIA 1CT2E 1EKBB 1ZGVA 3ZZCA 3SNCA 5BRRE 1DY9A 3SV9A 2UWPA 5F03A 4D9QA 2YNBA 1AKSB 1O2UA 1NRRH 3LGTA 2FWWA 4UEHH 4GPGA 3RC6A 1GMDG 2PSYA 2ZGBH 1FY4A 3CNRA 4FUEA 1O3BA 4ABJA 2PSXA 5A8XA 3RMOH 2OINA 4BAMB 2J9NA 4TYDA 2KFWA 2PKSB 5KECA 3Q3KA 1GHBF 1JXPA 1YC0A 2UUKB 3GY3A 2WUCA 3BG4C 2J38A 1IQFA 4ZXXH 3V0XA 1YPEH 1O3OA 1E79D 1NZQH 3A7WA 1C5SA 3RXQA 2FIRH 3LJOA 1HB0B 3NZIA 5AFYH 3E90B 2HLDD 3UUZA 2JDID 1SQRA 1GCTB 1TX6A 2VIVA 2BZ6H 2P3FH 3F0PA 3S7HB 1GI3A 3TJUA 1NFXA 2GT8A 2AIQA 1NRPH 3UNQA 1P9SA 6GCHF 1SGPE 1DWDH 3PMAB 1EZXC 1F5RA 1L1NA 2XWAA 1ZR0A 5HIZA 3SV7A 2VNTA 2QF5A 1FQ3A 1OYTH 4WMFA 5EJZA 1YLDA 5JBAS 2FM2A 1QTFA 1IAUA 4XDEA 1DICA 1O3HA 1QNJA 2ZU4A 3A88A 4WY3A 5CE1A 4XSKU 1NM6A 2BQ7B 1AY6H 3RU4E 5LPFA 1C1OA 1IQGA 1XKAC 1ESTA 2F4LA 3GCHB 1EB1H 3UNRA 2BDYA 1QCPA 3EE7A 4J1YA 1QQUA 2ANWA 3OX7U 1O2IA 1AD8H 1C2GA 1BIOA 2OD3B 3F9EA 4K8YA 4ZAEA 3SGQE 5JBTA 1QL9A 2HGTH 3A7ZA 4FUJA 4K5ZA 3V13A 1JOUB 4KELA 1HRTH 1UK3A 2A4GA 2SGQE 5F53A 4LXBH 1V2QT 2Y5GA 2ZI2H 1SG8B 3TJOA 4E06H 3HATH 2G51A 4THNH 1O2MA 1DLKB 4X1NU 1A61H 3O8RA 1C5NH 5SGAE 1A0LA 1O2PA 3FOAA 1C1NA 4AOQA 5A09A 3UR9A 3BF6H 5B6OA 1EJNA 3VGCC 1QJ7B 3OE7D 1ZLRA 2QV1A 1OP0A 2Z6BD 2Z7FE 2BXUH 1VJ9U 4Z6AH 3SGBE 1AZZA 2QF3A 1F5LA 1C1WH 1ELAA 4ISLA 3D49H 1BTZA 3SNEA 2O8TA 1ESAA 2A5AA 3SJIA 4ZHAA 3PLKA 3M5NA 1HNEE 1GHBG 3PMHB 3H09A 3A8AA 1PPFE 3U28C 3PMBB 1DDJA 1ZPZA 3RP2A 4M9FA 4CRBA 3A80A 1HPGA 1SPJA 1EX3A 1FI8A 2ZHDA 1AFQB 1C5QA 2O8UA 3DT0H 2Y7ZA 4CRDA 3L33A 1SOZA 1C5UA 8GCHG 2WPKS 3TVJB 1H9HE 1UVOA 4Y10E 4I86A 2J4IA 1ID5H 6GCHG 5A0BA 1QB6A 1Z1JA 1UTJA 4K1EA 4K1TA 5TCAA 5KGOA 1WTGH 3JZ1B 1VGCC 2FOHA 2ZQ1A 3UPEA 1TMBH 1N8OC 4RKOB 4YM9A 7GCHF 1O2KA 4Z1MD 1GJ9B 2R2WU 1AN1E 1WOFA 2P95A 2OTVA 4NG9H 4BAOB 4HGCA 3S9BA 1THRH 1O3CA 4GLYA 1MUEB 1MQ5A 6LPRA 1A3EH 2VB0A 1BRBE 1NFUA 1K1JA 1V2WT 2SGPE 3A83A 4JZFH 1C4U2 1H9LB 1Z8IB 1L4ZA 4AX9H 1L1JA 2PKSC 4TT3D 3EDXB 3P8OA 1D3PB 3NK8A 6CHAC 2WSSD 1OOKB 1FN6A 3PYHA 1IQIA 1G9IE 1HAYB 1GHXH 1O2TA 1SLUB 1DUEA 3K65B 1ZRBA 1SGDE 1BZXE 2P93A 4B2BA 1HYLA 2FYRA 5C0TA 3EE0B 1O2HA 1O35A 1EPTA 2BMGB 3LH1A 1GCTC 3D23A 3CS0A 1NTPA 4MLFB 2RCEA 3GY2A 1NN6A 2R0KA 3RXAA 1B0FA 5EODA 1GBEA 1GHZA 3OFND 1GL0E 4FUHA 4ABBA 4YXWD 5EW1H 3KL6A 1MZDA 1Q2WA 1Z1IA 4RN6A 1BMMH 1H8DH 3GISB 1C5VA 1FY1A 4ISNA 2QIQA 5CDFE 2JJ2D 2OCVB 3N7DA 1B0EA 2I6SA 2Z94A 3U69H 1ZGIA 1A2CH 2BDIA 1OWEA 3SV8A 3F3BA 3GCHC 2EI8A 1EXFA 4INKA 3MYWA 4ZROA 5FPSA 2HWLB 4ISHH 3ZVEA 1Y5UT 2YMSD 4YOJA 5DN6D 3T29A 4B2CA 3TK9A 2W6JD 5EOKA 2GX4A 2BLOA 2UWOA 1QGFA 1E1QD 2ZTZA 4FUBA 3GCNA 3DSGA 5FX6A 1HGTH 3DCLA 4MPUA 5TCCA 4CH2B 2ZFRH 4GVUA 1ELCA 1JBUH 1GBHA 2ZC9H 1MH0A 1FIWA 1V2JT 5LPEA 3A7TA 1UVPA 2F9VA 2TGPZ 3QUMP 1OP2A 3PV2A 4I32A 5E2OA 2P59A 1MTNB 3HPTB 5L2ZH 1V2OT 2Z9IA 7GCHG 5F8ZA 5CHAB 1VITF 4OGYA 2OC1A 3UY9A 1K1MA 3BV9B 4OGXA 2ZU3A 