2FYQA

Crystal structure of the norwalk virus protease
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
181
structure length
170
Chain Sequence
APPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Chymotrypsin-like cysteine proteinase
publication title X-ray crystallographic structure of the Norwalk virus protease at 1.5-A resolution.
pubmed doi rcsb
source organism Norwalk virus
total genus 39
structure length 170
sequence length 181
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fyqA01
1CBWC 2D8WA 6GCHG 2GCTB 3VGCB 1S0RA 4AFUA 1MTSA 1RIWC 2FYRA 2HWLB 1NU9A 1AUJA 1CA0C 4D7GA 3LKWA 3UFAA 3L3TA 1HAVA 1C5ZB 1GJ5H 4ZKRU 4O03A 3MHWU 4JZIA 1HXFH 2GZ8A 2YNAA 5PTPA 3O8CA 2BD4A 1O2OA 1A4WH 2OBQA 4Y10E 5DP4A 1K1LA 1YPKH 4U30A 1GJAB 3MMGA 4NWLA 3FVFB 2R3UA 1EP5A 2ASUB 3SW2B 1NTPA 1JRTA 1TNGA 3M37A 1NRSH 3MNSA 2B5TB 1C1UH 1GI5A 3PYHA 2FI3E 2WYJA 2UUJB 1C5SA 2D1JA 1G3CA 1O31A 1W0YH 1IQGA 1RTKA 2JH5D 5JB9S 4R8TB 2ZTYA 3MOCA 4FU7A 1FY8E 2ZDAH 4MNVA 1FONA 1Z8GA 2AGGX 2ZHQH 2A5KA 2OBOA 2C4FH 4FUGA 1OS8A 4X8TH 1GJ4H 1KTSB 2OINA 2WV4A 3LGVA 1S84A 3GCOA 1EZQA 1YGCH 2IPHA 3I78A 1YLCA 3RU4E 4DY7B 3Q3XA 5L2ZH 1P57B 2ZGJA 3A82A 1O3DA 1Z1JA 3DHKH 4K1EA 6CHAC 3RM0H 3SU3A 1K28D 5F03A 2RA3A 1TPOA 1C1PA 2PKSC 3A8AA 5HYOA 1O3EA 1KSNA 1CVWH 1EASA 2QAAA 4JZEH 2Z9GA 3TK5A 1L1NA 1V2LT 2GGVB 1EAUA 1YM0A 3EGKH 3V0XA 3G01A 2XBXA 3K2UA 2ZQ1A 3GCNA 3QLPH 1OWHA 2ULLA 2R3YA 2QXIA 3GY6A 1M9UA 1P2OA 4A1VA 1O2YA 3A85A 1LPGB 1GMCF 2FEQH 3FANA 1O3KA 2UWLA 2VVCA 1PFXC 4WMFA 4X6MA 1DSTA 1IQJA 1A61H 1SFIA 1ZMLA 1G9IE 4AFZA 3UTUH 3A86A 1T8MA 4ABIA 3RXFA 1UCYK 3ZZDA 1O3AA 3TGIE 1A3BH 1O3CA 1NPMA 1GI7B 3ATIA 2F91A 1AN1E 3GY2A 1XXFA 2HNTC 1OWEA 2Z9JA 1H4WA 1FIWA 1FY3A 5ETXA 1QA7A 3TJVA 2ZU1A 3E90B 4LXBH 4D7FA 4MPVA 1DLEA 4YT7H 3F9HA 4WF8A 1ZOMA 3W95A 1LHEH 4THNH 1UTPA 2AMDA 5SGAE 3PMBB 1F0SA 2HALA 1ANEA 3RXDA 2STAE 3BF6H 2ZDLA 3V3MA 3A7VA 3RXAA 3PB1E 3UIRA 1N6YA 5DO4H 1O3FA 4AGJA 4ASHA 1E35B 2P8OB 1RRKA 4UDWH 4AORA 2AMPA 2ZECA 2BDBA 4FUHA 2PSYA 4AB9A 4DGJA 1OPHB 1C1WH 1DPOA 4O3TA 2GZ9A 1FY5A 1MKXK 3ZVBA 2BD9A 1VGCB 3SV6A 2C90B 2WPIS 4JK6A 1LQEA 2ZCLP 1BDAA 2W7UA 4Y0YE 2Z9LA 3EAJA 1V2TT 4OS6A 3MU1A 2XC4A 3SUFA 1QBVH 1SGIB 1GJ7B 4WJG2 4KP0A 1ELDE 3SV9A 5T6GA 1YC0A 2BY6X 3QK1A 1VCQA 5C3NA 1GMHG 1TRNA 2HGTH 2ZFRH 1BHXB 2FZZA 2B8OH 4NIWA 1AFQB 4NFFA 2BDHA 2BB4A 2BY7X 1CO7E 1MTNB 5C1YA 1TOMH 3LONA 1G3BA 1EJNA 2H9EH 1T7CA 2G4UA 2M5TA 2F3CE 3U9AH 2XWBI 1P2IA 1KLIH 1SGQE 2QXGA 3V7TA 1DM4B 1D6RA 4OS5A 1W11U 3QZQA 1TA2A 2NU0E 2ZPSA 1UTNA 1ZSKA 1WOFA 1GDQA 4AFQA 1CE5A 2R2MB 3AW0A 4HGCA 4JYVH 2VIQA 1ZSJA 1HJAB 4BOHA 1FQ3A 1GJ6A 2H5DA 2VH6A 4Y71A 5FHTA 4YLQH 2A5IA 2BQWB 1ELBA 1EX3A 1YPLH 3CS0A 2ZU4A 1J14A 1KYNA 3ESTA 1O2ZA 5GCHG 1IQIA 1F5RA 3FP8E 4J1YA 1Y3YA 3E16B 3KL6A 2BDIA 1D6WA 2KAIA 1CU1A 1EP6A 1UCYE 1GI2A 1SGDE 2JH6D 2GMTB 1ELAA 3GY8A 7GCHG 3MNBA 1TABE 2HNTE 3NUMA 4O97A 1LKAA 1FPHH 5B6OA 1C4U2 3SQEE 1GBMA 1P11E 1GJBB 3A7TA 4WMDA 2PTNA 3T28A 3LH3A 4F4OC 4F49A 1WBGB 3FFGA 1GJ9B 2XXLA 1MUEB 2Y6TA 3PWCA 2PKAA 2O8LA 3T26A 2A45B 1LHGH 4Q2KA 3DD2H 3LT3A 4UE7H 4ISOA 5JDUB 1P02A 1SQTA 1P05A 3LGUA 4FXGH 3ELAH 2Z94A 1GBAA 4YOIA 1QGFA 1O33A 5FPYA 3NWUA 3PROA 1EOJA 1CBWB 1OKXA 4X6PA 1AQ7A 1ZPCA 3GDVA 1RIWB 1CA0B 1JMOH 4X1PU 