1SGDE

Asp 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgdE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgdE01
2XXLA 2ESTE 5DP3A 4NFEA 3E0NB 1HAOH 3LGIA 4ZXYH 1S5SA 4XDEA 8GCHG 1RTLA 5DP9A 1OS8A 2Q6FA 1PQ7A 3SV6A 4JMYA 1SB1H 3SGAE 2F9NA 1TLDA 1BOQA 1O2VA 4UEHH 4FUBA 1ZJKA 1EJAA 3STIA 3I78A 2VVVA 5C1YA 2G51A 1O2ZA 1P2KA 2ODQA 3W94A 3T25A 1FZZA 1TBZH 2C8ZB 5C1XA 3A7ZA 1P03A 5EXLA 2ZGJA 3TK9A 1P02A 4D8NA 5F8XA 5AHGH 2F83A 2PTCE 2ZFQH 3RXCA 2FOGA 8LPRA 5F03A 4ABFA 4XBBA 3RXQA 3KHVA 1D9IA 1O5BB 3LGUA 5HM2A 3MH5A 1E35B 3GY6A 1QFKH 1Z8GA 1BITA 3ZZ8A 1QNJA 1J17T 1GMDG 4GSOA 2K1QA 2O8WA 3F9GA 2ZDNA 1FPHH 5EU8A 1K1MA 3FVFB 2EC9H 4AFZA 1VJ9U 1RTKA 2AMDA 2ZF0H 2VNTA 2ZGHA 7LPRA 5DPAA 1E36B 1EAXA 1C2DA 1YPHC 1P9SA 2Y5GA 3EDXB 4NCYA 3SJKA 1CT0E 2ZDMA 3SOSA 5E8EH 1A46H 2ZEBA 1H9IE 2Z9LA 1IQKA 3CS0A 3ENSB 1SPJA 3RXKA 1THRH 5I46H 4VGCC 1LVYA 1V2MT 6LPRA 2ANWA 1Y3YA 1SHHB 4Y79A 3M5LA 1P2OA 4ISNA 4WMEA 1Y5AT 2G55A 1ARBA 2VVUA 2C8YB 4AZ2B 1CO7E 4X6PA 4YZUA 3MFJA 1GJ9B 1SLXB 1QRXA 1TQ7B 3SNCA 1VJAU 1LQDB 8KME2 1A61H 1HAIH 5T6FA 4BAQB 5E2PA 2GT7A 5ESTE 2EA3A 4MNXA 2ZU5A 2FP7B 4CH2B 5C67A 3SQEE 1UK3A 1SVPA 1Z7KA 3SUDA 1ELGA 1O2WA 2ZU1A 1P06A 1RTFB 1KXDA 3F9HA 2H5DA 2PUQH 1CBWC 1ZPBA 4ZROA 3RXAA 1BTUA 1ZGIA 4X1NU 2ZGCA 1EUFA 4Q2KA 1G3DA 2IJOB 1OYTH 3V3MA 3D62A 4LZ1H 3FAOA 3QTOH 2TGPZ 4HGCA 1Z6JH 3S9BA 1A5GH 3ZV9A 3RMOH 1BTWA 4YO9A 2CGAA 4IC6A 2NU0E 4X8UH 5ETXA 1C5ZB 2BMGB 3BF6H 1EX3A 3UFAA 4MG3A 1WBGB 4D7GA 1TMTH 2XC0A 2A7CA 1O2IA 1GI5A 5SGAE 2WV4A 1DDJA 1V6DA 1E38B 2AEIH 2R0KA 6CHAB 5I25A 1IQIA 4D7FA 4AFSA 1Y8TA 1O5FH 1NS3A 3TNTA 4GCHG 3KNXA 2PSYA 1BZXE 2W5EA 3M5OA 1BB0B 2PLXA 2ZZUH 1Y5BT 3M36A 3MI4A 3QWCH 3STJA 1FMGA 1PPGE 2A5IA 4BOHA 1GJ4H 2P16A 4K2YA 3LH1A 2UWOA 3U8TH 1N1LA 8ESTE 4AFUA 3RXOA 3UREA 1F92A 5JBCS 4IW4E 1A0HB 2SGQE 1W7GH 4CRGA 1PPHE 3BEFB 4I33A 3MNXA 2VIOA 3EYDA 1GCDA 3M3TA 1XKAC 1O3KA 1UCYE 1JBUH 1BDAA 3LGVA 1J14A 2Z94A 1GMHG 4JYTA 2J95A 2GTBA 1UCYK 1O5GH 1FXYA 1O2MA 3LC3A 3PLKA 3TVJB 4B2AA 5A2MH 1C1UH 1QL9A 4TPIZ 4GPGA 4ABAA 2PHBA 3QO6A 1LHGH 2NU3E 5ABWA 3KCGH 1E0FD 3Q00A 3RMLH 2Z3DA 1G3EA 1V2KT 1C5PA 3M37A 1HAVB 1GMCF 3B9FH 2IOTA 3MU8A 3ZVGA 3DHKH 1O2OA 1QGFA 1DWBH 5E0HA 3H5CB 1C2HA 3DFJA 1YKTA 2VIWA 4DG4A 3A80A 1DX5M 2SGFE 1O2QA 1BA8B 4UFEH 2XYAA 4F49A 3OY5U 4UDWH 3PB1E 2ZGBH 4AG1A 1CA0C 7GCHG 1YCPK 1C1PA 1CT4E 1QRZA 2VIVA 4Y8XA 2O8MA 1C5SA 1GI6A 2ZCHP 2ZNKH 3T26A 5GCHF 2UUKB 1H8DH 3GDSA 1ELEE 1CHGA 1DM4B 2A0QB 3EA7A 1YPLH 2JKHA 1N8OC 2XWAA 2ZHQH 3SUEA 1DWEH 2Z3EA 3FANA 4R8TB 2AGEX 4DURA 2PW8H 1O38A 1G37A 2I6SA 1S6HA 3VB3A 2F3CE 3RU4T 1O2RA 4RKOB 5FHTA 2BDGA 3E1XB 5JPMH 2G4TA 1K1IA 1GJDB 1O2PA 2SFAA 2ZDKA 3VB6A 1WTGH 2C8XB 3ESTA 3T29A 4MTBA 1NFWA 1FY1A 1OP8A 1ESBA 2A5AA 3KQCA 2V6NA 1Y3UA 2RA3A 3LGTA 3UOUA 3SN8A 2GGVB 2JH5D 2QN5T 4X2VA 2GKVE 1QTFA 2WPIS 1MAXA 4BXWA 4VGCB 3Q3KA 3ZZ9A 2FYQA 1GDQA 1GGDC 2YNAA 4RSPA 5GDSH 2ZPRA 3PMHB 4O3TA 4IN2A 1J8AA 4B2BA 4JYVH 1QB6A 1S6FA 2ZU3A 3PMBB 4X1RU 8GCHF 1NROH 5HMAA 3L3TA 3HK6B 2I6QA 2B5TB 2FOBA 2QA9E 2PGQB 2ZP0H 1GBBA 1OWEA 2FTLE 3TJOA 1T8MA 2F9VA 1YPJH 1P01A 1P12E 1O3JA 1TWXB 1XVOA 3MNSA 4TWYA 1G32B 3KGPA 2AMQA 1WU1A 1LVBA 3SV9A 1CBWB 5K7RA 1Y3WA 5EW1H 1QQ4A 3RXLA 1O3CA 1A5IA 2ZQ1A 4JCNA 3I29A 1V2LT 2O8LA 1GMDF 4B75A 1JOUB 1OKXA 3B8JA 3ODFA 1NN6A 5FPSA 3BIVH 2BTCE 4XBCA 2ALVA 2BXTH 2P94A 1DWCH 3BTME 5EGMA 1GBJA 1BUIA 3A83A 2QYIA 1P2JA 1V2QT 3ZZCA 2YNBA 2BD3A 3MO6A 3T27A 4Y7BA 1BMNH 3PM3A 1SGQE 1KXAA 3TITA 1Q31A 1TX7A 3TGIE 4OS1A 3RMNH 1G30B 1AVWA 1SQAA 1DXPA 1O3NA 6ESTA 2O8UA 1AIXH 1EP5A 2SGAA 1GPZA 1O2JA 4NG9H 2H9EH 3RXPA 1PQ5A 2HNTE 1TRYA 1EZSC 2J92A 3M7TA 2SGPE 4Y7AA 1GHBG 1NTPA 2Q6GA 1C5UA 2NU2E 3KQBA 4NFFA 3BEUA 5DP6A 4AFQA 3R3GB 1O3EA 2P93A 2BB4A 4CRCA 3O8CA 4ABDA 3BTEE 3C1KA 1SOTA 1DT2A 1GJAB 7KMEH 1SGFG 3MNCA 4X6NA 3SV8A 2AFQB 1GJ6A 3RXUA 4WJG2 4JK6A 3BTKE 3SV2H 4Y6DA 3OYPA 2BDHA 3SU4A 1BRBE 4FUCA 1TE0A 4BTUB 2J38A 3T28A 2XBWA 2C93B 4AN7A 1XKBC 2BQWB 1O3PB 4FUJA 1X7AC 2PFEA 4K1EA 3KIDU 3GDVA 4ZKSU 3SNDA 3GY4A 1TPPA 1OOKB 5DKMA 1WUNH 4AYYB 4JZEH 4KTUA 4OS5A 3UNQA 3SU6A 4Y8ZA 1UMAH 2H9HA 3UTUH 1O37A 1LHEH 1GHWH 1KXCA 1V2PT 1RXPA 1GBTA 2PKAA 3HKIB 1O3GA 3T5FH 2GCTC 2ZFRH 1LHDH 1UVOA 1Z1JA 4BXSA 2VH0A 1TIOA 2QIQA 4GUXA 4RKJB 1YP9A 2FYRA 2PSXA 1EOJA 2OD3B 4FUDA 1XUHA 3ELAH 1T8NA 2UWPA 5GPIB 2GV6A 1AWFH 1OWDA 1SC8U 2WYGA 5A09A 4SGBE 2V3OH 1ZR0A 4WMFA 2W7SA 2FS8A 3ZVAA 3TK5A 1O2NA 1DPOA 1SLVB 1L1JA 2GZ7A 4BTTB 3LH3A 2V35A 3EE0B 1F5RA 1QB9A 1RIWC 1TPOA 3EQ0H 2XTTB 3SU0A 2QF0A 3SU1A 1YM0A 4ZAEA 1NT1A 2OXSA 2G81E 3PO1C 4WF8A 1FUJA 4JK5A 1UTQA 3A86A 3ZYEA 1GI0A 3LONA 4E05H 2ZU4A 2FO9A 1O3BA 4AB9A 1EAIA 2FEQH 1LQEA 2OC7A 3RXSA 1U6QA 5GXPA 5J4QA 2HPQH 4MLFB 1O0DH 1V2JT 1N8OB 2BVSH 4HI3A 1TX8A 1C2JA 1UTNA 1P2MA 2EEKA 3PLPA 1O2SA 3SGBE 2BHGA 4LOYH 4DGJA 5EPYA 1CVWH 1HJ8A 5CE1A 3F1SB 1HUTH 4A92A 1HPGA 4CRAA 1E34B 1GI1A 2IPHA 1HXEH 2C8WB 2CJIA 1SQOA 1NRSH 2VINA 1GHAG 1L4DA 1A0LA 1HJ9A 4UONA 1TOMH 1NFYA 1ZMJA 5HYOA 4CR9A 1BJUA 4K3JA 1AFQC 