2GV7A 2ZTYA 4J2YB 3SUDA 1W8BH 1ZHPA 2P94A 3S0NA 1SLVB 1WTHD 1H9IE 4OS6A 4X1PU 5DP6A 1O5AB 2FYQA 1TNGA 5JDUB 3A8DA 2Y81A 2G5VA 5EPNA 3FAOA 5C5OA 4DOQA 3M5LA 2GGVB 3OTPA 4Y7AA 3Q77A 1SQAA 1W7XH 3RXSA 1UCYE 3AASA 1W13U 2A32A 2EI7A 4NZQA 2TGDA 3QZRA 4VGCC 1AFQC 4ZKRU 1F0SA 2P16A 4NIXA 1GBDA 2KAIA 2XC4A 1MKXK 1UMAH 1D9IA 1A5IA 4B73A 1AUJA 3HGNA 1O38A 1WV7H 1W3CA 2EI6A 1LMWB 3F6UH 1QBNA 2OP9A 2H2ZA 1TA6A 1P10A 4RT1A 4ABDA 2FS9A 1T8LA 1KXAA 2YNAA 2GJGA 4DT4A 1TONA 3PTNA 1WAYB 1KY9A 1PFXC 3ATLA 3RXBA 3W95A 3GICB 3SUGA 3Q00A 1OWIA 1TMUH 1O3NA 4ABAA 3SV6A 2KR7A 4UONA 1W0ZU 4DIIH 1Y59T 2PP6A 3FFGA 3SV2H 2BOKA 1HJAC 1EUFA 5AHGH 3W94A 2TIOA 3F9GA 5ETXA 4X1QU 1VCQA 1D3DB 2BY9X 1K1NA 1IQLA 1SLWB 5J4SA 1W12U 1C1SA 3K6YA 2AGEX 2YMSB 3MI4A 1TGCA 3UFAA 2NU4E 5C20A 1EPTB 3EGKH 3UNSA 4JYUH 3KQDA 4A5TS 1NT1A 3TJVA 4GAWA 1MU8B 2V35A 4NA7A 1RD3B 4CH8B 2GDEH 1QBVH 1QL8A 2XYAA 5BPEA 4B71A 2C8ZB 3RM0H 1P8VC 1BMLA 1H8ED 4E7RG 1DE7H 1UO6A 4BAHB 1VITG 2KM0A 3T2NA 3GDUA 1TFXA 3QO6A 1H8HD 3LGUA 2C4FH 3ATIA 3M61U 1HAVB 3QK1A 1LO6A 5T6GA 2HPPH 7KMEH 1XUGA 2G55A 1ELGA 1FY5A 1V2NT 2G52A 3UOPA 3A8CA 4ACBA 1O5DH 1QQ4A 1O0DH 2BD3A 1TPSA 1H8IH 3VXFH 4KTUA 1C5LH 1GPZA 1HBTH 2PUQH 5JPMH 4Y0YE 2ALPA 2AGIX 1P2QA 3MU8A 1ETSH 2DE9A 4HI3A 2PTCE 2RG3A 1TX8A 2ZTXA 2FS8A 2J94A 3BG4B 5CMXH 1O2OA 3U8RH 4ISIH 2V7QD 4WVPE 1SMFE 3C27B 1W10U 2BM2A 4X8UH 5I46H 1W11U 1TGSZ 2ZHWH 1AMHA 2G8TA 2OC8A 2GV6A 2VVUA 2Z3EA 3BIVH 4MTBA 3A89A 2W3IA 4WWYA 1HDTH 1RIWC 1EJAA 1MQ6A 1GJ5H 2DE8A 2Z3DA 2BQ6B 3OEHD 4O3TA 2A2XH 3SU0A 3O8DA 2BY8X 2AMDA 3ZVCA 5T1VA 3F68H 1TLDA 3RLWH 4JCNA 3DFJA 5HXFA 5J4QA 3A85A 4XE4A 1AFEH 4XD7D 1GDQA 1GI7B 5CHAC 2GD4B 2ESTE 1BMAA 2ALVA 4YTAA 1BRAA 5FBEA 3ZZ5A 1KTSB 2W3KA 1TNIA 5C5NA 3WWBA 2Z9KA 2WYJA 1C1UH 1GBLA 1LTOA 4D7FA 2K0QA 2V6NA 3ATMA 3E16B 2VVVA 2RDEA 1P2OA 1V2ST 2UWLA 1PYTD 2SNWA 4GSOA 4HZHA 1NFYA 4TWYA 1G3EA 4ABGA 4OS5A 1T7CA 3P8GA 4Y71A 1MAYA 3TJNA 2J5UA 1GBIA 2FOGA 4IMQA 1NRSH 5C94A 2PHBA 2J97A 3QN7A 1IQNA 1O2SA 4Y11E 3E3TA 2FPZA 3SU2A 2ANKH 3RC4A 1Y3WA 2LELA 1YP9A 1O3FA 1NU9A 3PTBA 5A2MH 4IW4E 1GVLA 3VFEA 3MMGA 3C1KA 1BBRE 1XX9A 3AW1A 5IK2D 1EZUC 3IG6B 1T8OA 4FU9A 1TABE 4DVAU 1EASA 1P2KA 1C5WB 2VWOA 1C1RA 4X2VA 4ZHLU 1O31A 1C4Y2 2FOCA 3MO3A 1OKXA 3VG8A 1N6XA 1H1BA 2WPIS 3SJ9A 1ANCA 3A87A 3M37A 1YBWA 2ZFSA 5FHTA 2GZ8A 1ZYOA 4QT8C 4IBLH 1KMHB 3PM3A 2YMSC 3GS9A 1O5BB 3QTOH 1PQAA 4U30A 2GMTB 1DANH 3F0OA 2B7DH 4O3UA 1LVOA 1EPTC 1TGTA 1UCYH 3GY4A 4FUCA 1TX7A 1B7XB 3F1SB 1TBZH 4I8KA 2HALA 2PGQB 3BTHE 1RJXB 5DPAA 1FX0B 1KYNA 2GTBA 2WV9A 4CRGA 5DK1A 1BHXF 1TOMH 1CVWH 2XCFA 1O39A 3SQHE 4FUDA 3G01A 1T31A 4CRFA 1CGHA 1O34A 2BD4A 1VGCB 1F2SE 2F3CE 4ABHA 3QZQA 1Z8JB 4F4OC 2Y80A 1TALA 1NESE 2FX4A 2W26A 2ZP0H 3ZVGA 1OXGA 3OAAD 4BAKB 3P70B 1C5PA 1S6HA 3GDVA 5A8ZA 4K3JA 2ZPQA 5F8XA 2ZPRA 1LVMA 2BX4A 4X2WA 