2FYQA

Crystal structure of the norwalk virus protease
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
181
structure length
170
Chain Sequence
APPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic structure of the Norwalk virus protease at 1.5-A resolution.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords Chymotrypsin-like cysteine proteinase
total genus 39
structure length 170
sequence length 181
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyqA01
1O2PA 1O3FA 2Z3DA 1B0FA 3KF2A 4NSYA 4U32A 1BTPA 2FPZA 2PW8H 4GUXA 1IHTH 2ZTXA 5JPMH 1CU1A 1O3DA 3L6PA 1P10A 3F6UH 2VIOA 1PPCE 4TY6A 1O5GH 2G52A 2O9QA 2F91A 1LQEA 2G5NA 3MU8A 1ARCA 4X6MA 3UR6A 5T6FA 2VIVA 1ZR0A 1Z8GA 5T6DA 1QQUA 1QJ6B 2ZPSA 5C2ZA 2HGTH 2C8ZB 2FESH 2XXLA 5T6GA 1O2IA 2ZDAH 2Z9JA 4FUJA 2BX4A 5C1XA 4Q2KA 1QB6A 3RMNH 1PPHE 2D26C 2QA9E 2CHAC 4A7IB 4CRAA 2NU2E 4Y8ZA 3VGCC 4OS6A 4UFGH 1TFXA 4AFQA 5EG4A 3HGNA 3RU4E 1OPHB 2FEQH 3RXIA 1C2HA 1CGIE 3Q3XA 3S7KB 3B8JA 3ZYDA 1HAYB 3GYMA 3KGPA 4AX9H 1AKSB 3LH1A 4B1TA 3NUMA 2ANKH 4TY7A 2QGRA 2BMGB 1BDAA 1TBZH 1UK2A 4X2YA 4BXWA 1DVAH 2XBWA 3U8RH 1NRQH 2ZGBH 1CA0C 1TA6A 1UCYE 4ZXXH 1ELBA 1TGCA 2BOHB 4FUGA 1LHDH 2C8WB 1THSH 1S5SA 4B74A 1YCPM 1CA8B 4AFZA 1C9TA 1YPEH 3D49H 5E8EH 2WUBA 3PWBA 2QY0B 2GP9B 1BJUA 3UUZA 3UTUH 4KTSA 1KTTB 1T4VH 2FMJA 3Q76A 5A8ZA 2G51A 5FPTA 1BTZA 4CHAC 1A46H 2ZHQH 1GDNA 2Z9LA 1WCZA 1F0UA 1F0SA 2ZCLP 5DK1A 1C5RA 4I8LA 1PPGE 3MMGA 1UCYH 2ZU3A 3UWJH 1HJAC 3AASA 1C5VA 1IQJA 3GCNA 2P3UB 1GI4A 2R0KA 1IOEA 2EI7A 1ZPCA 3U69H 3QTOH 1V2JT 4Y6DA 1HIAA 3RMMH 2WYGA 3EE0B 2AMDA 2J94A 1BTYA 2Z9GA 1RTLA 1PJPA 1BA8B 1TGSZ 1YPMH 3BV9B 4CRFA 4ISOA 4Y8XA 1T8MA 2ULLA 1YPGH 2BYAX 4IMQA 3RDZA 1XXFA 2GZ9A 3RXMA 1TX8A 2GTBA 1HV7A 1KLTA 4BNRA 3ZVEA 3QTVH 2H9TH 3ZV9A 3BG8A 2LNCA 3PMBB 1THRH 1GPZA 3GY4A 4I7YH 1HPGA 2J38A 2NU1E 1SGEE 3HKJB 2OXSA 3HPTB 1JXPA 6GCHF 1MAXA 2JETC 2H9HA 1A4WH 2Z9IA 1Z8IB 1QA0A 1JOUB 1NFYA 3M7TA 3K6YA 5JBAS 1ZJDA 4B76A 3NCLA 1K1OA 2FX4A 4MNVA 5GJ4B 2AIPA 3ZVCA 2ZC9H 3E0NB 1QL9A 2CXVA 1ZHMA 5IYTA 4X2XA 5FCKA 2P3FH 2A4OA 1YM0A 7KMEH 3QZRA 2HNTE 1EKBB 4MPWA 1HUTH 2UWOA 2TRMA 1FJSA 1BOQA 1MQ6A 1MTNC 1O36A 1O2MA 1QGFA 1XUKA 4JZ1A 5C20A 4YM9A 2BDYA 1MZAA 3MOCA 2HPQH 2O8UA 4IN1A 2F9PA 1F0RA 1N8OB 8GCHF 1OP2A 1O32A 4UFEH 3GY2A 1CBWB 2BD8A 3TH3H 3I78A 3TK9A 1K1JA 3BTHE 4ZHLU 1C5PA 1H8IH 1MQ5A 1YGCH 3OY6U 1GJDB 1XUGA 3ODDA 1Z7KA 1BITA 2XTTB 3GY3A 1Y3YA 1FPHH 3M3TA 1ZHPA 4IN2A 3PYHA 2GD4B 1GI6A 1LVYA 3MU5A 1KSNA 3T2NA 4Y7AA 1SQAA 3CS7A 1LCYA 2TGTA 2FI5E 5DKMA 5TJXA 1RXPA 2ZDKA 1MMJN 4NWLA 4LZ4B 1RGQA 1DWCH 1GBTA 1NESE 5C5NA 2ZFSA 4NSVA 1MZDA 1AKSA 1TGNA 1MTWA 2ZA5A 1DUEA 1C5YB 4AORA 1MKXH 1MKWH 4DGJA 2R0LA 3MH6A 2J92A 1C9PA 3MH5A 3P8GA 1Y3UA 1DFPA 1OWKA 2DE9A 3SJKA 3P70B 3ZZAA 3QDZB 1P2KA 1ABIH 1SFQB 4DY7B 1SGPE 2ZFFH 2GVFA 4KELA 1OWEA 1S83A 4H42U 1OWIA 3LKWA 3V12A 2PUQH 1RTFB 2AS9A 3HK3B 4ABIA 2BM2A 3SU0A 4A6LA 1TPSA 2Q6DA 1W7GH 3VB7A 5SGAE 1C2DA 1GWAA 1C1VH 5DP9A 3IITA 4XBBA 1GG6B 2ODPA 2ANWA 2G4UA 1P2NA 5A0BA 1AU8A 1O5DH 4FUCA 2ZIQH 3QX5H 1FAKH 4KKDA 1MAYA 5LGOA 1IQFA 3CS0A 3PM3A 1A0JA 1CT4E 3PMHB 2B9LA 1MU6B 1ANDA 3LGWA 2Y81A 3A80A 1W14U 1FONA 1G3CA 5FX5A 4MNWA 1O2JA 3PMAB 3W94A 2FOHA 4CBNA 2GV7A 2ZGHA 1YC0A 3A88A 1GI0A 3MO3A 4DVAU 1AY6H 3TJOA 1TABE 1TMBH 2ZGXH 4YESB 3F9EA 1TNGA 3S69A 1GI3A 1CT2E 2PTCE 1BMAA 3FP7E 2FOEA 3GCHC 1SGQE 1LQDB 2Y7ZA 1ELTA 2OTVA 3EA8A 2GMTB 2RCEA 3KCGH 3UREA 1C1UH 1NO9H 1DLKB 1GHAG 4E7RG 1GJ8B 5A8XA 1F7ZA 4MNYA 2H2ZA 2R3YA 1SMFE 5BPEA 1O3AA 1YKTA 4YTAA 3U98H 4Y10E 3FP8E 3BN9A 1SG8B 1WAYB 2YOLA 4TWYA 5G4BA 2K1QA 1JIMA 2GV6A 1O30A 5EXLA 5GCHF 1YP9A 2I6SA 3SU3A 1UK4A 5FHTA 5LH8A 2Z3CA 1C5NH 4WMEA 4QT8C 3TGIE 3T25A 2VIPA 3GY7A 1C1WH 1WSSH 4IW4E 1O38A 2BD3A 2BY8X 2IJOB 3ZZDA 1N6YA 1AFEH 2STBE 5LPFA 1O3KA 1PPZA 2F83A 2FZZA 4IC6A 2C90B 2H1UA 8KME2 1W7XH 3E91A 2BDBA 4WXIA 3ZZ3A 5EXMA 1GBMA 2RDLA 1ZTLA 2JH5D 1P3CA 3MYWA 1E35B 5DG6A 3RC4A 4UFDH 4MLFB 1W0YH 3DFJA 1O5FH 3O8DA 1ABJH 1ELFA 3Q3KA 2SFAA 4BXSA 2SGPE 2OC8A 2AMQA 2R3UA 4BOHA 5CMXH 4FVBA 3D23A 4F4OC 5PTPA 2UUFB 2Y5FA 3RLWH 1QBNA 1FY8E 1SPJA 5DO4H 4JYVH 4IMZA 1Q2WA 1NFWA 4BAMB 1TNJA 3UFAA 3BEIB 3SOSA 2R2WU 1FY5A 1GHAF 2P3TB 3GCHB 5E0HA 1ID5H 1Z1IA 4CRBA 3RC5A 1Z8JB 3L3TA 1MCVA 1P01A 4NGAH 3VXEH 1HRTH 2C8YB 2W3KA 1GJCB 2IN2A 1BUIA 3LJOA 2IPHA 1HFDA 4BAHB 3UNRA 3AAUA 1O34A 2G55A 3PV4A 2A2QH 3MH7A 1BZXE 1O3JA 1C1PA 3NXPA 1GL1A 3QN7A 1Z8RA 4BTTB 1GBDA 1PYTD 3SV9A 2BLVA 1VJAU 1BTHH 1MTUA 4NA8A 1BBRK 2ZCHP 2A4GA 1TPPA 1TONA 2A5AA 1VGCB 4WXVA 1VZQH 3LOXA 4D8NA 4E7NA 1G9IE 3RXOA 1T8NA 1YCPH 4B2CA 4X6OA 4ISLA 1FI8A 5CHAC 1W2KH 3SU4A 1A3EH 1GG6C 1QY6A 1FN8A 3QWCH 5ESBA 4Z6AH 1SGRE 2ZGCA 7GCHG 5L2YH 5C3NA 3MNSA 1HAHH 2A7CA 4YT6H 2F3CE 3RXJA 1L4DA 1O2HA 1ETSH 1RJXB 1HB0B 1G2MA 2VNTA 4NFFA 1TYNA 1DSUA 2P16A 1LPZB 1EX3A 1MCTA 2WYJA 3RXGA 1O2XA 1KXBA 1T32A 1EAUA 1HNEE 1GCTC 2FLRH 3RMOH 5DP8A 3UOPA 1YF4A 3M36A 1AFQB 1GI1A 4DURA 3SGAE 1O5CB 1ZMNA 4K8BA 3B23B 2VH0A 4X6PA 3HATH 2ALPA 3SN8A 4HFPB 1LHEH 1GMCG 1O2LA 4DW2U 2AERH 1O3BA 4E05H 5E2PA 