2QAAA 2BD9A 4SGAE 1ELTA 3U8RH 1GMHF 3K65B 5JB9S 2TGDA 3S9CA 3GY7A 1UO6A 1BMLA 3BV9B 3BSQA 3RXJA 2XC5A 5A0AE 1GJBB 1A7SA 1GVLA 1QL7A 2ANKH 3BN9A 2Z6BD 4NZQA 3S69A 2TGAA 5A8ZA 3GYLB 1YPKH 1GGDB 3MO3A 1BBRH 4A1TA 1TRNA 3F9EA 5HGGA 2EI8A 1NY22 2P3FH 2OQ5A 1EB1H 3MOCA 3BTQE 3HK3B 5C20A 1WYKA 4XBDA 3C27B 3TH3H 1SQTA 1ABJH 1VCWA 4XE4A 3ZZ5A 1AU8A 2B9LA 2G5NA 4K5ZA 1DXWA 1DLEA 4HTCH 5IYTA 3LGYA 1GVZA 2HVXA 1F0RA 3RXVA 2BZAA 4BAOB 2ZDVH 4Y71A 3UOPA 2HOBA 3RXMA 3ZZ4A 1O31A 2HNTC 1O5AB 3E3TA 3IWMA 3DT0H 1L4ZA 3VB7A 1DY8A 1TPSA 1FY4A 1UTOA 1IQHA 1QJ7B 3DA9B 3KN2A 4INKA 1YPMH 2FX6A 3UR9A 1ZGVA 1GVKB 2ZO3H 1QCPA 3SW2B 2F9OA 1HJAB 1P05A 1Y5UT 3ATKA 3QGNB 4YTAA 3W95A 1GJ8B 4X2YA 1EZXC 2ZCKP 2FOHA 1CT2E 1O3IA 1W14U 2ZFFH 1IQGA 3A82A 4X8SH 1DSUA 4A5TS 1HIAB 2PGBB 1NPMA 1W11U 1C1VH 4PROA 1JRTA 1KIGH 3ZZBA 3D65E 2WPHS 1Z1IA 1HXFH 1Q2WA 4UE7H 4AYVB 4I8LA 3GCHC 4NSVA 1JXPA 1NFXA 1S84A 1GDUA 4WWYA 4NIWA 1TALA 3DUXH 1RRKA 1IQJA 1TNKA 1D3DB 3GYMA 3UWJH 5E2OA 3GOVB 3EGKH 5JDUB 2Z9GA 3SNBA 2J4IA 2A31A 2W3KA 4WH6A 2ZFTA 3SU2A 3TH2H 2QXHA 5PTPA 1FI8A 1MTVA 5JBTA 1C5YB 2FZZA 3P17H 1PQAA 1ZRBA 1FY8E 1W10U 1DUEA 4GVUA 5IDKA 3RXHA 3LOXA 1L0ZA 1QY6A 4DCDA 1YLDA 3MYWA 4OGYA 5BPEA 4OS4A 3ZV8A 1ACBE 4M7GA 3ZZ7A 1DSTA 1GJ7B 3RXDA 3RMMH 1W12U 1ZMLA 2G4UA 2XBYA 2AGGX 3L6PA 1CGHA 1K28D 2GCTB 4DVAU 1SBWA 2LPRA 4IMQA 1UVTH 4QT8C 5LGOA 1V2TT 1MKXH 1GBDA 2P3TB 1W7XH 1SGRE 1AB9C 1HNEE 1LO6A 1HAPH 4Z6AH 2OBQA 1J9CH 1ELCA 1C2GA 2CN0H 4Q80A 2KAIA 2ZCLP 3RC4A 1O3FA 1XM1A 2XBXA 2XC4A 1W3CA 1ELAA 1ZHRA 1O2YA 1OP2A 3VXEH 2A4GA 2FX4A 2OINA 3SZNA 3G01A 1TPAE 2AIQA 1OPHB 1ZYOA 4YOIA 2VIDA 5AFZH 1YBWA 4ABJA 3AW1A 1D3QB 1RIWB 1SGYE 1SFIA 4O97A 5LPEA 4NA7A 3SBKA 3PO1B 1O3DA 2TPIZ 1XXDA 4FVDA 2A5KA 3WY8A 2A2QH 1VITH 3RC6A 1GWAA 1XMNB 2BLOA 3A8CA 4X6OA 1GHBF 1T4UH 3A81A 4NWLA 1G9IE 1QBVH 5FPTA 3UNRA 5F8TA 3UQOA 2RG3A 5FBEA 1BTZA 3A8AA 4DT7B 1DUAA 2WYJA 2OP9A 1FAXA 5DK1A 2VWNA 1TYNA 1M9UA 1XUGA 1GI9B 2D26C 4FU7A 4B73A 4H4FA 1D3TB 3PROA 5AFYH 1C5OH 1AFQB 1P2QA 1UJ1A 4JZFH 4WY3A 1SGCA 5DG6A 1QIXB 1KYNA 3MNBA 3FP6E 4F4OC 2NU4E 1C5XB 1K9OE 2VVCA 3D49H 1EJNA 4ISLA 7ESTE 5DP5A 1W13U 1PPFE 1TNGA 4JZDH 2WPLS 3GCTG 1FAKH 3SORA 1AWHB 4Y11E 4FUEA 1OWHA 3RXGA 2C4FH 2R0LA 1MTUA 1VITG 3M35A 1N6YA 4YOGA 4WH8A 2FODA 2W7UA 3JZ2B 2FESH 1OSSA 1EAUA 1ETSH 4HZHA 1TGBA 2A7JA 1TGNA 1YGCH 1YYY1 4CHAC 4ASHA 4U2WA 4NZLA 1OWJA 1S83A 1C2KA 1ETRH 5A0CA 3P92A 3BEIB 3OTJE 3PYHA 2GDDA 1GG6C 1F0TA 5FCKA 4YM9A 1QQUA 2Z9IA 1ZSJA 3NWUA 5FBIA 1BHXF 1MCTA 1P57B 2W26A 1UVPA 3MMGA 3M5NA 3NKKA 4K1TA 1DFPA 3QUMP 3Q3YA 1HBTH 2FS9A 1TRMA 4Y0YE 1C1TA 2FTMA 5TCCA 1EP6A 3AW0A 2TGTA 3Q77A 4TPYA 2ASUB 2A4OA 3MWIU 2FI5E 3VB4A 2F91A 2FDAA 1ELDE 1J16A 3JZ1B 1GHVH 1MD7A 4I7YH 3TJUA 1H8IH 2J9NA 1O2UA 3GCHB 1O3AA 4UFGH 4D76A 2ULLA 1EQ9A 3V0XA 1XUIA 1S0QA 1WV7H 3R0FA 1MQ6A 4MQAA 3SUFA 1TA2A 4JYUH 1C4V2 2IN2A 1NM6A 3SV7A 1TBRH 3P8FA 1BQYA 2H2ZA 2A4QA 2VWLA 1ZOMA 1C1SA 1GI4A 2XCFA 1O3MA 1MCVA 1AN1E 3IG6B 4K60A 4YT7H 1O33A 5J4SA 4YLUA 1ARCA 2FWWA 2H1UA 3F9FA 2WUCA 3RLWH 3Q3XA 1SGIB 4U32A 2AIPA 1TNJA 4CBNA 2BD8A 1AKSA 3TJNA 3MH6A 3P95A 1ESTA 1HLTH 3NK8A 3U1JB 4ZUHA 1QJ6B 4MDSA 4D9QA 3F6UH 2ZFPH 2P95A 2BXUH 2Z7FE 2FI4E 1UCYH 1BJVA 2ZI2H 3SU3A 2DE8A 2PKAB 4X0WU 2QCYA 4NIYA 3A7VA 1NU9A 2R2WU 2AH4X 5TCAA 2A4RA 3EAJA 1ANDA 1O3OA 1UVUH 3HPTB 3K9XB 3URCA 3N7OA 1AB9B 2VH6A 1A1RA 3QLPH 1MH0A 3AASA 3GY2A 4ABHA 1XUKA 3BTHE 4Y0ZE 5JBAS 5AVDA 2GMTC 4CBOA 3A7WA 1TBQH 2UUJB 4Q7XA 1VZQH 3KQEA 3M5MA 1SSXA 1G2LA 1F7ZA 4I8HA 3RM2H 3LJJA 3TK6A 5DJ7A 4GHTA 5JYIA 3SGQE 4KGAA 2D1JA 1ZTJA 4UD9H 4HFPB 1BT7A 1ANCA 1SGPE 5E0JA 4THNH 1HGTH 4CREA 1XX9A 1C5MD 1ZMNA 3GCOA 3FZDA 1YCPM 3FP8E 3M3SA 1G3BA 3RM0H 1GI3A 1DITH 2OCVB 1ZTKA 3S7KB 1UTMA 3KQDA 4H42U 3QZRA 1B0FA 1BCUH 1OX1A 1CGIE 1VCQA 2ZG0H 3A88A 1QA0A 2ZWLH 1OWKA 3PTBA 4MPVA 2G52A 3RP2A 4B76A 4CRBA 1ZPCA 2Z9JA 1EPTA 1GBAA 2BD4A 5K0HA 1PJPA 1GDNA 2G5VA 1MTSA 1AZZA 2XCNA 3CENA 4I31A 3PWBA 1W0ZU 1SGDE 3QZQA 3Q76A 2PR3A 2H5CA 1K1OA 1ZSKA 5EW2H 3BTWE 2JH6D 2P3UB 2BZ6H 2OC8A 1F0UA 1DICA 3AAVA 1F5KU 4GHQA 4YOJA 4X6MA 1FV9A 1Y3VA 3AVZA 4OS7A 3SI3H 4H6SB 4WVPE 3LIWA 5DGJA 1WSSH 2ZC9H 4X2XA 3RUOA 2HWLB 1S85A 1GL0E 2PKSC 1GHYH 1NFUA 1BBRE 1BIOA 1W0YH 4X1SU 1K22H 1EZQA 2SGDE 2ZTXA 1HFDA 4CHAB 2BD7A 5CHAC 5EQQA 3ZVEA 2VIQA 1KSNA 2QY0B 5B6OA 5C3NA 1C5WB 1MKWH 5H4IB 1MBMA 1LTOA 1EASA 1UTPA 2VB0A 1BBRK 1SLWB 3NXPA 1C2EA 2Y80A 1D6WA 1K21H 2Y82A 5A8YA 1IQMA 1FQ3A 2B7DH 5L6NH 1AQ7A 1EOLA 3ODDA 3BTFE 4FU9A 1C5TA 1A5HA 1GG6B 2BY9X 2GCHG 1GBMA 3FFGA 2VU8E 2FLBH 4OGXA 3TIUA 5A8XA 3PMAB 1VGCC 3LT3A 4YLQH 3ATLA 3RXRA 1BTPA 3GISB 2FOCA 1INCA 1FN8A 1HDTH 1C1MA 2G8TA 2FOEA 2AERH 2NU1E 1A2CH 4AG2A 2G00A 1CU1A 4FUGA 1WAYB 4XOJA 2BQ7B 1KLJH 1CA0B 3TU7H 1C5NH 4GCHF 2NWNA 1QL8A 3P8GA 2HLCA 1J15A 2CV3A 2FIRH 1C2FA 5A0BA 4Q7YA 2GP9B 5F6MA 2O8TA 2WINI 1D6RA 2FOMB 1QHRB 1O35A 4U01A 5DO4H 2ZHWH 4KP0A 2FI3E 6GCHG 3TGJE 1QURH 2P8OC 2FLRH 1QA7A 2LNCA 1V2WT 2WPKS 4WXVA 1KTTB 1LVMA 1GMCG 2Q6DA 4X1QU 3ATWA 1LHCH 2ZDLA 