2A31A 7ESTE 4Q7XA 4ABFA 2VGCB 1EB2A 1EAIA 1ORFA 1BA8B 3NPSA 2BDHA 1OYQA 3GY6A 1KDQB 1O5EH 4UFDH 6CHAB 1Y3YA 3M7QA 4TY7A 5EU8A 4JZEH 1KLIH 4R8TB 1IHTH 2WPJS 3OY5U 4GUXA 1WXRA 4MDSA 1GBBA 3SZEA 2ZA5A 2B5TB 3KN2A 1A0HB 3O8CA 1ESBA 1UCYK 3PROA 2J98A 1MTVA 3LONA 3TK5A 3F9HA 1SB1H 2BD7A 4U2WA 4NFFA 2ZECA 1SC8U 3QGJA 3H5CB 5C17A 3U8TH 2P8OB 2JH6D 3KQBA 1KXDA 1GJ7B 4MPXA 3ZZ9A 2IPHA 3RXMA 2TGTA 1RTKA 2NU0E 5FPYA 1IQKA 5EQRA 1D3QB 1EATA 3M3SA 1KXFA 2KZ4A 4ZHMU 4OS2A 3SNDA 2BTCE 2BOHB 2VIPA 1TB6H 1ZJDA 2PW8H 1SHHB 1KIGH 5EXLA 3RXLA 1D4PB 2IPQX 2QXIA 4MNVA 1O3DA 3PWCA 4XRNA 1OSSA 1TBRH 1YWUA 1TOCB 2SGFE 4YLQH 3F2HA 2ZU1A 2PTNA 3GCTG 3SOSA 2ZGHA 1BRCE 2PKAB 1P2JA 1V6DA 1YPMH 1MD7A 1Y3UA 2ASUB 2FI4E 2XC5A 4TPYA 3OU0A 1LHGH 1V2MT 3SQEE 1O3GA 4F49A 5A0CA 1TNLA 4BTIB 3DSOA 4E7NA 2D26C 3A8BA 3ATKA 2F43B 2WPLS 3N7OA 1PQ5A 1RTLA 2Q6GA 1YGCH 4ZKNU 4AGJA 3T25A 1D3TB 1O5GH 3SGAE 3LC3A 1AGJA 3PB1E 3TLOA 1YYY1 3QWCH 3M7UA 4NFEA 1A7SA 1GMCG 2C8YB 3GOVB 2GCHF 1VCWA 3RLYH 3PO1B 3U1IB 5T6DA 4NCYA 4F55A 2WV4A 3GDSA 4WH6A 1A46H 3FN8A 3MHWU 1S85A 4K2YA 4ZKSU 2VU8E 1QHRB 2AIPA 3T26A 1SFIA 2A5IA 2FODA 4P02A 5ABWA 4BANB 2CMYA 4H4FA 2FEQH 1DXWA 2EA3A 1JMOH 4IN1A 4ZUHA 1P2MA 3VB5A 4BTUB 3GY8A 1K28D 9ESTA 2GMTC 4INHA 1CO7E 2BVSH 2KCOA 4VGCB 1UTPA 5EXNA 3R0FA 1ELEE 1GI5A 1W0JD 1AQ7A 5DP7A 1OWHA 1UHBB 1O2GH 1QIXB 1PPBH 2CK3D 1ZTKA 5G4BA 2ZHEH 2GCTB 2M5TA 2QCYA 3BN9A 3OTJE 4JYVH 4YO9A 3SZNA 1BHXB 2C3SA 2VIDA 2CF8H 1SGRE 4TY6A 4ESTE 5EW2H 4Q7ZA 1AWFH 2ZFTA 2ZO3H 1CT4E 1P0SH 5DP8A 1AE5A 4CBOA 3LGWA 4X2YA 1BBRH 1FZZA 3DSPA 1Z8GA 2JH0D 2ZEBA 3NWUA 1PPCE 2J2UA 3A7XA 1GBKA 1O3PB 2IJD1 1MTSA 4I8JA 4I33A 1NO9H 1O36A 3K9XB 1HJAB 2F9PA 4NIYA 3NRLA 3LIWA 2ZNKH 1ZOMA 1QFKH 2VGCC 5JBBS 2UUYA 1E38B 1MBMA 3BTWE 2ZIQH 1AE8H 1G30B 1QB9A 1YPGH 1GHAF 3ELAH 2Y82A 1ETRH 1O37A 4A6LA 1TPPA 1BTUA 1OWJA 3KYFA 3KQ5A 1M9UA 1SQTA 2BY7X 1LQDB 2PLXA 3ZZ7A 2GT7A 3TGIE 4FXGH 2QA9E 1ELVA 2LPRA 1VITH 2Y6TA 6ESTA 3BIUH 5EIYA 4AC9A 1F92A 2H9EH 2NU2E 4BXWA 3S9CA 4KKDA 5PTPA 3T27A 3NXPA 2A4RA 1P2IA 5DO4H 1LKBA 2RDLA 3UTUH 2GCHG 1C5RA 2C90B 2P8OC 1T4VH 2AMPA 3MNSA 3RXTA 1C2DA 4DGJA 2FTLE 2RA0A 1XXDA 1BQYA 3RU4T 1ANEA 1SGYE 1WQSA 3MU5A 1VR1H 1SSXA 1UVTH 2AHME 4WH8A 2SFAA 2V3MA 1CE5A 2G5NA 2FZZA 2BLWA 2KCAA 1YCPH 4HTCH 4SGAE 5ESBA 3SU3A 1EAXA 3QX5H 1TWXB 2ZDAH 1L0ZA 2CN0H 3Q3YA 1HJ8A 4TWWA 1EAWA 4DT7B 2FX6A 1RTFB 4JK6A 1YY3A 4WXVA 4XOJA 2FI5E 1HJ9A 1MCVA 3BG8A 1HAXB 1MZAA 3ZV9A 1RIWB 3WY8A 5IYTA 3BTKE 4TPIZ 3A82A 3VEQB 1P02A 4AFQA 1T8NA 2CJIA 3NKKA 1QRWA 3GY7A 1K2I1 3MH7A 3A86A 1O33A 3VPKA 1GG6B 1LVYA 4HG6A 2QY0B 5E0HA 1BOQA 1N1LA 2VINA 3BTQE 2AEIH 2O8WA 3QLPH 2EY4C 1K21H 1FJSA 3PO1C 5DGJA 4GHTA 5EG4A 2BD9A 1IQJA 1L4DA 2BX3A 1C2EA 2R9PA 1P3CA 2UUJB 3QGNB 4KTSA 1O2YA 2FOFA 1J16A 2OUAA 2ZDVH 1HIAA 2BVRH 3KF2A 4KP0A 2KCYA 3MO9A 2TPIZ 