3URCA 1DSUA 3GISB 3S0NA 1YYY1 1QL8A 1QRZA 2P59A 1QB1A 4E7RG 4B73A 3P6ZB 1TRMA 2G8TA 4ZKSU 3VB6A 1O5AB 3A84A 3ODDA 2BYAX 3HK6B 1W2KH 1O5DH 2H6MA 3P8FA 4MVNA 2QY0B 1Q2WA 4YZUA 3TJOA 1C2DA 1HLTH 3ATLA 2VH0A 1P8VC 2ZDVH 3TJUA 1GJ8B 1BA8B 5E0HA 2BVRH 1S6HA 4KTUA 3KEEA 4X8VH 1ANBA 4TPYA 1UVPA 3BTEE 3U1JB 1YKTA 1O3GA 5C2ZA 2ZFTA 1DUAA 1BQYA 3E6PH 3S69A 4ESTE 5A0AE 1V2KT 2VVUA 3UPEA 4GVUA 4BNRA 1BT7A 5FPTA 1C1QA 1O2VA 5E2OA 5DKMA 1K21H 3TPIZ 6CHAB 1F0UA 3SHCH 3OY5U 2Z9KA 2CHAC 1HCGA 4FUJA 1C1OA 5EGMA 4GAWA 1TGSZ 2FI5E 2PKSB 2HNTF 1Q3XA 4JZ1A 1LHFH 2BD7A 4YLUA 2G51A 1VITG 2Y5FA 2JETB 3A80A 3K65B 3TH2H 9LPRA 3MU5A 1AE8H 5A8XA 2FO9A 1UK4A 4IS5A 1GI8B 1ABJH 1SLWB 4MNXA 3GY7A 2Z9IA 4AX9H 2P95A 3C27B 2HPQH 1TPSA 2LPRA 1PPCE 1FMGA 4DJZB 1C5MD 1S85A 2OQ5A 1N1LA 2O8UA 5HM9A 1QTFA 2ZHWH 1G2LA 5DK1A 1SHHB 4MDSA 1P06A 1BUIA 1VJAU 1IHSH 3QWCH 1MBMA 1ETSH 3AASA 2A2QH 4IC5A 5FCRA 3HGNA 1F0TA 5EPYA 1Y3UA 2VNTA 1XKBC 1DX5M 2FYQA 3SHAH 4J2YB 1L0ZA 1ZLRA 4ISHH 3UQOA 2GT7A 1ZSLA 4B2AA 1C1RA 3RMMH 1A5GH 5JYIA 1DY8A 3BG8A 1QL7A 3E3TA 4B2BA 2BY5X 1OWJA 1IQNA 1C1SA 2GX4A 3MFJA 1P2NA 3PLPA 3RXCA 3N7OA 2CJIA 1G37A 3LGWA 4RKJB 2P8OC 3LJJA 1ESBA 4ABAA 3LDXH 1E34B 1CGIE 3QX5H 1CHOF 1MAYA 3E0PB 4JZFH 2VU8E 1OYQA 2VJ1A 1J16A 2QYIA 2Y5HA 3ATKA 2PW8H 1MZAA 1GHAG 2P16A 1CT2E 4ISLA 2GT8A 3PLKA 3LGTA 3DFJA 3M3TA 5F8ZA 3A83A 3SNBA 1GVKB 4AG2A 4AN7A 1B7XB 1KXCA 1BTUA 3UOUA 5GJ4B 1ZGIA 1GBCA 1NS3A 4JK5A 4WMEA 2ZG0H 3SU5A 1N8OC 2ZGXH 1DE7H 4Y7AA 2RCEA 5FX5A 2ZFSA 2AIPA 3HGPA 3LGYA 3MO6A 1AMHA 1TMTH 4OS2A 1C1MA 1TGNA 1PPFE 1LHCH 1TX6A 1JWTA 2ZF0H 4I8JA 1GBKA 3P70B 3HATH 1LTOA 4WXIA 1SGCA 3QTVH 4HZHA 1HAVB 4Q7YA 2ZWLH 3H7OA 4FUIA 4RSPA 1NRQH 1Z7KA 5EOKA 2Y7ZA 3QTOH 1LPKB 3A7WA 5TJXA 4A6LA 1PPEE 3BTQE 1EAXA 1B5GH 1W7GH 4DIHH 4YESB 1S5SA 5EG4A 4Z6AH 1YPHC 1IAUA 3BTFE 4ZMAH 2H2ZA 1DANH 2G5NA 3GCTF 2FOAA 1HB0B 3NK8A 2J94A 1OWDA 5L2YH 3R0FA 1A5IA 3ZZ3A 5BRRE 1KXDA 3S9AA 3CS7A 3M35A 1P0SH 1ELVA 2CXVA 1GHVH 3SGAE 3PTBA 1MTVA 1S83A 1C5NH 3BEIB 1GBTA 4A7IB 4UEHH 2J95A 3CP7A 2BOHB 4NA9H 1ZGVA 1K1MA 3MNCA 2SGEE 1ELTA 5DGJA 5A8YA 1BBRK 1O5CB 5JB8S 1MQ5A 1P01A 2FOGA 2OQUA 1Z71A 4NIYA 1GHBF 2XRCA 4X1QU 8ESTE 3RP2A 3URDA 2G81E 2J9NA 1T4VH 2G52A 4ZUHA 1G2MA 1HAIH 1ZHPA 4LK4A 1DFPA 2A1DB 3GDUA 1KIGH 1P2JA 4LZ1H 1C1NA 5CMXH 2OP9A 5DP3A 2ZGHA 1P2MA 3LGIA 1V2OT 1YPGH 3D65E 1BITA 1O2GH 2Y81A 1W3CA 3RXMA 3SV7A 3MO3A 1BTHH 1FIZA 1KDQA 1FN8A 1QQ4A 2RG3A 3GY3A 5EODA 2XBVA 2SGDE 1G30B 1FAKH 2F9OA 2FLRH 3RXGA 1NY22 4ABEA 4BAKB 3TK9A 2BY9X 1SFQB 1T4UH 1Z1IA 3HKJB 4DT7B 1O2RA 2IN2A 5H4IB 1E38B 1HJ9A 1K2I1 3Q00A 4GCHG 2ZFQH 1SHYA 1VITH 2BD2A 4YOJA 2ZU3A 3BEFB 1ZZZA 2P3TB 2A5AA 1LCYA 1BB0B 1JIMA 2H1UA 1E36B 2OC8A 4GSOA 5GCHF 2FOMB 1XUFA 1CQQA 1K22H 1ZMNA 3SI4H 2ZTXA 5JBAS 1GMDG 1XKAC 4HI3A 4MNWA 5C1UA 1L1GA 1THPB 4TYDA 1S81A 3SBKA 1GWAA 3UWIA 1AE5A 1GDUA 1OXGA 1W7XH 3E91A 5T6FA 5IYTA 2BZAA 1V2NT 4GUXA 4K8BA 1TONA 4NSYA 4D8NA 2PUQH 1MCVA 1ELEE 1WCZA 1BBRH 4XBDA 1SPJA 7LPRA 1YCPH 3TIUA 2ANMH 1SGEE 1Z8IB 1EZXC 1MTUA 2ZFPH 4UFFH 4XFQA 2JETC 2PUXB 1AO5A 2ZCHP 5GDSH 4WH6A 1MQ6A 1BTWA 1O5EH 1O5FH 2ZDNA 3GICB 2ZCKP 1PJPA 2V6NA 3SJKA 1GHYH 1MH0A 1V2PT 1XUHA 1UHBA 3EDXB 2C8XB 2CHAB 1LO6A 2P94A 3ZZCA 1INCA 1J8AA 4H42U 1GCTC 1VCWA 1WSSH 6LPRA 1RS0A 3M7TA 4MPUA 