1O39A 1C1NA 2OP9A 2STAE 2V3OH 5EQQA 4ZHAA 4ZMAH 3DT0H 3FZDA 3A7ZA 3ZZ4A 4MVNA 1G32B 2GZ8A 2ILNA 2GGVB 3ATIA 2FI3E 5DP7A 1P8VC 3GDVA 1A5HA 3KQDA 1CBWC 1VCQA 3KEEA 1A5GH 1UTPA 3LONA 1J9CH 1NC6A 1N8OC 1PFXC 3SHAH 1KIGH 1C5WB 1A3BH 1HCGA 3T27A 3BTKE 3MNCA 3RUOA 3F9GA 3FZZA 3EQ0H 1C5QA 3QLPH 1D6RA 1V2WT 3OU0A 3BEUA 4YOJA 2OBQA 4YZUA 2ODYB 1ANCA 3LGYA 3LH3A 1WBGB 2QV1A 1O2UA 1DICA 3MNXA 1SLUB 1AQ7A 1X7AC 1DT2A 1O3CA 2VIWA 1OKXA 3K9XB 1EXFA 1YPHE 2BQWB 5F8XA 2ANMH 4FU8A 2FX6A 3A83A 1YBWA 2XC0A 2BXUH 3E8LA 3ZZ5A 3C1KA 1KY9A 1TOCB 1GL0E 1H4WA 1K1MA 4JYUH 1QB9A 2BD9A 1NN6A 1TOMH 4KP0A 1UJ1A 1BTUA 1TRMA 2NU3E 5L30H 1WTHD 1ELEE 1BHXF 4Y7BA 3STIA 3TJVA 3TIUA 1BMLA 1LVBA 4U30A 3GISB 4NIXA 1TQ7B 6GCHG 2BVRH 4I8GA 2NU0E 1C2EA 2BY6X 3U1JB 1SGTA 3JZ2B 4AB8A 1AO5A 1V2TT 2VWOA 3CP7A 1GMCF 3MNBA 4ZHMU 2QXGA 3PROA 1C2LA 3SBKA 2VGCC 2ZFRH 5L2ZH 1GBCA 2FIRH 5ETXA 4NWKA 4R0IA 2FOBA 1BB0B 4CH8B 3A8AA 1C2MA 4LXBH 4FU7A 4ABGA 3TH4H 4OGYA 5HMAA 2A31A 4GAWA 1C5ZB 2F9BH 2ZNKH 4XBDA 1J16A 3I29A 1AD8H 2ZFQH 1DOJA 1CGHA 1CT0E 1OWJA 2ZFPH 5A0CA 1FY1A 1V2PT 2OUAA 3GCOA 1AHTH 3O8BA 3EYDA 2BDAA 1H9IE 3T29A 1GHZA 1F0TA 2A32A 3L33A 3RXDA 4CRCA 1GI9B 2J34A 3FAOA 1UTLM 1ZGIA 4YO9A 2V0BA 2PKAB 2OC7A 2TIOA 5AF9H 3T5FH 2PSYA 4TPYA 2Q6FA 1P2MA 2A7JA 4FUHA 1C4U2 1DX5M 2P8OC 3BIUH 1O2QA 2FS8A 1O2WA 1HDTH 4X8VH 4AYYB 1LHFH 3SGQE 3ZYEA 3ESTA 3MU4A 1GCDA 1A0LA 1MBMA 2GZ7A 1ZMJA 2ZKSA 2ZWLH 8ESTE 5J4SA 3MU1A 4WF8A 1AN1E 1L1NA 4XSKU 1A0HB 1UTJA 4YLUA 1YLCA 3ATLA 3VB5A 1BRBE 4R8TB 3RM2H 1TIOA 1TPOA 2D2DA 2VGCB 2PKSC 3ZZ9A 3UQOA 2P94A 1KXAA 1O37A 1EJNA 3MU0A 2Q1JA 5AHGH 3UPEA 4ABHA 3RXBA 3BTWE 3ZVAA 2PKAA 4AFSA 4B73A 3HGPA 4ABDA 2ZHWH 1P05A 1UCYK 1P03A 5FXLA 4NCYA 4D76A 1C4V2 3E1XB 1HXEH 1AE5A 1UTMA 3SNBA 3R0FA 1FUJA 4FUFA 3B9FH 1JBUH 2WPKS 3SZNA 5HM9A 2AYWA 1EATA 2WINI 1W0ZU 3OY5U 1TMUH 2HPPH 1EUFA 4ZKSU 1V2MT 4UE7H 2O8MA 5F6MA 1NM6A 2SGEE 1QR3E 4X8TH 1Y3XA 6ESTA 2CJIA 3RXRA 4B2AA 1C5LH 3SUDA 4CR5A 1SHHB 1FQ3A 2FM2A 1O5EH 2PKSB 3AVZA 1O3GA 2WUCA 3BIVH 3RXCA 1ZRBA 3F9HA 3STJA 3P6ZB 3RXTA 4BANB 1MTNB 3AW1A 4YLQH 2FOMB 2BHGA 4GVUA 1HAIH 5AFYH 1Z6JH 1C5TA 2GT8A 1UVUH 4D9RA 4HI3A 1B7XB 5GCHG 3TNSA 4ABEA 1SHYA 3TITA 2FOCA 3RXPA 2BXTH 3JZ1B 4Y8YA 2ZZUH 1EZXC 1H1BA 4MG3A 1NFUA 2I6QA 2F9OA 1TNIA 1P3EA 1OP0A 3QGJA 1NU7B 2A5KA 2ESTE 3RXLA 3SGBE 2W5EA 2ZO3H 5HGGA 5L6NH 4J2YB 3S9BA 1IQHA 4FUBA 1MTSA 3O8RA 1SSXA 3EAJA 2O8WA 3TNTA 2FP7B 2ZHFH 4I32A 1RIWC 3SU5A 4ISIH 1EPTC 1RFNA 4Q7XA 3EA9A 1G30B 1D9IA 4OS2A 4WJG2 3NPSA 2QYIA 3T62A 1V2QT 4F49A 3RXKA 5E0GA 1K1PA 5EGMA 6CHAB 1Y5BT 3FFGA 5CHAB 4A1VA 2A45B 1QHRB 4CREA 3VPKA 1H9LB 3ZVDA 4INLA 4WVPE 1SBWA 1MD7A 3KQEA 3KQBA 1J14A 3UIRA 3UR9A 2Z3EA 4MPXA 1C1QA 2C4FH 2OBOA 2P95A 1MBQA 2AGEX 1EB1H 3N7OA 4DT7B 1IQGA 4Y0ZE 4FUEA 1TGTA 4B2BA 2PHBA 1QL8A 1MKXK 2FOGA 1C1TA 1DITH 1S81A 2XRCA 5HYOA 2QXHA 4U01A 2TGDA 1CSOE 2ZI2H 4A5TS 3SJ9A 1SL3A 3GDUA 1G2LA 1XUHA 1ZPBA 2GX4A 5BRRE 2ZFTA 1BCUH 1AIXH 2BDHA 2BLOA 3P92A 1V6DA 1JMOH 3KHVA 2PWXA 3MO9A 1P06A 3GY8A 3BEFB 2BVXH 1FY3A 1EOLA 1XX9A 1QBOA 2PV9B 3E3TA 4NZQA 2VJ1A 1DM4B 1C2JA 1TPAE 1GJ5H 2OC1A 3Q3YA 2BZAA 1VITF 4ZXYH 2ZDLA 1XMNB 2A4RA 4A92A 4K69A 2XC4A 4AG1A 1O3LA 1FLEE 4WMDA 1AVWA 3M7UA 2ZPQA 2F9UA 3P8OA 1MTVA 3SORA 5J4QA 2D1JA 1GMDG 5EXNA 1LHCH 7GCHF 4ZH8A 3M35A 1S6HA 4ASHA 3QO6A 1GGDB 3A7VA 1K1NA 1IAUA 4ZROA 2QIQA 4X8UH 4M7GA 4UDWH 5C1YA 3NWUA 1V3XA 1DY9A 2JH0D 3A89A 5F8ZA 3PMJA 1GBAA 1FIWA 1C5XB 1Q31A 1SOTA 1TBQH 2FS9A 4I33A 1HJ9A 1UVTH 1OYTH 3M7QA 3A86A 1AZ8A 1F5RA 1KYNA 1TQ0B 5GWZA 1DANH 1KLJH 5F8TA 4Y11E 3A8CA 1Y3WA 2OQ5A 1LVOA 3QUMP 1C2FA 4Y79A 3M5OA 4RKOB 2DE8A 3VEQB 1DXPA 4O9VA 2XBXA 2G8TA 1ZSJA 4JZDH 4Y71A 4J1YA 2J9NA 3GY5A 1GI2A 2VVCA 4DJZB 1FAXA 2ODQA 3F9FA 3CENA 1OWHA 1C5OH 2Z94A 2H5DA 5IDKA 1OYQA 2PR3A 2HWLB 3LC5A 3SNAA 3A82A 3A87A 5DPAA 1GHBG 5HXFA 1D3DB 1V2KT 3KL6A 1HAPH 1K22H 1NPMA 4MPUA 2IOTA 1XVOA 3M61U 2QC2A 3K65B 5CE1A 1ZTKA 3SV2H 1PPBH 2YNAA 1XUFA 3LDXH 3M5LA 2HALA 1V2VT 4NZLA 1J15A 1BQYA 1OWDA 3M37A 5EU8A 3LGTA 1T31A 2XNIA 3TK6A 1EAWA 1SR5C 2UWPA 4K5ZA 2ALVA 4ABJA 1HXFH 1PQ7A 2UUJB 2BOKA 2GMTC 1ANEA 2BTCE 2PUXB 1FIZA 2SGAA 3PTBA 3GDSA 2P8OB 3E0PB 1IHSH 1K2I1 5DJ7A 4MNXA 2ZU2A 3U1IB 1K28D 4UD9H 2Z6BD 1T4UH 5DP6A 1YPLH 2FTMA 1WTGH 1AZZA 1LHGH 3LT3A 5JYIA 4XOJA 1TE0A 4CR9A 4O3UA 1ANBA 1P04A 1T8LA 1P11E 3BG4B 1W13U 3SI4H 3KQCA 1QURH 2A1DB 4IBLH 5FPYA 1ELDE 5K7RA 1O2RA 1SI5H 3LC3A 1GI8B 3P8FA 1FPCH 1G3DA 1PQ5A 2VVVA 3KNXA 3FVFB 2Q6GA 1O3IA 1ZTJA 3U9AH 1YYY1 2AFQB 2VIQA 2BB4A 1LPGB 3WY8A 3KN2A 1SGNE 1MUEB 3RXUA 4KTCA 4LZ1H 4XE4A 1K9OE 3S0NA 1DDJA 5EPYA 1MKWK 2ANYA 2PGQB 2ZDMA 1CVWH 1UK3A 2Y5HA 1QJ7B 1HAOH 1CO7E 4BAKB 1DLEA 4INHA 1ELGA 5A2MH 3VGCB 3UQVA 1TX7A 2ZU1A 2CHAB 1EPTB 1DE7H 4I8HA 1G3EA 4GCHF 4ZKOU 3A7TA 3A7XA 1E34B 3MO6A 2XW9A 1LKAA 1BJVA 5DP5A 4BTUB 3MHWU 5GPIB 2OQUA 1P02A 1AB9B 4JZEH 4SGAE 1UTKA 1MU8B 2BLWA 3SW2B 1VCPA 5A09A 1A61H 2F9NA 3DD2H 2ZU5A 1ETTH 1C1SA 1BBRE 3FP6E 3OSYA 3E16B 5AVDA 3VB3A 3ITIA 1O5BB 4HZHA 4H4FA 1K1IA 1UO6A 4K1TA 2ZECA 2BD2A 1L1GA 1IQLA 4AFUA 1TMTH 1Y5AT 5LPEA 