2Z9KA 4BNRA 2Y81A 4H6TA 5TJXA 1TB6H 3A7XA 1A3EH 1VITF 1UHBA 3BIUH 3VB5A 1SL3A 1GBKA 5EQRA 4B2CA 3RLYH 2Y5HA 5EQSA 1AE5A 2VIPA 3L33A 2ZHEH 4X1PU 3ZVCA 1O30A 5GIBA 1LDTT 2QXGA 3TNSA 1C4Y2 5GCHG 1C4U2 1LKBA 2A45B 1A3BH 2FOAA 2HRVA 1VCPA 3M7QA 3OX7U 1OYQA 3UQVA 1B7XB 2EI6A 5EG4A 4DW2U 2V0BA 3A7YA 2ILNA 4MNVA 1IQFA 2SGEE 2CF9H 1WOFA 4ISOA 4B1TA 1XVMA 7GCHF 2KAIB 4FUHA 4I8JA 1CQQA 4ESTE 3SU5A 1ZPZA 5T3HA 1C1RA 4ZKNU 1AFEH 4KELA 2ZECA 1IQNA 2ZPQA 1P11E 1W2KH 3NPSA 2HPPH 1NRNH 2QXIA 2Z3CA 3DFLA 2XW9A 2GMTB 3A8BA 3NZIA 1SG8B 3ZVFA 1CGJE 1OWIA 2SNWA 2Y7ZA 2ZHFH 3MH7A 1JRSA 2PTNA 3UIRA 1CHOG 1MKXK 3BG8A 3IITA 3TPIZ 4KTCA 1MTNC 1V2OT 1O2HA 3E91A 1Z71A 1G2MA 1F5LA 3VXFH 1GBCA 2C3SA 4ZHLU 1Z8IB 4CRFA 1P9UA 3DD2H 1DS2E 2W3IA 4NIXA 1PPZA 1IHTH 4ZHMU 2BY6X 4BANB 1EAWA 2H9TH 1D4PB 2J34A 1T8OA 1AZ8A 4BAHB 1EPTC 1MQ5A 3S0NA 4B74A 5AF9H 3FP7E 1Y59T 3P8OA 5C2ZA 1H9HE 3SQHE 2CMYA 2BVXH 1KDQA 1FNIA 1TNIA 1PPEE 4E7RG 3RXEA 1PQ8A 3K6YA 3VPKA 4YT6H 1GI2A 3KF2A 2GV7A 1SOZA 2JH0D 2RDLA 2R3UA 1P09A 1GBFA 4NWKA 1YPEH 3H7OA 4J2YB 1K2I1 1GI7B 2BYAX 1DOJA 1GBIA 4NA9H 4LXBH 2WV5A 1AGJA 1ID5H 2QC2A 1AO5A 1BTXA 3GDUA 4JZ1A 2PKSB 3KL6A 3O8BA 3RXFA 1DE7H 3A85A 1Z6EA 4FUIA 1LVOA 3UWIA 1MZAA 4ZKRU 1ZJDA 1MD8A 3CS7A 1TAWA 5CHAB 3UUZA 2BX3A 2B8OH 1P0SH 3P6ZB 1P10A 2J2UA 1V2ST 4ABIA 1O3LA 3QDZB 2WPMS 4O3UA 3LJOA 2PUXB 4A1VA 3QGJA 2BLQA 1SR5C 1AHTH 1BRUP 1C2IA 1VGCB 1C1NA 3U69H 2WUBA 4ZXXH 1CSOE 3V12A 2OUAA 1VR1H 4IC5A 1QRWA 1SLUB 3K2UA 1KXEA 2ANMH 1HAHH 3V7TA 3PLBA 1JIRA 1DWDH 3ZYDA 1KY9A 1Z8JB 1PPCE 3RXIA 2UUFB 2Q1JA 1JWTA 1XXFA 2A7HA 4ZHAA 4A6LA 3A89A 2H6MA 5G4BA 1SMFE 4A1XA 3M7UA 1GJCB 1C9PA 1ELBA 3SHAH 5JBBS 1QB1A 3F68H 1P3EA 1EATA 1MBQA 4NIVA 1KXFA 4Y76A 3MU5A 1OXGA 1T31A 4NSYA 1FLEE 1TNHA 1TONA 4GLYA 3TLOA 2P8OB 3ZZ6A 2ZU2A 1FY5A 2BX4A 3PMJA 4RN6A 3OU0A 3OSYA 2BLWA 3ATMA 1BHXB 2QXJA 1NESE 3E16B 3GY3A 1H4WA 4MVNA 1T4VH 2XBVA 4INLA 3GICB 1L1NA 1MTWA 2BDAA 3LPRA 1Z8RA 1HIAA 1NZQH 1RJXB 3ZZAA 5GWZA 1GHXH 1TMBH 5FAHA 4Y8YA 4ZH8A 1AKSB 1SI5H 1AUJA 1O2KA 1ZHMA 3O8DA 5DP7A 2JETC 1C2LA 1S81A 4O9VA 2J94A 1SGFA 1Y3XA 2GD4B 2GCHF 1BRCE 1W8BH 2BDIA 1DVAH 1GBEA 1NRRH 3HGNA 1CE5A 4CR5A 2Y6TA 1GCTC 3FZZA 1P2NA 3PWCA 4E7NA 2ZTZA 3KEEA 4DJZB 4IMZA 3O8RA 4D9RA 4BAKB 1SHYA 2SNVA 3ZZDA 1MMJN 1IQLA 1ZLRA 1THPB 1V2NT 2BDBA 1BTHH 1K1PA 1K1JA 4IBLH 5EOKA 1ESAA 1O2LA 2OTVA 2PWXA 1E37B 1AVGH 2CF8H 2OC0A 3ATIA 2BD2A 1HV7A 9LPRA 5LPFA 1EXFA 2M5TA 4AOQA 4ABGA 2ZDAH 3PTNA 1TGCA 5BRRE 1C1QA 6GCHF 4A7IB 5JB8S 3RXBA 1V2UT 2F9PA 3MU1A 1MTNB 1HAGE 1AI8H 4LZ4B 3A7TA 3EA8A 1MAYA 3BTGE 1GHAF 5DP8A 2WPJS 1AY6H 1HB0B 1P3CA 2ANYA 2ZPSA 2AYWA 4AB8A 4AX9H 1AD8H 2F9UA 1ZSLA 3S7HB 1EB2A 2QGRA 2CHAC 1MUEB 2F9BH 1LKAA 2XRCA 4U30A 1C1WH 5T6GA 3ZVDA 2D8WA 5ESBA 1GBHA 1P2IA 4Z0KA 2BY7X 1EPTB 2ALPA 2FMJA 3EA9A 1PPBH 1FDPA 2VWOA 4CH8B 2VJ1A 4K1SA 2GDEH 3LU9B 1H9LB 1QBOA 3S9AA 1LPZB 4I8KA 1DY9A 3D23A 1KLIH 4ZMAH 2BLVA 2PV9B 3VGCC 2GZ9A 2DUCA 1D3PB 5L30H 2FPZA 2UWLA 1G36A 4ABBA 1IAUA 1ZRKA 3AAUA 3RXTA 5CMXH 3TJVA 1THSH 1P8VC 1O32A 2GX4A 5FX6A 4E06H 1O2GH 1EZUC 5FX5A 3T62A 2A32A 1RD3B 1IQEA 2BY5X 2ZTYA 1C1OA 4TWWA 3BG4C 4JZIA 2Y7XA 1MZDA 3I77A 2STBE 5HM9A 2TIOA 3SNEA 2HNTF 1TGTA 1V3XA 3BTTE 4KKDA 1CHOF 1FIWA 5EODA 2VGCC 1MU6B 3MH4A 3LDXH 5EXNA 4IGDA 2STAE 1ANEA 1HAXB 3LGWA 1UK4A 3MO9A 1LCYA 1MKWK 1C5VA 3P8NA 2ODPA 3E8LA 2Y5FA 1TFXA 1TABE 4NGAH 4IN1A 3RU4E 4J1YA 1YLCA 4UFDH 1UTJA 1C2MA 1C9TA 1A4WH 2ZIQH 3GY8A 1GHZA 2AMPA 4YESB 3MU0A 1HAZB 3QK1A 1F0SA 4MPUA 1V2RT 1ELVA 1WCZA 1YCPH 3MHWU 1NRQH 2P59A 3HKJB 3SI4H 1C5LH 2ODYB 2R3YA 1HAVA 3E90B 2R2MB 3E0PB 1BRAA 4OS6A 4UFFH 1L1GA 1DANH 4AGKA 2FOFA 1AUTC 4AGJA 4X8TH 3HGPA 4WXIA 1BTYA 1TGSZ 2GVFA 3UNSA 2DE9A 5LPRA 5FPYA 4ABEA 1QBNA 4X8VH 1FJSA 1HJAC 3A8DA 1OP0A 1T32A 3VFEA 1V2VT 5EPNA 3QTVH 1S0RA 9ESTA 1UHBB 1ETTH 1O5CB 3RC5A 3LC5A 2BD5A 3H7TA 3RDZA 1LHFH 2ZHDA 1KXBA 1XUJA 2A2XH 1S82A 1XUFA 1N6XA 1ABIH 1PYTD 2HALA 4DIHH 5EXMA 4NA8A 4Y10E 4ISIH 4DIIH 1FIZA 2JETB 4MPWA 3QX5H 3V13A 1FPCH 2TRMA 1SGEE 5C1UA 2ZQ2A 3SUGA 1LMWB 1Q3XA 2XWBI 4DOQA 4MNWA 2BY8X 1BMAA 3VEQB 5C5OA 1BMMH 2FM2A 3HATH 2GZ8A 2R9PA 1F2SE 4BAMB 1O36A 1GCTB 3B23B 3M3VA 4B71A 2BM2A 3SHCH 4BTIB 1T8LA 3TGKE 3P70B 4AORA 3LKWA 3SO3A 3RU4D 3MTYA 1FN6A 2BVRH 3U1IB 1ORFA 5T6DA 1KTSB 3CP7A 3SJ9A 1ELFA 1SGNE 1B0EA 1CA8B 2HGTH 5C5NA 1FY3A 2RCEA 4I8GA 3BTDE 4FUFA 1TA6A 1HCGA 5DP4A 4XFQA 5LH8A 2QF3A 1A0JA 1B5GH 2CXVA 1UVSH 1YC0A 1RGQA 1YPHE 1TMUH 2O9QA 1JIMA 4FVBA 1O2XA 1UTKA 1O39A 3SNAA 4ZKOU 1TX6A 4K8YA 3UR6A 1P04A 3U98H 4XSKU 1O2TA 3SJ8A 2CHAB 1DLKB 1LPKB 2OC1A 2GT8A 4FXGH 1EKBB 3T2NA 3NUMA 1EJMA 2C90B 1HYLA 1KLTA 1TOCB 4WMDA 4GAWA 1QR3E 1PYTC 1O3HA 2QV1A 4OS2A 1MU8B 2BDCA 1QJ1B 3A87A 5HXFA 1TNLA 1K1NA 1WQVH 2ZFSA 3GCTF 1KDQB 1FONA 3ZZ3A 3GCNA 1L2EA 2ZKSA 2XNIA 2FXRA 3K6ZA 6CHAC 1ZHPA 4ISHH 1UTLM 4KTSA 3ZVBA 5FCRA 2OQUA 4IS5A 3VGCB 1IHSH 2D2DA 3PV4A 1RFNA 1NC6A 4FU8A 1SFQB 1PFXC 1HAYB 2ZA5A 4MNYA 2ZGXH 4R0IA 3TH4H 1C5QA 2B0FA 1AMHA 4LK4A 1RS0A 3UY9A 2BOKA 4MPXA 3UPEA 4O03A 1GI8B 3ITIA 1LPGB 1YPGH 2BOHB 3U9AH 1H1BA 1O5EH 1NO9H 1C5RA 1ZTLA 5L2YH 4X2WA 5GJ4B 1HRTH 1AE8H 3SJIA 1NRPH 3OY6U 3BG4B 1SGTA 1TQ0B 1UK2A 4I32A 1GJ5H 3NCLA 4TY7A 2BQ6B 4K69A 1NU7B 5E0GA 4K8BA 5FXLA 2A1DB 3URDA 2THFB 5L2ZH 2TBSA 3U8OH 5F8ZA 2EI7A 4Q7ZA 1O5DH 2VGCB 4TYDA 1O34A 4TY6A 2AS9A 1ZZZA 2OBOA 1K1LA 4INHA 4CRDA 1GBLA 1YF4A 1ANBA 1WTHD 2AGIX 2VWMA 2UUYA 3M61U 1IOEA 1G3CA 1JMOH 3GY5A 1AVXA 3E6PH 4DY7B 2OLGA 1WQSA 1T7CA 3QN7A 1GL1A 2YOLA 3SJOA 2RA0A 3A84A 2BDYA 3MU4A 2V3HH