5FAHA 1FN6A 4TY6A 3U8TH 3BIVH 3VFEA 3PM3A 2ALPA 1BBRE 4X2YA 3UR9A 1CA8B 1WV7H 1WAYB 3RXTA 4A92A 4ABJA 1GI1A 3RUOA 1TPAE 4X1NU 1C5RA 2H5CA 3RLWH 1C2IA 1DY9A 1SI5H 1A0JA 1K1NA 3ZVDA 4VGCC 4ZAEA 1O2HA 1Y5BT 1LKBA 1IQKA 1W14U 2A4OA 4CHAC 4X6NA 1KY9A 4TY7A 3DUXH 1GI9B 1MD8A 1SB1H 1GGDC 5G4BA 1TGBA 4I8KA 1SR5C 4ZKOU 8LPRA 2W7SA 4NIXA 2VGCB 2ZC9H 1O3BA 1MAXA 5DP7A 1BHXF 1AVGH 4K1TA 1YPEH 1ZTJA 1JIRA 4B76A 4AFSA 1H9LB 1YF4A 1C5PA 3GOVB 2HOBA 4K8YA 2D26C 2BX3A 2ZTZA 5CE1A 2KAIB 1C5LH 1GPZA 2LNCA 4BAOB 3NXPA 3NKKA 4AG1A 8GCHF 3AVZA 2J38A 4DW2U 1MKWH 4IN1A 4JYUH 3KQDA 3RU4D 1C5UA 3Q3KA 3ZVAA 2F9BH 2H9HA 1L4ZA 1XXDA 3Q3YA 1HXEH 1H1BA 1O37A 3VB7A 2OD3B 3MTYA 1BRAA 4O9VA 3MWIU 4LZ4B 1A2CH 1SSXA 2PKAB 5DP9A 3BEUA 1Z6JH 3UREA 3LIWA 3P95A 1AUTC 3ZVFA 2Q6DA 2XBWA 3F68H 1O2WA 4HTCH 1SLVB 3RXHA 1KLTA 1HIAA 2EI8A 1HAOH 3IG6B 3SQHE 1UTQA 4FUBA 1O3HA 1TMUH 2EC9H 1O2UA 1N8OB 3MU0A 3ZZ9A 4I8LA 5BPEA 2XTTB 1PQ5A 5JBCS 2ZO3H 1AB9C 2GKVE 1D4PB 1BMAA 2TIOA 2PSXA 1VR1H 1DUEA 2C8ZB 2BMGB 1HV7A 2FS9A 4YO9A 1WTGH 4KTSA 1C5WB 2O8WA 3D62A 1TBQH 4ABHA 2AERH 1IOEA 1KXAA 1H9IE 1S82A 2ANKH 2ZDKA 3RC4A 1SL3A 5FPSA 1P3CA 4INLA 3KIDU 2QXJA 1O36A 3SGQE 3RXLA 1T32A 2BLOA 5J4QA 1LVYA 1HUTH 1F5KU 1QCPA 4Q7XA 4GLYA 1CGHA 1PQ8A 3U8RH 3SJ8A 1ZTLA 1BCUH 5DJ7A 4CRDA 3ZVCA 2P3UB 3TGKE 1OSSA 3T5FH 3PLBA 1KLJH 1TRYA 4Y11E 3EYDA 1LVOA 5E0GA 2PV9B 1FAXA 3P8OA 5GPIB 2GD4B 3PMJA 1SGNE 3I29A 3L33A 5TCCA 3IWMA 1P9SA 4Q80A 2J4IA 1DICA 5CHAC 1OX1A 1TAWA 3SU6A 1P3EA 3MH4A 4Y79A 3M3SA 4O3UA 4X8UH 3SUGA 5C5NA 2W5EA 2A4GA 1SGYE 4CH2B 2ZU2A 3RMNH 4ABFA 1C5XB 1T8OA 5AF9H 3ZZ8A 3SU1A 5C20A 1ZHRA 1A3EH 1W13U 1Y5UT 4B74A 1HAXB 5GXPA 3F1SB 4BTUB 5AVDA 2XC5A 1ANCA 1GBFA 4KELA 1O2NA 4X2VA 2WUBA 4K3JA 3PMHB 1PPHE 2PGBB 2FP7B 1QHRB 4XBBA 4I32A 2BDCA 1TWXB 2F83A 1QB9A 1UO6A 4ZHMU 1NFYA 1ARBA 1AZZA 2A31A 2BVSH 1ELCA 1UTKA 5LH8A 3OTJE 4XSKU 4ZH8A 1V2JT 2Q6GA 3LH1A 1HBTH 3EE0B 1QFKH 1EOLA 4ZKNU 4CR9A 1SBWA 2BQ6B 3L6PA 4ABDA 1A0LA 1A7SA 1ZR0A 3TJNA 3VEQB 5A0CA 1GMCG 3A81A 1QJ7B 1O3IA 1ZHMA 2V3HH 1C4Y2 4GHTA 2QGRA 2ZNKH 3SV2H 1O2QA 1D3TB 1QA0A 2BZ6H 3CENA 2ODYB 3K9XB 4FU8A 3RM2H 1QR3E 1O2JA 2SFAA 1RXPA 1K1JA 3ZZAA 3RXJA 4MPXA 1G3EA 3AAVA 4AOQA 4CRGA 3BIUH 3M5NA 4I7YH 2W26A 2BD8A 1XUJA 3RXEA 3ATWA 3LU9B 1V2ST 4UFGH 6GCHF 4Y0ZE 1Y3XA 2VWLA 3QUMP 2GV7A 4U01A 3M5LA 2P3FH 3SV8A 1O5GH 1DWEH 3H7TA 2C3SA 1HAHH 2SGQE 2YOLA 3JZ1B 3T2NA 2ZQ2A 5HXFA 1V2QT 3BTWE 4D9QA 3SUDA 2TGDA 4K1SA 2VIOA 1ORFA 1DLKB 5JBBS 4E06H 2AGEX 1WQVH 4K69A 3UR6A 1SG8B 1AU8A 1H8DH 1GCDA 1GCTB 4U2WA 1ZJDA 2G00A 1IQMA 4H6SB 3S7KB 3UNSA 1C9TA 4PROA 3DT0H 3LC5A 1F92A 1H9HE 2THFB 1ZPBA 2C8WB 1QJ6B 4WWYA 1BTXA 2J92A 4RKOB 2Z3EA 1UMAH 5DP8A 2QF0A 3SOSA 1GVZA 5T6DA 2BLWA 2A4RA 4MTBA 3RXRA 4NFEA 1CT0E 3ZV8A 3FAOA 3QDZB 2VGCC 1BMLA 1C2MA 3F9EA 4VGCB 5EXLA 1C5VA 4ZROA 1PPBH 1TBRH 2OCVB 1P03A 2TGAA 2I6QA 4CHAB 3D23A 1UVUH 3LOXA 1FDPA 1TMBH 1UTLM 3EQ0H 1O2XA 2FS8A 2TGPZ 1GGDB 4BAQB 4AYYB 2WPJS 4JZDH 1NN6A 3QGNB 5LGOA 2ZU5A 1ESAA 2FESH 1GBIA 4NA7A 2AMQA 1GHXH 1NROH 1Y8TA 3A8BA 4ZXXH 2QXHA 4CRBA 2BD3A 3UOPA 1TNJA 1L4DA 3BTGE 4QT8C 2EI7A 4ABBA 1C9PA 4WVPE 1TNHA 1E0FD 5GWZA 1Z8JB 2ZZUH 1LDTT 1C5YB 1MD7A 1IQFA 1WQSA 4OGXA 1OWIA 1YBWA 3M7QA 4M7GA 4DVAU 4X8SH 3STJA 4IMQA 3O8RA 4BAMB 5E2PA 1D3DB 3BTHE 2EI6A 