4UFFH 1CHGA 2NWNA 4WMFA 2XCNA 1TRYA 1KXEA 3RU4T 2ZCKP 1T7CA 7LPRA 2BDIA 5E0JA 1DWEH 3GY6A 2EI6A 2V35A 2GDEH 4IC5A 3TK5A 3C27B 4O3TA 3E90B 1YCPK 3ELAH 1CE5A 2HNTC 3SHCH 1V2UT 3ZZ6A 1EAXA 3A8BA 2PSXA 2XWAA 4JZIA 3TJUA 1P12E 3ZZCA 5FX6A 1NTPA 4OS7A 4Q7ZA 1JWTA 1NRPH 1TNHA 3Q00A 1SGYE 2H9EH 1HAZB 2F9VA 4K1EA 1OOKB 2GCHF 1D6WA 2HNTF 3V0XA 2BQ7B 4X1NU 3URDA 1XKAC 1QJ1B 3UNQA 4AB9A 2BY5X 1GJ6A 1BRCE 1GBKA 1LDTT 5TCCA 3G01A 3ZZBA 1SQTA 3O8CA 3M3SA 1GJBB 2B5TB 1KXDA 3RXEA 3TJNA 1W11U 1A5IA 3PLBA 1RRKA 1KDQA 4WH6A 4D7FA 1ETRH 1O3MA 1ZLRA 3AAVA 4X2VA 4NFEA 1DXWA 1TAWA 3SNDA 3U8TH 1GBLA 1KXFA 3TU7H 2GDDA 1OSSA 3FANA 1OX1A 2ZDVH 1AWFH 1HBTH 1C1RA 1RD3B 1EZQA 1QCPA 3QGNB 2PLXA 1C1OA 1GHXH 3KIDU 3SNCA 4DCDA 3MFJA 3A8DA 1UVPA 3MI4A 4UONA 4YT7H 4AOQA 2XCFA 2RA3A 4XFQA 2QXJA 5ABWA 1B5GH 1VGCC 1B0EA 2ZHEH 5H4IB 1OP8A 5B6OA 1CHOF 3EGKH 5GXPA 1O2SA 4WH8A 3VB6A 4OS4A 3F68H 4IGDA 1QQ4A 1BRUP 2A2XH 2C93B 1LKBA 1O31A 4GHTA 2ZDNA 1NY22 1UMAH 4NA7A 1A2CH 1EP5A 1YPJH 1Y8TA 4MPVA 1EZSC 1T8OA 4JMYA 2FI4E 1NRRH 1QFKH 5K0HA 1O2YA 3M5MA 1NFXA 4DIIH 5ESTE 4DOQA 1ELVA 1O2KA 1GBIA 4X0WU 1SLXB 3SJOA 5EOKA 1CGJE 1C5SA 4ISHH 4RKJB 5C5OA 1EOJA 2OC0A 1A7SA 2A0QB 4X6NA 1F5KU 1Z71A 3P8NA 3LU9B 4JCNA 2AH4X 3LGVA 2ZHDA 2H5CA 5EQRA 1ZSKA 3ODFA 5EW2H 5GIBA 1W8BH 1PQAA 3ENSB 3NKKA 2WPLS 2ZQ1A 1AVXA 2ZPRA 1FDPA 2W7SA 1Z6EA 2VINA 3RC6A 1KTSB 1O2VA 1YPKH 1EASA 3H7TA 1FNIA 2EI8A 2HOBA 4AG2A 2QAAA 1GCTB 2AMPA 3RM0H 1PYTC 1A1RA 1O33A 1EAIA 3QZQA 2M5TA 2UUYA 1C1MA 3S9AA 4IS5A 1O3HA 1O2OA 3VFEA 1L0ZA 1QIXB 1LO6A 2V6NA 3GICB 1ZGVA 3EA7A 1DY8A 3TGJE 2QCYA 2SGDE 2XBYA 4NIYA 2AGGX 2HLCA 1G36A 1GGDC 4Y76A 3MWIU 1E37B 3QK1A 1LVMA 1BTXA 3SV6A 2WV4A 4FUDA 1O3OA 2NU4E 3ZVGA 4I8JA 4XBCA 2ZQ2A 5FPSA 1VJ9U 1E0FD 2G00A 4HTCH 2LPRA 2FOAA 2ZTYA 3DA9B 3T28A 1Q3XA 2G4TA 5AFZH 5E2OA 1UVSH 3D62A 2BY9X 3S7HB 4MTBA 2BZ6H 5EODA 3OYPA 1GJAB 1AVGH 1VR1H 1SQOA 1EZUC 1SVPA 2D8WA 4X1PU 2B8OH 2THFB 3DFLA 1NS3A 4JYTA 1AB9C 3SJ8A 1SLVB 4A1XA 2ZP0H 2SNVA 3SU6A 2W7UA 4O97A 1GMHG 4MQAA 2J4IA 4ABAA 1IQNA 5JDUB 1XKBC 1O3PB 2VIDA 1XUJA 1OS8A 2ZU4A 1DS2E 1ARBA 3MH4A 1WYKA 1AFQC 3TLOA 4ABFA 3A7YA 3RXVA 2XC5A 1TWXB 1CA0B 1QL7A 2TPIZ 3ATWA 4OS5A 3SUFA 1W10U 2W26A 3URCA 2A5IA 1FY4A 2RA0A 1QTFA 3SU2A 2Y82A 1P0SH 3RXQA 3I77A 1UTOA 3D65E 1JIRA 1AUTC 1ZJKA 1GVZA 2J2UA 1GJ7B 1E38B 3DUXH 1WUNH 5EQSA 1DSTA 1W12U 3TGKE 2HVXA 4FUIA 1BBRH 1O5AB 3EDXB 2ASUB 2AEIH 1XM1A 1L4ZA 2JKHA 5GDSH 1O2NA 2FDAA 1S0RA 1TNLA 4BAQB 1C2KA 1FV9A 3UWIA 4JK5A 1TRNA 1S84A 2QF0A 3SNEA 1NU9A 1UTQA 2KAIB 2G81E 2VB0A 4GLYA 4D7GA 2J95A 3DHKH 3GOVB 1U6QA 1KLIH 1WQVH 4AGKA 3A81A 2BQ6B 3ATMA 1HAXB 4CH2B 3HK6B 1D3TB 4SGBE 5I46H 3RLYH 3GCTF 1V2OT 1NRNH 2FODA 1VCWA 5JBBS 4FVDA 1ZRKA 1TNKA 4VGCC 2GKVE 4AN7A 4WY3A 1V2ST 1GMHF 3VXFH 3AW0A 1YPHC 1ACBE 1XUIA 4THNH 1EQ9A 1LPKB 1ZZZA 5FCRA 2P59A 3PO1C 1GBJA 2A7HA 1N1LA 4NA9H 1LMWB 1S82A 3RMLH 1XVMA 2Y5GA 5A8YA 4INKA 3H5CB 1KXCA 3VB4A 1V2NT 2Y7XA 2R2MB 1D4PB 2VVUA 3S9CA 3SV7A 1CHOG 1DWBH 1ELCA 1GJ4H 3V3MA 4ESTE 1ESAA 5LPRA 1EP6A 1TGBA 4UEHH 4JK6A 1M9UA 1VITG 3K2UA 1PQ8A 1NT1A 1XXDA 2UUKB 1SGDE 4NG9H 3K6ZA 4MDSA 3Q77A 2ZGJA 2AIQA 3ZZ7A 4GCHG 4K2YA 1BTWA 1ORFA 5JBCS 1UVOA 4RSPA 2B0FA 1AGJA 2JETB 2GCTC 3LPRA 1ESBA 1GMDF 3RXHA 1IQEA 1DPOA 4ABBA 4K1SA 5FBEA 3W95A 3BTQE 3PB1E 1S85A 4CRDA 1FMGA 2QN5T 3NZIA 1QBVH 3LIWA 1FN6A 2O8TA 3LGUA 2VWLA 4ZUHA 1Y59T 1SGIB 1CQQA 2CMYA 3PLKA 2A4QA 4YOIA 2XBVA 1D3PB 3RXFA 1AMHA 4K8YA 1TX6A 4Q7YA 1TALA 2PFEA 2CV3A 4GPGA 3P95A 4TPIZ 1HIAB 2QXIA 1HAVB 3IG6B 4LOYH 1S0QA 1UHBB 2BD7A 2OLGA 4OGXA 4H6SB 1H8DH 1QA7A 1RIWB 1WU1A 4XDEA 3BSQA 3R3GB 1JRTA 1GBHA 2VWMA 1GBFA 2ZG0H 4GSOA 8LPRA 1ZSLA 2OCVB 1ZMLA 4NIWA 2AGIX 1C2IA 1L1JA 4TWWA 4BTIB 2CF8H 3BF6H 4A1TA 1HJAB 2DUCA 3BG4C 3OX7U 1THPB 4U2WA 3A7WA 1LTOA 3M3VA 1O35A 3BTME 1OXGA 3BTEE 1SFIA 5DGJA 1QRZA 4JZFH 4LK4A 1GHBF 5I25A 4ZKNU 2GCHG 2TBSA 2CGAA 2GT7A 1SGFG 1C5UA 1GVKB 1TBRH 4CRGA 1PPEE 2Z7FE 5TCAA 2O8LA 4K60A 1KDQB 1F5LA 2VU8E 4BAOB 2VH6A 2W3IA 4X1SU 4AZ2B 1G3BA 2OINA 3RXAA 9ESTA 2EEKA 2G5VA 2R9PA 2ZTZA 1Z1JA 3HKIB 2JH6D 3RU4D 5T3HA 8GCHG 1SOZA 3PTNA 2BDGA 2EC9H 1HAGE 3A84A 3BTFE 1BMNH 1NRSH 1N6XA 3V13A 2KAIA 2WPHS 6CHAC 2BVSH 4ZAEA 3RXSA 1P57B 4X2WA 1AUJA 1UHBA 1ELAA 4O03A 1GHWH 4B71A 3TPIZ 2FTLE 3SUEA 3ZV8A 1NZQH 1EJMA 1QRWA 1HAVA 1P2OA 2FO9A 5FAHA 1HJ8A 2WPMS 1QB1A 2FOFA 1P9UA 1AE8H 1Y5UT 2PTNA 2QF3A 4YOGA 3BTDE 3UOUA 1O0DH 4ISNA 4D9QA 1UTNA 1PPFE 2SNWA 1DUAA 3ZZ8A 1GVLA 2TGAA 1EB2A 1EJAA 1BRAA 1F2SE 4FXGH 1EPTA 1L2EA 1ESTA 4CBOA 1IQMA 5F03A 1C4Y2 2ZF0H 3TH2H 1J17T 1INCA 4Z0KA 4E06H 2C3SA 1BHXB 2FWWA 1O3NA 4X1RU 5C1UA 3F1SB 3M5NA 4DG4A 4I8KA 1SGCA 3SV8A 1FXYA 2TGPZ 2BX3A 2BLQA 2XYAA 4FU9A 2PGBB 2B7DH 4WWYA 3PLPA 1WQSA 2WPJS 5C67A 3NK8A 2BY7X 3PO1B 4TYDA 1P2IA 1WOFA 1SC8U 3SI3H 4ZKRU 1FZZA 3GCTG 2BD4A 5DP3A 3T26A 1J8AA 1IQKA 1K21H 2EA3A 3RP2A 1HGTH 4GHQA 4VGCB 4OS1A 2FXRA 1GJ9B 3UNSA 1P2QA 5JB9S 4DIHH 1QRXA 1GI5A 1K1LA 1F92A 3ATKA 2XWBI 1P09A 4Q80A 1W3CA 3E6PH 4KTUA 2FYRA 4NIVA 1V2RT 1D3QB 5FBIA 2VWNA 3SO3A 1BT7A 1AWHB 2BDCA 1BIOA 1C2GA 6LPRA 7ESTE 5HM2A 3P17H 2UWLA 2BD5A 1WV7H 1GBEA 2FLBH 1O2GH 1GDQA 1O2TA 4KGAA 3SQHE 1ZYOA 1MH0A 4HGCA 9LPRA 3MTYA 2Y6TA 2C8XB 3BTTE 2WPIS 1P9SA 1AI8H 1GHVH 2WV5A 3SUGA 1HLTH 1O3EA 1SGFA 2ZEBA 5EW1H 3IWMA 1C5MD 1NROH 2P93A 2SGQE 5DP4A 1BMMH 2OD3B 4X8SH 3U8OH 4RN6A 4PROA 3V7TA 5JBTA 5JB8S 1GDUA 1YLDA 1JRSA 4AGJA 1TB6H 4K3JA 3SU1A 3TVJB 3SJIA 1HYLA 1MD8A 2HRVA 1RTKA 1V2LT 4H6TA 4Y0YE 1H9HE 3LJJA 2GCTB 4I31A 1RS0A 1QNJA 1GHYH 1G37A 5EPNA 4X1QU 2YNBA 2H6MA 1IQIA 2Y80A 2RG3A 1SLWB 1GBBA 4CHAB 5A0AE 1GI7B 2FYQA 1S6FA 3GYLB 2Z9KA 3A85A 3BTGE 3PWCA 2SGFE 3UY9A 3LGIA 1ZPZA 1O2ZA 4AYVB 3ZVFA 3H7OA 1P2JA 3ZVBA 2V3HH 1Y3VA 1TA2A 1SB1H 4B75A 1E36B 1ZOMA 1VITH 3OTJE 1DWDH 3SQEE 2CN0H 1TLDA 1ZHRA 2CF9H