chains in the Genus database with same CATH superfamily
2XXLA 2ESTE 5DP3A 4NFEA 3E0NB 1HAOH 3LGIA 4ZXYH 1S5SA 4XDEA 8GCHG 1RTLA 5DP9A 1OS8A 2Q6FA 1PQ7A 3SV6A 4JMYA 1SB1H 4B6EA 3SGAE 2F9NA 1TLDA 3N7DA 1BOQA 1O2VA 4UEHH 4FUBA 1ZJKA 1EJAA 3STIA 3I78A 2VVVA 5C1YA 2G51A 1O2ZA 1P2KA 2ODQA 3W94A 3T25A 1FZZA 1TBZH 2C8ZB 5C1XA 3A7ZA 1P03A 5EXLA 2ZGJA 3TK9A 1P02A 4D8NA 5F8XA 5AHGH 2F83A 2PTCE 2ZFQH 3RXCA 2FOGA 8LPRA 5F03A 4ABFA 4XBBA 3RXQA 3KHVA 1D9IA 1O5BB 3LGUA 5HM2A 3MH5A 1E35B 3GY6A 1QFKH 1Z8GA 1BITA 3ZZ8A 1QNJA 1J17T 1GMDG 4GSOA 2K1QA 2O8WA 3F9GA 2ZDNA 1FPHH 5EU8A 1K1MA 3FVFB 2EC9H 3FOAA 1VJ9U 1RTKA 4AFZA 2AMDA 2ZF0H 2VNTA 2ZGHA 7LPRA 5DPAA 1E36B 1EAXA 1C2DA 1YPHC 1P9SA 1YY3A 2Y5GA 3EDXB 4NCYA 3SJKA 1CT0E 2ZDMA 3SOSA 5E8EH 1A46H 2ZEBA 1H9IE 2Z9LA 1IQKA 3CS0A 3OEHD 3ENSB 1SPJA 3RXKA 1THRH 5I46H 2KFWA 4VGCC 1LVYA 1V2MT 6LPRA 2ANWA 1Y3YA 1SHHB 4Y79A 3M5LA 1P2OA 4ISNA 4WMEA 2JIZD 1Y5AT 2G55A 1ARBA 2VVUA 2C8YB 4AZ2B 1CO7E 4X6PA 4YZUA 3MFJA 1GJ9B 1SLXB 1QRXA 1TQ7B 3SNCA 5KECA 1VJAU 1LQDB 8KME2 1A61H 1HAIH 1QZ8A 5T6FA 4BAQB 5E2PA 2GT7A 5ESTE 2EA3A 4MNXA 2ZU5A 2FP7B 4CH2B 5C67A 3SQEE 1UK3A 2V3MA 1SVPA 1Z7KA 3SUDA 1ELGA 1O2WA 2ZU1A 1P06A 1RTFB 1KXDA 3F9HA 2H5DA 2PUQH 1CBWC 1ZPBA 4ZROA 3RXAA 1BTUA 1ZGIA 4X1NU 2ZGCA 1EUFA 4Q2KA 1G3DA 2IJOB 1OYTH 3V3MA 3D62A 4LZ1H 3FAOA 3QTOH 2TGPZ 4HGCA 1Z6JH 3S9BA 1A5GH 3ZV9A 3RMOH 1BTWA 4YO9A 2CGAA 4IC6A 2NU0E 4X8UH 5ETXA 5C0UA 1C5ZB 2BMGB 3BF6H 1EX3A 3UFAA 4MG3A 1WBGB 4D7GA 1TMTH 2XC0A 2A7CA 1O2IA 1GI5A 5SGAE 2WV4A 1DDJA 1V6DA 1E38B 2AEIH 2R0KA 6CHAB 3UB0A 5I25A 1IQIA 4D7FA 4AFSA 1Y8TA 1O5FH 3F2HA 1NS3A 3TNTA 4GCHG 3WWBA 5CHBA 3KNXA 2PSYA 1BZXE 2W5EA 3M5OA 1BB0B 2PLXA 2ZZUH 1Y5BT 3M36A 3MI4A 3QWCH 3STJA 3PV5A 1FMGA 1OHHD 1PPGE 2A5IA 2J97A 1GJ4H 2EQNA 2P16A 4BOHA 4K2YA 3LH1A 2UWOA 3U8TH 1N1LA 8ESTE 4AFUA 5KGOA 3RXOA 3UREA 1VKYA 1F92A 5JBCS 4IW4E 1A0HB 2SGQE 1W7GH 4CRGA 1PPHE 3BEFB 4I33A 3MNXA 2VIOA 3EYDA 1GCDA 3M3TA 1XKAC 1O3KA 1UCYE 3H09A 1JBUH 1BDAA 3LGVA 1J14A 2Z94A 1GMHG 4JYTA 2J95A 2GTBA 1UCYK 1O5GH 1FXYA 1O2MA 3LC3A 3PLKA 3TVJB 4B2AA 5A2MH 3W1EA 1C1UH 1QL9A 4TPIZ 4GPGA 2XNDD 4ABAA 2PHBA 3QO6A 1LHGH 2NU3E 5ABWA 3AK5A 3KCGH 1E0FD 3Q00A 3RMLH 2Z3DA 1G3EA 1V2KT 1C5PA 3M37A 1HAVB 1GMCF 2WSSD 3B9FH 2IOTA 3MU8A 3ZVGA 3DHKH 1O2OA 1QGFA 1DWBH 5B6LA 5E0HA 3H5CB 1C2HA 3DFJA 1YKTA 2VIWA 4DG4A 3A80A 1DX5M 2SGFE 1O2QA 1BA8B 4UFEH 2XYAA 2JJ2D 4F49A 3OY5U 4UDWH 3PB1E 2M2AA 5GNDA 2ZGBH 4AG1A 1CA0C 2WHXA 7GCHG 1YCPK 1C1PA 1CT4E 1QRZA 2VIVA 4Y8XA 2O8MA 1C5SA 1GI6A 2ZCHP 2ZNKH 3T26A 5GCHF 2UUKB 1H8DH 3GDSA 1ELEE 1CHGA 1DM4B 2A0QB 3EA7A 1YPLH 2JKHA 1N8OC 2XWAA 2ZHQH 3SUEA 1DWEH 2Z3EA 3FANA 4R8TB 2AGEX 4DURA 2PW8H 1O38A 1G37A 2I6SA 1S6HA 3VB3A 2F3CE 3RU4T 1O2RA 4RKOB 5FHTA 2BDGA 3E1XB 5JPMH 2G4TA 4ACAA 3DSGA 1K1IA 1GJDB 1O2PA 2SFAA 2ZDKA 3VB6A 1WTGH 2C8XB 3ESTA 3T29A 4MTBA 1NFWA 1FY1A 1OP8A 1ESBA 2A5AA 3KQCA 2V6NA 1Y3UA 2RA3A 3LGTA 3UOUA 3SN8A 2GGVB 2JH5D 2QN5T 4X2VA 2GKVE 1QTFA 2WPIS 1MAXA 4BXWA 4VGCB 3Q3KA 3ZZ9A 1H8ED 1GDQA 1GGDC 2FYQA 2YNAA 4RSPA 5GDSH 2ZPRA 3PMHB 4O3TA 2EY4C 4IN2A 1J8AA 4B2BA 4JYVH 1QB6A 1K0HA 1S6FA 2ZU3A 3PMBB 4X1RU 8GCHF 1NROH 2WV9A 5HMAA 3L3TA 3HK6B 2I6QA 2B5TB 2FOBA 2QA9E 2PGQB 2ZP0H 1GBBA 1OWEA 5IK2D 2FTLE 3TJOA 1T8MA 2QF5A 2F9VA 1YPJH 1P01A 1P12E 1O3JA 1TWXB 1XVOA 3MNSA 4TWYA 1G32B 3KGPA 2AMQA 1WU1A 1LVBA 3SV9A 1CBWB 5K7RA 1Y3WA 5EW1H 1QQ4A 3RXLA 1O3CA 1A5IA 2ZQ1A 4JCNA 3I29A 1V2LT 2O8LA 1GMDF 4B75A 1JOUB 1OKXA 3B8JA 3ODFA 1NN6A 5FPSA 4DT4A 3BIVH 2BTCE 4XBCA 2ALVA 2BXTH 2P94A 1DWCH 3BTME 5EGMA 1GBJA 1BUIA 3A83A 2QYIA 1P2JA 1V2QT 3ZZCA 3EE7A 2YNBA 2BD3A 3MO6A 3T27A 4Y7BA 1BMNH 3PM3A 1SGQE 1KXAA 3TITA 1Q31A 1TX7A 3TGIE 4OS1A 2YMSD 3RMNH 1G30B 1AVWA 1SQAA 1DXPA 1O3NA 6ESTA 2O8UA 1AIXH 1EP5A 2SGAA 1GPZA 1O2JA 4NG9H 2H9EH 3RXPA 1PQ5A 2HNTE 1TRYA 1EZSC 2J92A 3M7TA 2SGPE 4Y7AA 1GHBG 1NTPA 2Q6GA 1C5UA 2NU2E 3KQBA 4NFFA 3BEUA 5DP6A 4AFQA 3R3GB 1O3EA 2P93A 2BB4A 4CRCA 3O8CA 4ABDA 2KR7A 3BTEE 3C1KA 1SOTA 1DT2A 1GJAB 7KMEH 1SGFG 3MNCA 4X6NA 3SV8A 2AFQB 1GJ6A 3RXUA 4WJG2 4JK6A 3BTKE 3SV2H 4Y6DA 3OYPA 2BDHA 1EFRD 3SU4A 1BRBE 4FUCA 1TE0A 4BTUB 2J38A 3T28A 3F2GA 2XBWA 2C93B 4AN7A 1XKBC 2BQWB 1O3PB 5EJ1A 4FUJA 1X7AC 2PFEA 4K1EA 3KIDU 3GDVA 4ZKSU 3SNDA 3GY4A 1TPPA 1OOKB 5DKMA 1WUNH 4AYYB 4JZEH 4KTUA 4OS5A 3UNQA 3SU6A 4Y8ZA 1UMAH 2H9HA 3UTUH 1O37A 1LHEH 1GHWH 1KXCA 1V2PT 1RXPA 1GBTA 2PKAA 3HKIB 1O3GA 3T5FH 2GCTC 2ZFRH 1LHDH 1UVOA 1Z1JA 4BXSA 2VH0A 1TIOA 2QIQA 4GUXA 4RKJB 1YP9A 2FYRA 2PSXA 1EOJA 2OD3B 4FUDA 