3FP6E 4FUDA 1KDQB 3M36A 2H9TH 4YM9A 4TWWA 4R0IA 2UWOA 3M3VA 4GHQA 2PFEA 4Y8YA 2OLGA 3OY6U 1RGQA 4ZHLU 1K1IA 1HFDA 2YNBA 2HPPH 1AB9B 1F0RA 2TRMA 1HNEE 1TX8A 1EUFA 1EB1H 4I8GA 3ZZ5A 3FZDA 1ID5H 1FPCH 4A1TA 4MPWA 1MMJN 2GDEH 4H6TA 4RN6A 2ZGCA 1C1VH 1HJ8A 1BIOA 1MCTA 2Z3CA 5F8XA 3KCGH 2Y5GA 1F2SE 1TGTA 3MH6A 4NA8A 3A89A 3ITIA 1FUJA 3ZZ6A 5EQQA 2ANYA 4UFEH 1FJSA 2R9PA 2VWMA 1O3JA 2HLCA 1Y3VA 4XOJA 4ABGA 1SVPA 4FUFA 1NFWA 3P17H 5A0BA 1QIXB 1SOZA 1NO9H 4K60A 5FBIA 1HPGA 1SGRE 7ESTE 1UTOA 1ZRBA 2DUCA 3BG4C 5DP6A 4X1SU 1XUIA 1CGJE 3SJOA 4CR5A 1UVSH 2ZA5A 3QO6A 1BOQA 1OOKB 4JMYA 2BTCE 3E1XB 2GTBA 1YCPK 1C2JA 1NRNH 1AFEH 2FOEA 2O8MA 4Y7BA 1D3QB 3SU0A 1EXFA 2XW9A 1EZUC 1OWKA 1CHGA 1SMFE 3TK6A 1O2LA 3HK3B 4TWYA 2TPIZ 3TGJE 2BD5A 1GMHF 2A7JA 2F9VA 2QCYA 2ZDMA 3UY9A 3TVJB 1TA6A 5F8TA 2FX4A 1GVLA 4X2XA 5CHAB 3RMOH 4BANB 2W3KA 1X7AC 1HAZB 3Q76A 3UUZA 2FM2A 4WY3A 1UHBB 2ZPQA 2B0FA 7KMEH 1QQUA 3D49H 2WPMS 1TIOA 3SNEA 4BTIB 5I25A 2QC2A 1P9UA 3MO9A 3A8CA 1ZJKA 2ZFFH 3A88A 1HAPH 3SJIA 4IW4E 3S9BA 1O0DH 1W0ZU 1YCPM 2BVXH 1ZMJA 1BMNH 1W8BH 3O8BA 5AHGH 1GBBA 1ANDA 1GBHA 2A4QA 2ZP0H 2WV5A 1BTPA 3RLYH 3VB5A 2BQ7B 2F9NA 2NWNA 4SGBE 1NESE 2WPLS 1D9IA 3TNSA 4NIVA 2OUAA 4K2YA 3RXOA 1SLUB 3SU2A 2Z7FE 5JBTA 2QIQA 4MG3A 2ZHDA 1C1TA 2VIDA 1DWDH 1QJ1B 7GCHF 4YTAA 1UVOA 1EB2A 1EPTC 1V3XA 4CBOA 3U69H 1NRPH 3ATMA 2CGAA 3GCHC 5TCAA 1SQAA 8KME2 4A5TS 4E7NA 3BTME 1OP8A 1N6XA 4U32A 1MKWK 3SJ9A 1DDJA 2ODQA 2ALVA 5FBEA 1FNIA 2Y7XA 3RDZA 3RXVA 6ESTA 4Y8ZA 4NGAH 4FUCA 1YPHE 5DP5A 5HM2A 1HDTH 4SGAE 1GG6C 2I6SA 4H4FA 5HGGA 3GY4A 2WYGA 5EPNA 3MU4A 4DOQA 3F6UH 1L1JA 3F9FA 1GI4A 2PHBA 4OS7A 5FCKA 2D2DA 3QGJA 1A5HA 1AKSA 1BRCE 2OC0A 2C8YB 2Q1JA 3KF2A 3MYWA 3AAUA 3LPRA 2B7DH 3SNDA 5K0HA 5E8EH 1TNLA 1GI6A 2XYAA 4HFPB 1ESTA 2FOBA 1FV9A 1HIAB 1C2KA 1DS2E 1O3MA 1QBNA 1QRWA 1UVTH 3V12A 4BAHB 1CHOG 1O3LA 1QBOA 2GCHG 1PPZA 5FX6A 2PGQB 1NT1A 1AI8H 4MQAA 4CRFA 1PYTD 4D76A 1G3DA 3S7HB 3F9GA 2Y80A 3BTKE 1UK2A 4WH8A 2R0KA 1IQHA 2GZ7A 3R3GB 1RTLA 4ZHAA 3PTNA 1NM6A 4FVBA 2STBE 3NCLA 2RDLA 2VWNA 3MU8A 1WU1A 3T25A 1UTMA 1AGJA 1ZTKA 1G36A 2DE9A 4XE4A 2RA0A 1K1PA 5IDKA 1LPZB 1O2IA 3EA7A 1D3PB 1EZSC 1O3PB 1GI3A 4B75A 2CV3A 3TH3H 4INKA 1EQ9A 1TYNA 1SGTA 1RJXB 4IBLH 5L30H 4NCYA 4X1RU 1FY4A 1AHTH 4AZ2B 3A87A 4IN2A 3KQEA 3I77A 5EQRA 1WYKA 3SGBE 1FI8A 3QZRA 2NU4E 1GBEA 5A8ZA 2FWWA 1J15A 2Q6FA 1GBJA 2QA9E 1QNJA 4CREA 2XC0A 3GCTG 3ZZ4A 1VITF 4D9RA 2TGTA 2GP9B 1SOTA 3PO1C 3P92A 1QY6A 2FTLE 1PPGE 1DWBH 2ZI2H 2EA3A 3ZYEA 1AZ8A 3M61U 1C2EA 1O38A 2XBYA 2AFQB 1DITH 3TNTA 2NU1E 2J2UA 1QB6A 1TB6H 1OP0A 1IHTH 1THSH 3P8GA 3H5CB 4NG9H 3RC5A 5EU8A 3OSYA 2PLXA 2UUKB 2TBSA 4WXVA 2Y82A 5AFZH 2GDDA 1SC8U 1AIXH 1VJ9U 2ZPRA 3W94A 1SQOA 1C5TA 1HRTH 2EEKA 3IITA 1GBDA 3VXFH 2SGPE 2FX6A 4YT6H 1GHBG 4X2WA 1LVBA 1TPPA 1RFNA 1TQ0B 2IJOB 1ZPZA 1LMWB 2BLVA 5EXNA 1V6DA 3NPSA 3KHVA 5LPEA 2PWXA 3M5MA 3UNRA 1RD3B 1FXYA 2FTMA 4Y76A 1BJUA 1TX7A 1V2WT 2BLQA 3TH4H 1WUNH 3BTDE 2ZGBH 5EQSA 3E0NB 1XX9A 1W10U 1SLXB 4ISNA 1DT2A 4LOYH 2AGIX 4XDEA 1CSOE 1YPMH 2BY8X 1E37B 1C2LA 3KQCA 1EAWA 3E8LA 4MNYA 1O32A 2BXUH 2QN5T 2A32A 2NU2E 2B9LA 4KGAA 1NFXA 1V2MT 4Q7ZA 3EA9A 1UCYH 2AEIH 2A2XH 3GY5A 5DPAA 2G4TA 3VB3A 1GHAF 3V13A 5C1XA 3RXUA 1P12E 1IQEA 1K9OE 2AIQA 1MU8B 1U6QA 3M7UA 2G55A 3KGPA 