chains in the Genus database with same CATH superfamily
1O2PA 1O3FA 2Z3DA 1B0FA 3KF2A 4NSYA 4U32A 1BTPA 2FPZA 2PW8H 4GUXA 1IHTH 2ZTXA 3F2GA 5JPMH 1CU1A 1O3DA 3L6PA 1P10A 3F6UH 2VIOA 1PPCE 4TY6A 1O5GH 2G52A 2O9QA 2F91A 1LQEA 2G5NA 3MU8A 1ARCA 4X6MA 3UR6A 5T6FA 2VIVA 2JJ2D 1ZR0A 1Z8GA 5T6DA 1QQUA 1QJ6B 2ZPSA 5C2ZA 2HGTH 2C8ZB 2FESH 2XXLA 5T6GA 1O2IA 2ZDAH 2Z9JA 1MABB 4FUJA 2BX4A 5C1XA 4Q2KA 1QB6A 3RMNH 1PPHE 2D26C 2QA9E 2CHAC 4A7IB 4CRAA 2NU2E 4Y8ZA 3VGCC 4OS6A 4UFGH 1TFXA 4AFQA 5EG4A 3HGNA 3RU4E 1OPHB 2FEQH 3RXIA 1C2HA 1CGIE 3Q3XA 3S7KB 3B8JA 3ZYDA 1HAYB 3GYMA 3KGPA 4AX9H 1AKSB 3LH1A 4B1TA 3NUMA 2ANKH 4TY7A 2QGRA 2BMGB 2KR7A 1BDAA 1TBZH 1UK2A 4X2YA 4BXWA 1DVAH 2XBWA 3U8RH 1NRQH 2ZGBH 1CA0C 1TA6A 1UCYE 4ZXXH 1ELBA 1TGCA 2BOHB 4FUGA 1LHDH 2C8WB 1THSH 1S5SA 4B74A 1YCPM 1CA8B 4AFZA 1C9TA 1YPEH 3D49H 5E8EH 2WUBA 3PWBA 2QY0B 2PP6A 2GP9B 1BJUA 3UUZA 3UTUH 4KTSA 1EFRD 1KTTB 1T4VH 2FMJA 3Q76A 5A8ZA 2G51A 5FPTA 1BTZA 4CHAC 1A46H 4B6EA 2ZHQH 1GDNA 2J98B 2Z9LA 1WCZA 1F0UA 1F0SA 2ZCLP 5CDFE 4P02A 5DK1A 1C5RA 4I8LA 1PPGE 3MMGA 1UCYH 3PV2A 2ZU3A 3UWJH 1HJAC 3AASA 1C5VA 1IQJA 3GCNA 3EE7A 2P3UB 4AC9A 1GI4A 2R0KA 1IOEA 2EI7A 1ZPCA 3U69H 3QTOH 1V2JT 4Y6DA 1HIAA 3RMMH 3N7DA 2WYGA 3EE0B 2AMDA 2J94A 1BTYA 2Z9GA 1RTLA 1PJPA 1BA8B 2WSSD 1TGSZ 1YPMH 3BV9B 4CRFA 4ISOA 4Y8XA 1T8MA 2ULLA 1YPGH 2BYAX 4IMQA 3RDZA 1XXFA 2GZ9A 3RXMA 1TX8A 2GTBA 1HV7A 1KLTA 5FL7D 4BNRA 3ZVEA 5F53A 3QTVH 2H9TH 3ZV9A 3BG8A 2LNCA 3PMBB 1THRH 1GPZA 3GY4A 4I7YH 1HPGA 2J38A 3GS9A 2NU1E 1SGEE 3HKJB 2OXSA 4P00A 1S6LA 2QF4A 3HPTB 1JXPA 6GCHF 1MAXA 2JETC 2H9HA 1A4WH 2Z9IA 1Z8IB 1QA0A 1JOUB 1NFYA 3M7TA 3K6YA 5JBAS 1ZJDA 4B76A 3NCLA 1K1OA 2FX4A 4MNVA 5GJ4B 2AIPA 3ZVCA 2ZC9H 3E0NB 1QL9A 2CXVA 1ZHMA 1SQRA 2J98A 5IYTA 4X2XA 5FCKA 2P3FH 2A4OA 1YM0A 7KMEH 3QZRA 3NRLA 2HNTE 4FOUC 1EKBB 4MPWA 1HUTH 2YMSD 2UWOA 2TRMA 1FJSA 1BOQA 1MQ6A 1MTNC 1O36A 1O2MA 1QGFA 1XUKA 4JZ1A 5C20A 4YM9A 2BDYA 1MZAA 3MOCA 2HPQH 2O8UA 4IN1A 2F9PA 1F0RA 1N8OB 8GCHF 1OP2A 1O32A 4UFEH 3GY2A 1CBWB 2BD8A 3TH3H 3I78A 3TK9A 1K1JA 2XOKD 3BTHE 4ZHLU 1C5PA 1H8IH 3F2FA 1MQ5A 1YGCH 3OY6U 1GJDB 1XUGA 3ODDA 1Z7KA 1BITA 2XTTB 3GY3A 1Y3YA 1FPHH 3M3TA 1ZHPA 4IN2A 3PYHA 2GD4B 1GI6A 1LVYA 3MU5A 3KQ5A 2KFWA 1KSNA 3T2NA 3WWBA 4Y7AA 1SQAA 3CS7A 1LCYA 2TGTA 2FI5E 5DKMA 3FKSD 5TJXA 1RXPA 2ZDKA 1MMJN 4NWLA 4LZ4B 1RGQA 1DWCH 1GBTA 1NESE 5C5NA 2ZFSA 4NSVA 1MZDA 1AKSA 1TGNA 1MTWA 2ZA5A 1DUEA 1C5YB 4AORA 1MKXH 3CNRA 1MKWH 4DGJA 2R0LA 3MH6A 2J92A 1C9PA 3MH5A 3P8GA 1Y3UA 1DFPA 1OWKA 2KCAA 1SKYE 2DE9A 3SJKA 3P70B 3ZZAA 2KZ4A 3QDZB 1P2KA 1ABIH 1SFQB 4DY7B 1SGPE 2ZFFH 2GVFA 4KELA 1OWEA 1S83A 3F0PA 4H42U 1OWIA 3LKWA 3V12A 2PUQH 1RTFB 2AS9A 3HK3B 4ABIA 2BM2A 3SU0A 4A6LA 1TPSA 2Q6DA 1W7GH 3VB7A 5SGAE 1C2DA 1GWAA 1C1VH 5DP9A 3IITA 4XBBA 1GG6B 2ODPA 2ANWA 2G4UA 1P2NA 5A0BA 1AU8A 1O5DH 4FUCA 2ZIQH 3QX5H 1FAKH 4KKDA 1MAYA 5LGOA 1IQFA 3CS0A 3PM3A 1A0JA 1CT4E 3PMHB 2B9LA 1MU6B 1ANDA 2KM0A 3LGWA 2Y81A 3A80A 1W14U 1FONA 1G3CA 5FX5A 4MNWA 1O2JA 3PMAB 3W94A 2FOHA 4CBNA 2GV7A 2ZGHA 1YC0A 3A88A 1GI0A 3MO3A 4DVAU 1AY6H 2LELA 3TJOA 1TABE 1TMBH 2ZGXH 4YESB 3F9EA 1TNGA 3S69A 1GI3A 1CT2E 2PTCE 1BMAA 3FP7E 2FOEA 3GCHC 1SGQE 1LQDB 2Y7ZA 1ELTA 2OTVA 3EA8A 2GMTB 2RCEA 3KCGH 3UREA 1C1UH 1NO9H 1DLKB 2JJ1D 1GHAG 4E7RG 1GJ8B 5A8XA 1F7ZA 4MNYA 2H2ZA 2R3YA 1SMFE 5BPEA 1O3AA 1YKTA 4YTAA 3U98H 4Y10E 3FP8E 3BN9A 1SG8B 1WAYB 2YOLA 4TWYA 5G4BA 2K1QA 1JIMA 2GV6A 5B6LA 1O30A 5EXLA 5GCHF 1YP9A 2I6SA 3SU3A 1UK4A 5FHTA 5LH8A 2Z3CA 1C5NH 4WMEA 4QT8C 5KEDA 3TGIE 3T25A 2VIPA 3GY7A 1C1WH 1WSSH 1WXRA 4IW4E 1O38A 2BD3A 2L6OA 2BY8X 2IJOB 3ZZDA 1N6YA 1AFEH 2STBE 2V7QD 4Q63A 4M9FA 5LPFA 1O3KA 1PPZA 2F83A 2FZZA 4IC6A 2C90B 2H1UA 8KME2 1W7XH 1W0JD 3OEED 2WV9A 3E91A 2BDBA 4WXIA 3ZZ3A 5EXMA 1GBMA 2RDLA 1ZTLA 2JH5D 1P3CA 3MYWA 3OEHD 1E35B 5DG6A 1E79D 3RC4A 4UFDH 4MLFB 1W0YH 3DFJA 1O5FH 3O8DA 5EJZA 1ABJH 1ELFA 3Q3KA 2SFAA 5T1VA 4BXSA 2SGPE 2OC8A 2AMQA 2R3UA 4BOHA 5CMXH 4FVBA 3D23A 3F2HA 4F4OC 5PTPA 2UUFB 2Y5FA 3RLWH 1COWD 1QBNA 1FY8E 1SPJA 5DO4H 4JYVH 4IMZA 1Q2WA 1NFWA 4BAMB 1TNJA 4RT0A 3UFAA 3BEIB 3SOSA 2R2WU 1FY5A 1GHAF 2P3TB 3GCHB 5E0HA 1ID5H 1Z1IA 4CRBA 3RC5A 1Z8JB 3L3TA 1MCVA 1P01A 4NGAH 3VXEH 1HRTH 2C8YB 2W3KA 1GJCB 2IN2A 1BUIA 3DSOA 3LJOA 2IPHA 1HFDA 4BAHB 3UNRA 3AAUA 1O34A 2G55A 3PV4A 2A2QH 3MH7A 1BZXE 1O3JA 1C1PA 3DSPA 3NXPA 1GL1A 