2BVXH 2Z3CA 1MD8A 1XUKA 4NIVA 1GHAG 2ZHFH 1SR5C 4ASUD 2ODYB 2YOLA 3VB6A 1V2VT 3BTFE 4Y6DA 2OLGA 5T3HA 2I6QA 3H7TA 3UOUA 1AB9C 1AI8H 1YCPK 1MTWA 1V2PT 4X1SU 3RXUA 3UQOA 1FNIA 4Q7YA 1P57B 1NS3A 1DSUA 1K1PA 1HAHH 2ZCHP 1C5ZB 3S9AA 4MNXA 1ZSKA 4Q4LA 1O3EA 2A7JA 1KLTA 1K0HA 1FUJA 2GCTC 3TH3H 4B74A 1DWCH 1TE0A 4IC5A 2WPDD 1A5GH 4AB9A 3ZV8A 2RFKC 2J34A 4A7IB 1KXCA 1SOTA 4IMZA 1XXFA 2L74A 3LGYA 1C5MD 4YOIA 3SU4A 2V3OH 4E05H 1AVXA 3ZVFA 5GWZA 5ESTE 4JZDH 1DSTA 3RXDA 4AN7A 3LGVA 1E0FD 3P17H 4AORA 1ZHMA 3AAVA 3MU0A 1SGQE 1Y3VA 4XFQA 4BXSA 2ZFQH 1UVUH 1K22H 2ZDNA 1C2IA 1JWTA 2XW9A 2Q6FA 3M35A 2FOBA 1FIZA 1SKYE 4CRCA 2XBVA 2OC7A 1GHYH 4ZMAH 1Y5AT 1ARBA 3A7VA 3L3TA 2R3YA 4K60A 4CREA 3O8BA 1O32A 1S6LA 3ITIA 3STJA 5EPYA 3ODFA 1N6YA 2BLQA 4XBBA 4MPVA 3FP6E 5E0GA 1AIXH 2AYWA 5FXLA 4AGKA 3BEUA 1UTLM 1AVGH 4FVDA 1CQQA 3V12A 5DP9A 4X8SH 3ODDA 4LZ1H 2EEKA 2H6MA 1G3BA 2HVXA 2QGRA 5C0UA 4X8VH 1O5FH 5GPIB 4X0WU 1DITH 1JIRA 1E35B 1EAUA 3SYJA 1HFDA 2BY5X 3W1EA 1AWHB 2FOMB 1GHWH 4I8HA 1O3MA 2XRCA 3MQKC 3MU1A 3RXFA 1PJPA 2ZFPH 3I78A 2GVFA 3SHAH 1MABB 5T6FA 4INLA 4LZ4B 1SGFA 2P3TB 3K2UA 4WXIA 1GBMA 2BDAA 1ABIH 1KLJH 2BDCA 1O3AA 1GI1A 3TH4H 1FY8E 2F9OA 1WCZA 2ZU2A 2SGDE 3KYGA 1ANDA 1GBJA 4ISOA 5FAHA 5DP5A 1ELTA 4Y7BA 1BTPA 3RM2H 1HCGA 1C5XB 1ZTLA 1AKSA 1BTWA 1ABJH 5EGMA 4ZKOU 1RRKA 1A1RA 1BMNH 3AK5A 2A4QA 5HYOA 1VKYA 4AFZA 1GG6C 2BY6X 4OS4A 1YCPM 2J92A 3PV4A 4MG3A 3Q3XA 4NWLA 1ZRKA 2XTTB 2FESH 1C1VH 1NRNH 2ODPA 4JZ1A 5C1YA 1ELBA 1S0RA 2BD2A 3M3VA 4BNRA 1EP6A 2AERH 3BEFB 3ZZ8A 1C2LA 3PRDA 4U01A 2GZ9A 3S7KB 1C2MA 3RMMH 2KAIB 1THSH 1OP8A 3M3TA 1MKWH 1E37B 2BHGA 2QF4A 3A81A 1UVSH 2TGAA 1VCPA 5FBIA 2D2DA 1O2ZA 1FDPA 5H4IB 1ZMNA 3R3GB 1FN8A 2FOEA 3F2FA 1EOLA 1C5TA 1SGIB 4IS5A 1O3IA 1GL1A 2HNTF 3BSQA 4GHQA 1D6RA 2VH6A 1CA0C 4B6FA 1UTNA 3P8NA 1G2MA 4X6OA 7LPRA 2FLBH 4FUFA 4JMYA 1E34B 1FMGA 2LNCA 5L2YH 4UFEH 1G3DA 1ZMLA 1UW7A 1SL3A 2XWBI 1TGBA 1ZSJA 1HAZB 2FMJA 1MAXA 1NU7B 1JRSA 1XVMA 3V3MA 3FANA 3MH5A 5E2PA 4Q2KA 1GI8B 2CGAA 3EAJA 4WMDA 1BJUA 4YESB 2FI3E 3UWIA 2XBYA 2OXSA 3DUXH 1BTHH 1Z71A 2FLRH 1YLNA 1KSNA 1LCYA 1W0YH 3TITA 2XOKD 4D76A 2QE7D 2PR3A 4O03A 5HIYA 3E6PH 1QA0A 2KX4A 2SGAA 1DY8A 2ZZUH 2IJOB 1SVPA 1K1IA 1GJCB 1TRNA 1DS2E 1HXFH 3MNBA 1IHSH 1MKWK 3HKJB 1G2LA 2D8WA 5HM9A 5DG6A 2VBCA 1MU6B 1K1LA 1QJ6B 1O2NA 4I7YH 1C2KA 4FUIA 2WPMS 1HAOH 2QYIA 4NGAH 1O3JA 2VIQA 2IN2A 1YM0A 3UR6A 1EZSC 3BTTE 3CP7A 1J8AA 1O2XA 3PRBA 1GBFA 3PV5A 4UE7H 5GDSH 2ZCKP 1AO5A 3RXJA 1HLTH 2AFQB 2XBWA 2VWLA 2Z9LA 3UIRA 3HKIB 2D1JA 4AB8A 3EA9A 3TH2H 3OY6U 2ZGJA 2B9LA 1DT2A 5C67A 3FP8E 1J14A 3N7EA 4Y0ZE 3FVFB 1O3KA 5GXPA 4MNWA 2Q6DA 3U98H 5K0HA 2JIZD 3CS7A 2ODQA 1LHCH 3LDXH 3SU6A 1FONA 5HGGA 3P92A 4ZXYH 5CHBA 3SN8A 3T62A 5EJ1A 2ZWLH 3OEED 3GCOA 4AFSA 5F8TA 1ARCA 1EOJA 4LOYH 1BTYA 5E8EH 3BTEE 1O2JA 3V7TA 1SGNE 1VZQH 4NSVA 