2JJ1D 1XUHA 3ELAH 1T8NA 2IJD1 2UWPA 2GV6A 1AWFH 5GPIB 1OWDA 1SC8U 2WYGA 5A09A 4SGBE 2YMSC 2V3OH 1ZR0A 4WMFA 2W7SA 2FS8A 3ZVAA 3TK5A 1O2NA 1DPOA 1SLVB 1L1JA 2GZ7A 4BTTB 3LH3A 2V35A 3EE0B 1F5RA 1QB9A 1RIWC 1TPOA 3EQ0H 2XTTB 3SU0A 2QF0A 3SU1A 1YM0A 4ZAEA 1NT1A 2OXSA 2G81E 3PO1C 4WF8A 5CDFE 1FUJA 4JK5A 1UTQA 3A86A 3ZYEA 1GI0A 3LONA 4E05H 2ZU4A 2FO9A 1O3BA 4AB9A 1EAIA 2FEQH 1LQEA 2OC7A 3RXSA 1U6QA 5GXPA 5J4QA 2HPQH 4MLFB 1O0DH 1V2JT 1N8OB 2BVSH 4HI3A 1TX8A 1C2JA 1UTNA 1P2MA 2EEKA 3PLPA 1O2SA 3SGBE 2BHGA 4LOYH 4DGJA 5EPYA 1CVWH 1HJ8A 2J98A 5CE1A 3F1SB 1HUTH 4A92A 1HPGA 4CRAA 1E34B 1GI1A 2IPHA 1HXEH 2C8WB 2CJIA 1SQOA 1NRSH 2VINA 1GHAG 1L4DA 1A0LA 4RI0A 1HJ9A 4UONA 1TOMH 1NFYA 1ZMJA 5HYOA 4CR9A 1BJUA 4K3JA 2L6OA 1AFQC 2QAAA 2BD9A 4SGAE 1ELTA 3U8RH 1GMHF 3K65B 5JB9S 2TGDA 5DSFA 3S9CA 3GY7A 1UO6A 1BMLA 3BV9B 3BSQA 3RXJA 2XC5A 5A0AE 1GJBB 1A7SA 1GVLA 4F55A 1QL7A 2ANKH 3BN9A 2WZQA 2Z6BD 4NZQA 3S69A 2TGAA 5A8ZA 3GYLB 1YPKH 1GGDB 3MO3A 1BBRH 4A1TA 1TRNA 3F9EA 5HGGA 2EI8A 1NY22 2P3FH 2OQ5A 1EB1H 3MOCA 3BTQE 3HK3B 5C20A 1WYKA 4XBDA 3C27B 3TH3H 1SQTA 1ABJH 1VCWA 4XE4A 3ZZ5A 1AU8A 2B9LA 4AC9A 2G5NA 2L74A 4K5ZA 1DXWA 1DLEA 4HTCH 5IYTA 3LGYA 1GVZA 2HVXA 1F0RA 3RXVA 2BZAA 4BAOB 2ZDVH 4Y71A 3UOPA 2HOBA 3RXMA 3ZZ4A 1O31A 2HNTC 1O5AB 3E3TA 3IWMA 3DT0H 1L4ZA 3VB7A 1DY8A 1TPSA 1FY4A 2RDEA 1UTOA 1IQHA 1QJ7B 3DA9B 3KN2A 4INKA 1YPMH 2FX6A 3UR9A 1ZGVA 1GVKB 2ZO3H 1QCPA 3SW2B 2F9OA 1HJAB 1P05A 1Y5UT 3ATKA 3QGNB 4YTAA 3W95A 1GJ8B 4X2YA 1EZXC 2ZCKP 3WWFA 2FOHA 1CT2E 1O3IA 1W14U 2ZFFH 1IQGA 3A82A 4X8SH 1DSUA 4A5TS 1HIAB 2PGBB 1NPMA 1W11U 1C1VH 4PROA 1JRTA 3DSOA 1KIGH 3ZZBA 3D65E 2WPHS 1Z1IA 1HXFH 2PP6A 1Q2WA 4UE7H 4AYVB 4I8LA 3GCHC 3OAAD 4NSVA 1JXPA 1NFXA 1S84A 1GDUA 4WWYA 4NIWA 1TALA 3DUXH 1RRKA 1IQJA 1TNKA 1D3DB 3GYMA 3UWJH 5E2OA 3GOVB 5C94A 3EGKH 5JDUB 2Z9GA 3SNBA 4B6FA 2J4IA 2A31A 2KZ4A 2W3KA 4WH6A 2ZFTA 5T1VA 3SU2A 3TH2H 2QXHA 5PTPA 1FI8A 1MTVA 5JBTA 1C5YB 2FZZA 3P17H 3OTPA 1PQAA 1ZRBA 1FY8E 1W10U 1DUEA 4GVUA 5IDKA 3RXHA 2LELA 3LOXA 1L0ZA 1QY6A 4DCDA 1E1RD 1YLDA 3MYWA 4OGYA 5BPEA 4OS4A 3ZV8A 1ACBE 4M7GA 3ZZ7A 1DSTA 1GJ7B 3RXDA 3RMMH 1W12U 1ZMLA 2G4UA 2XBYA 2AGGX 3L6PA 1CGHA 1K28D 2GCTB 4DVAU 1SBWA 2LPRA 4IMQA 1UVTH 4QT8C 5LGOA 1V2TT 1MKXH 1GBDA 4TT3D 2P3TB 1W7XH 1SGRE 1AB9C 1HNEE 1LO6A 1HAPH 4Z6AH 2OBQA 1J9CH 1ELCA 1BMFD 1C2GA 2CN0H 4Q80A 2KAIA 2ZCLP 3RC4A 1O3FA 1XM1A 2XBXA 2XC4A 1W3CA 1ELAA 1ZHRA 1O2YA 1OP2A 3VXEH 2A4GA 2FX4A 2OINA 2YMSB 3SZNA 3G01A 1TPAE 2AIQA 1OPHB 1ZYOA 4YOIA 2VIDA 5AFZH 1YBWA 4ABJA 3AW1A 1D3QB 1RIWB 1SGYE 1SFIA 4O97A 4I86A 5LPEA 4NA7A 3SBKA 3PO1B 1O3DA 2TPIZ 1XXDA 4FVDA 5DN6D 2A5KA 3WY8A 2A2QH 1VITH 3RC6A 1GWAA 1XMNB 2BLOA 3A8CA 4X6OA 1GHBF 1T4UH 3A81A 4NWLA 1G9IE 1QBVH 3OE7D 5FPTA 3UNRA 5F8TA 3UQOA 2RG3A 3PV2A 5FBEA 1BTZA 3A8AA 4DT7B 1DUAA 2WYJA 2OP9A 1FAXA 5DK1A 2VWNA 1TYNA 1M9UA 1XUGA 1GI9B 2D26C 4FU7A 4B73A 3SYJA 4H4FA 1D3TB 3PROA 5AFYH 1C5OH 1AFQB 1P2QA 1UJ1A 4JZFH 4WY3A 1SGCA 5DG6A 1QIXB 1KYNA 3MNBA 3FP6E 4F4OC 3NRLA 2NU4E 1C5XB 1K9OE 2VVCA 2IPQX 3D49H 1EJNA 4ISLA 7ESTE 5DP5A 1W13U 1PPFE 1TNGA 4JZDH 2WPLS 3GCTG 1FAKH 1COWD 3SORA 1AWHB 2W6JD 4Y11E 4FUEA 3VG8A 1OWHA 3RXGA 2C4FH 2R0LA 1MTUA 1VITG 3M35A 1N6YA 4YOGA 4WH8A 2FODA 2W7UA 3JZ2B 2FESH 1OSSA 1EAUA 1ETSH 4HZHA 1TGBA 2A7JA 1TGNA 3N7EA 1YGCH 1W0KD 1YYY1 4CHAC 4ASHA 4U2WA 4NZLA 1OWJA 1S83A 1C2KA 1ETRH 5A0CA 3P92A 3BEIB 3OTJE 2HLDD 3PYHA 2GDDA 1GG6C 1F0TA 5FCKA 4YM9A 1QQUA 2Z9IA 1ZSJA 3NWUA 5FBIA 1BHXF 1MCTA 1H8HD 1P57B 2W26A 1YLNA 1UVPA 3MMGA 3M5NA 3NKKA 4K1TA 3CNRA 1DFPA 3UAIC 3QUMP 3Q3YA 1HBTH 2W6ID 2FS9A 1TRMA 4Y0YE 1C1TA 2FTMA 5TCCA 1EP6A 3AW0A 2TGTA 1UW7A 3Q77A 4TPYA 2ASUB 2A4OA 3MWIU 2FI5E 3VB4A 2F91A 2FDAA 1ELDE 1J16A 1MABB 3JZ1B 1GHVH 1MD7A 4I7YH 3TJUA 1H8IH 2J9NA 1O2UA 3GCHB 1O3AA 4UFGH 4D76A 2ULLA 1EQ9A 3V0XA 1XUIA 1S0QA 1WV7H 3R0FA 1MQ6A 4MQAA 3SUFA 1TA2A 4JYUH 1C4V2 2OK5A 2IN2A 1NM6A 3SV7A 1TBRH 3P8FA 1BQYA 2H2ZA 2A4QA 2VWLA 1ZOMA 1C1SA 1GI4A 2XCFA 1O3MA 1MCVA 1AN1E 3IG6B 4K60A 4YT7H 1O33A 5J4SA 4YLUA 1ARCA 2FWWA 2H1UA 3F9FA 2WUCA 3RLWH 3Q3XA 1SGIB 4U32A 2AIPA 1TNJA 4CBNA 2BD8A 1AKSA 3TJNA 3MH6A 3P95A 1ESTA 1HLTH 3NK8A 3U1JB 4ZUHA 1QJ6B 4MDSA 1KMHB 4D9QA 3FKSD 3F6UH 2ZFPH 2P95A 2BXUH 2Z7FE 2FI4E 1UCYH 1BJVA 2ZI2H 3SU3A 2DE8A 2PKAB 4X0WU 2QCYA 4NIYA 3A7VA 1NU9A 2R2WU 2AH4X 5TCAA 2A4RA 3EAJA 1ANDA 4RT1A 1O3OA 1UVUH 3HPTB 3K9XB 3URCA 3N7OA 1AB9B 2VH6A 1YWUA 1A1RA 3QLPH 1MH0A 3AASA 3GY2A 4ABHA 4RT0A 1XUKA 3BTHE 4Y0ZE 5JBAS 5AVDA 2GMTC 4CBOA 3A7WA 1TBQH 2UUJB 4Q7XA 1VZQH 3KQEA 3M5MA 1SSXA 1G2LA 1F7ZA 4I8HA 3RM2H 3LJJA 3TK6A 5DJ7A 4GHTA 5JYIA 3SGQE 4KGAA 2D1JA 1ZTJA 4UD9H 4HFPB 1BT7A 1ANCA 1SGPE 5E0JA 4THNH 1HGTH 4CREA 1XX9A 1C5MD 1ZMNA 3GCOA 3FZDA 1YCPM 3FP8E 3M3SA 1G3BA 3RM0H 1GI3A 1DITH 2OCVB 1ZTKA 3S7KB 1UTMA 2J98B 3KQDA 4H42U 3QZRA 4ZCNA 1B0FA 1BCUH 1OX1A 1CGIE 1VCQA 2ZG0H 3F3BA 3A88A 1QA0A 2ZWLH 1OWKA 3PTBA 4MPVA 2G52A 3MQKC 3RP2A 4B76A 4CRBA 1ZPCA 2Z9JA 1EPTA 1GBAA 2BD4A 5K0HA 1PJPA 1GDNA 2G5VA 1MTSA 1AZZA 2XCNA 3CENA 