2FYQA

Crystal structure of the norwalk virus protease
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
181
structure length
170
Chain Sequence
APPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like cysteine proteinase
publication title X-ray crystallographic structure of the Norwalk virus protease at 1.5-A resolution.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 39
structure length 170
sequence length 181
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyqA01
1UO6A 1LQDB 3I77A 4I8LA 3EDXB 4DCDA 1P03A 2IJOB 4YOJA 1U6QA 1HAXB 1NFWA 4TY7A 3S9BA 3ATIA 3RXRA 1V2TT 1HAGE 4OS5A 2GP9B 3MOCA 4K2YA 4Y6DA 5E0GA 2FTLE 1DSUA 1P10A 3KGPA 1EOJA 1BITA 1O3JA 1SGFA 2OLGA 1KLJH 3PMHB 5C2ZA 2AH4X 3UR6A 3DT0H 1A2CH 3BF6H 7GCHF 4NA7A 3RC4A 1AUTC 1O2PA 1ZHMA 1GHBF 3B8JA 1GDNA 1ABIH 4DURA 3MU1A 1O2UA 5CHAB 1FZZA 3A7VA 1GBCA 2G00A 1C5NH 3PLPA 1T8MA 2DE8A 1HRTH 3BTFE 2ILNA 5L2YH 3PO1C 2FOHA 1F0UA 3ELAH 3MU5A 1MTWA 4Z0KA 4YM9A 3EA8A 1JXPA 1YLDA 1W12U 3ZVBA 1O3OA 1MUEB 3V0XA 2FX4A 1NROH 3MU4A 1A4WH 1FIZA 4B71A 1O3BA 3ZZAA 5C1YA 1GJ8B 3VGCC 1WUNH 3CENA 3A7WA 1EPTA 1C5QA 4NA8A 1DSTA 4YOGA 4Y10E 1YP9A 2NU3E 1LO6A 2SGEE 3QDZB 3U98H 5FHTA 5E0JA 2XXLA 1N8OB 1Z8GA 3QX5H 6LPRA 3MU0A 1GJ4H 3UNQA 1UK4A 3P8GA 2UWPA 1MBMA 1FPHH 1HAOH 1QBNA 2XC4A 2EI6A 3GDVA 3RXMA 3SBKA 1C5XB 3TJOA 3PYHA 1O5EH 3KQCA 2OUAA 2GV7A 8KME2 4K1TA 2YNBA 4ABFA 1TGCA 1AKSA 2BZAA 2GMTC 2Y7ZA 1PQ8A 2FLBH 1IOEA 2ZU4A 4RSPA 1H1BA 1LHFH 1LVBA 3L33A 3VB6A 1OP2A 4AGJA 2XCFA 3QK1A 5EXMA 4LOYH 2CV3A 1P0SH 2CGAA 1NRPH 5DP4A 3L6PA 3LH1A 5C5NA 2VIPA 2FOGA 2HRVA 4CBOA 2HNTC 5JYIA 1J17T 1A5IA 2F9BH 4RKOB 1QY6A 1V2WT 3U1IB 4K5ZA 1NU7B 2NU4E 5H4IB 2FS8A 2VVUA 1DVAH 1HAVB 1RFNA 3ODFA 1DDJA 4BANB 5ESTE 3OY5U 1IQGA 1ZMNA 1GBBA 2A0QB 1V2OT 4Y8XA 1Z1JA 2BQ6B 2JKHA 2PSXA 4B2AA 2JETB 1SVPA 1QQUA 1S6HA 1BA8B 2GGVB 1O2HA 4IN1A 1K22H 4XBCA 1UVOA 1HJ9A 1MTUA 1O5CB 1TNGA 1V2VT 2ASUB 1E34B 3D49H 2XBVA 4Y0ZE 3AW0A 5GXPA 3LT3A 5CMXH 5J4QA 1O3AA 3K65B 2BD7A 3RMLH 1JOUB 1SPJA 1TMTH 3C1KA 2W26A 3FVFB 1AWHB 2RA0A 4BXSA 3S69A 1RTKA 8LPRA 3NUMA 1ZZZA 1G36A 3HGPA 7ESTE 1UTKA 2ALPA 5L6NH 1FPCH 2ZCKP 3UREA 3ZZ4A 2C90B 1XVOA 1YPJH 4J1YA 1YPLH 2G4TA 3SNAA 1AE5A 4CRCA 1C1WH 1TX7A 1DS2E 3U69H 1GI4A 5JB8S 1GHAG 4WMEA 4I33A 4NZQA 3TGJE 3BTHE 4CHAB 2FOFA 4X8VH 3Q76A 2ZFFH 4ABEA 3O8BA 1O2WA 2F91A 3SZNA 1ZGIA 4ISNA 4FUJA 1P2IA 2A4RA 1ZLRA 3K9XB 4UEHH 3Q3YA 1A5GH 3GYLB 4GHQA 4B1TA 3RMOH 2BD9A 4O03A 5FAHA 1S6FA 1THSH 4OS1A 2FPZA 3OTJE 2BY5X 3O8CA 2UUJB 1TGBA 1TMBH 3OU0A 2A2XH 3QZRA 4D9RA 1HAYB 1HAIH 2BXUH 2P93A 2BD8A 4NFEA 1ZHRA 1C2MA 5FPSA 1LHCH 3MHWU 2VIVA 1ANDA 2ZPRA 5EOKA 2G4UA 4YT6H 3UNSA 2W3IA 2BD3A 1FONA 1GJAB 1TNJA 3A83A 4HFPB 3TH4H 1GI6A 3V7TA 4XOJA 4O9VA 1YLCA 2FP7B 4MPXA 2ZKSA 1PPHE 1AE8H 1C1NA 1EZXC 2VU8E 4Y76A 3LDXH 1GI5A 1DXPA 1SC8U 2VVCA 1NM6A 1BBRH 1QRXA 3HK6B 1A3BH 1TPPA 1IQJA 1CGJE 2PKSC 1IQKA 2TBSA 2BM2A 4YT7H 3QGNB 4J2YB 3RMMH 4XBDA 3FAOA 2ODYB 4BAHB 1QFKH 2FI3E 1MZDA 2HPQH 2Z9LA 4WH6A 1L1JA 3TGIE 1TLDA 2GMTB 1P02A 4ABAA 1GHZA 2GV6A 4TPIZ 1SGDE 2Z3EA 1UTLM 3FP8E 3KCGH 2TGPZ 1NT1A 1PFXC 3F68H 3F9FA 3KHVA 1XVMA 7KMEH 1ZJDA 2A1DB 1GCTB 1L0ZA 2M5TA 1D3DB 3M5MA 8GCHF 4ABHA 1GBAA 3M37A 5EPYA 4Y0YE 4IBLH 2AGGX 4MDSA 3U1JB 4IS5A 4O3TA 3SV6A 3KQEA 1WCZA 1DX5M 1HNEE 2ZQ1A 1GJ5H 1A5HA 1BT7A 1A46H 1BRAA 1H9IE 1YPHE 2W7SA 4CH8B 1BOQA 1KXBA 2G55A 1EP6A 4ZAEA 8ESTE 4B2CA 1O3NA 1C5OH 2H2ZA 1KTSB 2ZTYA 3MFJA 2ZFSA 4ZH8A 1T4VH 1Y3VA 4A5TS 4AFSA 3HATH 1KXAA 2W7UA 3EYDA 3GCTF 1FLEE 3SHAH 2HLCA 2F9UA 2IOTA 1IHTH 4X8SH 1KSNA 1QQ4A 1E37B 1Y3YA 2BDGA 3ZZBA 2ZA5A 4NIVA 1TA2A 3RXKA 2Q6FA 1D3QB 1NO9H 1G30B 1EJNA 1EQ9A 2FMJA 1N6XA 1TOCB 1VITH 1C2DA 1VITG 3E91A 2PR3A 2WPJS 1O38A 3MNXA 3TGKE 1AFEH 5T6GA 1DANH 1O2JA 1S83A 1MQ6A 3QN7A 1DWCH 4ZHAA 3TJVA 4I8KA 1G37A 1ANCA 3BEIB 1DFPA 3M35A 1PPFE 2ZDVH 4UE7H 3ZV8A 4KP0A 1Z7KA 4Y8ZA 1QL9A 2PW8H 1P2JA 1TNHA 1BQYA 4E06H 3SI3H 1EKBB 4AZ2B 9ESTA 3F1SB 1FAXA 1L4DA 5EXLA 1QL7A 3KIDU 1G3EA 1MMJN 2BD5A 1YPEH 1ARCA 1C5ZB 1FUJA 4H4FA 3UQVA 1TWXB 1O5GH 3TLOA 4Y7AA 3ITIA 1HJAB 4MNVA 3LIWA 3LU9B 4Q80A 1DPOA 1C5WB 1CE5A 2GKVE 1GVZA 2VJ1A 4BNRA 1UCYH 1TNIA 4ABBA 2CF9H 2Q6GA 3LGWA 1AVXA 2HPPH 3U8OH 4I8HA 4WMFA 1HYLA 1O36A 2BQWB 1C9PA 1F92A 1KXCA 2ZFQH 1E38B 1GBJA 2ZEBA 2ZGXH 1ELBA 1ZR0A 2C93B 3CS7A 4MNWA 1OOKB 1SGRE 4I7YH 3RXQA 3RM2H 5CHAC 1Y5AT 3GDSA 3ZZ5A 4NIXA 3RXFA 1BJUA 2VH6A 2ULLA 1O3LA 1EZUC 1HIAB 1PYTD 4TY6A 1CO7E 5BPEA 2ANYA 1LHGH 1OPHB 1XM1A 3T28A 5BRRE 3M7UA 2AMPA 1EUFA 2J2UA 3RU4E 2F3CE 1C4V2 1MAYA 3NXPA 1O2ZA 1NESE 1O3DA 1P3CA 1TA6A 2Y80A 1MU6B 9LPRA 4JYVH 2H5CA 3T5FH 3RP2A 3KQDA 3LJOA 2ANKH 2BY6X 1IQEA 5HXFA 3T2NA 3A8BA 1E0FD 5FPYA 3MNSA 3IWMA 3GY5A 1KY9A 1S81A 2OQ5A 2EA3A 3RXBA 2JH6D 1BRUP 1GI7B 1SGQE 4MTBA 3NPSA 3UY9A 3S0NA 4WXIA 1TNKA 1ZMJA 1LVOA 5DGJA 2XTTB 3S9CA 3LGUA 1BTHH 2C8YB 1C2GA 5L30H 1AGJA 2BVSH 1L1GA 3ODDA 4CR9A 5TCAA 1JBUH 1SFIA 4CRAA 3SO3A 5HGGA 4DY7B 1O2MA 1FJSA 4UFGH 1SL3A 3RXTA 1L4ZA 3RC5A 1GVLA 1O3CA 3GY3A 2J34A 4HZHA 2FOEA 5JPMH 1T8NA 1Z8IB 4A1VA 1ZMLA 1SGEE 1ETRH 2A5IA 