3QN7A 1Z8RA 4BTTB 1GBDA 1PYTD 3SV9A 2BLVA 1VJAU 1BTHH 1MTUA 4NA8A 1BBRK 2ZCHP 2YMSB 2A4GA 1TPPA 1TONA 2A5AA 1VGCB 4WXVA 1VZQH 5C17A 3LOXA 4D8NA 4E7NA 1G9IE 3RXOA 1T8NA 1YCPH 4B2CA 4X6OA 4ISLA 1FI8A 5CHAC 1W2KH 3SU4A 1A3EH 1GG6C 1QY6A 1FN8A 3QWCH 5ESBA 4Z6AH 1SGRE 2ZGCA 7GCHG 5L2YH 2EQNA 5C3NA 3MNSA 1HAHH 2A7CA 4YT6H 2F3CE 3RXJA 1L4DA 1O2HA 1ETSH 1RJXB 1HB0B 1G2MA 2VNTA 4NFFA 1TYNA 1DSUA 2P16A 1LPZB 1EX3A 1MCTA 2WYJA 3RXGA 1O2XA 1KXBA 1T32A 1EAUA 1HNEE 1GCTC 2FLRH 3RMOH 5HKKD 5DP8A 3UOPA 1YF4A 3M36A 3N99A 1AFQB 1GI1A 5IK2D 4DURA 3SGAE 1O5CB 1ZMNA 4K8BA 3B23B 2VH0A 4X6PA 3HATH 2ALPA 3SN8A 1OHHD 4HFPB 4Q4LA 1LHEH 1GMCG 1O2LA 4TT3D 4DW2U 2AERH 1O3BA 4E05H 5E2PA 1O39A 1C1NA 2OP9A 2STAE 2V3OH 5EQQA 4ZHAA 4ZMAH 3DT0H 3FZDA 3A7ZA 3ZZ4A 4MVNA 1G32B 2RFKC 2GZ8A 2ILNA 2GGVB 3ATIA 2FI3E 5DP7A 1P8VC 3GDVA 1A5HA 3KQDA 1CBWC 1VCQA 3KEEA 1A5GH 1UTPA 3LONA 1J9CH 1NC6A 1N8OC 1PFXC 3SHAH 3FN8A 1KIGH 1C5WB 1A3BH 1HCGA 3T27A 3BTKE 3MNCA 3RUOA 3F9GA 3FZZA 3EQ0H 1C5QA 3QLPH 1D6RA 5KGOA 1V2WT 3OU0A 3BEUA 4YOJA 2OBQA 4YZUA 2ODYB 1ANCA 3LGYA 3LH3A 1NBMD 1WBGB 2QV1A 1O2UA 2CK3D 1DICA 1VKYA 3MNXA 1SLUB 1AQ7A 1X7AC 1DT2A 1O3CA 2VIWA 1OKXA 3K9XB 1EXFA 1YPHE 2BQWB 5F8XA 2ANMH 4FU8A 2FX6A 3A83A 1YBWA 2XC0A 2BXUH 3E8LA 2IPQX 3C1KA 1KY9A 3ZZ5A 1TOCB 1GL0E 1H4WA 1K1MA 4JYUH 1QB9A 2BD9A 1NN6A 1TOMH 4KP0A 1UJ1A 1BTUA 1TRMA 2NU3E 5L30H 1WTHD 1ELEE 1BHXF 4Y7BA 3STIA 3TJVA 3TIUA 1BMLA 1LVBA 4U30A 3GISB 4NIXA 1TQ7B 6GCHG 2BVRH 4I8GA 2NU0E 1C2EA 2BY6X 3U1JB 1SGTA 3JZ2B 4AB8A 1AO5A 1V2TT 2VWOA 3CP7A 2M2AA 1GMCF 3MNBA 4ZHMU 2QXGA 3PROA 1C2LA 3SBKA 2VGCC 2ZFRH 5L2ZH 1GBCA 2FIRH 5ETXA 4NWKA 4R0IA 2FOBA 1BB0B 4CH8B 3A8AA 1C2MA 4LXBH 3N7EA 4FU7A 4ABGA 3TH4H 4OGYA 5HMAA 2A31A 4GAWA 1C5ZB 2F9BH 2ZNKH 4XBDA 3FO8D 1J16A 3I29A 1AD8H 2ZFQH 1E1QD 1DOJA 1CGHA 1CT0E 1OWJA 2ZFPH 5A0CA 1FY1A 1V2PT 2OUAA 3GCOA 1AHTH 3O8BA 4FETA 3EYDA 2BDAA 1H9IE 3T29A 1GHZA 1F0TA 5EIYA 2A32A 3L33A 3RXDA 1YWUA 4CRCA 1GI9B 2J34A 3FAOA 1UTLM 1ZGIA 4YO9A 2V0BA 2PKAB 2OC7A 2TIOA 4RT1A 5AF9H 3T5FH 2PSYA 4TPYA 3OTPA 2Q6FA 1P2MA 2A7JA 4FUHA 1C4U2 1DX5M 2P8OC 3BIUH 1O2QA 2FS8A 1O2WA 1HDTH 4X8VH 4AYYB 1LHFH 3SGQE 3ZYEA 3ESTA 3MU4A 1GCDA 1A0LA 1MBMA 2GZ7A 1ZMJA 2ZKSA 2ZWLH 8ESTE 5J4SA 3MU1A 4WF8A 1AN1E 1L1NA 4XSKU 1A0HB 1UTJA 4YLUA 4YXWD 4B6FA 1YLCA 3ATLA 3VB5A 1BRBE 4R8TB 3RM2H 1TIOA 1TPOA 2D2DA 2VGCB 2PKSC 3ZZ9A 3UQOA 2P94A 1KXAA 1O37A 1EJNA 3MU0A 2Q1JA 2K8IA 5AHGH 3UPEA 4ABHA 3RXBA 3BTWE 3ZVAA 2PKAA 4AFSA 4B73A 3HGPA 4ABDA 2ZHWH 1P05A 1UCYK 1P03A 5FXLA 4NCYA 4D76A 1C4V2 3E1XB 1HXEH 1AE5A 1UTMA 3SNBA 3R0FA 1FUJA 4FUFA 3B9FH 1JBUH 2WPKS 3SZNA 5HM9A 2AYWA 1EATA 2WINI 1W0ZU 3OY5U 1TMUH 2HPPH 1EUFA 4ZKSU 1V2MT 4UE7H 2O8MA 5F6MA 1NM6A 2SGEE 1QR3E 4F48B 4X8TH 1Y3XA 6ESTA 3ZIAD 2CJIA 3RXRA 4B2AA 1C5LH 4TSFD 3SUDA 4CR5A 1SHHB 1FQ3A 2FM2A 1O5EH 2PKSB 3AVZA 1NBME 1O3GA 2AHME 2WUCA 3BIVH 5C0TA 3RXCA 1ZRBA 3F9HA 3STJA 3P6ZB 3RXTA 4BANB 1MTNB 3AW1A 4YLQH 2FOMB 2BHGA 4GVUA 1HAIH 5AFYH 1Z6JH 1C5TA 2GT8A 1UVUH 4D9RA 4HI3A 1B7XB 5GCHG 3TNSA 4ABEA 1SHYA 3TITA 2FOCA 3RXPA 2BXTH 3JZ1B 4Y8YA 2ZZUH 1EZXC 1H1BA 4MG3A 1NFUA 2I6QA 2F9OA 1TNIA 1P3EA 1OP0A 3QGJA 3UAIC 1NU7B 2A5KA 2ESTE 3RXLA 3SGBE 2W5EA 2ZO3H 5HGGA 5L6NH 4J2YB 3S9BA 1IQHA 4FUBA 1MTSA 3O8RA 1SSXA 3EAJA 2O8WA 3TNTA 2FP7B 2ZHFH 4I32A 2V3MA 1RIWC 3SU5A 4ISIH 1EPTC 1RFNA 4Q7XA 3EA9A 1G30B 2KCPA 2XNDD 1D9IA 4OS2A 4WJG2 3NPSA 2QYIA 3T62A 1V2QT 4F49A 3RXKA 5E0GA 1K1PA 5EGMA 6CHAB 1Y5BT 3FFGA 5CHAB 4A1VA 2A45B 1QHRB 4CREA 3VPKA 1H9LB 3ZVDA 4INLA 4WVPE 1SBWA 1MD7A 3KQEA 3KQBA 1J14A 3UIRA 3UR9A 2Z3EA 4MPXA 1C1QA 2C4FH 2OBOA 2P95A 1MBQA 2AGEX 1EB1H 3N7OA 4DT7B 1IQGA 4Y0ZE 4FUEA 1TGTA 4B2BA 2PHBA 1QL8A 1MKXK 2FOGA 1C1TA 1DITH 1S81A 2XRCA 5HYOA 2QXHA 4U01A 2TGDA 1CSOE 2ZI2H 4A5TS 3SJ9A 1SL3A 3GDUA 1G2LA 1XUHA 1ZPBA 2GX4A 5BRRE 2ZFTA 1BCUH 1AIXH 2BDHA 2BLOA 3P92A 1V6DA 1JMOH 3KHVA 2PWXA 3MO9A 1P06A 3GY8A 3BEFB 2BVXH 1FY3A 1EOLA 1XX9A 1QBOA 2PV9B 3E3TA 4NZQA 2VJ1A 1DM4B 1C2JA 1TPAE 1GJ5H 2OC1A 3Q3YA 2BZAA 1VITF 4ZXYH 2ZDLA 1XMNB 2A4RA 4A92A 4K69A 2XC4A 5DSFA 4AG1A 1O3LA 1FLEE 4WMDA 1AVWA 3M7UA 2ZPQA 2F9UA 3P8OA 1MTVA 4OM9A 3SORA 2D1JA 5J4QA 1GMDG 5EXNA 1LHCH 7GCHF 4ZH8A 3M35A 1S6HA 4ASHA 3QO6A 1GGDB 3A7VA 1K1NA 1IAUA 4ZROA 2QIQA 4X8UH 4M7GA 4UDWH 5C1YA 3NWUA 1V3XA 1DY9A 2JH0D 3A89A 5F8ZA 3PMJA 1GBAA 1FIWA 1C5XB 1Q31A 1SOTA 1TBQH 2FS9A 4I33A 2LP6A 1HJ9A 1UVTH 1OYTH 3M7QA 3A86A 5HIYA 1AZ8A 1F5RA 1KYNA 1TQ0B 5GWZA 4ZCNA 1DANH 1KLJH 5F8TA 4Y11E 3A8CA 1Y3WA 2OQ5A 1LVOA 3QUMP 1C2FA 4Y79A 3M5OA 4RKOB 2DE8A 3VEQB 1DXPA 4O9VA 2XBXA 2G8TA 1ZSJA 4JZDH 4Y71A 4J1YA 2J9NA 3GY5A 1GI2A 2VVCA 4DJZB 1FAXA 2ODQA 3F9FA 3CENA 1OWHA 1C5OH 2Z94A 2H5DA 5IDKA 1OYQA 2PR3A 2HWLB 3LC5A 3DSGA 3SNAA 3A82A 3A87A 5DPAA 1GHBG 5HXFA 1D3DB 1V2KT 3KL6A 1HAPH 1K22H 1NPMA 4MPUA 2IOTA 2OK5A 1XVOA 3M61U 2QC2A 3K65B 5CE1A 1ZTKA 3SV2H 1PPBH 2YNAA 1XUFA 3LDXH 3M5LA 2HALA 1V2VT 4NZLA 4XD7D 1J15A 1BQYA 1OWDA 3M37A 5EU8A 3LGTA 1T31A 2XNIA 3TK6A 1EAWA 1SR5C 2UWPA 4K5ZA 2ALVA 4ABJA 1HXFH 1PQ7A 2UUJB 2BOKA 2GMTC 1ANEA 2BTCE 2PUXB 1FIZA 