2KCOA 3PWBA 4I31A 1W0ZU 1SGDE 3QZQA 3Q76A 2PR3A 2H5CA 1K1OA 1ZSKA 5EW2H 3BTWE 2JH6D 2P3UB 2BZ6H 2OC8A 1F0UA 2K0QA 1DICA 3AAVA 1F5KU 4GHQA 4YOJA 4X6MA 1FV9A 1Y3VA 3AVZA 4OS7A 3SI3H 4H6SB 4WVPE 3LIWA 5DGJA 1WSSH 2ZC9H 4X2XA 3RUOA 2HWLB 1S85A 1GL0E 2PKSC 1GHYH 1NFUA 1BBRE 1BIOA 1W0YH 4X1SU 1K22H 1EZQA 2SGDE 2ZTXA 1HFDA 4CHAB 2BD7A 5CHAC 2F43B 5EQQA 2VIQA 1KSNA 2QY0B 3ZVEA 5B6OA 1C5WB 1MKWH 5C3NA 5H4IB 1MBMA 1LTOA 1EASA 1UTPA 2VB0A 1BBRK 1SLWB 3NXPA 2KM0A 1C2EA 2Y80A 1D6WA 1K21H 2WPDD 2Y82A 5A8YA 1IQMA 1FQ3A 2B7DH 5L6NH 1AQ7A 1EOLA 3ODDA 3BTFE 4FU9A 1C5TA 1A5HA 1GG6B 2BY9X 2GCHG 1GBMA 3FFGA 2VU8E 2FLBH 4OGXA 3TIUA 5A8XA 3PMAB 1VGCC 3LT3A 4YLQH 3ATLA 3RXRA 1BTPA 3GISB 4P02A 2FOCA 1INCA 1FN8A 1HDTH 1C1MA 2G8TA 2FOEA 2AERH 2NU1E 1A2CH 4AG2A 2G00A 1CU1A 4FUGA 1WAYB 4XOJA 2BQ7B 1KLJH 1CA0B 3TU7H 5C0TA 1C5NH 4GCHF 2NWNA 1QL8A 3P8GA 2HLCA 1J15A 2CV3A 2FIRH 1C2FA 5A0BA 1E1QD 4Q7YA 2GP9B 5F6MA 2O8TA 2WINI 1D6RA 2FOMB 1QHRB 1O35A 3F2FA 4U01A 5DO4H 2ZHWH 4KP0A 2FI3E 6GCHG 3TGJE 1QURH 2P8OC 2FLRH 1QA7A 3KYGA 2LNCA 1V2WT 2WPKS 2KX4A 4WXVA 1KTTB 1LVMA 1GMCG 2Q6DA 4X1QU 3ATWA 1LHCH 2ZDLA 2Z9KA 4BNRA 2Y81A 4H6TA 5TJXA 1TB6H 3A7XA 1A3EH 1VITF 1UHBA 3BIUH 3VB5A 1SL3A 1GBKA 5EQRA 4B2CA 5HKKD 3RLYH 2Y5HA 5EQSA 1AE5A 2VIPA 4Q63A 3L33A 2ZHEH 4X1PU 3ZVCA 1O30A 5GIBA 1LDTT 2QXGA 3TNSA 1C4Y2 5GCHG 1C4U2 1LKBA 2A45B 1A3BH 2FOAA 2HRVA 1VCPA 3M7QA 3OX7U 1OYQA 3UQVA 1B7XB 2EI6A 5EG4A 4DW2U 2V0BA 3A7YA 2ILNA 4MNVA 1IQFA 4HG6A 2SGEE 2CF9H 1WOFA 4ISOA 2QE7D 4B1TA 1XVMA 7GCHF 2KAIB 4FUHA 4I8JA 1CQQA 4ESTE 3SU5A 1ZPZA 5T3HA 1C1RA 4ZKNU 1AFEH 4KELA 2ZECA 5EJZA 1IQNA 2ZPQA 5C17A 1P11E 1W2KH 3NPSA 2HPPH 1NRNH 2QXIA 2Z3CA 3DFLA 2XW9A 2GMTB 3A8BA 3NZIA 1SG8B 3ZVFA 1CGJE 1OWIA 2SNWA 2Y7ZA 2ZHFH 3MH7A 1JRSA 2PTNA 3UIRA 1CHOG 1MKXK 3BG8A 3IITA 3TPIZ 4KTCA 1MTNC 1V2OT 1O2HA 3E91A 1Z71A 1G2MA 1F5LA 2F4LA 3VXFH 1GBCA 2C3SA 5F53A 4FETA 4ZHLU 1Z8IB 4CRFA 1P9UA 3DD2H 1DS2E 2W3IA 4NIXA 1PPZA 1IHTH 4ZHMU 2BY6X 4BANB 1EAWA 2H9TH 1D4PB 2J34A 1T8OA 1AZ8A 4BAHB 1EPTC 1MQ5A 3S0NA 4B74A 5AF9H 3FP7E 1Y59T 3P8OA 5C2ZA 1H9HE 3SQHE 2CMYA 2BVXH 1KDQA 1FNIA 1TNIA 1PPEE 4E7RG 3RXEA 1PQ8A 3K6YA 3VPKA 4YT6H 1GI2A 3KF2A 2GV7A 1SOZA 2JH0D 3FO8D 2RDLA 2R3UA 1P09A 1SKYE 1GBFA 4NWKA 1YPEH 3H7OA 4J2YB 1K2I1 4ASUD 1GI7B 2BYAX 1DOJA 1GBIA 4NA9H 4LXBH 2WV5A 1AGJA 1ID5H 2QC2A 1AO5A 1BTXA 3GDUA 4JZ1A 2PKSB 3KL6A 4FOUC 3O8BA 3RXFA 1DE7H 4YXWD 3A85A 1Z6EA 4FUIA 1LVOA 3UWIA 1MZAA 4ZKRU 1ZJDA 1MD8A 3CS7A 1TAWA 5CHAB 3UUZA 2BX3A 5KEDA 2B8OH 1P0SH 3P6ZB 1P10A 4M9FA 2J2UA 1V2ST 4ABIA 1O3LA 3QDZB 2WPMS 1WDIA 4O3UA 3LJOA 2PUXB 4A1VA 3QGJA 2BLQA 1SR5C 1AHTH 1BRUP 1C2IA 4XRNA 1VGCB 1C1NA 3U69H 2WUBA 4ZXXH 1CSOE 3V12A 2OUAA 1VR1H 4IC5A 1QRWA 1SLUB 3K2UA 1KXEA 2ANMH 1HAHH 3V7TA 3PLBA 1JIRA 1DWDH 3ZYDA 1KY9A 1Z8JB 1PPCE 3RXIA 2UUFB 2Q1JA 1JWTA 1XXFA 2A7HA 4ZHAA 4A6LA 3A89A 2H6MA 5G4BA 1SMFE 4A1XA 3M7UA 1GJCB 1C9PA 1ELBA 3SHAH 5JBBS 1QB1A 3F68H 1P3EA 1EATA 1MBQA 4NIVA 1KXFA 4Y76A 3MU5A 1OXGA 1T31A 3OEED 4NSYA 1FLEE 1TNHA 1TONA 4GLYA 3TLOA 2P8OB 3ZZ6A 2ZU2A 1FY5A 2BX4A 3PMJA 1NBME 4RN6A 3OU0A 3OSYA 2BLWA 3ATMA 1BHXB 2QXJA 2AHME 1NESE 3E16B 3GY3A 1H4WA 4MVNA 1T4VH 2XBVA 4INLA 3GICB 1L1NA 1MTWA 3WW7A 2BDAA 3LPRA 1Z8RA 1HIAA 1NZQH 1RJXB 3ZZAA 3SZEA 5GWZA 1GHXH 1TMBH 5FAHA 4Y8YA 4ZH8A 1AKSB 1SI5H 1AUJA 1O2KA 1ZHMA 3O8DA 5DP7A 2JETC 1C2LA 1S81A 4O9VA 2J94A 4Z1MD 1SGFA 1Y3XA 2GD4B 2GCHF 1BRCE 1W8BH 2BDIA 1DVAH 1GBEA 1NRRH 3HGNA 1CE5A 4CR5A 2Y6TA 1GCTC 3FZZA 1P2NA 3PWCA 4E7NA 2ZTZA 3KEEA 4DJZB 4IMZA 3O8RA 4D9RA 3PRDA 4BAKB 1SHYA 2SNVA 3ZZDA 1MMJN 2HVYB 1IQLA 1ZLRA 1THPB 1V2NT 2BDBA 1BTHH 2KCYA 1K1PA 1S6LA 1K1JA 4IBLH 4XD7D 5EOKA 1ESAA 1O2LA 2OTVA 2PWXA 1E37B 1AVGH 2CF8H 2OC0A 3ATIA 2BD2A 1HV7A 9LPRA 5LPFA 1EXFA 2M5TA 4AOQA 4ABGA 2ZDAH 3PTNA 1TGCA 5BRRE 1C1QA 6GCHF 4A7IB 5FL7D 5JB8S 3RXBA 1V2UT 2F9PA 3MU1A 1MTNB 1NBMD 1HAGE 1AI8H 2CK3D 4LZ4B 3A7TA 3EA8A 4F48B 1MAYA 3BTGE 1GHAF 5DP8A 2WPJS 1AY6H 1HB0B 1P3CA 2ANYA 2ZPSA 2AYWA 4AB8A 4AX9H 1AD8H 2F9UA 1ZSLA 3S7HB 1EB2A 2QGRA 2CHAC 1MUEB 2F9BH 1LKAA 2XRCA 4U30A 1C1WH 1FX0B 5T6GA 3ZVDA 2D8WA 5ESBA 1GBHA 1P2IA 4Z0KA 2BY7X 1EPTB 2ALPA 2FMJA 3EA9A 1WXRA 1PPBH 1FDPA 2VWOA 4P00A 5HIYA 4CH8B 2VJ1A 4K1SA 2GDEH 3LU9B 1H9LB 1QBOA 3S9AA 1LPZB 4I8KA 1DY9A 1W0JD 3D23A 1KLIH 5HIZA 4ZMAH 3U28C 2BLVA 2PV9B 3F0PA 3VGCC 2GZ9A 2DUCA 1D3PB 5L30H 2FPZA 2UWLA 2V7QD 1G36A 4ABBA 1IAUA 1ZRKA 3AAUA 3RXTA 5CMXH 3TJVA 1THSH 1P8VC 1O32A 2GX4A 5FX6A 4E06H 1O2GH 1EZUC 5FX5A 3T62A 2A32A 1RD3B 1IQEA 2BY5X 2ZTYA 1C1OA 4TWWA 3BG4C 4JZIA 2Y7XA 1MZDA 3I77A 2STBE 5HM9A 2TIOA 3SNEA 2HNTF 1TGTA 1V3XA 3BTTE 4KKDA 1CHOF 1FIWA 5EODA 5EIYA 2VGCC 1MU6B 3MH4A 3LDXH 5EXNA 4IGDA 2STAE 1ANEA 1HAXB 3LGWA 1UK4A 3MO9A 2XOKD 1LCYA 1MKWK 2LP6A 1C5VA 3P8NA 2ODPA 3E8LA 2Y5FA 1TFXA 1TABE 4NGAH 4IN1A 3RU4E 4J1YA 1YLCA 4UFDH 1UTJA 1C2MA 1C9TA 1A4WH 2ZIQH 3GY8A 1GHZA 2AMPA 4YESB 3MU0A 1HAZB 3QK1A 1F0SA 4MPUA 1V2RT 1ELVA 1WCZA 1YCPH 3MHWU 1NRQH 2P59A 3HKJB 3SI4H 2RFKC 1C5LH 2ODYB 2R3YA 1HAVA 3E90B 