1O3GA 2ZDAH 1OYTH 1K1NA 3OX7U 3OYPA 2J4IA 3SUGA 1W10U 2CMYA 5DG6A 1D3PB 1G3BA 1GJ6A 4K1EA 2ZPSA 3B9FH 3RXUA 3I29A 3OSYA 3GYMA 1MBQA 2J92A 3PROA 2BZ6H 1AVGH 3BIVH 1TYNA 4CRDA 1RRKA 1MCTA 1SQTA 2BY9X 2GD4B 5FCKA 1D6WA 1V2NT 1O2OA 4KELA 1GDQA 4FUIA 4CRGA 1AZZA 1TIOA 3U8RH 1PQ7A 1GI9B 2XBYA 4NZLA 1J15A 1ELCA 4D9QA 1SHYA 1CVWH 1QL8A 1TRNA 3E6PH 1GMDG 4D76A 2B8OH 1K1MA 3A82A 5TCCA 1QBVH 2IPHA 1S0QA 2BDYA 4U30A 3I78A 2B5TB 3Q3XA 1GBTA 4X1QU 5LGOA 3KEEA 2OTVA 2OD3B 2Z7FE 2HWLB 1B7XB 5CE1A 1GI2A 2SNVA 3E16B 1GHVH 2P3TB 5F6MA 2WV5A 2NU0E 4AG1A 1AQ7A 5A8YA 1CHOG 3AAVA 1C2FA 1SGNE 4R8TB 1SGPE 1N6YA 1OXGA 1FNIA 1C1QA 3BEUA 3DFJA 3BG4C 4AOQA 3ATKA 4DIIH 1SOZA 1D4PB 2Z9GA 2FWWA 3E0NB 2A7HA 3MH4A 2ZTXA 2BTCE 1C4Y2 3GICB 5FCRA 1BHXB 4ZKRU 2OXSA 1GBKA 1UTPA 3AASA 3BTGE 4CHAC 1HLTH 3KN2A 1HJ8A 1KXEA 5A8XA 1Z6EA 2A4QA 1B0FA 1C1RA 2O8MA 1TNLA 1SFQB 1FY3A 2SGQE 3QLPH 3NKKA 2BX4A 1O5AB 3QUMP 4MLFB 2VWNA 1LVYA 1CBWC 3ZZ6A 2ODQA 1C2EA 1C5PA 1O35A 4FUBA 5HM2A 1BHXF 1UVUH 5DP3A 4X2YA 2J9NA 2P8OB 1YF4A 5C67A 1UVSH 1P05A 4FXGH 5JBBS 3RXHA 1WTHD 1ZSJA 1C9TA 2UUKB 3HPTB 1O3EA 1SI5H 2PUXB 2Y7XA 3PMJA 1SLVB 1GMCG 1V2ST 1TPSA 3FP7E 5FBIA 1QRWA 3BTQE 1PQAA 4OGYA 3PLBA 4DGJA 2ZF0H 5AF9H 3RMNH 1C5UA 1LPZB 1P3EA 4KKDA 1H4WA 3UQOA 3VEQB 2AYWA 2Z3CA 1GBDA 1LCYA 1W14U 2F9NA 2QGRA 1GHWH 1O3FA 4H42U 3GCOA 4X8UH 2SGAA 4ZHMU 3UNRA 1PPGE 1V2RT 4UDWH 1NFXA 2P94A 1BDAA 3MWIU 1UTMA 3T25A 2WPMS 3GISB 4GSOA 1WAYB 5E2PA 1DUAA 2AGEX 3TPIZ 2PFEA 2PWXA 4IC6A 1SLWB 1TX6A 2BD4A 3F6UH 4MPVA 1J8AA 1OP8A 2QXJA 3HKIB 3EAJA 3T26A 1O2XA 1THPB 3SI4H 4IC5A 1JWTA 1BTPA 3LGIA 5A0CA 3SU6A 2ZU1A 1TONA 4GPGA 3A85A 1GBHA 4INHA 1ETSH 1Y3XA 5FPTA 2ZZUH 4B74A 1ELFA 4AX9H 1LKBA 5C3NA 4JZ1A 2TGDA 1GCTC 2KAIA 4ISLA 5AFZH 1SGTA 2PV9B 3PMAB 1Q3XA 2H6MA 2FXRA 2FS9A 2QY0B 3LC3A 2H5DA 1O3PB 2ZDLA 1MTNC 4GCHF 3GY2A 3KNXA 4TPYA 1BIOA 2GCHF 3PWCA 2O9QA 3RDZA 1RXPA 1EPTC 4HI3A 1SB1H 2HNTE 3NK8A 1LHDH 2A32A 1O3MA 1W7GH 1C5TA 3JZ2B 1ZPZA 2YOLA 5DK1A 1AFQC 3FP6E 3UFAA 3C27B 2SGFE 4AFZA 3RLWH 4AFQA 1C5LH 1QNJA 3LPRA 4DT7B 4AYVB 1SGFG 1WQSA 5DPAA 1KIGH 3M3VA 1FY1A 3RXVA 3SJ9A 1INCA 1THRH 2GDEH 1PYTC 1KDQA 1T7CA 3T62A 2BHGA 4ABGA 1K28D 1TGSZ 4AN7A 2UWOA 6CHAB 4ZKSU 1OWDA 1IQFA 1J16A 3RXOA 1IAUA 3BIUH 1E36B 5C1XA 3IG6B 1JMOH 2Y5GA 3BG4B 1HFDA 1CQQA 3VXFH 3SV2H 4TWWA 4WF8A 1QIXB 5F8XA 3A7ZA 2ZTZA 3MH7A 5EG4A 3SN8A 2VVVA 5EW2H 1DWBH 4UFFH 1NN6A 2WV4A 1O5BB 4IMQA 5E0HA 3SJKA 1O3HA 5TJXA 4INLA 4UONA 4A7IB 1BUIA 2NWNA 1FMGA 1NRNH 2ZGBH 1S0RA 1O2NA 1HJAC 1CBWB 1XUKA 4BTTB 2VB0A 1CA0C 2Y5FA 5F8TA 1DT2A 4NG9H 5EQQA 3TK6A 1AO5A 2VGCC 1NRSH 3A8AA 1LHEH 2WYGA 4Q7XA 5EODA 1A3EH 1AIXH 4Q7YA 2ZO3H 1FY5A 1W3CA 1B0EA 3MNBA 3E0PB 1BRBE 2Q1JA 2ZHWH 1YBWA 1ZJKA 4BTUB 1SBWA 1O2VA 3SUDA 2FTMA 1BBRK 1BMNH 2BOKA 1GJCB 4NGAH 1GMHG 3H5CB 5E8EH 1XUJA 3F9HA 4JMYA 1UVTH 2GZ8A 2QXHA 3BTEE 1Z8JB 2AFQB 4XBBA 1AMHA 2Y81A 1SQOA 1O3KA 3SU1A 4IN2A 2BQ7B 5LPEA 5A0BA 2BVRH 2BLWA 2Z94A 4THNH 1M9UA 3TH2H 5GCHG 1YGCH 3L3TA 1EAUA 1RTLA 4A6LA 2V6NA 1TRMA 1Y5UT 4YESB 4X6OA 4K3JA 4Y8YA 2FYQA 3P70B 5DKMA 3SHCH 2B7DH 1P2NA 1O3IA 5DO4H 1C5MD 1RS0A 1ZPCA 3DA9B 4KTUA 5C20A 1EOLA 2FIRH 1TALA 1S85A 2PKAA 3A89A 2ZQ2A 2XRCA 4FUGA 4AFUA 1HAPH 1A7SA 4LZ4B 1FY4A 1MTNB 2V3HH 3TNSA 1K21H 1OWEA 1OYQA 1XXFA 2UUYA 2ZDKA 3UR9A 2HOBA 4FUFA 3ZV9A 4ISHH 1VJAU 1EPTB 4FVBA 4OS7A 3EQ0H 4IW4E 2QN5T 1DWDH 4A1TA 2RG3A 1QRZA 2PLXA 3D62A 4K1SA 5EQSA 3TH3H 1T8OA 1AFQB 1QA0A 4D7GA 2PGBB 3EA7A 1H9LB 3ZVEA 1AY6H 2HNTF 1GHAF 4B73A 1YKTA 3LGVA 1QJ7B 3H7OA 3VB3A 1O2LA 6ESTA 1BMMH 1TPAE 1IQMA 2P3FH 3TNTA 5FX6A 3F9EA 1C5VA 3URCA 1SLUB 4X1RU 3RXJA 2OBOA 1ZTLA 1LDTT 1TAWA 4XE4A 4MPWA 1AKSB 2J38A 4ISOA 2ZFRH 3LOXA 4AG2A 3U9AH 4LK4A 1HXFH 1O2IA 2GT7A 1GGDC 2BDCA 5JBTA 1AVWA 1CT0E 4BAOB 2C8ZB 2G5VA 3FZDA 4CRFA 4H6SB 1YPMH 2BD2A 4U01A 4JYTA 1DWEH 2GT8A 4MG3A 4I32A 2V3OH 3B23B 1ZRKA 1ETTH 2BDIA 1RIWC 3PM3A 7LPRA 1WSSH 1UCYK 3ZVDA 2G81E 4GLYA 1ZSKA 2FODA 1Y5BT 1A1RA 1KLIH 5G4BA 1TQ7B 1RD3B 3ZVFA 4B75A 2OC8A 4INKA 5K7RA 4X8TH 4WXVA 3M36A 4Y11E 1C2IA 2BXTH 3RXIA 2CHAC 1HDTH 1UK2A 2B0FA 3N7OA 4NIWA 1C1VH 1CA0B 1P2MA 4OS2A 1J9CH 4MPUA 2VGCB 4U32A 2YNAA 5DP5A 2BYAX 3MMGA 4NA9H 5FX5A 3FFGA 4IGDA 2WINI 1VCQA 2F9VA 1Z71A 4ISIH 3A80A 6GCHG 1AHTH 2WPLS 3M5OA 1IHSH 3LJJA 4XSKU 3Q77A 3H7TA 1AUJA 2P8OC 1FN8A 3SJ8A 1SOTA 3V3MA 2AGIX 2ALVA 1K1PA 2QF3A 2ZFTA 2ANMH 1PPEE 1XKBC 4NWKA 1WU1A 1H9HE 5HM9A 2HGTH 3PWBA 1D6RA 3W94A 3P92A 2C8WB 4TWYA 2QYIA 1HAZB 4X0WU 3A7TA 4VGCC 1DE7H 4MNXA 1P01A 2DE9A 4LZ1H 5JBAS 2THFB 3P6ZB 1AWFH 1TGTA 1YCPM 3RXLA 4X6MA 2GDDA 2CXVA 1MD7A 1MKWH 1O2QA 4YOIA 5B6OA 1HAVA 2BDAA 1C1UH 1OWKA 4KTSA 3GY6A 1ESBA 7GCHG 3MO3A 3ZZDA 4GVUA 1NU9A 2WUCA 1GHBG 1KYNA 1OWHA 3U8TH 3UUZA 1C5RA 4ABIA 4E05H 1GG6C 2DUCA 2XBXA 2STAE 4ZXYH 3LH3A 2P16A 1V2LT 1TB6H 3M3SA 3ZZ8A 4D8NA 2XW9A 1RTFB 2CJIA 4ZXXH 3UPEA 2R3UA 1ZGVA 1NRRH 1L1NA 1VITF 2LPRA 4ZKOU 1YCPH 4LXBH 2FO9A 2JH0D 2ZCLP 2QC2A 1W0ZU 1OX1A 2VWMA 3DHKH 3K6ZA 2SFAA 1O2SA 1EZQA 1W2KH 3PMBB 2ZHFH 1AU8A 1MCVA 3QTOH 2H1UA 1GBMA 5FXLA 2CN0H 4OS4A 5E2OA 2H9HA 2SNWA 4DVAU 