2SGAA 3PTBA 3GDSA 2P8OB 4F55A 3E0PB 1IHSH 1K2I1 5DJ7A 4MNXA 2ZU2A 3U1IB 1K28D 4UD9H 2Z6BD 1T4UH 5DP6A 3OE7D 1YPLH 2FTMA 1WTGH 1AZZA 4HG6A 1LHGH 3LT3A 5JYIA 4XOJA 1TE0A 4CR9A 4O3UA 1ANBA 1P04A 1T8LA 1P11E 3BG4B 3VG8A 1W13U 3SI4H 1H8ED 3KQCA 1QURH 2A1DB 4IBLH 5FPYA 1ELDE 5K7RA 1O2RA 1SI5H 3LC3A 1GI8B 3P8FA 1FPCH 1G3DA 1PQ5A 2VVVA 3KNXA 3FVFB 4Z1MD 2Q6GA 1O3IA 1ZTJA 3U9AH 1YYY1 2AFQB 2VIQA 2BB4A 1LPGB 3WY8A 3KN2A 1SGNE 1MUEB 3RXUA 2WPDD 4KTCA 4LZ1H 2JDID 4XE4A 1K9OE 3S0NA 1DDJA 5EPYA 1MKWK 2ANYA 2PGQB 2ZDMA 1CVWH 1UK3A 2Y5HA 1QJ7B 1HAOH 1CO7E 4BAKB 1DLEA 4INHA 1ELGA 1K0HA 5A2MH 3VGCB 3UQVA 1TX7A 2ZU1A 2CHAB 1EPTB 1DE7H 3F0OA 4I8HA 1G3EA 4GCHF 4ZKOU 3A7TA 3A7XA 1E34B 3MO6A 2XW9A 5DN6D 1LKAA 1BJVA 5DP5A 4BTUB 3MHWU 5GPIB 2OQUA 4ASUD 1P02A 1AB9B 4JZEH 4SGAE 1UTKA 1MU8B 2BLWA 3SW2B 1VCPA 5A09A 1A61H 2F9NA 3DD2H 2ZU5A 1ETTH 1C1SA 1BBRE 3FP6E 3OSYA 3E16B 5AVDA 3VB3A 1BMFD 3ITIA 1O5BB 4HZHA 3SYJA 4H4FA 1K1IA 1UO6A 4K1TA 2ZECA 2BD2A 1L1GA 1IQLA 4AFUA 1TMTH 1Y5AT 5LPEA 4UFFH 1CHGA 2NWNA 4WMFA 2XCNA 1TRYA 1KXEA 3RU4T 2ZCKP 1T7CA 7LPRA 2BDIA 5E0JA 1DWEH 3GY6A 2EI6A 2V35A 2GDEH 4IC5A 3TK5A 3C27B 4O3TA 3E90B 1YCPK 3ELAH 1CE5A 2HNTC 3SHCH 1V2UT 3ZZ6A 1EAXA 2IJD1 3A8BA 2PSXA 2XWAA 4JZIA 3TJUA 1P12E 3ZZCA 2KCYA 2J97A 5FX6A 1NTPA 4OS7A 4Q7ZA 1JWTA 1NRPH 1TNHA 3Q00A 1SGYE 2H9EH 1HAZB 2F9VA 4K1EA 1OOKB 2GCHF 1D6WA 2HNTF 3V0XA 2BQ7B 4X1NU 3URDA 1XKAC 1QJ1B 3UNQA 4AB9A 2BY5X 1GJ6A 1BRCE 1GBKA 1LDTT 5TCCA 2W6JD 3G01A 3KYGA 3ZZBA 1SQTA 5EJ1A 3O8CA 3DCLA 3M3SA 4I86A 1GJBB 2B5TB 1KXDA 3RXEA 3TJNA 1W11U 1A5IA 5C94A 3PLBA 1RRKA 1KDQA 4WH6A 4D7FA 1ETRH 1O3MA 1ZLRA 3AAVA 4X2VA 4NFEA 1DXWA 1TAWA 3SNDA 3U8TH 1GBLA 1KXFA 3TU7H 2GDDA 1OSSA 3FANA 1OX1A 2ZDVH 1AWFH 1HBTH 2QF5A 1W0KD 1C1RA 1RD3B 1EZQA 1QCPA 3QGNB 2PLXA 1C1OA 3OFND 1GHXH 5KECA 3MQKC 3KIDU 3SNCA 4DCDA 3MFJA 3A8DA 1UVPA 3MI4A 4UONA 4YT7H 4AOQA 2XCFA 2RA3A 4XFQA 2QXJA 5ABWA 4RI0A 1B5GH 1VGCC 1B0EA 2ZHEH 5H4IB 1OP8A 5B6OA 1CHOF 3EGKH 5GXPA 1O2SA 4WH8A 3VB6A 4OS4A 3F68H 4IGDA 1QQ4A 1BRUP 2A2XH 2C93B 1LKBA 1O31A 4GHTA 2ZDNA 1NY22 1UMAH 4NA7A 1A2CH 1EP5A 1YPJH 1Y8TA 4MPVA 1EZSC 1T8OA 4JMYA 2FI4E 1NRRH 1QFKH 5K0HA 1O2YA 3M5MA 1NFXA 1E1RD 4DIIH 5ESTE 4DOQA 1ELVA 1O2KA 1GBIA 4X0WU 1SLXB 3SJOA 5EOKA 1CGJE 1C5SA 4ISHH 4RKJB 5C5OA 1EOJA 2OC0A 1A7SA 2A0QB 4X6NA 1F5KU 1Z71A 3P8NA 3LU9B 4JCNA 2AH4X 3LGVA 2ZHDA 2H5CA 5EQRA 1ZSKA 3ODFA 5EW2H 5GIBA 1W8BH 1PQAA 3W1EA 3ENSB 3NKKA 2WPLS 2ZQ1A 1AVXA 2ZPRA 1FDPA 2W7SA 1Z6EA 2VINA 3RC6A 1KTSB 1O2VA 1YPKH 1EASA 3H7TA 1FNIA 2EI8A 2HOBA 4AG2A 2QAAA 1GCTB 2AMPA 3RM0H 1PYTC 1A1RA 2GJGA 1KMHB 1O33A 2HVYB 1EAIA 1YLNA 3QZQA 2M5TA 2UUYA 1C1MA 3S9AA 4IS5A 1O3HA 1O2OA 3VFEA 1L0ZA 1QIXB 1LO6A 2V6NA 3GICB 1ZGVA 3EA7A 2WHXA 1DY8A 3TGJE 2QCYA 2SGDE 2XBYA 4NIYA 2AGGX 2HLCA 1G36A 1GGDC 4Y76A 3MWIU 1YY3A 1E37B 3QK1A 1LVMA 1BTXA 3SV6A 2HLDD 2WV4A 4FUDA 1O3OA 2NU4E 3ZVGA 4I8JA 4XBCA 2ZQ2A 5FPSA 1VJ9U 1E0FD 2G00A 4HTCH 2LPRA 2FOAA 2ZTYA 3DA9B 3T28A 1Q3XA 2G4TA 5AFZH 5E2OA 1UVSH 3D62A 2BY9X 3S7HB 4MTBA 2BZ6H 5EODA 3OYPA 1GJAB 1AVGH 1VR1H 1SQOA 1EZUC 1SVPA 2D8WA 3F3BA 4X1PU 2B8OH 2THFB 3DFLA 1NS3A 4JYTA 1AB9C 3SJ8A 1SLVB 4A1XA 2ZP0H 2SNVA 3SU6A 2W7UA 4O97A 1GMHG 4MQAA 2J4IA 4ABAA 1IQNA 5JDUB 1XKBC 1O3PB 2VIDA 1XUJA 1OS8A 2ZU4A 1DS2E 1ARBA 3MH4A 1WYKA 1AFQC 3TLOA 4ABFA 3A7YA 3RXVA 2XC5A 1TWXB 1CA0B 1QL7A 2TPIZ 3ATWA 4OS5A 3SUFA 1W10U 2W26A 3URCA 2A5IA 1FY4A 2RA0A 1QTFA 3SU2A 2Y82A 1P0SH 3RXQA 3I77A 1UTOA 3D65E 1JIRA 1AUTC 1ZJKA 2QE7D 1GVZA 2J2UA 1GJ7B 1E38B 4ACAA 3DUXH 1WUNH 5EQSA 1DSTA 1W12U 3TGKE 2HVXA 4FUIA 1BBRH 1O5AB 3EDXB 2ASUB 2AEIH 1XM1A 1L4ZA 2JKHA 5GDSH 1O2NA 2FDAA 3UB0A 1S0RA 1TNLA 4BAQB 1C2KA 1FV9A 3UWIA 4JK5A 1TRNA 1S84A 2QF0A 3SNEA 1NU9A 1UTQA 2KAIB 2G81E 2VB0A 4GLYA 4D7GA 2J95A 3DHKH 3GOVB 1U6QA 1KLIH 1WQVH 4AGKA 3A81A 2BQ6B 3ATMA 1HAXB 4CH2B 3HK6B 1D3TB 2K0QA 4SGBE 5I46H 3RLYH 3GCTF 1V2OT 1NRNH 2FODA 1VCWA 5JBBS 4FVDA 1ZRKA 1TNKA 4VGCC 1WDIA 2GKVE 2KX4A 4AN7A 4WY3A 1V2ST 1GMHF 3VXFH 3AW0A 1YPHC 1ACBE 1XUIA 4THNH 1EQ9A 1LPKB 1ZZZA 5FCRA 2P59A 3PO1C 1GBJA 2A7HA 1N1LA 4NA9H 1LMWB 1S82A 3RMLH 1XVMA 2Y5GA 5A8YA 5HIZA 4INKA 3H5CB 1KXCA 3VB4A 1V2NT 2Y7XA 2R2MB 1D4PB 2JIZD 2VVUA 3S9CA 3SV7A 1CHOG 4XRNA 1DWBH 1ELCA 1GJ4H 3V3MA 2W6ID 4ESTE 1ESAA 5LPRA 3OAAD 1EP6A 1TGBA 4UEHH 4JK6A 1M9UA 1VITG 3K2UA 1PQ8A 1NT1A 1XXDA 2F43B 1SGDE 2UUKB 4NG9H 3K6ZA 4MDSA 3Q77A 2ZGJA 2AIQA 3ZZ7A 2EY4C 4GCHG 4K2YA 1BTWA 1ORFA 5JBCS 1UVOA 4RSPA 2B0FA 1AGJA 2JETB 2GCTC 3LPRA 1ESBA 1GMDF 3RXHA 1IQEA 1DPOA 4ABBA 4K1SA 5FBEA 3W95A 3BTQE 3PB1E 1S85A 5GNDA 4CRDA 1FMGA 2QN5T 3NZIA 1QBVH 3LIWA 1FN6A 2O8TA 3LGUA 2VWLA 4ZUHA 1Y59T 1SGIB 1CQQA 3H09A 2CMYA 3PLKA 2A4QA 4YOIA 2XBVA 1D3PB 3RXFA 1AMHA 4K8YA 1TX6A 4Q7YA 1TALA 2PFEA 4ACBA 2CV3A 4GPGA 3P95A 4TPIZ 1HIAB 2QXIA 1HAVB 3IG6B 4LOYH 1S0QA 1UHBB 2BD7A 2OLGA 4OGXA 4H6SB 1H8DH 1QA7A 1RIWB 1WU1A 4XDEA 3BSQA 3R3GB 1JRTA 1GBHA 2VWMA 1GBFA 2ZG0H 4GSOA 8LPRA 1ZSLA 2OCVB 1ZMLA 4NIWA 2AGIX 1C2IA 1L1JA 3WW7A 4TWWA 4BTIB 2CF8H 3BF6H 4A1TA 1HJAB 2DUCA 3BG4C 3OX7U 1THPB 4U2WA 3A7WA 1LTOA 