2R2MB 3E0PB 1BRAA 4OS6A 4UFFH 3KYFA 1L1GA 1DANH 4AGKA 2FOFA 1AUTC 4AGJA 4X8TH 3HGPA 4WXIA 1BTYA 1TGSZ 2GVFA 3UNSA 2DE9A 5LPRA 5FPYA 4ABEA 1QBNA 4X8VH 1FJSA 1HJAC 3A8DA 1OP0A 1T32A 3VFEA 1V2VT 5EPNA 3QTVH 1S0RA 1SQRA 9ESTA 1UHBB 1ETTH 1O5CB 3RC5A 3LC5A 3OFND 2BD5A 1E79D 3H7TA 3RDZA 1LHFH 2ZHDA 1KXBA 1XUJA 2A2XH 1S82A 1XUFA 1N6XA 2KCAA 1ABIH 1PYTD 2HALA 4DIHH 5EXMA 4NA8A 4Y10E 4ISIH 4DIIH 1FIZA 2JETB 2KCPA 4MPWA 3QX5H 3V13A 1FPCH 2TRMA 1SGEE 5C1UA 2ZQ2A 3DCLA 3SUGA 1LMWB 1Q3XA 2XWBI 4DOQA 4MNWA 2BY8X 1BMAA 3VEQB 2JDID 2QF4A 2K8IA 3FN8A 5C5OA 1BMMH 2FM2A 3HATH 2GZ8A 2R9PA 1F2SE 4BAMB 1O36A 1GCTB 3B23B 3M3VA 4B71A 2BM2A 4Q4LA 3SHCH 4BTIB 1T8LA 3TGKE 3P70B 4AORA 3LKWA 3SO3A 3RU4D 3MTYA 1FN6A 2BVRH 3U1IB 1ORFA 4OM9A 5T6DA 1KTSB 3CP7A 3SJ9A 1ELFA 1SGNE 1B0EA 1CA8B 2HGTH 5C5NA 1FY3A 2RCEA 4I8GA 3BTDE 4FUFA 3ZIAD 1TA6A 1HCGA 5DP4A 4XFQA 5LH8A 2QF3A 1A0JA 1B5GH 2CXVA 1UVSH 1YC0A 1RGQA 1YPHE 1TMUH 2O9QA 1JIMA 4FVBA 1O2XA 1UTKA 1O39A 3SNAA 4ZKOU 1TX6A 4K8YA 3UR6A 1P04A 3U98H 4ACBA 4XSKU 1O2TA 3SJ8A 2J5UA 2CHAB 1DLKB 1LPKB 2OC1A 2GT8A 3GS9A 4FXGH 1EKBB 3T2NA 3NUMA 1EJMA 2C90B 1HYLA 3N99A 1KLTA 1TOCB 5EJLA 4WMDA 4GAWA 1QR3E 1PYTC 1O3HA 2QV1A 4OS2A 1MU8B 2BDCA 1QJ1B 3A87A 5HXFA 1TNLA 1K1NA 3PRBA 1WQVH 2ZFSA 3GCTF 2VBCA 1KDQB 1FONA 3ZZ3A 3GCNA 1L2EA 2ZKSA 2XNIA 2FXRA 3K6ZA 2GJGA 6CHAC 1ZHPA 4ISHH 1UTLM 4KTSA 3ZVBA 5FCRA 2OQUA 4IS5A 3VGCB 1IHSH 2D2DA 3PV4A 1RFNA 3DSPA 1NC6A 4FU8A 1SFQB 1PFXC 1HAYB 2ZA5A 4MNYA 2ZGXH 4R0IA 3TH4H 1C5QA 2B0FA 1AMHA 4LK4A 1RS0A 3UY9A 2BOKA 4MPXA 3UPEA 4O03A 1GI8B 3ITIA 1LPGB 1YPGH 2BOHB 3U9AH 1H1BA 1O5EH 1NO9H 1C5RA 1ZTLA 5L2YH 4X2WA 5GJ4B 1HRTH 1AE8H 3SJIA 1NRPH 3OY6U 3BG4B 1SGTA 1TQ0B 1UK2A 4I32A 1GJ5H 3NCLA 4TY7A 2BQ6B 4K69A 1NU7B 5E0GA 4K8BA 5FXLA 2A1DB 3KQ5A 3URDA 2THFB 5L2ZH 2TBSA 3U8OH 5F8ZA 2EI7A 4Q7ZA 1O5DH 2VGCB 4TYDA 1O34A 4TY6A 2AS9A 1ZZZA 2OBOA 1K1LA 4INHA 4CRDA 1GBLA 1YF4A 1ANBA 1WTHD 2AGIX 2VWMA 2UUYA 3M61U 3F0OA 1IOEA 1G3CA 1JMOH 3GY5A 1AVXA 3E6PH 4DY7B 2OLGA 1WQSA 1T7CA 3QN7A 1GL1A 2YOLA 3SJOA 2RA0A 3A84A 2BDYA 3MU4A 2V3HH 4TSFD
chains in the Genus database with same CATH topology
2XXLA 2ESTE 5DP3A 4NFEA 3E0NB 1HAOH 3LGIA 4ZXYH 1S5SA 4XDEA 8GCHG 1RTLA 5DP9A 1OS8A 2Q6FA 1PQ7A 3SV6A 4JMYA 1SB1H 3SGAE 2F9NA 1TLDA 1BOQA 1O2VA 4UEHH 4FUBA 1ZJKA 1EJAA 3STIA 3I78A 2VVVA 5C1YA 2G51A 1O2ZA 1P2KA 2ODQA 3W94A 3T25A 1FZZA 1TBZH 2C8ZB 5C1XA 3A7ZA 1P03A 5EXLA 2ZGJA 3TK9A 1P02A 4D8NA 5F8XA 5AHGH 2F83A 2PTCE 2ZFQH 3RXCA 2FOGA 8LPRA 5F03A 4ABFA 4XBBA 3RXQA 3KHVA 1D9IA 1O5BB 3LGUA 5HM2A 3MH5A 1E35B 3GY6A 1QFKH 1Z8GA 1BITA 3ZZ8A 1QNJA 1J17T 1GMDG 4GSOA 2K1QA 2O8WA 3F9GA 2ZDNA 1FPHH 5EU8A 1K1MA 3FVFB 2EC9H 4AFZA 1VJ9U 1RTKA 2AMDA 2ZF0H 2VNTA 2ZGHA 7LPRA 5DPAA 1E36B 1EAXA 1C2DA 1YPHC 1P9SA 2Y5GA 3EDXB 4NCYA 3SJKA 1CT0E 2ZDMA 3SOSA 5E8EH 1A46H 2ZEBA 1H9IE 2Z9LA 1IQKA 3CS0A 3ENSB 1SPJA 3RXKA 1THRH 5I46H 4VGCC 1LVYA 1V2MT 6LPRA 2ANWA 1Y3YA 1SHHB 4Y79A 3M5LA 1P2OA 4ISNA 4WMEA 1Y5AT 2G55A 1ARBA 2VVUA 2C8YB 4AZ2B 1CO7E 4X6PA 4YZUA 3MFJA 1GJ9B 1SLXB 1QRXA 1TQ7B 3SNCA 1VJAU 1LQDB 8KME2 1A61H 1HAIH 5T6FA 4BAQB 5E2PA 2GT7A 5ESTE 2EA3A 4MNXA 2ZU5A 2FP7B 4CH2B 5C67A 3SQEE 1UK3A 1SVPA 1Z7KA 3SUDA 1ELGA 1O2WA 2ZU1A 1P06A 1RTFB 1KXDA 3F9HA 2H5DA 2PUQH 1CBWC 1ZPBA 4ZROA 3RXAA 1BTUA 1ZGIA 4X1NU 2ZGCA 1EUFA 4Q2KA 1G3DA 2IJOB 1OYTH 3V3MA 3D62A 4LZ1H 3FAOA 3QTOH 2TGPZ 4HGCA 1Z6JH 3S9BA 1A5GH 3ZV9A 3RMOH 1BTWA 4YO9A 2CGAA 4IC6A 2NU0E 4X8UH 5ETXA 1C5ZB 2BMGB 3BF6H 1EX3A 3UFAA 4MG3A 1WBGB 4D7GA 1TMTH 2XC0A 2A7CA 1O2IA 1GI5A 5SGAE 2WV4A 1DDJA 1V6DA 1E38B 2AEIH 2R0KA 6CHAB 5I25A 1IQIA 4D7FA 4AFSA 1Y8TA 1O5FH 1NS3A 3TNTA 4GCHG 3KNXA 2PSYA 1BZXE 2W5EA 3M5OA 1BB0B 2PLXA 2ZZUH 1Y5BT 3M36A 3MI4A 3QWCH 3STJA 1FMGA 1PPGE 2A5IA 4BOHA 1GJ4H 2P16A 4K2YA 3LH1A 2UWOA 3U8TH 1N1LA 8ESTE 4AFUA 3RXOA 3UREA 1F92A 5JBCS 4IW4E 1A0HB 2SGQE 1W7GH 4CRGA 1PPHE 3BEFB 4I33A 3MNXA 2VIOA 3EYDA 1GCDA 3M3TA 1XKAC 1O3KA 1UCYE 1JBUH 1BDAA 3LGVA 1J14A 2Z94A 1GMHG 4JYTA 2J95A 2GTBA 1UCYK 1O5GH 1FXYA 1O2MA 3LC3A 3PLKA 3TVJB 4B2AA 5A2MH 1C1UH 1QL9A 4TPIZ 4GPGA 4ABAA 2PHBA 3QO6A 1LHGH 2NU3E 5ABWA 3KCGH 1E0FD 3Q00A 3RMLH 2Z3DA 1G3EA 1V2KT 1C5PA 3M37A 1HAVB 1GMCF 3B9FH 2IOTA 3MU8A 3ZVGA 3DHKH 1O2OA 1QGFA 1DWBH 5E0HA 3H5CB 1C2HA 3DFJA 1YKTA 2VIWA 4DG4A 3A80A 1DX5M 2SGFE 1O2QA 1BA8B 4UFEH 2XYAA 4F49A 3OY5U 4UDWH 3PB1E 2ZGBH 4AG1A 1CA0C 7GCHG 1YCPK 1C1PA 1CT4E 1QRZA 2VIVA 4Y8XA 2O8MA 1C5SA 1GI6A 2ZCHP 2ZNKH 3T26A 5GCHF 2UUKB 1H8DH 3GDSA 1ELEE 1CHGA 1DM4B 2A0QB 3EA7A 1YPLH 2JKHA 1N8OC 2XWAA 2ZHQH 3SUEA 1DWEH 2Z3EA 3FANA 4R8TB 2AGEX 4DURA 2PW8H 1O38A 1G37A 2I6SA 1S6HA 3VB3A 2F3CE 3RU4T 1O2RA 4RKOB 5FHTA 2BDGA 3E1XB 5JPMH 2G4TA 1K1IA 1GJDB 1O2PA 2SFAA 2ZDKA 3VB6A 1WTGH 2C8XB 3ESTA 3T29A 4MTBA 1NFWA 1FY1A 1OP8A 1ESBA 2A5AA 3KQCA 2V6NA 1Y3UA 2RA3A 3LGTA 3UOUA 3SN8A 2GGVB 2JH5D 2QN5T 4X2VA 2GKVE 1QTFA 2WPIS 1MAXA 4BXWA 4VGCB 3Q3KA 3ZZ9A 2FYQA 1GDQA 1GGDC 2YNAA 4RSPA 5GDSH 2ZPRA 3PMHB 4O3TA 4IN2A 1J8AA 4B2BA 4JYVH 1QB6A 1S6FA 2ZU3A 3PMBB 4X1RU 8GCHF 