3ATLA 4BAQB 1RJXB 1JRTA 3VB4A 1HAHH 3VXEH 2LNCA 3FZZA 1A61H 4Y79A 4NCYA 3CP7A 5GDSH 3A84A 1G2MA 4FU7A 1BTUA 1MZAA 5JB9S 1O2KA 5ETXA 1SSXA 2CF8H 2WUBA 1GGDB 1EX3A 2PSYA 4GUXA 3SORA 3A7XA 3M61U 1F7ZA 1UK3A 4F4OC 2XWBI 1NC6A 2ZIQH 4YZUA 1EJMA 4WJG2 1F2SE 3M7QA 1IQLA 2O8UA 1WTGH 2VWOA 2PGQB 2UWLA 1NFUA 3MYWA 2ZFPH 1RIWB 4FU8A 4ABJA 5DP9A 6CHAC 2VIQA 3AVZA 2A5AA 4JZIA 1HGTH 3BEFB 4OGXA 1CT4E 1ZYOA 3TIUA 1XUIA 1W8BH 1W11U 2PHBA 2TIOA 3QWCH 3SQEE 4Y7BA 2O8TA 1KLTA 2R0LA 4ASHA 3ZVCA 3PTBA 3NCLA 2QF0A 2CHAB 3STIA 1V2UT 3TU7H 1KXFA 1VZQH 2R2WU 5GJ4B 1P09A 2ZPQA 1Y3UA 2A45B 5ABWA 1WOFA 1AI8H 3SV8A 1UHBB 2TRMA 3O8DA 1XUHA 2SGDE 2OINA 5EW1H 4U2WA 1BTYA 2D8WA 2AIPA 1QB9A 1LPKB 3SGBE 3P95A 1P9SA 2VNTA 2XC0A 1G3DA 1V3XA 1EASA 1GBIA 1QTFA 1K9OE 2VWLA 4ESTE 1TQ0B 1E35B 2W5EA 1W13U 2BMGB 1FN6A 1EB2A 1V2KT 4CBNA 5A0AE 2BY8X 2XWAA 1DOJA 2OC7A 1GI3A 2Z3DA 2ZDMA 1O2TA 1NTPA 1QA7A 3SW2B 2VIWA 4RKJB 2EI8A 2QAAA 4YLQH 1OWJA 2B9LA 3ZZ7A 5EXNA 1RGQA 1FQ3A 3PTNA 2XCNA 3SJIA 4F49A 4PROA 2ZECA 4BXWA 2Z9JA 2IN2A 3Q00A 4GHTA 4VGCB 4MQAA 2A4OA 4AGKA 4B76A 4X1PU 1Y3WA 2FYRA 3BTTE 1TABE 2D1JA 1C2JA 2K1QA 2W3KA 1LMWB 2A4GA 5C5OA 3D23A 3MO9A 1GJBB 3TK5A 4E7RG 2FX6A 1OSSA 1SGIB 2BX3A 3SNDA 1MTVA 3KL6A 1FAKH 5K0HA 4DOQA 3DFLA 3RXPA 3RXCA 1EZSC 1GG6B 1VCPA 3EE0B 5A8ZA 3LGTA 3SNBA 3SNCA 1NS3A 3HKJB 1SGYE 4AYYB 2STBE 3TJNA 1GI0A 1TBZH 1UJ1A 1V2MT 5HYOA 5F8ZA 1AZ8A 4WY3A 3SUEA 1GMDF 2BLVA 1CSOE 3A87A 1QGFA 1G9IE 3GDUA 4AB9A 3STJA 3MU8A 4K8BA 2V0BA 5I25A 1F5RA 1O2RA 1TMUH 3EGKH 4RN6A 1ARBA 3RXSA 2RA3A 1LPGB 1SQAA 1AB9B 2UUFB 1DLKB 1BJVA 4AB8A 2SGPE 1DITH 4I8JA 1ESTA 3ZYEA 1CHOF 2ZHQH 4Z6AH 5AHGH 1GDUA 4NSYA 3RU4D 2Y5HA 4A92A 2J94A 1UTJA 1TGNA 3M5LA 3ZZ3A 1C2KA 1DXWA 2GVFA 5L2ZH 2AS9A 3M5NA 3ZZ9A 4QT8C 2FOMB 1VCWA 3R3GB 3URDA 1UTQA 2A31A 1NFYA 1MAXA 3SNEA 1BZXE 2TPIZ 1P04A 4JK5A 2VH0A 1Q2WA 3LGYA 1F0RA 1ZPBA 3SQHE 2H9EH 1UTNA 2FI4E 1UVPA 5DP8A 5JDUB 1F0TA 3E8LA 1YPKH 1AD8H 2GTBA 4BOHA 3BG8A 3T29A 3PB1E 8GCHG 1TRYA 2ZG0H 3A8CA 2EEKA 1BRCE 4CREA 4I31A 5JBCS 5A2MH 3LKWA 4JZFH 1FY8E 1C1PA 2PTNA 4NFFA 2GCTC 1P2QA 3BV9B 4FUEA 1OWIA 3T27A 1C2LA 1GMCF 4Q2KA 2P59A 2Q6DA 1K1OA 4X6PA 2Z9IA 1CHGA 4KTCA 2OP9A 2A7JA 2OC1A 2GX4A 1HIAA 3TITA 4GAWA 2FDAA 1LKAA 4X1NU 5I46H 2V35A 1DLEA 1P2KA 1BBRE 3AW1A 4JZEH 1QB6A 4B2BA 4JYUH 1QJ6B 5LH8A 3OY6U 1CT2E 1NPMA 3RM0H 1CA8B 4X2XA 4BAMB 3MH6A 1O30A 3GCTG 1W0YH 1C5YB 1QCPA 1C1OA 5DP6A 4CR5A 4K8YA 5EGMA 1GHYH 1GCDA 1EAIA 3A81A 1KTTB 1ABJH 3SGQE 3RXEA 1Z8RA 3ZVAA 2ZP0H 3KQBA 2BY7X 1BTXA 5AVDA 1Y8TA 4K69A 3DUXH 3EA9A 1XX9A 3K2UA 4NSVA 1ELDE 1G2LA 4UFDH 3SJOA 3SU5A 3S9AA 3VPKA 2ZGHA 1S5SA 2TGTA 3PO1B 3P8OA 1MQ5A 1DY9A 2EC9H 5FBEA 3S7KB 3O8RA 1CGHA 2BDBA 2RCEA 3ZYDA 1FXYA 4M7GA 1VGCC 3E3TA 2XC5A 2Z6BD 5T3HA 3FANA 3TJUA 1A0HB 1ZSLA 3VGCB 1X7AC 1XXDA 4HGCA 1SLXB 4ZROA 3UOUA 1HV7A 3AAUA 2BDHA 2A7CA 1C1SA 4FUDA 1C1MA 1V6DA 2QCYA 1WYKA 1PPBH 1O2YA 2NU2E 2VINA 3Q3KA 5GIBA 3TVJB 2I6SA 1CU1A 1ACBE 1MH0A 1O5DH 2QV1A 1WBGB 3GY7A 3SUFA 1XKAC 1DM4B 1FIWA 5C1UA 2R9PA 3SU0A 1S84A 1LQEA 3CS0A 1OP0A 4X2WA 5HMAA 1PQ5A 1GBFA 4FVDA 3BTME 1O5FH 2F9OA 2PTCE 3ENSB 3VB7A 1EB1H 1GL1A 4NIYA 1W7XH 1QJ1B 4JCNA 1AN1E 1QR3E 3RUOA 1TE0A 1GWAA 5EU8A 4DG4A 3NZIA 3SGAE 1JRSA 1T31A 2HVXA 1K2I1 1YYY1 2Z9KA 2Y6TA 2FOBA 4ZKNU 3LC5A 1ORFA 1EAWA 2C8XB 4I8GA 5ESBA 1PJPA 4FUCA 1VR1H 1FV9A 1BMAA 2ZU5A 4CH2B 2FLRH 1S82A 5DJ7A 1K1JA 1EATA 1BCUH 1C1TA 1A0LA 1EJAA 3F9GA 2GZ7A 1SGCA 2BB4A 4YO9A 4UD9H 1UTOA 1ELAA 1NRQH 1EXFA 1UMAH 1O39A 4FUHA 4ZUHA 3SV9A 1YPHC 1GVKB 2PUQH 1OS8A 3BTKE 3RXGA 4YLUA 3GCHC 1EP5A 1LTOA 1TPOA 5GWZA 2WPHS 3SU2A 1GBLA 1C4U2 1ELEE 2R2MB 2Y82A 3HGNA 2O8LA 1P11E 2H9TH 1TBRH 2ZC9H 1OKXA 1P57B 1Q31A 2A2QH 1UCYE 2QXGA 2FZZA 2WPKS 5IYTA 1XUGA 3ZVGA 1SR5C 4AORA 1HBTH 2C3SA 4DW2U 4ABDA 1B5GH 1GL0E 5LPFA 1UHBA 1BB0B 4O97A 2AEIH 2ANWA 3M3TA 2KAIB 1O0DH 1O34A 3QGJA 1GPZA 2NU1E 1ANEA 1H8IH 2BLQA 1O32A 1Y59T 3QTVH 3UWJH 3A88A 4UFEH 2GCTB 1O37A 1HB0B 2JH5D 1C5SA 1BTZA 1QURH 2C4FH 1KXDA 1GHXH 5T6FA 2TGAA 2BLOA 2O8WA 1QB1A 1WQVH 1GI8B 3UTUH 2RDLA 1P06A 5GPIB 1GMHF 2ESTE 4NWLA 3LONA 2FOCA 1ZOMA 3NWUA 3RC6A 1TX8A 1F5KU 1GBEA 1YC0A 4BAKB 3SU3A 4WH8A 1J14A 4TYDA 3MNCA 1ZHPA 1ANBA 1V2JT 1GJ7B 4JZDH 1ESAA 2G51A 2ZI2H 2XBWA 1G32B 5GCHF 3BTWE 4R0IA 2FEQH 1H8DH 1Z6JH 2I6QA 1L2EA 2AERH 1KDQB 3V13A 3BSQA 4E7NA 1WV7H 1C2HA 4HTCH 2QIQA 2FI5E 1QBOA 1ID5H 2F9PA 1MTSA 5AFYH 1MD8A 2QA9E 3TK9A 1FDPA 1QHRB 1HPGA 5IDKA 4FU9A 2G52A 2FOAA 2VIDA 2ZGJA 1ELGA 3WY8A 2XYAA 1DICA 3P8NA 5A09A 1VGCB 3G01A 1T4UH 2J95A 1D3TB 1MKWK 2D26C 3BTDE 3QO6A 5DP7A 3RXAA 2XNIA 5F03A 1SMFE 1ZTJA 1TBQH 2FESH 2ZDNA 3IITA 2F83A 1G3CA 4WWYA 1HUTH 2ZGCA 3GY8A 1NZQH 5EPNA 1F5LA 2D2DA 1XMNB 3MI4A 1ELTA 2P95A 1GJ9B 1V2QT 4D7FA 1NY22 1HCGA 2QXIA 2ZWLH 2AMQA 1PPZA 3P17H 1MKXK 2OC0A 4OS6A 2OBQA 1JIRA 4SGBE 1SG8B 3SOSA 4DJZB 1YCPK 3ATMA 1K1LA 1BTWA 5J4SA 2PKSB 1IQHA 3MO6A 1N8OC 3RXDA 3A8DA 1P9UA 3BN9A 1YM0A 4IMZA 1V2PT 2R3YA 3UIRA 1A0JA 1P2OA 3SU4A 1MKXH 4A1XA 1T8LA 1Z1IA 1O33A 2A5KA 4WVPE 4CRBA 3GCNA 1XUFA 3ZZCA 3A7YA 1HXEH 1F0SA 4XDEA 2P3UB 5LPRA 2ZHEH 5PTPA 4ZHLU 1FI8A 4SGAE 4O3UA 4KGAA 3SV7A 2VIOA 3DD2H 1O31A 1IQIA 1GI1A 3QZQA 3R0FA 3V12A 1DUEA 3VB5A 4ZMAH 2G8TA 2BOHB 1AB9C 4MNYA 4YTAA 4WMDA 1YPGH 3E90B 5T6DA 2AIQA 1LVMA 2HALA 4DIHH 3GCHB 3PV4A 1P8VC 1N1LA 3P8FA 3ESTA 2FM2A 4JK6A 1IQNA 4H6TA 3GY4A 3RLYH 4MVNA 3VFEA 3GOVB 3W95A 1DY8A 1TOMH 2WPIS 1PPCE 3D65E 2GZ9A 5SGAE 2PKAB 1BMLA 2WYJA 2JETC 5EQRA 1D9IA 3M7TA 1CGIE 3JZ1B 2ZCHP 3A86A 1TFXA 2G5NA 2OCVB 3HK3B 4X2VA 3ATWA 1EAXA 2OQUA 1T32A 2ZNKH 2BVXH 1SHHB 2EI7A 4XFQA 3KF2A 6GCHF 4K60A 4Q7ZA 1ELVA 1GJDB 3MTYA 1MU8B 4X1SU 1K1IA 1JIMA 1O2GH 1VJ9U 3PLKA 4Y71A 3UWIA 1ZRBA 2AMDA 2ZU2A 3RU4T 4GCHG 2ZU3A 2GCHG 1P12E 3UOPA 2ZHDA 4BTIB 3E1XB 3K6YA 2ODPA 3MH5A 4X6NA 1ZTKA 3S7HB 2R0KA