3LOXA 4OM9A 3SNBA 3EYDA 3EQ0H 1C9TA 1NC6A 1DPOA 1T8MA 3E1XB 3TPIZ 1PQ8A 1W2KH 3UQVA 3MTYA 4X6MA 3S69A 2CXVA 2UUFB 3MFJA 1S83A 4KTCA 4IC6A 1Y8TA 4Z0KA 5EQQA 3GYLB 5F6MA 1G3CA 1EFRD 4PROA 3ZZBA 3RMNH 1SGCA 1LDTT 2VVCA 4O9VA 2VJ1A 8GCHF 4R0IA 5EXMA 1XUJA 1Z6EA 4YLUA 2GZ7A 2Z9GA 1J15A 1TGNA 2R2MB 1MBQA 4YOGA 1BUIA 4BAQB 1MMJN 1GI4A 3TNSA 5LPRA 3KQEA 2ZG0H 1GJ8B 3ZYEA 4DY7B 3RXGA 1O3LA 1YPLH 3PMJA 1GDUA 1BITA 1T4UH 2M2AA 2ZGXH 4FVBA 1RXPA 3BTME 1GJ6A 2XXLA 1A3BH 1CBWC 3RXOA 1S82A 1WBGB 3URDA 1CHOF 3ZVAA 4LK4A 1P03A 5DJ7A 4A92A 4B2AA 2G4UA 1C5YB 1YPJH 1GJBB 3B9FH 5E0JA 3A7YA 3B23B 1V2RT 1TIOA 3BEIB 3SU1A 4OS7A 3FKSD 3CENA 1KTTB 1S6FA 3KGPA 1LPZB 2A45B 3B8JA 2ZKSA 1F0TA 1WUNH 4X6PA 3TGKE 1C2JA 1GVZA 1QR3E 1ETTH 3MOCA 1UJ1A 3LC5A 2ULLA 3TK6A 1LVBA 4GCHF 4X6NA 2GKVE 3TNTA 1A4WH 3PLBA 2ZHQH 1YPHE 1SGTA 3WWFA 1CA8B 1BDAA 1AB9B 1AZ8A 3BTGE 4TSFD 1CGIE 2BDGA 4AG2A 1V2KT 1G36A 2K1QA 1LPGB 1QBOA 1V2LT 4H6TA 3ZYDA 1GCDA 3WW7A 3KNXA 1C9PA 1SQOA 2JJ1D 4DCDA 1L1GA 3U9AH 4Y8ZA 3RXEA 3M5OA 3UREA 1P09A 3F9FA 2WV5A 2R0LA 2QXJA 3QTVH 2VWMA 1UTOA 1OS8A 2ZFFH 1QZ8A 1GVKB 2STAE 5FL7D 4DJZB 1W7GH 2QN5T 2PUXB 3KHVA 4XBDA 1BB0B 1S81A 1YF4A 3SBKA 3MNCA 2F9BH 1TMTH 4DG4A 1O2VA 1P01A 1C4V2 1P9UA 2WUBA 2B8OH 2F91A 2QC2A 4D8NA 1OWKA 2XNDD 2Y5FA 2HNTE 1ZPBA 3BTDE 1PYTC 2ZGCA 2SNVA 3AVZA 1X7AC 1GWAA 1P05A 1CU1A 1GMHF 1TPAE 3UAIC 2FTMA 1VJAU 2BZAA 4B1TA 1GGDB 1QA7A 1CHOG 1XVOA 3MNXA 4RI0A 2J98B 3RUOA 3E0PB 1P04A 2ZDMA 3ATWA 2RA3A 4NSYA 1NBMD 3SW2B 1C1QA 1XUFA 4WMEA 1QRXA 3ZZDA 3RXPA 3OSYA 3OYPA 4Q63A 1A5HA 1ZPCA 2NWNA 4MQAA 1RFNA 2AS9A 5HMAA 4Y76A 1YPHC 2WPHS 4NA9H 2PV9B 2TRMA 1E36B 4MNYA 2A7CA 2KCPA 2FOAA 1EJMA 1TBQH 1GBCA 1Y5BT 3A84A 4I31A 1C1PA 1FAXA 1SBWA 2OQUA 3LJJA 4FETA 3UWJH 3ZZ3A 4B75A 4DURA 3SORA 1BBRK 3ENSB 4GCHG 4YZUA 1EZQA 2WHXA 1Y3XA 1NY22 2H5CA 1BJVA 4SGBE 3MO6A 3F2GA 1XKBC 3SNAA 1DWEH 1SFQB 2ILNA 2JETB 3HK6B 3AAUA 1S0QA 5EQSA 1HUTH 2F9NA 3PWBA 1IQEA 1C2HA 1HAVA 2QF0A 2BB4A 5A0AE 4MVNA 2XNIA 3AW0A 2AH4X 1MKXH 1HV7A 4ZCNA 2L6OA 3LGIA 1TQ7B 1O2RA 3L6PA 2ANYA 1GI2A 3LU9B 3SU5A 3EA8A 1MCTA 4B76A 2HNTC 3FZZA 4JZIA 1W0KD 4RKJB 1P2NA 1CHGA 2EC9H 3RMLH 1IQHA 1XMNB 1ZZZA 1DX5M 1PPHE 2TBSA 1H4WA 2ZQ2A 4FOUC 1NROH 8KME2 1FAKH 4O97A 1PQ7A 3M5MA 5JBCS 2H9HA 4UD9H 2NU1E 4AFUA 5GCHF 2WYGA 1P11E 3QDZB 3HGPA 1SI5H 4H6SB 3RXIA 4I8GA 4WF8A 5GIBA 1O2QA 4JYTA 4DW2U 4IGDA 5KEDA 2HPQH 4UFGH 2W5EA 2ZF0H 1GMHG 1F7ZA 2OQ5A 1COWD 1G32B 1J9CH 1JIMA 1GHVH 2G81E 4Y79A 2LP6A 2BD5A 1L2EA 3TU7H 2HRVA 2FP7B 2W7UA 3IITA 2VWNA 4A1VA 1QL7A 2OBQA 5FPTA 3JZ2B 1V2UT 4X8TH 5DSFA 1AU8A 1CA0B 3Q76A 1QJ1B 4RSPA 4A1XA 1BRUP 4AZ2B 2W6ID 2FDAA 2PFEA 1KXEA 3FO8D 3RXRA 2ZPSA 2BYAX 1Q31A 2BD8A 1CSOE 1D6WA 5EJLA 5FX5A 3D62A 4YT6H 5C1XA 1HAPH 2F83A 1MTUA 1KXBA 5GNDA 1U6QA 3VB3A 1THPB 4BOHA 3T28A 2AGGX 4H42U 2O8MA 1P12E 2GP9B 1ZMJA 