1P04A 1GI0A 3BG4B 4BXSA 3A7ZA 3WY8A 4OS4A 2FIRH 3JZ2B 1JXPA 1SGFA 1Z8RA 3HPTB 1HAYB 3DFLA 3SNCA 2BM2A 3U98H 4CRAA 1DVAH 2VWOA 2CF9H 2VIWA 3RMLH 1ELFA 3B8JA 1EAIA 4JCNA 2WINI 2IOTA 4INHA 2ZEBA 3EA8A 1CT4E 2ZIQH 3A7XA 3HKIB 2SNWA 2BDYA 3C1KA 3RU4T 5L6NH 1ACBE 2UUYA 4AGKA 3SORA 1J17T 3BV9B 4FVDA 1BTYA 1RTFB 2ZKSA 1BRBE 1JOUB 1O2KA 2GCTC 3SZNA 1EJMA 1XVMA 2QV1A 3VGCC 1V2VT 1MKXH 2G5VA 4Z0KA 1DOJA 2C93B 5JPMH 1IQLA 4A1XA 1S0QA 1TQ7B 1C2HA 1DWCH 1DXWA 3ZV9A 1TALA 3OU0A 3RXSA 2V35A 2XWAA 5T3HA 4OGYA 3ZZ7A 1TNKA 1GHWH 4NSVA 1NU7B 4NWKA 2OXSA 3ZYDA 1C2GA 2OC7A 4IMZA 4AYVB 1SGFG 4FUEA 1GL1A 3RXIA 1ABIH 1UJ1A 2UUFB 4B2CA 4DG4A 2ILNA 1O2MA 1SGPE 1VCPA 3ODFA 2FMJA 3RC6A 1KXEA 1O2SA 1DXPA 1TE0A 3SO3A 4CBNA 1UK3A 4I31A 2W3IA 1NC6A 1Y3WA 1EPTB 3MI4A 2P93A 2VIPA 2CN0H 3GCHB 5AFYH 2Z3DA 5ESBA 2CMYA 1AY6H 5I46H 1GBLA 1MU6B 5ABWA 4E05H 1MZDA 2CF8H 3NZIA 3TLOA 4I8HA 2BXTH 4GPGA 4Y6DA 1GG6B 4KTCA 4OS1A 2F9UA 1P09A 1TFXA 2FPZA 2O9QA 5C5OA 4MLFB 3T62A 3T29A 4B71A 1JBUH 3GYLB 2QF3A 3SNAA 1ETRH 4UONA 1B0EA 2HVXA 2R0LA 3FP7E 5K7RA 4CRCA 8GCHG 4GCHF 1PQAA 3BSQA 3VB4A 2FXRA 1AVXA 1V2UT 2SGFE 1NZQH 1ZRKA 1NFUA 3A7YA 2AYWA 1Q31A 2FI4E 2PTCE 4XBCA 1YLDA 2VIVA 1TBZH 5FXLA 1KTTB 1C5OH 1ETTH 1QRXA 4IC6A 4YOGA 4DURA 4I33A 1S6FA 3TITA 2A7CA 1UTJA 1Y5AT 1Y59T 1GMDF 3B9FH 1BZXE 3ZZBA 4ISIH 2O8TA 1QURH 1A0HB 1HGTH 2A0QB 1EKBB 3SU4A 4TPIZ 5GIBA 1P2QA 3PV4A 1TNIA 1T8NA 1A46H 3LC3A 4JYTA 4X6OA 1JRSA 1ZYOA 3PWBA 1AVWA 1KXBA 2ZHEH 1G32B 3ENSB 2J34A 5DG6A 3PMAB 2AH4X 2FODA 1FZZA 1F5LA 1FLEE 1O2PA 2F9PA 3SUEA 2AS9A 4Y8XA 2PR3A 1ELGA 1HYLA 1EPTA 5F6MA 3UWJH 2FDAA 1NRRH 1BRUP 3STIA 1QL9A 1LHDH 3O8DA 1C4V2 1KXFA 3GYMA 4UD9H 2BDGA 5A2MH 1B0FA 1VZQH 1XUKA 2BDAA 1TGCA 4IGDA 4X0WU 2Z6BD 4KKDA 1OP2A 1LQDB 1FY1A 1THRH 3QN7A 1O35A 1AWFH 3KN2A 1BJVA 3BTTE 3UNQA 1W12U 1GHZA 2GCHF 3FZZA 2XCNA 1BMMH 1GJDB 1VGCC 1GL0E 5HMAA 3PO1B 2VB0A 2XCFA 5ESTE 1PYTC 2FOHA 2VINA 2R2WU 2VVVA 2ESTE 1P10A 1P2KA 2ODPA 2NU3E 4FU9A 3Q77A 1MTWA 1O34A 4ZXYH 1AWHB 1LVMA 4NZQA 1K1OA 1O3OA 4DIIH 1TOCB 4UFDH 2BHGA 2ANWA 1EJAA 1HAGE 3DA9B 1O39A 3A8DA 1AFQC 1C5QA 2WPHS 1O30A 1MTNC 2K1QA 1EATA 1V2RT 2JKHA 1T31A 3OYPA 3S9CA 2HRVA 1AD8H 9ESTA 1F7ZA 3OX7U 3B23B 1Z6EA 5EXMA 1C2FA 3TU7H 2SGAA 3K6ZA 3RXBA 1PQ7A 3VXEH 3GDSA 4NZLA 1YP9A 2BX4A 3P8NA 1O2TA 2V0BA 2WUCA 1HJAC 2OC1A 4DCDA 2GV6A 1ARCA 1MBQA 1WTHD 2SNVA 1T8LA 3KNXA 1OYTH 1XVOA 4BXWA 2GVFA 2A7HA 1XMNB 3SI3H 1BTZA 2FOCA 3RXKA 3BN9A 1A1RA 4AB8A 3SN8A 2DE8A 3ZVEA 2GMTC 1J9CH 4BTTB 3UQVA 5LPFA 5E0JA 1TLDA 3VPKA 3T27A 3KQBA 3U1IB 5EW1H 5EW2H 3K6YA 3M5OA 3RXQA 1XUGA 3LJOA 1AKSB 3U8OH 2WPKS 4K5ZA 3MNXA 2BOKA 2FOFA 2V3OH 1L2EA 4CH8B 1XM1A 1GJCB 2FLBH 1YPJH 1O3NA 1GDNA 2UWPA 2XNIA 3MH7A 5LPRA 1H8IH 3AW1A 3ZVGA 5C67A 3RXPA 1O5BB 4B1TA 2OTVA 5J4SA 5A09A 2JH0D 3MH5A 2ZHFH
chains in the Genus database with same CATH superfamily