chains in the Genus database with same CATH superfamily
1UO6A 1LQDB 3I77A 4I8LA 3EDXB 4DCDA 1P03A 2IJOB 4YOJA 1U6QA 1HAXB 1NFWA 2WPDD 4TY7A 3WW7A 3S9BA 3ATIA 3RXRA 1V2TT 1HAGE 4OS5A 2GP9B 2KFWA 3MOCA 2WZQA 4K2YA 4Y6DA 4RT1A 5E0GA 2FTLE 1DSUA 1P10A 3KGPA 1EOJA 1BITA 1O3JA 1SGFA 2OLGA 5EIYA 1KLJH 3PMHB 5C2ZA 3SYJA 2AH4X 3UR6A 3DT0H 1A2CH 3BF6H 7GCHF 4NA7A 3RC4A 1AUTC 1O2PA 1ZHMA 4I86A 1GHBF 3B8JA 1GDNA 1ABIH 4DURA 3MU1A 1O2UA 5CHAB 1FZZA 3A7VA 5CDFE 1UW7A 1GBCA 2G00A 1C5NH 3PLPA 1T8MA 2DE8A 1HRTH 3BTFE 2ILNA 5L2YH 3PO1C 2FOHA 1F0UA 3ELAH 3MU5A 1MTWA 4Z0KA 4YM9A 3EA8A 1JXPA 4Q63A 1YLDA 1W12U 3ZVBA 4Z1MD 1O3OA 1MUEB 3V0XA 2FX4A 1NROH 2IJD1 3MU4A 1A4WH 1FIZA 4B71A 1O3BA 3ZZAA 5C1YA 1GJ8B 3VGCC 1WUNH 3CENA 3A7WA 1EPTA 1C5QA 4NA8A 3KYGA 1DSTA 4YOGA 4Y10E 1YP9A 2NU3E 1LO6A 2SGEE 3QDZB 3U98H 5FHTA 5E0JA 2XXLA 1N8OB 1Z8GA 3QX5H 6LPRA 3MU0A 1GJ4H 3UNQA 1UK4A 3P8GA 2UWPA 4FETA 1MBMA 1FPHH 1HAOH 1QBNA 2XC4A 2EI6A 3GDVA 3RXMA 3SBKA 1C5XB 3TJOA 3PYHA 1O5EH 3KQCA 2OUAA 2GV7A 8KME2 2JDID 4K1TA 2J5UA 2YNBA 4ABFA 1TGCA 1AKSA 2BZAA 2GMTC 2Y7ZA 1PQ8A 2FLBH 1IOEA 2ZU4A 4RSPA 1H1BA 1LHFH 1LVBA 3L33A 3VB6A 1OP2A 4AGJA 2XCFA 3QK1A 5EXMA 4LOYH 2CV3A 1P0SH 1SQRA 1NRPH 2CGAA 5DP4A 5DN6D 3L6PA 3LH1A 5C5NA 2VIPA 1K0HA 2FOGA 2HRVA 4CBOA 2HNTC 5JYIA 1J17T 1A5IA 2F9BH 4RKOB 1QY6A 1V2WT 3U1IB 4K5ZA 1NU7B 2NU4E 5H4IB 2FS8A 2VVUA 1DVAH 1HAVB 1RFNA 3ODFA 1DDJA 4BANB 5ESTE 3OY5U 1IQGA 1ZMNA 1GBBA 2A0QB 1V2OT 4Y8XA 1Z1JA 2BQ6B 2JKHA 2PSXA 4B2AA 2JETB 1SVPA 1QQUA 1S6HA 3OE7D 1BA8B 2GGVB 1O2HA 4IN1A 1K22H 4HG6A 4XBCA 1UVOA 1HJ9A 1MTUA 1O5CB 1TNGA 1V2VT 2ASUB 1E34B 3D49H 2QF5A 2XBVA 4Y0ZE 3AW0A 5GXPA 3LT3A 5CMXH 1QZ8A 5J4QA 1O3AA 3K65B 2BD7A 3RMLH 1JOUB 1SPJA 1TMTH 3C1KA 3F2HA 2W26A 3FVFB 1AWHB 2RA0A 4BXSA 3S69A 1RTKA 8LPRA 3NUMA 1ZZZA 1G36A 3HGPA 7ESTE 1UTKA 2ALPA 5L6NH 1FPCH 2ZCKP 3UREA 3ZZ4A 2C90B 1XVOA 1YPJH 3PRDA 4J1YA 1YPLH 2G4TA 3SNAA 1AE5A 4CRCA 1C1WH 1TX7A 1DS2E 2GJGA 3U69H 2K8IA 1GI4A 5JB8S 1GHAG 4WMEA 4I33A 4NZQA 3TGJE 3BTHE 4CHAB 1WXRA 2FOFA 4X8VH 3Q76A 2ZFFH 2W6JD 4ABEA 3O8BA 1O2WA 2F91A 3SZNA 1ZGIA 4ISNA 4FUJA 1P2IA 2A4RA 1ZLRA 3K9XB 4UEHH 3Q3YA 1A5GH 3GYLB 4GHQA 4B1TA 3RMOH 2BD9A 4O03A 5FAHA 1S6FA 1THSH 4OS1A 2FPZA 3OTJE 2BY5X 3O8CA 5EJLA 2UUJB 1TGBA 1TMBH 3OU0A 2A2XH 3QZRA 4D9RA 1HAYB 2PP6A 1HAIH 2BXUH 3OFND 2P93A 2BD8A 4NFEA 1ZHRA 1C2MA 5FPSA 1LHCH 3MHWU 2F4LA 2VIVA 1ANDA 2ZPRA 5EOKA 2G4UA 4YT6H 3UNSA 2W3IA 2BD3A 1FONA 1GJAB 1TNJA 3A83A 4HFPB 5HIZA 3TH4H 1GI6A 3V7TA 4XOJA 4O9VA 1YLCA 2FP7B 4MPXA 2ZKSA 1PPHE 1AE8H 1C1NA 1EZXC 2VU8E 4Y76A 3LDXH 1GI5A 1DXPA 1SC8U 2VVCA 1NM6A 1BBRH 1QRXA 3HK6B 1A3BH 1TPPA 1IQJA 1CGJE 2PKSC 1IQKA 2TBSA 2BM2A 4YT7H 3QGNB 4J2YB 3RMMH 4XBDA 3FAOA 2ODYB 4BAHB 1QFKH 2FI3E 1MZDA 2HPQH 2Z9LA 4WH6A 1L1JA 3TGIE 1TLDA 2GMTB 1P02A 4ABAA 1GHZA 2GV6A 4TPIZ 4B6FA 1SGDE 2Z3EA 1UTLM 2RDEA 3FP8E 3KCGH 2TGPZ 1NT1A 1PFXC 3F68H 3F9FA 3KHVA 1XVMA 7KMEH 1ZJDA 2A1DB 1GCTB 1L0ZA 2M5TA 1D3DB 3M5MA 8GCHF 4ABHA 1GBAA 3M37A 5EPYA 4Y0YE 4IBLH 2AGGX 4MDSA 5C0UA 3U1JB 4IS5A 4O3TA 3SV6A 3KQEA 1WCZA 1DX5M 1HNEE 2ZQ1A 1GJ5H 3F0OA 1A5HA 1BT7A 1A46H 1BRAA 1H9IE 1YPHE 2W7SA 4CH8B 5C0TA 1BOQA 1KXBA 2G55A 1EP6A 4ZAEA 8ESTE 4B2CA 1O3NA 1C5OH 2H2ZA 1KTSB 2J97A 2ZTYA 1EFRD 3MFJA 2ZFSA 4ZH8A 1T4VH 1Y3VA 4A5TS 4AFSA 3HATH 1KXAA 2W7UA 3EYDA 3GCTF 1FLEE 3SHAH 2HLCA 2F9UA 2IOTA 1IHTH 4X8SH 1KSNA 1QQ4A 1E37B 1Y3YA 2BDGA 3ZZBA 2ZA5A 4P02A 4NIVA 1TA2A 3RXKA 2Q6FA 1D3QB 1NO9H 1G30B 1EJNA 1EQ9A 2FMJA 1N6XA 1TOCB 4FOUC 1VITH 1C2DA 1VITG 3E91A 2PR3A 2WPJS 1O38A 3MNXA 3TGKE 1AFEH 5T6GA 1DANH 1O2JA 1S83A 1MQ6A 3QN7A 2JJ1D 1DWCH 4ZHAA 3TJVA 4I8KA 1G37A 1ANCA 3BEIB 1DFPA 3M35A 1PPFE 2ZDVH 4UE7H 3ZV8A 4KP0A 1Z7KA 4Y8ZA 1QL9A 2PW8H 1P2JA 1TNHA 1BQYA 4E06H 3SI3H 1EKBB 4AZ2B 4P00A 3F1SB 9ESTA 1FAXA 1L4DA 5EXLA 1QL7A 2KCPA 3KIDU 1W0JD 1G3EA 1MMJN 2BD5A 1YPEH 1ARCA 1C5ZB 1FUJA 4H4FA 3UQVA 1TWXB 1O5GH 3TLOA 4Y7AA 3ITIA 1HJAB 4MNVA 3LIWA 3LU9B 4Q80A 1DPOA 4TT3D 1C5WB 1CE5A 2GKVE 1GVZA 2VJ1A 4BNRA 1UCYH 2KM0A 1TNIA 4ABBA 2CF9H 2Q6GA 3LGWA 1AVXA 2HPPH 3U8OH 4Q4LA 4I8HA 4WMFA 1HYLA 1O36A 5C17A 2BQWB 1C9PA 1F92A 2WHXA 1KXCA 2ZFQH 1E38B 1GBJA 2ZEBA 2ZGXH 1ELBA 1ZR0A 2C93B 2W6ID 3CS7A 4MNWA 1OOKB 1SGRE 4I7YH 3RXQA 3RM2H 5CHAC 1Y5AT 3GDSA 3ZZ5A 4NIXA 3RXFA 1BJUA 2VH6A 2ULLA 1O3LA 1EZUC 1HIAB 1PYTD 4TY6A 1CO7E 2L74A 5BPEA 