3LH3A 4AG1A 5C3NA 3SUFA 3SI3H 3UB0A 1DUAA 1DWBH 2O9QA 4Y8XA 2A5KA 1V2TT 3I77A 4K69A 1GJAB 3URCA 1EP5A 2OBOA 2Y7XA 2JKHA 1LQEA 1RS0A 1CGJE 2ZDLA 1T32A 1QY6A 4OS1A 2PWXA 5AVDA 4WJG2 3PLPA 4NA8A 5FCRA 1HAIH 5HKKD 1ZJKA 3N99A 2BDBA 4I8LA 3VB4A 2JH5D 1GGDC 3VB7A 8LPRA 1AUTC 2FXRA 4CHAB 2A7HA 2NU3E 3NCLA 1WDIA 1XUHA 1F5KU 2OC0A 5LGOA 5B6LA 3SJOA 4D7GA 4P00A 5L30H 1Z6JH 1OX1A 2WINI 4AYYB 1TYNA 2VH0A 1FV9A 1TAWA 1GJ4H 4U32A 2BLVA 2K8IA 1O30A 1NRQH 1SHYA 2H5DA 1LHEH 3SJ8A 4M7GA 3SI4H 1INCA 1C1TA 2Q1JA 1YKTA 1DOJA 5GCHG 2HOBA 1K1OA 3KCGH 4UFFH
chains in the Genus database with same CATH topology
2CF9H 5C1UA 1C5OH 1BCUH 2CHAB 2GDDA 5I25A 3M36A 3RXVA 3RDZA 2FO9A 1ELFA 1UK4A 3HK3B 1PPEE 2CV3A 1YLCA 1QRZA 3DHKH 4KGAA 1NPMA 2J95A 1JRTA 1TRYA 3LKWA 1TNKA 1S5SA 3ZZAA 1PPGE 4YT7H 3P95A 2F9UA 2JETC 2G4TA 3NUMA 1ZTJA 5K7RA 1WQVH 2A0QB 2ANMH 2PGBB 2V3HH 1S84A 2R3UA 3TGJE 2V0BA 1DLEA 4NWKA 1YPKH 3E8LA 4NIWA 4IN2A 2VIOA 3LPRA 1FPHH 1O2WA 1OWDA 1UK2A 1LHFH 2SGEE 4MPWA 4AYVB 4Y8YA 1QB1A 1P06A 4ABEA 5JB9S 1HXEH 5AFZH 2A2QH 3DA9B 3RXKA 1BTXA 1TRMA 4K8BA 4Q80A 5GJ4B 3VXEH 1HIAB 1KDQA 1FY3A 3D65E 4D9RA 1XM1A 3RU4D 2A4OA 2Y5HA 2ZU5A 3MU4A 1J17T 4X2XA 5JYIA 3U1JB 3STIA 1B5GH 2DUCA 1MTNC 1FXYA 4UDWH 3H7OA 3RXHA 4ASHA 5IDKA 3SJKA 2H1UA 2C8XB 1TPOA 2STBE 4ZH8A 1DFPA 1GDNA 3ZVDA 1UTMA 1FPCH 2A1DB 2QAAA 1SGEE 2THFB 4A1TA 3U8OH 5JB8S 1CBWB 1O2LA 2XBXA 3T5FH 1A0JA 3ZVBA 2C93B 3FZDA 1TNHA 1TNJA 2HLCA 1C1MA 3GYMA 5AF9H 1GMDF 2P3UB 2VIWA 2XC0A 1O5CB 1AHTH 1UTKA 3E0NB 1WU1A 3EA7A 5DP4A 1ELDE 2QXGA 1BT7A 1QURH 4X1RU 4CRAA 1EQ9A 4BTTB 1ANBA 3SUEA 1Q3XA 2G00A 1F0UA 8ESTE 1TQ0B 1WYKA 3I29A 4ABIA 4FUGA 4CR9A 1SGFG 2C8WB 2PKAA 4JK5A 4K1SA 1Z7KA 3GY5A 1UTQA 2ZDKA 1WSSH 4HFPB 1GI6A 1ZSLA 2Z9JA 3SO3A 3LT3A 1DM4B 1GBAA 3FP7E 3E91A 2BXTH 4XBCA 4DIHH 3KIDU 1GJDB 1V3XA 3VGCB 4CR5A 3ZZ6A 1ACBE 1GBTA 1DXPA 1P3EA 3ZZ4A 2O8LA 1C2FA 3RC5A 3K6ZA 1IOEA 3MH4A 3RXCA 1LPKB 5C2ZA 4CHAC 5HM2A 1RGQA 1DVAH 1G37A 3ESTA 1PPZA 2BQWB 1FLEE 3P6ZB 5FCKA 2AMQA 1TA2A 1AVWA 3IWMA 3GCTF 3MH6A 1ZHRA 2H9TH 5A8YA 3MWIU 1CT0E 1LHDH 2B0FA 1NFWA 5DP3A 1K9OE 1OPHB 2XCNA 3DD2H 1GI0A 5TJXA 3TIUA 1Z8RA 1IQMA 3KEEA 2CHAC 4FU8A 5DKMA 4CBNA 5L6NH 3P8FA 5LH8A 3KQCA 1UHBA 9LPRA 2W7SA 1LKAA 4FU7A 2ZCLP 4NZLA 1GI9B 3SHCH 1SLXB 1HAGE 1N8OB 3M7TA 2IOTA 1GMCF 1W14U 3DFLA 2QXHA 1F0RA 1XUIA 1CT2E 1EKBB 1ZGVA 3ZZCA 3SNCA 5BRRE 1DY9A 3SV9A 2UWPA 5F03A 4D9QA 2YNBA 1AKSB 1O2UA 1NRRH 3LGTA 2FWWA 4UEHH 4GPGA 3RC6A 1GMDG 2PSYA 2ZGBH 1FY4A 4FUEA 1O3BA 4ABJA 2PSXA 5A8XA 3RMOH 2OINA 4BAMB 2J9NA 4TYDA 2PKSB 3Q3KA 1GHBF 1JXPA 1YC0A 2UUKB 3GY3A 2WUCA 3BG4C 2J38A 1IQFA 4ZXXH 3V0XA 1YPEH 1O3OA 3RXQA 1NZQH 3A7WA 1C5SA 2FIRH 3LJOA 1HB0B 3NZIA 5AFYH 3E90B 3UUZA 1GCTB 1TX6A 2VIVA 2BZ6H 2P3FH 3S7HB 1GI3A 3TJUA 1NFXA 2GT8A 2AIQA 1NRPH 3UNQA 1P9SA 6GCHF 1SGPE 1DWDH 3PMAB 1EZXC 