1CBWC 2D8WA 6GCHG 2GCTB 3VGCB 1S0RA 4AFUA 1MTSA 1RIWC 2FYRA 2HWLB 1NU9A 1AUJA 1CA0C 4D7GA 3LKWA 3UFAA 3L3TA 1HAVA 1C5ZB 1GJ5H 4ZKRU 4O03A 3MHWU 4JZIA 1HXFH 2GZ8A 2YNAA 5PTPA 3O8CA 2BD4A 1O2OA 1A4WH 2OBQA 4Y10E 5DP4A 1K1LA 1YPKH 4U30A 1GJAB 3MMGA 4FETA 5C94A 4NWLA 3FVFB 2R3UA 1EP5A 2K0QA 2ASUB 3SW2B 1NTPA 1JRTA 1TNGA 3M37A 1NRSH 3MNSA 2B5TB 1C1UH 1GI5A 3PYHA 2FI3E 2WYJA 2UUJB 1C5SA 2D1JA 2JIZD 1G3CA 1O31A 1W0YH 1IQGA 3OEHD 1RTKA 2JH5D 5JB9S 3FKSD 4R8TB 2ZTYA 3MOCA 4FU7A 1FY8E 2ZDAH 4MNVA 2HVYB 1FONA 1Z8GA 2AGGX 2ZHQH 2A5KA 2OBOA 2C4FH 4FUGA 1OS8A 4X8TH 1GJ4H 5C0UA 1KTSB 2OINA 2WV4A 3LGVA 1S84A 3GCOA 1EZQA 1YGCH 2IPHA 3I78A 1YLCA 3RU4E 4DY7B 3Q3XA 5L2ZH 1P57B 2ZGJA 3A82A 1O3DA 1Z1JA 3DHKH 4K1EA 6CHAC 2F43B 3RM0H 5T1VA 3SU3A 1K28D 5F03A 2RA3A 1TPOA 1C1PA 2PKSC 3A8AA 5HYOA 1O3EA 1KSNA 3EE7A 1CVWH 1EASA 2QAAA 4JZEH 2Z9GA 3OEED 1L1NA 3TK5A 1V2LT 2GGVB 4ASUD 1EAUA 1YM0A 4Z1MD 3EGKH 3V0XA 3G01A 2XBXA 3K2UA 2ZQ1A 3GCNA 3QLPH 1OWHA 2ULLA 2R3YA 2QXIA 3F0OA 3GY6A 1M9UA 1P2OA 4A1VA 1O2YA 3A85A 1LPGB 1GMCF 2FEQH 3FANA 1O3KA 2UWLA 2VVCA 1PFXC 4WMFA 4X6MA 1DSTA 1IQJA 1A61H 1SFIA 1ZMLA 1G9IE 4AFZA 3UTUH 3A86A 1T8MA 4ABIA 3RXFA 1UCYK 3ZZDA 1O3AA 3TGIE 1A3BH 1O3CA 1NPMA 2HLDD 1GI7B 3ATIA 2F91A 1AN1E 3GY2A 1XXFA 2HNTC 1OWEA 2Z9JA 1H4WA 1FIWA 1FY3A 5ETXA 1QA7A 3TJVA 2ZU1A 3E90B 4LXBH 4D7FA 4MPVA 3KYGA 1H8HD 1DLEA 4YT7H 3F9HA 4WF8A 1ZOMA 3W95A 1LHEH 4THNH 1UTPA 2AMDA 5SGAE 3PMBB 1F0SA 2HALA 1ANEA 3RXDA 2STAE 3BF6H 4Q4LA 2ZDLA 3V3MA 3A7VA 3RXAA 3PB1E 3UIRA 3U28C 1N6YA 5DO4H 1O3FA 4AGJA 4ASHA 1E35B 2P8OB 1RRKA 4UDWH 4AORA 2AMPA 2ZECA 2BDBA 4FUHA 2PSYA 4AB9A 4DGJA 1OPHB 1C1WH 1DPOA 4O3TA 2GZ9A 1FY5A 1MKXK 3F2GA 3ZVBA 2BD9A 1VGCB 3SV6A 2C90B 2WPIS 4JK6A 1LQEA 2ZCLP 1BDAA 2W7UA 4Y0YE 2Z9LA 3EAJA 1V2TT 4OS6A 3MU1A 2XC4A 3SUFA 1QBVH 1SGIB 1GJ7B 4WJG2 4KP0A 1ELDE 3SV9A 5T6GA 1YC0A 2BY6X 3QK1A 1VCQA 5C3NA 1GMHG 1TRNA 2HGTH 2ZFRH 1BHXB 2FZZA 2B8OH 4NIWA 5CHBA 1AFQB 4NFFA 2BDHA 2BB4A 2BY7X 1CO7E 1MTNB 2L6OA 2XNDD 5C1YA 2JJ2D 1TOMH 3LONA 1G3BA 1EJNA 2H9EH 1T7CA 2G4UA 2M5TA 2F3CE 3U9AH 2XWBI 1P2IA 1KLIH 1SGQE 2QXGA 3V7TA 1DM4B 1D6RA 4OS5A 1W11U 3QZQA 1TA2A 2NU0E 2ZPSA 1UTNA 1ZSKA 1WOFA 1GDQA 4AFQA 1CE5A 2R2MB 3AW0A 4HGCA 4JYVH 2VIQA 1ZSJA 1HJAB 4BOHA 1FQ3A 1GJ6A 2H5DA 2VH6A 3PV5A 4Y71A 5FHTA 4YLQH 2A5IA 2BQWB 1ELBA 1EX3A 1YPLH 3CS0A 2ZU4A 1J14A 1KYNA 4RT0A 3ESTA 1O2ZA 5GCHG 1IQIA 1F5RA 3FP8E 4J1YA 1Y3YA 3E16B 3KL6A 2BDIA 1D6WA 2KAIA 1CU1A 1EP6A 1UCYE 1GI2A 1SGDE 2JH6D 2GMTB 1ELAA 3GY8A 7GCHG 3MNBA 1TABE 2HNTE 3NUMA 4O97A 1LKAA 1FPHH 2WV9A 5B6OA 1C4U2 3SQEE 1GBMA 1P11E 1GJBB 3A7TA 4WMDA 2PTNA 3T28A 3LH3A 4F4OC 4F49A 1WBGB 1NBMD 3FFGA 1GJ9B 2XXLA 1MUEB 2Y6TA 3PWCA 2PKAA 2O8LA 3T26A 2A45B 1LHGH 4Q2KA 3UAIC 3DD2H 3LT3A 4UE7H 4ISOA 5JDUB 1P02A 1SQTA 1P05A 3LGUA 4FXGH 5KECA 1KMHB 3ELAH 2Z94A 1GBAA 4YOIA 1QGFA 1O33A 5FPYA 2AHME 3NWUA 3PROA 1EOJA 1CBWB 1OKXA 4X6PA 1AQ7A 1ZPCA 3GDVA 1RIWB 2KCOA 1CA0B 1JMOH 4X1PU 1W0KD 1DSUA 3GISB 3URCA 1WXRA 3S0NA 2PP6A 1YYY1 1QL8A 1QRZA 2P59A 1QB1A 2VBCA 4E7RG 4B73A 1OHHD 3P6ZB 1TRMA 2G8TA 4ZKSU 3VB6A 1O5AB 3A84A 3ODDA 2BYAX 3HK6B 1W2KH 1O5DH 2H6MA 3P8FA 4MVNA 2QY0B 1Q2WA 4YZUA 3TJOA 1C2DA 1HLTH 3ATLA 2VH0A 4P02A 3AK5A 1P8VC 2ZDVH 3TJUA 1GJ8B 1BA8B 5E0HA 2BVRH 1S6HA 4KTUA 3KEEA 4X8VH 1ANBA 4TPYA 1UVPA 3BTEE 5HIYA 3U1JB 1YKTA 4B6FA 1O3GA 5C2ZA 2ZFTA 1DUAA 1BQYA 3E6PH 3S69A 4ESTE 5A0AE 1V2KT 2VVUA 3UPEA 4GVUA 4BNRA 1BT7A 5FPTA 1C1QA 1O2VA 5E2OA 5DKMA 1K21H 3TPIZ 6CHAB 1F0UA 3SHCH 3OY5U 2Z9KA 2CHAC 1HCGA 4FUJA 1C1OA 5EGMA 4GAWA 1TGSZ 2FI5E 2PKSB 2HNTF 1Q3XA 4JZ1A 1LHFH 2BD7A 4YLUA 2G51A 1VITG 2Y5FA 2JETB 3A80A 3K65B 3TH2H 9LPRA 3MU5A 1AE8H 5A8XA 2FO9A 1UK4A 4IS5A 1GI8B 