2ANYA 1LHGH 1OPHB 1XM1A 3T28A 5BRRE 3M7UA 2AMPA 1EUFA 2J2UA 3RU4E 2F3CE 1C4V2 1MAYA 3W1EA 3NXPA 1O2ZA 1NESE 1O3DA 1P3CA 1TA6A 2Y80A 1MU6B 3DCLA 4JYVH 9LPRA 2H5CA 3T5FH 3N99A 3RP2A 3KQDA 3LJOA 2ANKH 2BY6X 1IQEA 5HXFA 3T2NA 3A8BA 1E0FD 5FPYA 3DSOA 3MNSA 3IWMA 3GY5A 1KY9A 1S81A 2OQ5A 2EA3A 3RXBA 2JH6D 1BRUP 1VKYA 1GI7B 4M9FA 1SGQE 4MTBA 3NPSA 3UY9A 3S0NA 4WXIA 1TNKA 1ZMJA 1LVOA 5DGJA 2XTTB 3S9CA 3LGUA 1BTHH 2C8YB 1C2GA 5L30H 1AGJA 2BVSH 1SKYE 1L1GA 3ODDA 4CR9A 5CHBA 5TCAA 1JBUH 1SFIA 4CRAA 3SO3A 5HGGA 4DY7B 1O2MA 1FJSA 4UFGH 1SL3A 3RXTA 1L4ZA 3RC5A 1GVLA 1O3CA 3GY3A 2J34A 4HZHA 2FOEA 5JPMH 1T8NA 1Z8IB 4A1VA 1ZMLA 1SGEE 3ZIAD 1ETRH 2A5IA 1O3GA 2ZDAH 1OYTH 1K1NA 4ACBA 3OX7U 3OYPA 2J4IA 3SUGA 1W10U 2CMYA 5DG6A 1D3PB 1G3BA 1GJ6A 4K1EA 2ZPSA 3B9FH 3RXUA 3I29A 3OSYA 3GYMA 1MBQA 3F2FA 2J92A 3PROA 2BZ6H 1AVGH 3BIVH 1TYNA 4CRDA 1RRKA 1MCTA 1SQTA 2BY9X 2GD4B 5FCKA 3SZEA 1D6WA 1V2NT 1O2OA 4KELA 1GDQA 4FUIA 5EJ1A 4CRGA 1AZZA 1TIOA 3U8RH 1PQ7A 1GI9B 2XBYA 4NZLA 1J15A 1ELCA 4D9QA 1SHYA 1CVWH 1QL8A 1TRNA 3E6PH 1GMDG 4D76A 2B8OH 1K1MA 3A82A 4ACAA 5TCCA 1QBVH 2IPHA 2RFKC 1S0QA 2BDYA 4U30A 5B6LA 3I78A 2B5TB 3Q3XA 1GBTA 4X1QU 2OK5A 3KEEA 5LGOA 2OTVA 2OD3B 2Z7FE 2HWLB 1B7XB 5CE1A 1GI2A 1FX0B 2SNVA 3E16B 1GHVH 2P3TB 5F6MA 2WV5A 2NU0E 4AG1A 1AQ7A 5A8YA 1CHOG 3AAVA 5IK2D 1C2FA 1SGNE 4R8TB 1SGPE 1N6YA 1OXGA 1FNIA 1C1QA 3BEUA 3DFJA 3BG4C 4OM9A 4AOQA 3ATKA 4DIIH 1SOZA 1D4PB 2Z9GA 2FWWA 3E0NB 2A7HA 3MH4A 2ZTXA 2BTCE 1C4Y2 3GICB 5FCRA 1BHXB 2J98A 2OXSA 4ZKRU 1GBKA 1UTPA 3AASA 3BTGE 4CHAC 2K0QA 1HLTH 3KN2A 4AC9A 1HJ8A 1KXEA 5A8XA 1Z6EA 2A4QA 1B0FA 1C1RA 2O8MA 1TNLA 1SFQB 1FY3A 2SGQE 3QLPH 3NKKA 2BX4A 1O5AB 3QUMP 4MLFB 2VWNA 1LVYA 1CBWC 3ZZ6A 2ODQA 1C2EA 1C5PA 1O35A 4FUBA 5HM2A 1BHXF 1UVUH 5DP3A 4X2YA 2J9NA 2P8OB 5F53A 1YF4A 5C67A 1UVSH 1P05A 4FXGH 5JBBS 3RXHA 1WTHD 1E79D 1ZSJA 1C9TA 2UUKB 3HPTB 1O3EA 1SI5H 2PUXB 2Y7XA 3PMJA 1SLVB 1GMCG 1V2ST 1TPSA 3FP7E 5FBIA 1QRWA 3BTQE 1PQAA 4OGYA 3PLBA 4DGJA 2ZF0H 5AF9H 3RMNH 1C5UA 1LPZB 1P3EA 4KKDA 1H4WA 3UQOA 3VEQB 2AYWA 2Z3CA 1GBDA 1LCYA 1W14U 2F9NA 2QGRA 1GHWH 1O3FA 4H42U 3GCOA 4X8UH 2SGAA 4ZHMU 5C94A 3UNRA 1PPGE 1V2RT 4UDWH 1NFXA 2P94A 1BDAA 3MWIU 1UTMA 3T25A 2WPMS 3GISB 4GSOA 1WAYB 5E2PA 1DUAA 2AGEX 3TPIZ 2PFEA 2PWXA 4IC6A 1SLWB 1TX6A 2BD4A 3F6UH 4MPVA 1J8AA 1OP8A 2QXJA 3HKIB 3EAJA 3T26A 1O2XA 1THPB 3SI4H 4IC5A 1JWTA 1BTPA 3LGIA 4RT0A 5A0CA 3SU6A 2ZU1A 1TONA 4GPGA 3A85A 1GBHA 4INHA 1ETSH 1Y3XA 5FPTA 2ZZUH 4B74A 1ELFA 4AX9H 1LKBA 5C3NA 4JZ1A 2TGDA 1GCTC 2KAIA 4ISLA 5AFZH 1SGTA 2PV9B 3PMAB 1Q3XA 2H6MA 2FXRA 2FS9A 2QY0B 3LC3A 2H5DA 1O3PB 5KEDA 2ZDLA 1MTNC 2EQNA 4GCHF 3GY2A 3KNXA 4TPYA 1BIOA 2GCHF 3PWCA 2O9QA 3RDZA 1RXPA 1EPTC 4HI3A 1SB1H 2HNTE 3NK8A 1LHDH 2A32A 1O3MA 1W7GH 1C5TA 3JZ2B 1ZPZA 2YOLA 5DK1A 1AFQC 3FP6E 2F43B 3UFAA 3C27B 5FL7D 2SGFE 4AFZA 3RLWH 4AFQA 1C5LH 1QNJA 3LPRA 4DT7B 4AYVB 1SGFG 1WQSA 5DPAA 1KIGH 3M3VA 1FY1A 3RXVA 3SJ9A 1INCA 1THRH 2GDEH 1PYTC 1KDQA 1T7CA 3T62A 2BHGA 4ABGA 1K28D 1TGSZ 5HIYA 4AN7A 2UWOA 6CHAB 4ZKSU 1OWDA 1IQFA 1J16A 3DSGA 3RXOA 1IAUA 3BIUH 1MABB 1E36B 5C1XA 3IG6B 1JMOH 2Y5GA 3BG4B 1HFDA 1CQQA 3VXFH 3SV2H 4TWWA 4WF8A 1QIXB 5F8XA 3A7ZA 2ZTZA 3MH7A 5EG4A 3SN8A 2VVVA 5EW2H 1DWBH 4UFFH 1NN6A 2WV4A 1O5BB 4IMQA 5E0HA 3SJKA 1O3HA 5TJXA 4INLA 4UONA 4A7IB 1BUIA 2NWNA 1FMGA 1NRNH 2ZGBH 1S0RA 1O2NA 1HJAC 1CBWB 1XUKA 4BTTB 2VB0A 1CA0C 2Y5FA 5F8TA 1DT2A 4NG9H 5EQQA 3TK6A 1AO5A 2VGCC 1NRSH 3A8AA 1LHEH 2WYGA 4Q7XA 5EODA 1A3EH 1AIXH 4Q7YA 2ZO3H 1FY5A 1W3CA 4RI0A 3WWBA 1B0EA 3MNBA 3E0PB 1BRBE 2Q1JA 2ZHWH 1YBWA 1ZJKA 4BTUB 1SBWA 1O2VA 2XOKD 3SUDA 2FTMA 1BBRK 1BMNH 2BOKA 3OEHD 1GJCB 4NGAH 1GMHG 3H5CB 5E8EH 1XUJA 3F9HA 4JMYA 1UVTH 4XRNA 1YWUA 2GZ8A 2QXHA 3BTEE 1Z8JB 2AFQB 4XBBA 1AMHA 2Y81A 1SQOA 5HKKD 1O3KA 3SU1A 4IN2A 2BQ7B 5LPEA 5A0BA 2BVRH 2BLWA 2Z94A 3NRLA 4THNH 1M9UA 3TH2H 5GCHG 1YGCH 3L3TA 1EAUA 1RTLA 4A6LA 2V6NA 1TRMA 1Y5UT 4YESB 4X6OA 4K3JA 1NBME 4Y8YA 2FYQA 2KZ4A 3P70B 5DKMA 3SHCH 2B7DH 1P2NA 1O3IA 5DO4H 1C5MD 1RS0A 1ZPCA 3DA9B 4KTUA 5C20A 1EOLA 2FIRH 1TALA 1S85A 2PKAA 1BMFD 1OHHD 3A89A 2ZQ2A 2XRCA 4FUGA 4AFUA 1HAPH 1A7SA 3AK5A 4LZ4B 1FY4A 1MTNB 2V3HH 3TNSA 1K21H 1OWEA 1OYQA 1XXFA 2UUYA 2ZDKA 3UR9A 2HOBA 4FUFA 3ZV9A 2YMSD 4ISHH 1VJAU 1EPTB 4FVBA 4OS7A 3EQ0H 4IW4E 2QN5T 1DWDH 4A1TA 2RG3A 1QRZA 2PLXA 3D62A 4K1SA 5EQSA 3TH3H 1T8OA 1AFQB 1QA0A 4D7GA 2M2AA 2PGBB 3EA7A 1H9LB 3ZVEA 1AY6H 2HNTF 3F0PA 1GHAF 4B73A 1YKTA 3LGVA 1QJ7B 3H7OA 3VB3A 1O2LA 6ESTA 1BMMH 1TPAE 1IQMA 2P3FH 3TNTA 5FX6A 3F9EA 1C5VA 3URCA 1SLUB 4X1RU 3RXJA 2OBOA 1ZTLA 1LDTT 1TAWA 4XE4A 4MPWA 1AKSB 2J38A 2KR7A 4ISOA 2ZFRH 3LOXA 4AG2A 3U9AH 4LK4A 1HXFH 1O2IA 2GT7A 1GGDC 2BDCA 5JBTA 1AVWA 1CT0E 4BAOB 2C8ZB 2G5VA 3FZDA 4CRFA 4H6SB 1YPMH 2BD2A 4U01A 4JYTA 1DWEH 2GT8A 4MG3A 4I32A 2V3OH 3B23B 1ZRKA 1ETTH 2BDIA 1RIWC 3PM3A 7LPRA 1WSSH 1UCYK 3ZVDA 2G81E 4GLYA 1ZSKA 2FODA 1Y5BT 1A1RA 5KGOA 1KLIH 2WV9A 5G4BA 1TQ7B 1RD3B 3N7DA 3ZVFA 4B75A 2OC8A 4INKA 5K7RA 4X8TH 4WXVA 3M36A 4Y11E 1C2IA 2V3MA 2BXTH 3RXIA 2CHAC 1HDTH 1UK2A 2B0FA 3N7OA 4NIWA 1C1VH 1CA0B 