1F5RA 1L1NA 2XWAA 1ZR0A 3SV7A 2VNTA 1FQ3A 1OYTH 4WMFA 1YLDA 5JBAS 2FM2A 1QTFA 1IAUA 4XDEA 1DICA 1O3HA 1QNJA 2ZU4A 3A88A 4WY3A 5CE1A 4XSKU 1NM6A 2BQ7B 1AY6H 3RU4E 5LPFA 1C1OA 1IQGA 1XKAC 1ESTA 3GCHB 1EB1H 3UNRA 2BDYA 1QCPA 4J1YA 1QQUA 2ANWA 3OX7U 1O2IA 1AD8H 1C2GA 1BIOA 2OD3B 3F9EA 4K8YA 4ZAEA 3SGQE 5JBTA 1QL9A 2HGTH 3A7ZA 4FUJA 4K5ZA 3V13A 1JOUB 4KELA 1HRTH 1UK3A 2A4GA 2SGQE 4LXBH 1V2QT 2Y5GA 2ZI2H 1SG8B 3TJOA 4E06H 3HATH 2G51A 4THNH 1O2MA 1DLKB 4X1NU 1A61H 3O8RA 1C5NH 5SGAE 1A0LA 1O2PA 1C1NA 4AOQA 5A09A 3UR9A 3BF6H 5B6OA 1EJNA 3VGCC 1QJ7B 1ZLRA 2QV1A 1OP0A 2Z6BD 2Z7FE 2BXUH 1VJ9U 4Z6AH 3SGBE 1AZZA 2QF3A 1F5LA 1C1WH 1ELAA 4ISLA 3D49H 1BTZA 3SNEA 2O8TA 1ESAA 2A5AA 3SJIA 4ZHAA 3PLKA 3M5NA 1HNEE 1GHBG 3PMHB 3A8AA 1PPFE 3PMBB 1DDJA 1ZPZA 3RP2A 4CRBA 3A80A 1HPGA 1SPJA 1EX3A 1FI8A 2ZHDA 1AFQB 1C5QA 2O8UA 3DT0H 2Y7ZA 4CRDA 3L33A 1SOZA 1C5UA 8GCHG 2WPKS 3TVJB 1H9HE 1UVOA 4Y10E 2J4IA 1ID5H 6GCHG 5A0BA 1QB6A 1Z1JA 1UTJA 4K1EA 4K1TA 5TCAA 1WTGH 3JZ1B 1VGCC 2FOHA 2ZQ1A 3UPEA 1TMBH 1N8OC 4RKOB 4YM9A 7GCHF 1O2KA 1GJ9B 2R2WU 1AN1E 1WOFA 2P95A 2OTVA 4NG9H 4BAOB 4HGCA 3S9BA 1THRH 1O3CA 4GLYA 1MUEB 1MQ5A 6LPRA 1A3EH 2VB0A 1BRBE 1NFUA 1K1JA 1V2WT 2SGPE 3A83A 4JZFH 1C4U2 1H9LB 1Z8IB 1L4ZA 4AX9H 1L1JA 2PKSC 3EDXB 3P8OA 1D3PB 3NK8A 6CHAC 1OOKB 1FN6A 3PYHA 1IQIA 1G9IE 1HAYB 1GHXH 1O2TA 1SLUB 1DUEA 3K65B 1ZRBA 1SGDE 1BZXE 2P93A 4B2BA 1HYLA 2FYRA 3EE0B 1O2HA 1O35A 1EPTA 2BMGB 3LH1A 1GCTC 3D23A 3CS0A 1NTPA 4MLFB 2RCEA 3GY2A 1NN6A 2R0KA 3RXAA 1B0FA 5EODA 1GBEA 1GHZA 4ABBA 1GL0E 4FUHA 5EW1H 3KL6A 1MZDA 1Q2WA 1Z1IA 4RN6A 1BMMH 1H8DH 3GISB 1C5VA 1FY1A 4ISNA 2QIQA 2OCVB 1B0EA 2I6SA 2Z94A 3U69H 1ZGIA 1A2CH 2BDIA 1OWEA 3SV8A 3GCHC 2EI8A 1EXFA 4INKA 3MYWA 4ZROA 5FPSA 2HWLB 4ISHH 3ZVEA 1Y5UT 4YOJA 3T29A 4B2CA 3TK9A 5EOKA 2GX4A 2BLOA 2UWOA 1QGFA 2ZTZA 4FUBA 3GCNA 5FX6A 1HGTH 4MPUA 5TCCA 4CH2B 2ZFRH 4GVUA 1ELCA 1JBUH 1GBHA 2ZC9H 1MH0A 1FIWA 1V2JT 5LPEA 3A7TA 1UVPA 2F9VA 2TGPZ 3QUMP 1OP2A 4I32A 5E2OA 2P59A 1MTNB 3HPTB 5L2ZH 1V2OT 2Z9IA 7GCHG 5F8ZA 5CHAB 1VITF 4OGYA 2OC1A 3UY9A 1K1MA 3BV9B 4OGXA 2ZU3A 2GV7A 2ZTYA 4J2YB 3SUDA 1W8BH 1ZHPA 2P94A 3S0NA 1SLVB 1WTHD 1H9IE 4OS6A 4X1PU 5DP6A 1O5AB 2FYQA 1TNGA 5JDUB 3A8DA 2Y81A 2G5VA 5EPNA 3FAOA 5C5OA 4DOQA 3M5LA 2GGVB 4Y7AA 3Q77A 1SQAA 1W7XH 3RXSA 1UCYE 3AASA 1W13U 2A32A 2EI7A 4NZQA 2TGDA 3QZRA 4VGCC 1AFQC 4ZKRU 1F0SA 2P16A 4NIXA 1GBDA 2KAIA 2XC4A 1MKXK 1UMAH 1D9IA 1A5IA 4B73A 1AUJA 3HGNA 1O38A 1WV7H 1W3CA 2EI6A 1LMWB 3F6UH 1QBNA 2OP9A 2H2ZA 1TA6A 1P10A 4ABDA 2FS9A 1T8LA 1KXAA 2YNAA 1TONA 3PTNA 1WAYB 1KY9A 1PFXC 3ATLA 3RXBA 3W95A 3GICB 3SUGA 3Q00A 1OWIA 1TMUH 1O3NA 4ABAA 3SV6A 4UONA 1W0ZU 4DIIH 1Y59T 3FFGA 3SV2H 2BOKA 1HJAC 1EUFA 5AHGH 3W94A 2TIOA 3F9GA 5ETXA 4X1QU 1VCQA 1D3DB 2BY9X 1K1NA 1IQLA 1SLWB 5J4SA 1W12U 1C1SA 3K6YA 2AGEX 3UFAA 3MI4A 1TGCA 