3M3VA 1O35A 3BTME 1OXGA 3BTEE 1SFIA 5DGJA 1QRZA 4JZFH 4LK4A 1GHBF 5I25A 4ZKNU 2GCHG 2TBSA 2CGAA 2GT7A 1SGFG 1C5UA 5C0UA 1GVKB 1TBRH 4CRGA 1PPEE 2Z7FE 5TCAA 2O8LA 4K60A 1KDQB 1F5LA 2VU8E 4BAOB 2VH6A 2W3IA 4X1SU 4AZ2B 1G3BA 2OINA 3RXAA 9ESTA 2EEKA 2G5VA 2R9PA 2ZTZA 1Z1JA 3HKIB 2JH6D 3RU4D 5T3HA 8GCHG 2RDEA 3PRDA 1SOZA 3PTNA 2BDGA 2EC9H 2WZQA 1HAGE 3A84A 3BTFE 1BMNH 1NRSH 1N6XA 3V13A 2KAIA 2WPHS 6CHAC 2BVSH 4ZAEA 3RXSA 1P57B 4X2WA 1AUJA 1UHBA 1ELAA 4O03A 1GHWH 4B71A 3TPIZ 2FTLE 3SUEA 3ZV8A 1NZQH 1EJMA 1QRWA 1HAVA 1P2OA 2FO9A 1FX0B 5FAHA 1HJ8A 2WPMS 1QB1A 2FOFA 1P9UA 1AE8H 1Y5UT 2PTNA 2QF3A 4YOGA 3AK5A 3BTDE 3UOUA 1O0DH 4ISNA 4D9QA 1UTNA 2SNWA 1PPFE 4DT4A 1DUAA 3ZZ8A 2J5UA 1GVLA 3FOAA 2TGAA 1EB2A 1EJAA 1BRAA 1F2SE 3SZEA 4FXGH 1EPTA 1L2EA 1ESTA 4CBOA 1IQMA 5F03A 1C4Y2 2ZF0H 3TH2H 1J17T 1INCA 4Z0KA 4E06H 2C3SA 1BHXB 2FWWA 1O3NA 4X1RU 5C1UA 3F1SB 3M5NA 4DG4A 4I8KA 1SGCA 3SV8A 1FXYA 2TGPZ 2L74A 2BX3A 2BLQA 2XYAA 4FU9A 2PGBB 2B7DH 4WWYA 3WWFA 3PLPA 1WQSA 2WPJS 5C67A 3NK8A 2BY7X 3PO1B 4TYDA 1P2IA 1WOFA 1UW7A 1SC8U 3SI3H 4ZKRU 1FZZA 3GCTG 2BD4A 5DP3A 3T26A 1J8AA 1IQKA 1K21H 2EA3A 3RP2A 1HGTH 5CHBA 4GHQA 4VGCB 4OS1A 2FXRA 1GJ9B 3UNSA 1P2QA 5JB9S 4DIHH 1QRXA 1GI5A 1K1LA 1F92A 3ATKA 2XWBI 1P09A 4Q80A 1W3CA 3E6PH 4KTUA 2FYRA 4NIVA 1V2RT 1D3QB 5FBIA 2VWNA 3SO3A 1BT7A 1AWHB 2BDCA 1BIOA 1C2GA 6LPRA 7ESTE 5HM2A 3P17H 2UWLA 2BD5A 1WV7H 1GBEA 2FLBH 1O2GH 1GDQA 1O2TA 1H8HD 4KGAA 3SQHE 1ZYOA 3PV5A 1MH0A 4HGCA 9LPRA 3MTYA 2Y6TA 2C8XB 3BTTE 2WPIS 1P9SA 1AI8H 1GHVH 2F4LA 2WV5A 3SUGA 1HLTH 1O3EA 1SGFA 2ZEBA 5EW1H 3IWMA 1C5MD 1NROH 2P93A 2SGQE 5DP4A 1BMMH 2OD3B 4X8SH 3U8OH 4RN6A 4PROA 3V7TA 5JBTA 5JB8S 1GDUA 1YLDA 1QZ8A 1JRSA 4AGJA 1TB6H 4K3JA 3SU1A 3TVJB 3SJIA 1HYLA 1MD8A 2HRVA 1RTKA 1V2LT 4H6TA 4Y0YE 1H9HE 3LJJA 2YMSC 2GCTB 4I31A 1RS0A 1QNJA 1GHYH 1G37A 5EPNA 4X1QU 2YNBA 2H6MA 1IQIA 3KYFA 2Y80A 2RG3A 1SLWB 1GBBA 4CHAB 5A0AE 3PRBA 1GI7B 2FYQA 5EJLA 1S6FA 3GYLB 2Z9KA 3A85A 3BTGE 3PWCA 2SGFE 3UY9A 3LGIA 1ZPZA 1O2ZA 2KCOA 4AYVB 3ZVFA 3H7OA 3U28C 1P2JA 3ZVBA 2V3HH 1Y3VA 1TA2A 1SB1H 4B75A 1E36B 1ZOMA 2VBCA 1VITH 3OTJE 1DWDH 3SQEE 2CN0H 1TLDA 1ZHRA 2CF9H
chains in the Genus database with same CATH topology
1O2PA 1O3FA 2Z3DA 1B0FA 3KF2A 4NSYA 4U32A 1BTPA 2FPZA 2PW8H 4GUXA 1IHTH 2ZTXA 5JPMH 1CU1A 1O3DA 3L6PA 1P10A 3F6UH 2VIOA 1PPCE 4TY6A 1O5GH 2G52A 2O9QA 2F91A 1LQEA 2G5NA 3MU8A 1ARCA 4X6MA 3UR6A 5T6FA 2VIVA 1ZR0A 1Z8GA 5T6DA 1QQUA 1QJ6B 2ZPSA 5C2ZA 2HGTH 2C8ZB 2FESH 2XXLA 5T6GA 1O2IA 2ZDAH 2Z9JA 4FUJA 2BX4A 5C1XA 4Q2KA 1QB6A 3RMNH 1PPHE 2D26C 2QA9E 2CHAC 4A7IB 4CRAA 2NU2E 4Y8ZA 3VGCC 4OS6A 4UFGH 1TFXA 4AFQA 5EG4A 3HGNA 3RU4E 1OPHB 2FEQH 3RXIA 1C2HA 1CGIE 3Q3XA 3S7KB 3B8JA 3ZYDA 1HAYB 3GYMA 3KGPA 4AX9H 1AKSB 3LH1A 4B1TA 3NUMA 2ANKH 4TY7A 2QGRA 2BMGB 1BDAA 1TBZH 1UK2A 4X2YA 4BXWA 1DVAH 2XBWA 3U8RH 1NRQH 2ZGBH 1CA0C 1TA6A 1UCYE 4ZXXH 1ELBA 1TGCA 2BOHB 4FUGA 1LHDH 2C8WB 1THSH 1S5SA 4B74A 1YCPM 1CA8B 4AFZA 1C9TA 1YPEH 3D49H 5E8EH 2WUBA 3PWBA 2QY0B 2GP9B 1BJUA 3UUZA 3UTUH 4KTSA 1KTTB 1T4VH 2FMJA 3Q76A 5A8ZA 2G51A 5FPTA 1BTZA 4CHAC 1A46H 2ZHQH 1GDNA 2Z9LA 1WCZA 1F0UA 1F0SA 2ZCLP 5DK1A 1C5RA 4I8LA 1PPGE 3MMGA 1UCYH 2ZU3A 3UWJH 1HJAC 3AASA 1C5VA 1IQJA 3GCNA 2P3UB 1GI4A 2R0KA 1IOEA 2EI7A 1ZPCA 3U69H 3QTOH 1V2JT 4Y6DA 1HIAA 3RMMH 2WYGA 3EE0B 2AMDA 2J94A 1BTYA 2Z9GA 1RTLA 1PJPA 1BA8B 1TGSZ 1YPMH 3BV9B 4CRFA 4ISOA 4Y8XA 1T8MA 2ULLA 1YPGH 2BYAX 4IMQA 3RDZA 1XXFA 2GZ9A 3RXMA 1TX8A 2GTBA 1HV7A 1KLTA 4BNRA 3ZVEA 3QTVH 2H9TH 3ZV9A 3BG8A 2LNCA 3PMBB 1THRH 1GPZA 3GY4A 4I7YH 1HPGA 2J38A 2NU1E 1SGEE 3HKJB 2OXSA 3HPTB 1JXPA 6GCHF 1MAXA 2JETC 2H9HA 1A4WH 2Z9IA 1Z8IB 1QA0A 1JOUB 1NFYA 3M7TA 3K6YA 5JBAS 1ZJDA 4B76A 3NCLA 1K1OA 2FX4A 4MNVA 5GJ4B 2AIPA 3ZVCA 2ZC9H 3E0NB 1QL9A 2CXVA 1ZHMA 5IYTA 4X2XA 5FCKA 2P3FH 2A4OA 1YM0A 7KMEH 3QZRA 2HNTE 1EKBB 4MPWA 1HUTH 2UWOA 2TRMA 1FJSA 1BOQA 1MQ6A 1MTNC 1O36A 1O2MA 1QGFA 1XUKA 4JZ1A 5C20A 4YM9A 2BDYA 1MZAA 3MOCA 2HPQH 2O8UA 4IN1A 2F9PA 1F0RA 1N8OB 8GCHF 1OP2A 1O32A 4UFEH 3GY2A 1CBWB 2BD8A 3TH3H 3I78A 3TK9A 1K1JA 3BTHE 4ZHLU 1C5PA 1H8IH 1MQ5A 1YGCH 3OY6U 1GJDB 1XUGA 3ODDA 1Z7KA 1BITA 2XTTB 3GY3A 1Y3YA 1FPHH 3M3TA 1ZHPA 4IN2A 3PYHA 2GD4B 1GI6A 1LVYA 3MU5A 1KSNA 3T2NA 4Y7AA 1SQAA 3CS7A 1LCYA 2TGTA 2FI5E 5DKMA 5TJXA 1RXPA 2ZDKA 1MMJN 4NWLA 4LZ4B 1RGQA 1DWCH 1GBTA 1NESE 5C5NA 2ZFSA 4NSVA 1MZDA 1AKSA 1TGNA 1MTWA 2ZA5A 1DUEA 1C5YB 4AORA 1MKXH 1MKWH 4DGJA 2R0LA 3MH6A 2J92A 1C9PA 3MH5A 3P8GA 1Y3UA 1DFPA 1OWKA 2DE9A 3SJKA 3P70B 3ZZAA 3QDZB 1P2KA 1ABIH 1SFQB 4DY7B 1SGPE 2ZFFH 2GVFA 4KELA 1OWEA 1S83A 4H42U 1OWIA 3LKWA 3V12A 2PUQH 1RTFB 2AS9A 3HK3B 4ABIA 2BM2A 3SU0A 4A6LA 1TPSA 2Q6DA 1W7GH 3VB7A 5SGAE 1C2DA 1GWAA 1C1VH 5DP9A 3IITA 4XBBA 1GG6B 2ODPA 2ANWA 2G4UA 1P2NA 5A0BA 1AU8A 1O5DH 4FUCA 2ZIQH 3QX5H 1FAKH 4KKDA 1MAYA 5LGOA 1IQFA 3CS0A 3PM3A 1A0JA 1CT4E 3PMHB 2B9LA 1MU6B 1ANDA 3LGWA 2Y81A 3A80A 1W14U 1FONA 1G3CA 5FX5A 4MNWA 1O2JA 3PMAB 3W94A 2FOHA 4CBNA 2GV7A 2ZGHA 1YC0A 3A88A 1GI0A 3MO3A 4DVAU 1AY6H 3TJOA 1TABE 1TMBH 2ZGXH 4YESB 3F9EA 1TNGA 3S69A 1GI3A 1CT2E 