1P2MA 4OS2A 1J9CH 4MPUA 2VGCB 4U32A 2YNAA 5DP5A 2BYAX 3MMGA 4NA9H 5FX5A 1YY3A 3FFGA 4IGDA 2WINI 1VCQA 2F9VA 1Z71A 4ISIH 3A80A 2XNDD 6GCHG 1AHTH 2WPLS 3M5OA 1IHSH 3EE7A 3LJJA 4XSKU 3Q77A 3H7TA 1AUJA 2P8OC 1FN8A 3SJ8A 1SOTA 3V3MA 2AGIX 2ALVA 1K1PA 2QF3A 2ZFTA 2ANMH 1PPEE 1XKBC 4NWKA 1WU1A 1H9HE 5HM9A 2HGTH 3PWBA 1D6RA 3W94A 3P92A 2C8WB 4TWYA 2QYIA 1HAZB 4X0WU 3GS9A 3A7TA 4VGCC 1DE7H 4MNXA 1P01A 2DE9A 4LZ1H 5JBAS 2THFB 3P6ZB 1AWFH 1TGTA 1YCPM 3RXLA 4X6MA 2GDDA 2CXVA 1MD7A 1MKWH 1O2QA 4YOIA 5B6OA 1HAVA 2BDAA 2KCAA 1C1UH 1OWKA 4KTSA 3GY6A 1ESBA 7GCHG 3MO3A 3ZZDA 4GVUA 1NU9A 2WUCA 1GHBG 1KYNA 1OWHA 3U8TH 3UUZA 1C5RA 4ABIA 4E05H 1GG6C 2DUCA 2XBXA 2STAE 4ZXYH 3LH3A 2P16A 1V2LT 1TB6H 3M3SA 3ZZ8A 4D8NA 3VG8A 2XW9A 1RTFB 2CJIA 4ZXXH 3UPEA 2R3UA 1ZGVA 1S6LA 1NRRH 1L1NA 1VITF 2LPRA 4ZKOU 1YCPH 4LXBH 2FO9A 2JH0D 2ZCLP 2QC2A 1W0ZU 1OX1A 2VWMA 3DHKH 3K6ZA 2SFAA 1O2SA 1EZQA 1W2KH 3PMBB 2ZHFH 1AU8A 1MCVA 3QTOH 2H1UA 1GBMA 5FXLA 2CN0H 4OS4A 3OEED 5E2OA 2H9HA 2SNWA 4DVAU 3ATLA 4BAQB 1RJXB 1JRTA 3VB4A 1HAHH 3VXEH 2LNCA 3FZZA 1A61H 4Y79A 4NCYA 3CP7A 5GDSH 3A84A 1G2MA 4FU7A 1BTUA 1MZAA 5JB9S 1O2KA 5ETXA 1SSXA 2CF8H 2WUBA 1GGDB 3CNRA 1EX3A 2PSYA 4GUXA 3SORA 3A7XA 3M61U 1E1RD 1F7ZA 1UK3A 4F4OC 2XWBI 1NC6A 2ZIQH 4YZUA 1EJMA 4WJG2 1F2SE 3M7QA 1IQLA 2O8UA 1WTGH 2VWOA 2PGQB 2UWLA 1NFUA 3MYWA 2ZFPH 1RIWB 4FU8A 4ABJA 5DP9A 2HLDD 6CHAC 2VIQA 3AVZA 2A5AA 4JZIA 1HGTH 3BEFB 3F2GA 4OGXA 1CT4E 1ZYOA 3TIUA 1XUIA 1W8BH 1W11U 2PHBA 2TIOA 3QWCH 3SQEE 4Y7BA 2O8TA 1KLTA 2R0LA 2KCYA 4ASHA 3ZVCA 3PTBA 3NCLA 2QF0A 2CHAB 3STIA 1V2UT 3TU7H 1KXFA 1VZQH 2R2WU 5GJ4B 1P09A 2ZPQA 1Y3UA 2A45B 5ABWA 1WOFA 1AI8H 3SV8A 1UHBB 2TRMA 3O8DA 1XUHA 2SGDE 2OINA 5EW1H 4U2WA 1BTYA 2D8WA 2AIPA 1QB9A 1LPKB 3SGBE 3P95A 1P9SA 2VNTA 2XC0A 1G3DA 1V3XA 1EASA 1GBIA 1QTFA 1K9OE 2VWLA 4ESTE 1TQ0B 1E35B 2W5EA 1W13U 2BMGB 1FN6A 1EB2A 1V2KT 4CBNA 2IPQX 5A0AE 2BY8X 2XWAA 1DOJA 2OC7A 1GI3A 2Z3DA 2ZDMA 2YMSC 1O2TA 1NTPA 1QA7A 3SW2B 2VIWA 4RKJB 2EI8A 2QAAA 4YLQH 1OWJA 2B9LA 1WDIA 3ZZ7A 5EXNA 1RGQA 1FQ3A 3PTNA 2XCNA 3SJIA 4F49A 4PROA 2ZECA 4BXWA 2Z9JA 2IN2A 3Q00A 4GHTA 4VGCB 4MQAA 2A4OA 4AGKA 4B76A 4X1PU 1Y3WA 2FYRA 3BTTE 1TABE 2D1JA 1C2JA 2K1QA 2W3KA 1LMWB 2A4GA 5C5OA 3D23A 3MO9A 1GJBB 3TK5A 4E7RG 2FX6A 1OSSA 1SGIB 2BX3A 3SNDA 1MTVA 3KL6A 4XD7D 1FAKH 5K0HA 4DOQA 3DFLA 3RXPA 3RXCA 1EZSC 1GG6B 1VCPA 3EE0B 5A8ZA 3LGTA 1W0KD 3SNBA 3SNCA 1NS3A 3HKJB 1SGYE 4AYYB 2AHME 2STBE 3TJNA 1GI0A 2WSSD 1TBZH 1UJ1A 1V2MT 5HYOA 2V7QD 5F8ZA 1AZ8A 4WY3A 3SUEA 1GMDF 2BLVA 1CSOE 3A87A 1QGFA 1G9IE 3GDUA 4AB9A 4F55A 3STJA 3MU8A 4K8BA 2V0BA 5I25A 1F5RA 1O2RA 1TMUH 3EGKH 2KCOA 4RN6A 1ARBA 3RXSA 2RA3A 1LPGB 1SQAA 1AB9B 3FO8D 1E1QD 3PV2A 2UUFB 1DLKB 1BJVA 4AB8A 2SGPE 1DITH 4I8JA 1ESTA 3ZYEA 1CHOF 2ZHQH 4Z6AH 5AHGH 3UB0A 1GDUA 4NSYA 3RU4D 2Y5HA 4A92A 2J94A 1UTJA 1TGNA 3M5LA 3ZZ3A 1C2KA 3KYFA 1DXWA 2GVFA 5L2ZH 2JJ2D 2AS9A 3M5NA 3ZZ9A 4QT8C 2FOMB 1VCWA 3R3GB 3URDA 1UTQA 2A31A 1NFYA 1MAXA 3SNEA 1BZXE 2TPIZ 1P04A 3OAAD 4JK5A 2VH0A 1Q2WA 3LGYA 1F0RA 1ZPBA 3SQHE 2H9EH 1UTNA 2FI4E 1UVPA 5DP8A 5JDUB 1F0TA 3E8LA 1YPKH 1AD8H 2GTBA 3FOAA 3BG8A 4BOHA 3T29A 3PB1E 8GCHG 1TRYA 2ZG0H 3A8CA 3UAIC 2EEKA 1BRCE 4CREA 4I31A 5JBCS 5A2MH 3LKWA 4JZFH 1FY8E 1C1PA 2PTNA 4NFFA 2GCTC 1P2QA 3BV9B 4FUEA 1OWIA 3T27A 1C2LA 1GMCF 4Q2KA 2P59A 4ASUD 2Q6DA 1K1OA 4X6PA 2Z9IA 1CHGA 4KTCA 2OP9A 2A7JA 2OC1A 2GX4A 1HIAA 3TITA 4GAWA 2LELA 2FDAA 1LKAA 4X1NU 5I46H 2V35A 1DLEA 1P2KA 1BBRE 3AW1A 4JZEH 1QB6A 4B2BA 4JYUH 1QJ6B 5LH8A 3OY6U 1CT2E 1NPMA 3RM0H 1CA8B 4X2XA 4BAMB 3MH6A 1O30A 3GCTG 1W0YH 1C5YB 1QCPA 1C1OA 5DP6A 4CR5A 4K8YA 5EGMA 1GHYH 1GCDA 1EAIA 3A81A 1KTTB 1ABJH 3SGQE 3RXEA 1Z8RA 2YMSB 3ZVAA 2ZP0H 3KQBA 2BY7X 1BTXA 5AVDA 4B6EA 1Y8TA 4K69A 3DUXH 3DSPA 3EA9A 1XX9A 3K2UA 5EJZA 4NSVA 1ELDE 1G2LA 4UFDH 3SJOA 3SU5A 3S9AA 3VPKA 2ZGHA 1S5SA 2TGTA 3PO1B 3P8OA 1MQ5A 1DY9A 2EC9H 5FBEA 3S7KB 3O8RA 1CGHA 2BDBA 2RCEA 3ZYDA 1FXYA 4M7GA 1VGCC 3E3TA 2XC5A 2Z6BD 5T3HA 3FANA 3TJUA 1A0HB 1ZSLA 2J98B 3VGCB 1X7AC 1XXDA 4HGCA 1SLXB 4ZROA 3UOUA 1HV7A 3AAUA 2BDHA 2A7CA 1C1SA 4FUDA 1C1MA 1V6DA 2QCYA 1WYKA 1PPBH 1O2YA 2NU2E 2VINA 3Q3KA 5GIBA 3TVJB 3PRBA 2I6SA 1CU1A 5DSFA 1ACBE 1MH0A 1O5DH 2QV1A 1WBGB 3GY7A 3SUFA 1XKAC 2VBCA 1DM4B 1FIWA 5C1UA 2R9PA 3FKSD 1S84A 3SU0A 1LQEA 3CS0A 1OP0A 4X2WA 5HMAA 1PQ5A 1GBFA 3KQ5A 4FVDA 3BTME 1O5FH 2F9OA 2LP6A 2PTCE 3ENSB 3VB7A 1EB1H 1GL1A 4NIYA 1W7XH 1QJ1B 4JCNA 1AN1E 1QR3E 3RUOA 1TE0A 1GWAA 5EU8A 4DG4A 3NZIA 3SGAE 1JRSA 1T31A 2HVXA 1K2I1 1YYY1 2Z9KA 2Y6TA 2FOBA 4ZKNU 3LC5A 1ORFA 1EAWA 2C8XB 4I8GA 5ESBA 1PJPA 4FUCA 1VR1H 1FV9A 1BMAA 5T1VA 2ZU5A 4CH2B 2FLRH 1S82A 5DJ7A 1K1JA 1EATA 1BCUH 1C1TA 1A0LA 1EJAA 3F9GA 2GZ7A 1SGCA 2BB4A 4YO9A 4UD9H 1UTOA 1ELAA 1NRQH 1EXFA 1UMAH 1O39A 4FUHA 4ZUHA 1H8HD 3SV9A 1YPHC 1GVKB 1YLNA 2PUQH 1OS8A 3BTKE 3RXGA 4YLUA 3GCHC 1EP5A 1LTOA 1TPOA 5GWZA 2WPHS 3SU2A 1GBLA 1C4U2 1ELEE 2R2MB 2Y82A 3HGNA 2O8LA 1P11E 2H9TH 1TBRH 2ZC9H 1OKXA 1P57B 1Q31A 2A2QH 1UCYE 2QXGA 2FZZA 2WPKS 5IYTA 1XUGA 3ZVGA 1SR5C 4AORA 1HBTH 2C3SA 4DW2U 4ABDA 1B5GH 1GL0E 2QF4A 