2NU4E 5C20A 1EPTB 3EGKH 3UNSA 4JYUH 3KQDA 4A5TS 1NT1A 3TJVA 4GAWA 1MU8B 2V35A 4NA7A 1RD3B 4CH8B 2GDEH 1QBVH 1QL8A 2XYAA 5BPEA 4B71A 2C8ZB 3RM0H 1P8VC 1BMLA 4E7RG 1DE7H 1UO6A 4BAHB 1VITG 3T2NA 3GDUA 1TFXA 3QO6A 3LGUA 2C4FH 3ATIA 3M61U 1HAVB 3QK1A 1LO6A 5T6GA 2HPPH 7KMEH 1XUGA 2G55A 1ELGA 1FY5A 1V2NT 2G52A 3UOPA 3A8CA 1O5DH 1QQ4A 1O0DH 2BD3A 1TPSA 1H8IH 3VXFH 4KTUA 1C5LH 1GPZA 1HBTH 2PUQH 5JPMH 4Y0YE 2ALPA 2AGIX 1P2QA 3MU8A 1ETSH 2DE9A 4HI3A 2PTCE 2RG3A 1TX8A 2ZTXA 2FS8A 2J94A 3BG4B 5CMXH 1O2OA 3U8RH 4ISIH 4WVPE 1SMFE 3C27B 1W10U 2BM2A 4X8UH 5I46H 1W11U 1TGSZ 2ZHWH 1AMHA 2G8TA 2OC8A 2GV6A 2VVUA 2Z3EA 3BIVH 4MTBA 3A89A 2W3IA 4WWYA 1HDTH 1RIWC 1EJAA 1MQ6A 1GJ5H 2DE8A 2Z3DA 2BQ6B 4O3TA 5DJ7A 2A2XH 3SU0A 3O8DA 2BY8X 2AMDA 3ZVCA 3F68H 1TLDA 3RLWH 4JCNA 3DFJA 5HXFA 5J4QA 3A85A 4XE4A 1AFEH 1GDQA 1GI7B 5CHAC 2GD4B 2ESTE 1BMAA 2ALVA 4YTAA 1BRAA 5FBEA 3ZZ5A 1KTSB 2W3KA 1TNIA 5C5NA 2Z9KA 2WYJA 1C1UH 1GBLA 1LTOA 4D7FA 2V6NA 3ATMA 3E16B 2VVVA 1P2OA 1V2ST 2UWLA 1PYTD 2SNWA 4GSOA 4HZHA 1NFYA 4TWYA 1G3EA 4ABGA 4OS5A 1T7CA 3P8GA 4Y71A 1MAYA 3TJNA 4IMQA 1GBIA 2FOGA 1NRSH 2PHBA 3QN7A 1IQNA 1O2SA 4Y11E 3E3TA 2FPZA 3SU2A 2ANKH 3RC4A 1Y3WA 1YP9A 1O3FA 1NU9A 3PTBA 5A2MH 4IW4E 1GVLA 3VFEA 3MMGA 3C1KA 1BBRE 1XX9A 3AW1A 1EZUC 3IG6B 1T8OA 4FU9A 1TABE 4DVAU 1EASA 1P2KA 1C5WB 2VWOA 1C1RA 4X2VA 4ZHLU 1O31A 1C4Y2 2FOCA 3MO3A 1OKXA 1N6XA 1H1BA 2WPIS 3SJ9A 1ANCA 3A87A 3M37A 1YBWA 2ZFSA 5FHTA 2GZ8A 1ZYOA 4QT8C 4IBLH 3PM3A 1O5BB 3QTOH 1PQAA 4U30A 2GMTB 1DANH 2B7DH 4O3UA 1LVOA 1EPTC 1TGTA 1UCYH 3GY4A 4FUCA 1TX7A 1B7XB 3F1SB 1TBZH 4I8KA 2HALA 2PGQB 3BTHE 1RJXB 5DPAA 1KYNA 2GTBA 4CRGA 5DK1A 1BHXF 1TOMH 1CVWH 2XCFA 1O39A 3SQHE 4FUDA 3G01A 1T31A 4CRFA 1CGHA 1O34A 2BD4A 1VGCB 1F2SE 2F3CE 4ABHA 3QZQA 1Z8JB 4F4OC 2Y80A 1TALA 1NESE 2FX4A 2W26A 2ZP0H 3ZVGA 1OXGA 4BAKB 3P70B 1C5PA 1S6HA 3GDVA 5A8ZA 4K3JA 2ZPQA 5F8XA 2ZPRA 1LVMA 2BX4A 4X2WA 2A31A 7ESTE 4Q7XA 4ABFA 2VGCB 1EB2A 1EAIA 1ORFA 1BA8B 3NPSA 2BDHA 1OYQA 3GY6A 1KDQB 1O5EH 4UFDH 6CHAB 1Y3YA 3M7QA 4TY7A 5EU8A 4JZEH 1KLIH 4R8TB 1IHTH 2WPJS 3OY5U 4GUXA 4MDSA 1GBBA 2ZA5A 2B5TB 3KN2A 1A0HB 3O8CA 1ESBA 1UCYK 3PROA 1MTVA 3LONA 3TK5A 3F9HA 1SB1H 2BD7A 4U2WA 4NFFA 2ZECA 1SC8U 3QGJA 3H5CB 3U8TH 2P8OB 2JH6D 3KQBA 1KXDA 1GJ7B 4MPXA 3ZZ9A 2IPHA 3RXMA 2TGTA 1RTKA 2NU0E 5FPYA 1IQKA 5EQRA 1D3QB 1EATA 3M3SA 1KXFA 4ZHMU 4OS2A 3SNDA 2BTCE 2BOHB 2VIPA 1TB6H 1ZJDA 2PW8H 1SHHB 1KIGH 5EXLA 3RXLA 1D4PB 2QXIA 4MNVA 1O3DA 3PWCA 1OSSA 1TBRH 1TOCB 2SGFE 4YLQH 2ZU1A 2PTNA 3GCTG 3SOSA 2ZGHA 1BRCE 2PKAB 1P2JA 1V6DA 1YPMH 1MD7A 1Y3UA 2ASUB 2FI4E 2XC5A 4TPYA 3OU0A 1LHGH 1V2MT 3SQEE 1O3GA 4F49A 5A0CA 1TNLA 4BTIB 4E7NA 2D26C 3A8BA 3ATKA 2WPLS 3N7OA 1PQ5A 1RTLA 2Q6GA 1YGCH 4ZKNU 4AGJA 3T25A 1D3TB 1O5GH 3SGAE 3LC3A 1AGJA 3PB1E 3TLOA 1YYY1 3QWCH 3M7UA 4NFEA 1A7SA 1GMCG 2C8YB 3GOVB 2GCHF