2PTCE 1BMAA 3FP7E 2FOEA 3GCHC 1SGQE 1LQDB 2Y7ZA 1ELTA 2OTVA 3EA8A 2GMTB 2RCEA 3KCGH 3UREA 1C1UH 1NO9H 1DLKB 1GHAG 4E7RG 1GJ8B 5A8XA 1F7ZA 4MNYA 2H2ZA 2R3YA 1SMFE 5BPEA 1O3AA 1YKTA 4YTAA 3U98H 4Y10E 3FP8E 3BN9A 1SG8B 1WAYB 2YOLA 4TWYA 5G4BA 2K1QA 1JIMA 2GV6A 1O30A 5EXLA 5GCHF 1YP9A 2I6SA 3SU3A 1UK4A 5FHTA 5LH8A 2Z3CA 1C5NH 4WMEA 4QT8C 3TGIE 3T25A 2VIPA 3GY7A 1C1WH 1WSSH 4IW4E 1O38A 2BD3A 2BY8X 2IJOB 3ZZDA 1N6YA 1AFEH 2STBE 5LPFA 1O3KA 1PPZA 2F83A 2FZZA 4IC6A 2C90B 2H1UA 8KME2 1W7XH 3E91A 2BDBA 4WXIA 3ZZ3A 5EXMA 1GBMA 2RDLA 1ZTLA 2JH5D 1P3CA 3MYWA 1E35B 5DG6A 3RC4A 4UFDH 4MLFB 1W0YH 3DFJA 1O5FH 3O8DA 1ABJH 1ELFA 3Q3KA 2SFAA 4BXSA 2SGPE 2OC8A 2AMQA 2R3UA 4BOHA 5CMXH 4FVBA 3D23A 4F4OC 5PTPA 2UUFB 2Y5FA 3RLWH 1QBNA 1FY8E 1SPJA 5DO4H 4JYVH 4IMZA 1Q2WA 1NFWA 4BAMB 1TNJA 3UFAA 3BEIB 3SOSA 2R2WU 1FY5A 1GHAF 2P3TB 3GCHB 5E0HA 1ID5H 1Z1IA 4CRBA 3RC5A 1Z8JB 3L3TA 1MCVA 1P01A 4NGAH 3VXEH 1HRTH 2C8YB 2W3KA 1GJCB 2IN2A 1BUIA 3LJOA 2IPHA 1HFDA 4BAHB 3UNRA 3AAUA 1O34A 2G55A 3PV4A 2A2QH 3MH7A 1BZXE 1O3JA 1C1PA 3NXPA 1GL1A 3QN7A 1Z8RA 4BTTB 1GBDA 1PYTD 3SV9A 2BLVA 1VJAU 1BTHH 1MTUA 4NA8A 1BBRK 2ZCHP 2A4GA 1TPPA 1TONA 2A5AA 1VGCB 4WXVA 1VZQH 3LOXA 4D8NA 4E7NA 1G9IE 3RXOA 1T8NA 1YCPH 4B2CA 4X6OA 4ISLA 1FI8A 5CHAC 1W2KH 3SU4A 1A3EH 1GG6C 1QY6A 1FN8A 3QWCH 5ESBA 4Z6AH 1SGRE 2ZGCA 7GCHG 5L2YH 5C3NA 3MNSA 1HAHH 2A7CA 4YT6H 2F3CE 3RXJA 1L4DA 1O2HA 1ETSH 1RJXB 1HB0B 1G2MA 2VNTA 4NFFA 1TYNA 1DSUA 2P16A 1LPZB 1EX3A 1MCTA 2WYJA 3RXGA 1O2XA 1KXBA 1T32A 1EAUA 1HNEE 1GCTC 2FLRH 3RMOH 5DP8A 3UOPA 1YF4A 3M36A 1AFQB 1GI1A 4DURA 3SGAE 1O5CB 1ZMNA 4K8BA 3B23B 2VH0A 4X6PA 3HATH 2ALPA 3SN8A 4HFPB 1LHEH 1GMCG 1O2LA 4DW2U 2AERH 1O3BA 4E05H 5E2PA 1O39A 1C1NA 2OP9A 2STAE 2V3OH 5EQQA 4ZHAA 4ZMAH 3DT0H 3FZDA 3A7ZA 3ZZ4A 4MVNA 1G32B 2GZ8A 2ILNA 2GGVB 3ATIA 2FI3E 5DP7A 1P8VC 3GDVA 1A5HA 3KQDA 1CBWC 1VCQA 3KEEA 1A5GH 1UTPA 3LONA 1J9CH 1NC6A 1N8OC 1PFXC 3SHAH 1KIGH 1C5WB 1A3BH 1HCGA 3T27A 3BTKE 3MNCA 3RUOA 3F9GA 3FZZA 3EQ0H 1C5QA 3QLPH 1D6RA 1V2WT 3OU0A 3BEUA 4YOJA 2OBQA 4YZUA 2ODYB 1ANCA 3LGYA 3LH3A 1WBGB 2QV1A 1O2UA 1DICA 3MNXA 1SLUB 1AQ7A 1X7AC 1DT2A 1O3CA 2VIWA 1OKXA 3K9XB 1EXFA 1YPHE 2BQWB 5F8XA 2ANMH 4FU8A 2FX6A 3A83A 1YBWA 2XC0A 2BXUH 3E8LA 3ZZ5A 3C1KA 1KY9A 1TOCB 1GL0E 1H4WA 1K1MA 4JYUH 1QB9A 2BD9A 1NN6A 1TOMH 4KP0A 1UJ1A 1BTUA 1TRMA 2NU3E 5L30H 1WTHD 1ELEE 1BHXF 4Y7BA 3STIA 3TJVA 3TIUA 1BMLA 1LVBA 4U30A 3GISB 4NIXA 1TQ7B 6GCHG 2BVRH 4I8GA 2NU0E 1C2EA 2BY6X 3U1JB 1SGTA 3JZ2B 4AB8A 1AO5A 1V2TT 2VWOA 3CP7A 1GMCF 3MNBA 4ZHMU 2QXGA 3PROA 1C2LA 3SBKA 2VGCC 2ZFRH 5L2ZH 1GBCA 2FIRH 5ETXA 4NWKA 4R0IA 2FOBA 1BB0B 4CH8B 3A8AA 1C2MA 4LXBH 4FU7A 4ABGA 3TH4H 4OGYA 5HMAA 2A31A 4GAWA 1C5ZB 2F9BH 2ZNKH 4XBDA 1J16A 3I29A 1AD8H 2ZFQH 1DOJA 1CGHA 1CT0E 1OWJA 2ZFPH 5A0CA 1FY1A 1V2PT 2OUAA 3GCOA 1AHTH 3O8BA 3EYDA 2BDAA 1H9IE 3T29A 1GHZA 1F0TA 2A32A 3L33A 3RXDA 4CRCA 1GI9B 2J34A 3FAOA 1UTLM 1ZGIA 4YO9A 2V0BA 2PKAB 2OC7A 2TIOA 5AF9H 3T5FH 2PSYA 4TPYA 2Q6FA 1P2MA 2A7JA 4FUHA 1C4U2 1DX5M 2P8OC 3BIUH 1O2QA 2FS8A 1O2WA 1HDTH 4X8VH 4AYYB 1LHFH 3SGQE 3ZYEA 3ESTA 3MU4A 1GCDA 1A0LA 1MBMA 2GZ7A 1ZMJA 2ZKSA 2ZWLH 8ESTE 5J4SA 3MU1A 4WF8A 1AN1E 1L1NA 4XSKU 1A0HB 1UTJA 4YLUA 1YLCA 3ATLA 3VB5A 1BRBE 4R8TB 3RM2H 1TIOA 1TPOA 2D2DA 2VGCB 2PKSC 3ZZ9A 3UQOA 2P94A 1KXAA 1O37A 1EJNA 3MU0A 2Q1JA 5AHGH 3UPEA 4ABHA 3RXBA 3BTWE 3ZVAA 2PKAA 4AFSA 4B73A 3HGPA 4ABDA 2ZHWH 1P05A 1UCYK 1P03A 5FXLA 4NCYA 4D76A 1C4V2 3E1XB 1HXEH 1AE5A 1UTMA 3SNBA 3R0FA 1FUJA 4FUFA 3B9FH 1JBUH 2WPKS 3SZNA 5HM9A 2AYWA 1EATA 2WINI 1W0ZU 3OY5U 1TMUH 2HPPH 1EUFA 4ZKSU 1V2MT 4UE7H 2O8MA 5F6MA 1NM6A 2SGEE 1QR3E 4X8TH 1Y3XA 6ESTA 2CJIA 3RXRA 4B2AA 1C5LH 3SUDA 4CR5A 1SHHB 1FQ3A 2FM2A 1O5EH 2PKSB 3AVZA 1O3GA 2WUCA 3BIVH 3RXCA 1ZRBA 3F9HA 3STJA 3P6ZB 3RXTA 4BANB 1MTNB 3AW1A 4YLQH 2FOMB 2BHGA 4GVUA 1HAIH 5AFYH 1Z6JH 1C5TA 2GT8A 1UVUH 4D9RA 4HI3A 1B7XB 5GCHG 3TNSA 4ABEA 1SHYA 3TITA 2FOCA 3RXPA 2BXTH 3JZ1B 4Y8YA 2ZZUH 1EZXC 1H1BA 4MG3A 1NFUA 2I6QA 2F9OA 1TNIA 1P3EA 1OP0A 3QGJA 1NU7B 2A5KA 2ESTE 3RXLA 3SGBE 2W5EA 2ZO3H 5HGGA 5L6NH 4J2YB 3S9BA 1IQHA 4FUBA 1MTSA 3O8RA 1SSXA 3EAJA 2O8WA 3TNTA 2FP7B 2ZHFH 4I32A 1RIWC 3SU5A 4ISIH 1EPTC 1RFNA 4Q7XA 3EA9A 1G30B 1D9IA 4OS2A 4WJG2 3NPSA 2QYIA 3T62A 1V2QT 4F49A 3RXKA 5E0GA 1K1PA 5EGMA 6CHAB 1Y5BT 3FFGA 5CHAB 4A1VA 2A45B 1QHRB 4CREA 3VPKA 1H9LB 3ZVDA 4INLA 4WVPE 1SBWA 1MD7A 3KQEA 3KQBA 1J14A 3UIRA 3UR9A 2Z3EA 4MPXA 1C1QA 2C4FH 2OBOA 2P95A 1MBQA 2AGEX 1EB1H 3N7OA 4DT7B 1IQGA 4Y0ZE 4FUEA 1TGTA 4B2BA 2PHBA 1QL8A 1MKXK 2FOGA 1C1TA 1DITH 1S81A 2XRCA 5HYOA 2QXHA 4U01A 2TGDA 1CSOE 2ZI2H 4A5TS 3SJ9A 1SL3A 3GDUA 1G2LA 1XUHA 1ZPBA 2GX4A 5BRRE 2ZFTA 1BCUH 1AIXH 2BDHA 2BLOA 3P92A 1V6DA 1JMOH 3KHVA 2PWXA 3MO9A 1P06A 3GY8A 3BEFB 2BVXH 1FY3A 1EOLA 1XX9A 1QBOA 2PV9B 3E3TA 4NZQA 2VJ1A 1DM4B 1C2JA 1TPAE 1GJ5H 2OC1A 3Q3YA 2BZAA 1VITF 4ZXYH 2ZDLA 1XMNB 2A4RA 4A92A 4K69A 2XC4A 4AG1A 1O3LA 1FLEE 4WMDA 1AVWA 3M7UA 2ZPQA 2F9UA 3P8OA 1MTVA 3SORA 5J4QA 2D1JA 1GMDG 5EXNA 1LHCH 7GCHF 4ZH8A 3M35A 1S6HA 4ASHA 3QO6A 1GGDB 3A7VA 1K1NA 1IAUA 4ZROA