3WWFA 5LPFA 1UHBA 1BB0B 4O97A 2AEIH 2ANWA 3M3TA 2KAIB 2JIZD 1O0DH 1O34A 3QGJA 1GPZA 2NU1E 1ANEA 1H8IH 2BLQA 3FN8A 1O32A 1Y59T 3QTVH 3UWJH 3A88A 4UFEH 2GCTB 1O37A 1HB0B 2JH5D 1C5SA 3OTPA 1BTZA 1QURH 2C4FH 1KXDA 2CK3D 1GHXH 5T6FA 2TGAA 2BLOA 2O8WA 1QB1A 1WQVH 1GI8B 3UTUH 2RDLA 1P06A 5GPIB 1GMHF 2ESTE 4NWLA 3LONA 2FOCA 1ZOMA 3NWUA 3RC6A 1TX8A 1F5KU 1GBEA 1YC0A 4BAKB 4TSFD 3SU3A 4WH8A 1J14A 4TYDA 3MNCA 1ZHPA 1ANBA 1V2JT 1GJ7B 4JZDH 1ESAA 4YXWD 2G51A 2ZI2H 2XBWA 1G32B 5GCHF 3BTWE 4R0IA 2FEQH 1H8DH 1Z6JH 2I6QA 1L2EA 2AERH 1KDQB 3V13A 2HVYB 3BSQA 4E7NA 1WV7H 1C2HA 4HTCH 2QIQA 2FI5E 1QBOA 1ID5H 2F9PA 1MTSA 5AFYH 1MD8A 2QA9E 3TK9A 1FDPA 1QHRB 1HPGA 5IDKA 4FU9A 1H8ED 2G52A 2FOAA 2VIDA 2ZGJA 1ELGA 3WY8A 2XYAA 1DICA 3P8NA 5A09A 1VGCB 3G01A 1T4UH 2J95A 1D3TB 1MKWK 2D26C 3BTDE 3QO6A 5DP7A 3RXAA 2XNIA 5F03A 1SMFE 1ZTJA 1TBQH 2FESH 2ZDNA 3IITA 2F83A 1G3CA 4WWYA 1COWD 1HUTH 2ZGCA 3GY8A 1NZQH 5EPNA 3N7EA 1F5LA 2D2DA 5GNDA 1XMNB 3MI4A 1ELTA 3U28C 2P95A 1GJ9B 1V2QT 4D7FA 1NY22 1HCGA 2QXIA 2ZWLH 2AMQA 1PPZA 3P17H 1MKXK 2OC0A 4OS6A 2OBQA 1JIRA 4SGBE 1SG8B 3SOSA 4DJZB 1YCPK 3ATMA 1K1LA 1BTWA 5J4SA 2PKSB 1IQHA 3H09A 3MO6A 1N8OC 3RXDA 3A8DA 1P9UA 3BN9A 1YM0A 4IMZA 1V2PT 2R3YA 3UIRA 1A0JA 1P2OA 3SU4A 1MKXH 4A1XA 1T8LA 1Z1IA 1O33A 4ZCNA 2A5KA 4WVPE 4CRBA 3GCNA 1XUFA 3ZZCA 3A7YA 1HXEH 1F0SA 4XDEA 2P3UB 5LPRA 2ZHEH 3F3BA 5PTPA 2EY4C 4ZHLU 1FI8A 4SGAE 4O3UA 4KGAA 2QE7D 2VIOA 3SV7A 3DD2H 1O31A 1IQIA 1GI1A 3QZQA 3R0FA 3V12A 1DUEA 3VB5A 4ZMAH 2G8TA 2BOHB 1AB9C 4MNYA 4YTAA 4WMDA 1YPGH 3E90B 5T6DA 2AIQA 1LVMA 2HALA 4DIHH 2L6OA 3GCHB 2KX4A 3PV4A 1P8VC 3PV5A 3MQKC 1N1LA 3P8FA 3ESTA 2FM2A 4JK6A 1IQNA 4H6TA 3GY4A 3RLYH 4MVNA 3VFEA 3GOVB 3W95A 1DY8A 1TOMH 2WPIS 1PPCE 3D65E 2GZ9A 5SGAE 2PKAB 1BMLA 2WYJA 2JETC 5EQRA 1D9IA 3M7TA 1CGIE 3JZ1B 2ZCHP 3A86A 1TFXA 2G5NA 2OCVB 3HK3B 4X2VA 3ATWA 1EAXA 1NBMD 1T32A 2OQUA 2ZNKH 2BVXH 1SHHB 2EI7A 4XFQA 3KF2A 6GCHF 4K60A 4Q7ZA 1ELVA 1GJDB 3MTYA 1MU8B 4X1SU 1K1IA 1JIMA 1O2GH 4DT4A 1VJ9U 3PLKA 4Y71A 3UWIA 1ZRBA 2AMDA 2ZU2A 3RU4T 4GCHG 2ZU3A 2GCHG 1P12E 3UOPA 4F48B 2ZHDA 4BTIB 3E1XB 1KMHB 3K6YA 5KECA 2ODPA 3MH5A 4X6NA 1ZTKA 3S7HB 2R0KA
chains in the Genus database with same CATH topology
1UO6A 1LQDB 3I77A 4I8LA 3EDXB 4DCDA 1P03A 2IJOB 4YOJA 1U6QA 1HAXB 1NFWA 4TY7A 3S9BA 3ATIA 3RXRA 1V2TT 1HAGE 4OS5A 2GP9B 3MOCA 4K2YA 4Y6DA 5E0GA 2FTLE 1DSUA 1P10A 3KGPA 1EOJA 1BITA 1O3JA 1SGFA 2OLGA 1KLJH 3PMHB 5C2ZA 2AH4X 3UR6A 3DT0H 1A2CH 3BF6H 7GCHF 4NA7A 3RC4A 1AUTC 1O2PA 1ZHMA 1GHBF 3B8JA 1GDNA 1ABIH 4DURA 3MU1A 1O2UA 5CHAB 1FZZA 3A7VA 1GBCA 2G00A 1C5NH 3PLPA 1T8MA 2DE8A 1HRTH 3BTFE 2ILNA 5L2YH 3PO1C 2FOHA 1F0UA 3ELAH 3MU5A 1MTWA 4Z0KA 4YM9A 3EA8A 1JXPA 1YLDA 1W12U 3ZVBA 1O3OA 1MUEB 3V0XA 2FX4A 1NROH 3MU4A 1A4WH 1FIZA 4B71A 1O3BA 3ZZAA 5C1YA 1GJ8B 3VGCC 1WUNH 3CENA 3A7WA 1EPTA 1C5QA 4NA8A 1DSTA 4YOGA 4Y10E 1YP9A 2NU3E 1LO6A 2SGEE 3QDZB 3U98H 5FHTA 5E0JA 2XXLA 1N8OB 1Z8GA 3QX5H 6LPRA 3MU0A 1GJ4H 3UNQA 1UK4A 3P8GA 2UWPA 1MBMA 1FPHH 1HAOH 1QBNA 2XC4A 2EI6A 3GDVA 3RXMA 3SBKA 1C5XB 3TJOA 3PYHA 1O5EH 3KQCA 2OUAA 2GV7A 8KME2 4K1TA 2YNBA 4ABFA 1TGCA 1AKSA 2BZAA 2GMTC 2Y7ZA 1PQ8A 2FLBH 1IOEA 2ZU4A 4RSPA 1H1BA 1LHFH 1LVBA 3L33A 3VB6A 1OP2A 4AGJA 2XCFA 3QK1A 5EXMA 4LOYH 2CV3A 1P0SH 2CGAA 1NRPH 5DP4A 3L6PA 3LH1A 5C5NA 2VIPA 2FOGA 2HRVA 4CBOA 2HNTC 5JYIA 1J17T 1A5IA 2F9BH 4RKOB 1QY6A 1V2WT 3U1IB 4K5ZA 1NU7B 2NU4E 5H4IB 2FS8A 2VVUA 1DVAH 1HAVB 1RFNA 3ODFA 1DDJA 4BANB 5ESTE 3OY5U 1IQGA 1ZMNA 1GBBA 2A0QB 1V2OT 4Y8XA 1Z1JA 2BQ6B 2JKHA 2PSXA 4B2AA 2JETB 1SVPA 1QQUA 1S6HA 1BA8B 2GGVB 1O2HA 4IN1A 1K22H 4XBCA 1UVOA 1HJ9A 1MTUA 1O5CB 1TNGA 1V2VT 2ASUB 1E34B 3D49H 2XBVA 4Y0ZE 3AW0A 5GXPA 3LT3A 5CMXH 5J4QA 1O3AA 3K65B 2BD7A 3RMLH 1JOUB 1SPJA 1TMTH 3C1KA 2W26A 3FVFB 1AWHB 2RA0A 4BXSA 3S69A 1RTKA 8LPRA 3NUMA 1ZZZA 1G36A 3HGPA 7ESTE 1UTKA 2ALPA 5L6NH 1FPCH 2ZCKP 3UREA 3ZZ4A 2C90B 1XVOA 1YPJH 4J1YA 1YPLH 2G4TA 3SNAA 1AE5A 4CRCA 1C1WH 1TX7A 1DS2E 3U69H 1GI4A 5JB8S 1GHAG 4WMEA 4I33A 4NZQA 3TGJE 3BTHE 4CHAB 2FOFA 4X8VH 3Q76A 2ZFFH 4ABEA 3O8BA 1O2WA 2F91A 3SZNA 1ZGIA 4ISNA 4FUJA 1P2IA 2A4RA 1ZLRA 3K9XB 4UEHH 3Q3YA 1A5GH 3GYLB 4GHQA 4B1TA 3RMOH 2BD9A 4O03A 5FAHA 1S6FA 1THSH 4OS1A 2FPZA 3OTJE 2BY5X 3O8CA 2UUJB 1TGBA 1TMBH 3OU0A 2A2XH 3QZRA 4D9RA 1HAYB 1HAIH 2BXUH 2P93A 2BD8A 4NFEA 1ZHRA 1C2MA 5FPSA 1LHCH 3MHWU 2VIVA 1ANDA 2ZPRA 5EOKA 2G4UA 4YT6H 3UNSA 2W3IA 2BD3A 1FONA 1GJAB 1TNJA 3A83A 4HFPB 3TH4H 1GI6A 3V7TA 4XOJA 4O9VA 1YLCA 2FP7B 4MPXA 2ZKSA 1PPHE 1AE8H 1C1NA 1EZXC 2VU8E 4Y76A 3LDXH 1GI5A 1DXPA 1SC8U 2VVCA 1NM6A 1BBRH 1QRXA 3HK6B 1A3BH 1TPPA 1IQJA 1CGJE 2PKSC 1IQKA 2TBSA 2BM2A 4YT7H 3QGNB 4J2YB 3RMMH 4XBDA 3FAOA 2ODYB 4BAHB 1QFKH 2FI3E 1MZDA 2HPQH 2Z9LA 4WH6A 1L1JA 3TGIE 1TLDA 2GMTB 1P02A 4ABAA 1GHZA 2GV6A 4TPIZ 1SGDE 2Z3EA 1UTLM 3FP8E 3KCGH 2TGPZ 1NT1A 1PFXC 3F68H 3F9FA 3KHVA 1XVMA 7KMEH 1ZJDA 2A1DB 1GCTB 1L0ZA 2M5TA 1D3DB 3M5MA 8GCHF 4ABHA 1GBAA 3M37A 5EPYA 4Y0YE 4IBLH 2AGGX 4MDSA 3U1JB 4IS5A 4O3TA 3SV6A 3KQEA 1WCZA 1DX5M 1HNEE 2ZQ1A 1GJ5H 1A5HA 1BT7A 1A46H 1BRAA 1H9IE 1YPHE 2W7SA 