1ABJH 1SLWB 4MNXA 3GY7A 2Z9IA 4AX9H 2P95A 3C27B 2HPQH 2KFWA 1TPSA 2LPRA 1PPCE 3F3BA 1FMGA 4DJZB 1C5MD 1S85A 2OQ5A 1N1LA 2O8UA 5HM9A 4M9FA 1QTFA 2ZHWH 1G2LA 5DK1A 1SHHB 4MDSA 1P06A 1BUIA 1VJAU 1IHSH 3QWCH 1MBMA 1ETSH 3AASA 2A2QH 4IC5A 5FCRA 3HGNA 1F0TA 5EPYA 1Y3UA 2VNTA 1XKBC 1DX5M 2FYQA 3SHAH 4J2YB 1L0ZA 1ZLRA 4ISHH 3UQOA 2GT7A 1ZSLA 4B2AA 1C1RA 3RMMH 1A5GH 5JYIA 1DY8A 3BG8A 1QL7A 3E3TA 4B2BA 2BY5X 1OWJA 1IQNA 1C1SA 2GX4A 3MFJA 1P2NA 2V7QD 3PLPA 3RXCA 3N7OA 2CJIA 1G37A 3LGWA 4RKJB 2P8OC 3LJJA 1ESBA 4ABAA 3LDXH 1E34B 1CGIE 3QX5H 1CHOF 1MAYA 3E0PB 4JZFH 2VU8E 1OYQA 2VJ1A 1J16A 2QYIA 2Y5HA 3ATKA 2PW8H 1MZAA 1GHAG 2P16A 1CT2E 4ISLA 2GT8A 3PLKA 3LGTA 3DFJA 3M3TA 5F8ZA 3A83A 3SNBA 1GVKB 4AG2A 4AN7A 1B7XB 5EJ1A 1KXCA 1BTUA 3UOUA 5GJ4B 1ZGIA 1GBCA 1NS3A 4JK5A 4WMEA 2ZG0H 3SU5A 1N8OC 2ZGXH 1DE7H 4Y7AA 2RCEA 5FX5A 2ZFSA 2AIPA 3HGPA 3LGYA 3MO6A 1AMHA 1TMTH 4OS2A 1C1MA 1TGNA 1PPFE 1LHCH 1TX6A 1JWTA 2ZF0H 4I8JA 1GBKA 3P70B 3HATH 1LTOA 4WXIA 1SGCA 3QTVH 4HZHA 1HAVB 4Q7YA 1VKYA 2ZWLH 3H7OA 4FUIA 4RSPA 1NRQH 1Z7KA 5EOKA 2Y7ZA 3QTOH 1LPKB 3A7WA 5TJXA 4A6LA 1PPEE 3BTQE 1EAXA 1B5GH 1W7GH 4DIHH 4YESB 1S5SA 5EG4A 4Z6AH 1YPHC 1IAUA 3BTFE 4ZMAH 2H2ZA 1DANH 2G5NA 3GCTF 2FOAA 1HB0B 3NK8A 2J94A 1OWDA 5L2YH 3R0FA 1A5IA 3ZZ3A 5BRRE 1KXDA 3S9AA 3CS7A 3M35A 1P0SH 1ELVA 2CXVA 1GHVH 3SGAE 3PTBA 1MTVA 1S83A 1C5NH 3BEIB 1GBTA 4A7IB 4UEHH 2J95A 3CP7A 2BOHB 4NA9H 1ZGVA 1K1MA 3MNCA 2SGEE 2QF4A 1ELTA 5DGJA 5A8YA 1BBRK 1O5CB 5JB8S 5HIZA 1MQ5A 1P01A 2FOGA 2OQUA 1Z71A 4NIYA 1GHBF 2XRCA 4X1QU 8ESTE 3RP2A 3URDA 2G81E 2J9NA 1T4VH 2G52A 4ZUHA 1G2MA 1HAIH 1ZHPA 4LK4A 1DFPA 2A1DB 3GDUA 5EIYA 1KIGH 1P2JA 3SZEA 4LZ1H 1C1NA 2KM0A 5CMXH 2OP9A 5DP3A 2ZGHA 1P2MA 3LGIA 1V2OT 1YPGH 3D65E 1BITA 1O2GH 2M2AA 1W3CA 2Y81A 3RXMA 3SV7A 3MO3A 3WW7A 1BTHH 1FIZA 1KDQA 1FN8A 1QQ4A 2RG3A 3GY3A 5EODA 2XBVA 2SGDE 1G30B 1FAKH 2F9OA 2FLRH 5EJLA 1NY22 5F53A 3RXGA 4ABEA 4BAKB 3TK9A 2BY9X 1SFQB 1T4UH 1Z1IA 3HKJB 4Q63A 3WWBA 4DT7B 1O2RA 2IN2A 5H4IB 1E38B 1HJ9A 1K2I1 3Q00A 4GCHG 2ZFQH 1SHYA 1VITH 2BD2A 4YOJA 2ZU3A 3BEFB 1ZZZA 2P3TB 2A5AA 1LCYA 1BB0B 1JIMA 2H1UA 1E36B 1WDIA 2OC8A 4GSOA 5GCHF 2FOMB 1XUFA 1CQQA 1K22H 1ZMNA 3SI4H 2ZTXA 5JBAS 1GMDG 1XKAC 4HI3A 4MNWA 5C1UA 3OTPA 1L1GA 1THPB 2EQNA 4TYDA 1S81A 3SBKA 1GWAA 3UWIA 2RFKC 1AE5A 1GDUA 1OXGA 1UW7A 1W7XH 3E91A 5T6FA 5IYTA 2BZAA 1V2NT 4GUXA 4K8BA 1TONA 4NSYA 4D8NA 2IJD1 2PUQH 2WPDD 1MCVA 2KCYA 1ELEE 1WCZA 1BBRH 4XBDA 1SPJA 7LPRA 1YCPH 3TIUA 2ANMH 1SGEE 1Z8IB 1EZXC 1MTUA 2ZFPH 3OAAD 4UFFH 4XFQA 2JETC 2PUXB 1AO5A 2ZCHP 5GDSH 4WH6A 1MQ6A 1BTWA 1O5EH 1O5FH 2ZDNA 3GICB 2ZCKP 1PJPA 2V6NA 3SJKA 1GHYH 1MH0A 1V2PT 1XUHA 1UHBA 3EDXB 2C8XB 2CHAB 1LO6A 5C0TA 2P94A 3ZZCA 1INCA 1J8AA 4H42U 1GCTC 1VCWA 1WSSH 6LPRA 1RS0A 3M7TA 4MPUA 5FAHA 1FN6A 4TY6A 3U8TH 3BIVH 3VFEA 3PM3A 2ALPA 3PRBA 1BBRE 4X2YA 3UR9A 3KQ5A 1CA8B 1WV7H 1WAYB 3RXTA 2QE7D 4A92A 4ABJA 1BMFD 1GI1A 3RUOA 1TPAE 4X1NU 1C5RA 4OM9A 2H5CA 3RLWH 1C2IA 1DY9A 1SI5H 3W1EA 1A0JA 1K1NA 3ZVDA 4VGCC 4ZAEA 1O2HA 1Y5BT 1LKBA 1IQKA 1W14U 2A4OA 2KCPA 4CHAC 4X6NA 1KY9A 4TY7A 3DUXH 1GI9B 1MD8A 1SB1H 1GGDC 5G4BA 1TGBA 4I8KA 1SR5C 4ZKOU 8LPRA 2W7SA 4NIXA 2VGCB 4TT3D 2ZC9H 1O3BA 1MAXA 5DP7A 1BHXF 1AVGH 4K1TA 1YPEH 1ZTJA 1JIRA 4B76A 4AFSA 1H9LB 1YF4A 1C5PA 3GOVB 2HOBA 