1NROH 5HMAA 3L3TA 3HK6B 2I6QA 2B5TB 2FOBA 2QA9E 2PGQB 2ZP0H 1GBBA 1OWEA 2FTLE 3TJOA 1T8MA 2F9VA 1YPJH 1P01A 1P12E 1O3JA 1TWXB 1XVOA 3MNSA 4TWYA 1G32B 3KGPA 2AMQA 1WU1A 1LVBA 3SV9A 1CBWB 5K7RA 1Y3WA 5EW1H 1QQ4A 3RXLA 1O3CA 1A5IA 2ZQ1A 4JCNA 3I29A 1V2LT 2O8LA 1GMDF 4B75A 1JOUB 1OKXA 3B8JA 3ODFA 1NN6A 5FPSA 3BIVH 2BTCE 4XBCA 2ALVA 2BXTH 2P94A 1DWCH 3BTME 5EGMA 1GBJA 1BUIA 3A83A 2QYIA 1P2JA 1V2QT 3ZZCA 2YNBA 2BD3A 3MO6A 3T27A 4Y7BA 1BMNH 3PM3A 1SGQE 1KXAA 3TITA 1Q31A 1TX7A 3TGIE 4OS1A 3RMNH 1G30B 1AVWA 1SQAA 1DXPA 1O3NA 6ESTA 2O8UA 1AIXH 1EP5A 2SGAA 1GPZA 1O2JA 4NG9H 2H9EH 3RXPA 1PQ5A 2HNTE 1TRYA 1EZSC 2J92A 3M7TA 2SGPE 4Y7AA 1GHBG 1NTPA 2Q6GA 1C5UA 2NU2E 3KQBA 4NFFA 3BEUA 5DP6A 4AFQA 3R3GB 1O3EA 2P93A 2BB4A 4CRCA 3O8CA 4ABDA 3BTEE 3C1KA 1SOTA 1DT2A 1GJAB 7KMEH 1SGFG 3MNCA 4X6NA 3SV8A 2AFQB 1GJ6A 3RXUA 4WJG2 4JK6A 3BTKE 3SV2H 4Y6DA 3OYPA 2BDHA 3SU4A 1BRBE 4FUCA 1TE0A 4BTUB 2J38A 3T28A 2XBWA 2C93B 4AN7A 1XKBC 2BQWB 1O3PB 4FUJA 1X7AC 2PFEA 4K1EA 3KIDU 3GDVA 4ZKSU 3SNDA 3GY4A 1TPPA 1OOKB 5DKMA 1WUNH 4AYYB 4JZEH 4KTUA 4OS5A 3UNQA 3SU6A 4Y8ZA 1UMAH 2H9HA 3UTUH 1O37A 1LHEH 1GHWH 1KXCA 1V2PT 1RXPA 1GBTA 2PKAA 3HKIB 1O3GA 3T5FH 2GCTC 2ZFRH 1LHDH 1UVOA 1Z1JA 4BXSA 2VH0A 1TIOA 2QIQA 4GUXA 4RKJB 1YP9A 2FYRA 2PSXA 1EOJA 2OD3B 4FUDA 1XUHA 3ELAH 1T8NA 2UWPA 5GPIB 2GV6A 1AWFH 1OWDA 1SC8U 2WYGA 5A09A 4SGBE 2V3OH 1ZR0A 4WMFA 2W7SA 2FS8A 3ZVAA 3TK5A 1O2NA 1DPOA 1SLVB 1L1JA 2GZ7A 4BTTB 3LH3A 2V35A 3EE0B 1F5RA 1QB9A 1RIWC 1TPOA 3EQ0H 2XTTB 3SU0A 2QF0A 3SU1A 1YM0A 4ZAEA 1NT1A 2OXSA 2G81E 3PO1C 4WF8A 1FUJA 4JK5A 1UTQA 3A86A 3ZYEA 1GI0A 3LONA 4E05H 2ZU4A 2FO9A 1O3BA 4AB9A 1EAIA 2FEQH 1LQEA 2OC7A 3RXSA 1U6QA 5GXPA 5J4QA 2HPQH 4MLFB 1O0DH 1V2JT 1N8OB 2BVSH 4HI3A 1TX8A 1C2JA 1UTNA 1P2MA 2EEKA 3PLPA 1O2SA 3SGBE 2BHGA 4LOYH 4DGJA 5EPYA 1CVWH 1HJ8A 5CE1A 3F1SB 1HUTH 4A92A 1HPGA 4CRAA 1E34B 1GI1A 2IPHA 1HXEH 2C8WB 2CJIA 1SQOA 1NRSH 2VINA 1GHAG 1L4DA 1A0LA 1HJ9A 4UONA 1TOMH 1NFYA 1ZMJA 5HYOA 4CR9A 1BJUA 4K3JA 1AFQC 2QAAA 2BD9A 4SGAE 1ELTA 3U8RH 1GMHF 3K65B 5JB9S 2TGDA 3S9CA 3GY7A 1UO6A 1BMLA 3BV9B 3BSQA 3RXJA 2XC5A 5A0AE 1GJBB 1A7SA 1GVLA 1QL7A 2ANKH 3BN9A 2Z6BD 4NZQA 3S69A 2TGAA 5A8ZA 3GYLB 1YPKH 1GGDB 3MO3A 1BBRH 4A1TA 1TRNA 3F9EA 5HGGA 2EI8A 1NY22 2P3FH 2OQ5A 1EB1H 3MOCA 3BTQE 3HK3B 5C20A 1WYKA 4XBDA 3C27B 3TH3H 1SQTA 1ABJH 1VCWA 4XE4A 3ZZ5A 1AU8A 2B9LA 2G5NA 4K5ZA 1DXWA 1DLEA 4HTCH 5IYTA 3LGYA 1GVZA 2HVXA 1F0RA 3RXVA 2BZAA 4BAOB 2ZDVH 4Y71A 3UOPA 2HOBA 3RXMA 3ZZ4A 1O31A 2HNTC 1O5AB 3E3TA 3IWMA 3DT0H 1L4ZA 3VB7A 1DY8A 1TPSA 1FY4A 1UTOA 1IQHA 1QJ7B 3DA9B 3KN2A 4INKA 1YPMH 2FX6A 3UR9A 1ZGVA 1GVKB 2ZO3H 1QCPA 3SW2B 2F9OA 1HJAB 1P05A 1Y5UT 3ATKA 3QGNB 4YTAA 3W95A 1GJ8B 4X2YA 1EZXC 2ZCKP 2FOHA 1CT2E 1O3IA 1W14U 2ZFFH 1IQGA 3A82A 4X8SH 1DSUA 4A5TS 1HIAB 2PGBB 1NPMA 1W11U 1C1VH 4PROA 1JRTA 1KIGH 3ZZBA 3D65E 2WPHS 1Z1IA 1HXFH 1Q2WA 4UE7H 4AYVB 4I8LA 3GCHC 4NSVA 1JXPA 1NFXA 1S84A 1GDUA 4WWYA 4NIWA 1TALA 3DUXH 1RRKA 1IQJA 1TNKA 1D3DB 3GYMA 3UWJH 5E2OA 3GOVB 3EGKH 5JDUB 2Z9GA 3SNBA 2J4IA 2A31A 2W3KA 4WH6A 2ZFTA 3SU2A 3TH2H 2QXHA 5PTPA 1FI8A 1MTVA 5JBTA 1C5YB 2FZZA 3P17H 1PQAA 1ZRBA 1FY8E 1W10U 1DUEA 4GVUA 5IDKA 3RXHA 3LOXA 1L0ZA 1QY6A 4DCDA 1YLDA 3MYWA 4OGYA 5BPEA 4OS4A 3ZV8A 1ACBE 4M7GA 3ZZ7A 1DSTA 1GJ7B 3RXDA 3RMMH 1W12U 1ZMLA 2G4UA 2XBYA 2AGGX 3L6PA 1CGHA 1K28D 2GCTB 4DVAU 1SBWA 2LPRA 4IMQA 1UVTH 4QT8C 5LGOA 1V2TT 1MKXH 1GBDA 2P3TB 1W7XH 1SGRE 1AB9C 1HNEE 1LO6A 1HAPH 4Z6AH 2OBQA 1J9CH 1ELCA 1C2GA 2CN0H 4Q80A 2KAIA 2ZCLP 3RC4A 1O3FA 1XM1A 2XBXA 2XC4A 1W3CA 1ELAA 1ZHRA 1O2YA 1OP2A 3VXEH 2A4GA 2FX4A 2OINA 3SZNA 3G01A 1TPAE 2AIQA 1OPHB 1ZYOA 4YOIA 2VIDA 5AFZH 1YBWA 4ABJA 3AW1A 1D3QB 1RIWB 1SGYE 1SFIA 4O97A 5LPEA 4NA7A 3SBKA 3PO1B 1O3DA 2TPIZ 1XXDA 4FVDA 2A5KA 3WY8A 2A2QH 1VITH 3RC6A 1GWAA 1XMNB 2BLOA 3A8CA 4X6OA 1GHBF 1T4UH 3A81A 4NWLA 1G9IE 1QBVH 5FPTA 3UNRA 5F8TA 3UQOA 2RG3A 5FBEA 1BTZA 3A8AA 4DT7B 1DUAA 2WYJA 2OP9A 1FAXA 5DK1A 2VWNA 1TYNA 1M9UA 1XUGA 1GI9B 2D26C 4FU7A 4B73A 4H4FA 1D3TB 3PROA 5AFYH 1C5OH 1AFQB 1P2QA 1UJ1A 4JZFH 4WY3A 1SGCA 5DG6A 1QIXB 1KYNA 3MNBA 3FP6E 4F4OC 2NU4E 1C5XB 1K9OE 2VVCA 3D49H 1EJNA 4ISLA 7ESTE 5DP5A 1W13U 1PPFE 1TNGA 4JZDH 2WPLS 3GCTG 1FAKH 3SORA 1AWHB 4Y11E 4FUEA 1OWHA 3RXGA 2C4FH 2R0LA 1MTUA 1VITG 3M35A 1N6YA 4YOGA 4WH8A 2FODA 2W7UA 3JZ2B 2FESH 1OSSA 1EAUA 1ETSH 4HZHA 1TGBA 2A7JA 1TGNA 1YGCH 1YYY1 4CHAC 4ASHA 4U2WA 4NZLA 1OWJA 1S83A 1C2KA 1ETRH 5A0CA 3P92A 3BEIB 3OTJE 3PYHA 2GDDA 1GG6C 1F0TA 5FCKA 4YM9A 1QQUA 2Z9IA 1ZSJA 3NWUA 5FBIA 1BHXF 1MCTA 1P57B 2W26A 1UVPA 3MMGA 3M5NA 3NKKA 4K1TA 1DFPA 3QUMP 3Q3YA 1HBTH 2FS9A 1TRMA 4Y0YE 1C1TA 2FTMA 5TCCA 1EP6A 3AW0A 2TGTA 3Q77A 4TPYA 2ASUB 2A4OA 3MWIU 2FI5E 3VB4A 2F91A 2FDAA 1ELDE 1J16A 3JZ1B 1GHVH 1MD7A 4I7YH 3TJUA 1H8IH 2J9NA 1O2UA 3GCHB 1O3AA 4UFGH 4D76A 2ULLA 1EQ9A 3V0XA 1XUIA 1S0QA 1WV7H 3R0FA 1MQ6A 4MQAA 3SUFA 1TA2A 4JYUH 1C4V2 2IN2A 1NM6A 3SV7A 1TBRH 3P8FA 1BQYA 2H2ZA 2A4QA 2VWLA 1ZOMA 1C1SA 1GI4A 2XCFA 1O3MA 1MCVA 1AN1E 3IG6B 4K60A 4YT7H 1O33A