4CH8B 1BOQA 1KXBA 2G55A 1EP6A 4ZAEA 8ESTE 4B2CA 1O3NA 1C5OH 2H2ZA 1KTSB 2ZTYA 3MFJA 2ZFSA 4ZH8A 1T4VH 1Y3VA 4A5TS 4AFSA 3HATH 1KXAA 2W7UA 3EYDA 3GCTF 1FLEE 3SHAH 2HLCA 2F9UA 2IOTA 1IHTH 4X8SH 1KSNA 1QQ4A 1E37B 1Y3YA 2BDGA 3ZZBA 2ZA5A 4NIVA 1TA2A 3RXKA 2Q6FA 1D3QB 1NO9H 1G30B 1EJNA 1EQ9A 2FMJA 1N6XA 1TOCB 1VITH 1C2DA 1VITG 3E91A 2PR3A 2WPJS 1O38A 3MNXA 3TGKE 1AFEH 5T6GA 1DANH 1O2JA 1S83A 1MQ6A 3QN7A 1DWCH 4ZHAA 3TJVA 4I8KA 1G37A 1ANCA 3BEIB 1DFPA 3M35A 1PPFE 2ZDVH 4UE7H 3ZV8A 4KP0A 1Z7KA 4Y8ZA 1QL9A 2PW8H 1P2JA 1TNHA 1BQYA 4E06H 3SI3H 1EKBB 4AZ2B 9ESTA 3F1SB 1FAXA 1L4DA 5EXLA 1QL7A 3KIDU 1G3EA 1MMJN 2BD5A 1YPEH 1ARCA 1C5ZB 1FUJA 4H4FA 3UQVA 1TWXB 1O5GH 3TLOA 4Y7AA 3ITIA 1HJAB 4MNVA 3LIWA 3LU9B 4Q80A 1DPOA 1C5WB 1CE5A 2GKVE 1GVZA 2VJ1A 4BNRA 1UCYH 1TNIA 4ABBA 2CF9H 2Q6GA 3LGWA 1AVXA 2HPPH 3U8OH 4I8HA 4WMFA 1HYLA 1O36A 2BQWB 1C9PA 1F92A 1KXCA 2ZFQH 1E38B 1GBJA 2ZEBA 2ZGXH 1ELBA 1ZR0A 2C93B 3CS7A 4MNWA 1OOKB 1SGRE 4I7YH 3RXQA 3RM2H 5CHAC 1Y5AT 3GDSA 3ZZ5A 4NIXA 3RXFA 1BJUA 2VH6A 2ULLA 1O3LA 1EZUC 1HIAB 1PYTD 4TY6A 1CO7E 5BPEA 2ANYA 1LHGH 1OPHB 1XM1A 3T28A 5BRRE 3M7UA 2AMPA 1EUFA 2J2UA 3RU4E 2F3CE 1C4V2 1MAYA 3NXPA 1O2ZA 1NESE 1O3DA 1P3CA 1TA6A 2Y80A 1MU6B 9LPRA 4JYVH 2H5CA 3T5FH 3RP2A 3KQDA 3LJOA 2ANKH 2BY6X 1IQEA 5HXFA 3T2NA 3A8BA 1E0FD 5FPYA 3MNSA 3IWMA 3GY5A 1KY9A 1S81A 2OQ5A 2EA3A 3RXBA 2JH6D 1BRUP 1GI7B 1SGQE 4MTBA 3NPSA 3UY9A 3S0NA 4WXIA 1TNKA 1ZMJA 1LVOA 5DGJA 2XTTB 3S9CA 3LGUA 1BTHH 2C8YB 1C2GA 5L30H 1AGJA 2BVSH 1L1GA 3ODDA 4CR9A 5TCAA 1JBUH 1SFIA 4CRAA 3SO3A 5HGGA 4DY7B 1O2MA 1FJSA 4UFGH 1SL3A 3RXTA 1L4ZA 3RC5A 1GVLA 1O3CA 3GY3A 2J34A 4HZHA 2FOEA 5JPMH 1T8NA 1Z8IB 4A1VA 1ZMLA 1SGEE 1ETRH 2A5IA 1O3GA 2ZDAH 1OYTH 1K1NA 3OX7U 3OYPA 2J4IA 3SUGA 1W10U 2CMYA 5DG6A 1D3PB 1G3BA 1GJ6A 4K1EA 2ZPSA 3B9FH 3RXUA 3I29A 3OSYA 3GYMA 1MBQA 2J92A 3PROA 2BZ6H 1AVGH 3BIVH 1TYNA 4CRDA 1RRKA 1MCTA 1SQTA 2BY9X 2GD4B 5FCKA 1D6WA 1V2NT 1O2OA 4KELA 1GDQA 4FUIA 4CRGA 1AZZA 1TIOA 3U8RH 1PQ7A 1GI9B 2XBYA 4NZLA 1J15A 1ELCA 4D9QA 1SHYA 1CVWH 1QL8A 1TRNA 3E6PH 1GMDG 4D76A 2B8OH 1K1MA 3A82A 5TCCA 1QBVH 2IPHA 1S0QA 2BDYA 4U30A 3I78A 2B5TB 3Q3XA 1GBTA 4X1QU 5LGOA 3KEEA 2OTVA 2OD3B 2Z7FE 2HWLB 1B7XB 5CE1A 1GI2A 2SNVA 3E16B 1GHVH 2P3TB 5F6MA 2WV5A 2NU0E 4AG1A 1AQ7A 5A8YA 1CHOG 3AAVA 1C2FA 1SGNE 4R8TB 1SGPE 1N6YA 1OXGA 1FNIA 1C1QA 3BEUA 3DFJA 3BG4C 4AOQA 3ATKA 4DIIH 1SOZA 1D4PB 2Z9GA 2FWWA 3E0NB 2A7HA 3MH4A 2ZTXA 2BTCE 1C4Y2 3GICB 5FCRA 1BHXB 4ZKRU 2OXSA 1GBKA 1UTPA 3AASA 3BTGE 4CHAC 1HLTH 3KN2A 1HJ8A 1KXEA 5A8XA 1Z6EA 2A4QA 1B0FA 1C1RA 2O8MA 1TNLA 1SFQB 1FY3A 2SGQE 3QLPH 3NKKA 2BX4A 1O5AB 3QUMP 4MLFB 2VWNA 1LVYA 1CBWC 3ZZ6A 2ODQA 1C2EA 1C5PA 1O35A 4FUBA 5HM2A 1BHXF 1UVUH 5DP3A 4X2YA 2J9NA 2P8OB 1YF4A 5C67A 1UVSH 1P05A 4FXGH 5JBBS 3RXHA 1WTHD 1ZSJA 1C9TA 2UUKB 3HPTB 1O3EA 1SI5H 2PUXB 2Y7XA 3PMJA 1SLVB 1GMCG 1V2ST 1TPSA 3FP7E 5FBIA 1QRWA 3BTQE 1PQAA 4OGYA 3PLBA 4DGJA 2ZF0H 5AF9H 3RMNH 1C5UA 1LPZB 1P3EA 4KKDA 1H4WA 3UQOA 3VEQB 2AYWA 2Z3CA 1GBDA 1LCYA 1W14U 2F9NA 2QGRA 1GHWH 1O3FA 4H42U 3GCOA 4X8UH 2SGAA 4ZHMU 3UNRA 1PPGE 1V2RT 4UDWH 1NFXA 2P94A 1BDAA 3MWIU 1UTMA 3T25A 2WPMS 3GISB 4GSOA 1WAYB 5E2PA 1DUAA 2AGEX 3TPIZ 2PFEA 2PWXA 4IC6A 1SLWB 1TX6A 2BD4A 3F6UH 4MPVA 1J8AA 1OP8A 2QXJA 3HKIB 3EAJA 3T26A 1O2XA 1THPB 3SI4H 4IC5A 1JWTA 1BTPA 3LGIA 5A0CA 3SU6A 2ZU1A 1TONA 4GPGA 3A85A 1GBHA 4INHA 1ETSH 1Y3XA 5FPTA 2ZZUH 4B74A 1ELFA 4AX9H 1LKBA 5C3NA 4JZ1A 2TGDA 1GCTC 2KAIA 4ISLA 5AFZH 1SGTA 2PV9B 3PMAB 1Q3XA 2H6MA 2FXRA 2FS9A 2QY0B 3LC3A 2H5DA 1O3PB 2ZDLA 1MTNC 4GCHF 3GY2A 3KNXA 4TPYA 1BIOA 2GCHF 3PWCA 2O9QA 3RDZA 1RXPA 1EPTC 4HI3A 1SB1H 2HNTE 3NK8A 1LHDH 2A32A 1O3MA 1W7GH 1C5TA 3JZ2B 1ZPZA 2YOLA 5DK1A 1AFQC 3FP6E 3UFAA 3C27B 2SGFE 4AFZA 3RLWH 4AFQA 1C5LH 1QNJA 3LPRA 4DT7B 4AYVB 1SGFG 1WQSA 5DPAA 1KIGH 3M3VA 1FY1A 3RXVA 3SJ9A 1INCA 1THRH 2GDEH 1PYTC 1KDQA 1T7CA 3T62A 2BHGA 4ABGA 1K28D 1TGSZ 4AN7A 2UWOA 6CHAB 4ZKSU 1OWDA 1IQFA 1J16A 3RXOA 1IAUA 3BIUH 1E36B 5C1XA 3IG6B 1JMOH 2Y5GA 3BG4B 1HFDA 1CQQA 3VXFH 3SV2H 4TWWA 4WF8A 1QIXB 5F8XA 3A7ZA 2ZTZA 3MH7A 5EG4A 3SN8A 2VVVA 5EW2H 1DWBH 4UFFH 1NN6A 2WV4A 1O5BB 4IMQA 5E0HA 3SJKA 1O3HA 5TJXA 4INLA 4UONA 4A7IB 1BUIA 2NWNA 1FMGA 1NRNH 2ZGBH 1S0RA 1O2NA 1HJAC 1CBWB 1XUKA 4BTTB 2VB0A 1CA0C 2Y5FA 5F8TA 1DT2A 4NG9H 5EQQA 3TK6A 1AO5A 2VGCC 1NRSH 3A8AA 1LHEH 2WYGA 4Q7XA 5EODA 1A3EH 1AIXH 4Q7YA 2ZO3H 1FY5A 1W3CA 1B0EA 3MNBA 3E0PB 1BRBE 2Q1JA 2ZHWH 1YBWA 1ZJKA 4BTUB 1SBWA 1O2VA 3SUDA 2FTMA 1BBRK 1BMNH 2BOKA 1GJCB 4NGAH 1GMHG 3H5CB 5E8EH 1XUJA 3F9HA 4JMYA 1UVTH 2GZ8A 2QXHA 3BTEE 1Z8JB 2AFQB 4XBBA 1AMHA 2Y81A 1SQOA 1O3KA 3SU1A 4IN2A 2BQ7B 5LPEA 5A0BA 2BVRH 2BLWA 2Z94A 4THNH 1M9UA 3TH2H 5GCHG 1YGCH 3L3TA 1EAUA 1RTLA 4A6LA 2V6NA 1TRMA 1Y5UT 4YESB 4X6OA 4K3JA 4Y8YA 2FYQA 3P70B 5DKMA 3SHCH 2B7DH 1P2NA 1O3IA 5DO4H 1C5MD 1RS0A 1ZPCA 3DA9B 4KTUA 5C20A 1EOLA 2FIRH 1TALA 1S85A 2PKAA 3A89A 2ZQ2A 2XRCA 4FUGA 4AFUA 1HAPH 1A7SA 4LZ4B 1FY4A 1MTNB 2V3HH 3TNSA 1K21H 1OWEA 1OYQA 1XXFA 2UUYA 2ZDKA 3UR9A 2HOBA 4FUFA 3ZV9A 4ISHH 1VJAU 1EPTB 4FVBA 4OS7A 3EQ0H 4IW4E