4K8YA 2D26C 2BX3A 2ZTZA 5CE1A 2KAIB 1C5LH 1GPZA 2LNCA 4BAOB 3NXPA 3NKKA 4AG1A 8GCHF 2J5UA 3AVZA 2J38A 4DW2U 1MKWH 4IN1A 4JYUH 3KQDA 3RU4D 1C5UA 3Q3KA 3ZVAA 2F9BH 2H9HA 1L4ZA 1XXDA 3Q3YA 1HXEH 1H1BA 1O37A 3VB7A 5C17A 2OD3B 3MTYA 1QZ8A 1BRAA 4O9VA 3MWIU 2GJGA 4LZ4B 1A2CH 1SSXA 2PKAB 5DP9A 3BEUA 1Z6JH 3UREA 3LIWA 3CNRA 3P95A 1AUTC 3ZVFA 2Q6DA 2XBWA 4DT4A 3F68H 1O2WA 4HTCH 1SLVB 2YMSD 3RXHA 1KLTA 1HIAA 2EI8A 1HAOH 3IG6B 3SQHE 1UTQA 4FUBA 1O3HA 1TMUH 2EC9H 1O2UA 1N8OB 3MU0A 3ZZ9A 4I8LA 5BPEA 2XTTB 1PQ5A 5JBCS 2ZO3H 1AB9C 2GKVE 1YLNA 1D4PB 1BMAA 2TIOA 2PSXA 1VR1H 1DUEA 2C8ZB 2BMGB 1HV7A 2FS9A 4YO9A 1WTGH 4KTSA 1C5WB 2O8WA 3D62A 1TBQH 4ABHA 2AERH 1IOEA 1KXAA 1H9IE 1S82A 2ANKH 2ZDKA 3RC4A 4ACBA 1SL3A 5FPSA 1P3CA 2QF5A 4INLA 3KIDU 2QXJA 3FOAA 1O36A 3SGQE 3RXLA 1T32A 2BLOA 5DSFA 5J4QA 1LVYA 1HUTH 1F5KU 1QCPA 4Q7XA 4GLYA 1CGHA 1PQ8A 3U8RH 3SJ8A 1ZTLA 1BCUH 5DJ7A 4CRDA 3ZVCA 2P3UB 3TGKE 1OSSA 3T5FH 3PLBA 1KLJH 1TRYA 4Y11E 3EYDA 1LVOA 5E0GA 2PV9B 1FAXA 3P8OA 5GPIB 2GD4B 3PMJA 1SGNE 3I29A 3L33A 5TCCA 3IWMA 1P9SA 4Q80A 2J4IA 1DICA 5CHAC 1OX1A 1TAWA 3SU6A 1P3EA 3MH4A 4Y79A 3M3SA 4O3UA 4X8UH 3SUGA 5C5NA 2W5EA 2A4GA 1SGYE 4CH2B 2ZU2A 3RMNH 4ABFA 1C5XB 1T8OA 5AF9H 3ZZ8A 3SU1A 4XD7D 5C20A 1ZHRA 1A3EH 3NRLA 1W13U 1Y5UT 4B74A 1HAXB 5GXPA 3F1SB 4BTUB 5AVDA 2XC5A 1ANCA 1GBFA 4KELA 1O2NA 4X2VA 2WUBA 3GS9A 4K3JA 2J98B 3PV2A 3PMHB 1PPHE 2PGBB 2FP7B 1QHRB 3N7EA 5DN6D 1SKYE 3KYFA 4XBBA 4I32A 2BDCA 1TWXB 2F83A 4TSFD 1QB9A 1UO6A 1FX0B 4ZHMU 1YY3A 1NFYA 1ARBA 1AZZA 2A31A 2BVSH 1ELCA 1UTKA 5LH8A 5B6LA 3OTJE 4XSKU 4ZH8A 1V2JT 2Q6GA 3LH1A 1HBTH 3EE0B 1QFKH 1EOLA 4ZKNU 2L74A 4CR9A 1SBWA 2BQ6B 3L6PA 4ABDA 1A0LA 1A7SA 1ZR0A 3TJNA 3VEQB 5A0CA 1GMCG 3A81A 1QJ7B 1O3IA 1ZHMA 2V3HH 1C4Y2 4GHTA 2CK3D 2QGRA 2ZNKH 3SV2H 1O2QA 1D3TB 1QA0A 2BZ6H 3CENA 2ODYB 3K9XB 4FU8A 3RM2H 1QR3E 1O2JA 2SFAA 1RXPA 1K1JA 3ZZAA 3RXJA 4MPXA 1G3EA 3MQKC 3AAVA 4AOQA 4CRGA 3BIUH 3M5NA 4I7YH 2W26A 2W6JD 5EJZA 2BD8A 1XUJA 3RXEA 3ATWA 3LU9B 1V2ST 4UFGH 6GCHF 4Y0ZE 1Y3XA 5CDFE 2VWLA 3QUMP 2GV7A 4U01A 3M5LA 2P3FH 3SV8A 1O5GH 1DWEH 3H7TA 2C3SA 1HAHH 2SGQE 2YOLA 3JZ1B 3T2NA 2ZQ2A 5HXFA 1V2QT 3BTWE 4D9QA 3SUDA 2TGDA 4K1SA 2VIOA 1ORFA 1DLKB 5JBBS 4E06H 2AGEX 1WQVH 2J98A 4K69A 3UR6A 1SG8B 1AU8A 1H8DH 1GCDA 5KEDA 1GCTB 4U2WA 1EFRD 1ZJDA 2G00A 1IQMA 4H6SB 3S7KB 3UNSA 1C9TA 4PROA 3DT0H 3LC5A 1F92A 1H9HE 2THFB 1ZPBA 2C8WB 1QJ6B 4WWYA 3SYJA 1BTXA 2J92A 3DSPA 4RKOB 2Z3EA 1UMAH 5DP8A 2QF0A 3SOSA 1GVZA 3VG8A 5T6DA 2BLWA 2A4RA 4MTBA 3RXRA 4NFEA 1CT0E 3ZV8A 3FAOA 3QDZB 2VGCC 1BMLA 1C2MA 3F9EA 4VGCB 5EXLA 1C5VA 4ZROA 1PPBH 1TBRH 2OCVB 1P03A 2TGAA 2I6QA 4CHAB 3D23A 1UVUH 3LOXA 1FDPA 1TMBH 1UTLM 3EQ0H 1O2XA 2FS8A 2TGPZ 2WZQA 1GGDB 4BAQB 4AYYB 2WPJS 4JZDH 1NN6A 3QGNB 5LGOA 2ZU5A 5GNDA 1ESAA 2FESH 1GBIA 4NA7A 2AMQA 1GHXH 1NROH 1Y8TA 3A8BA 4ZXXH 2QXHA 4CRBA 2BD3A 3UOPA 1TNJA 1L4DA 2KZ4A 3BTGE 4QT8C 2LP6A 2EI7A 4ABBA 1C9PA 4WVPE 1TNHA 1E0FD 5GWZA 1Z8JB 2ZZUH 1LDTT 1C5YB 1MD7A 1IQFA 1WQSA 4OGXA 1OWIA 1YBWA 3M7QA 4M7GA 4DVAU 4X8SH 3STJA 4IMQA 3O8RA 4BAMB 5E2PA 1D3DB 3BTHE 2EI6A 3FP6E 4FUDA 1KDQB 3M36A 2H9TH 4YM9A 4TWWA 4R0IA 2IPQX 2UWOA 3M3VA 4GHQA 2PFEA 4Y8YA 2OLGA 3OY6U 1RGQA 4ZHLU 1K1IA 1HFDA 2YNBA 2HPPH 1AB9B 1F0RA 2TRMA 1HNEE 1TX8A 1EUFA 1EB1H 4I8GA 3ZZ5A 3FZDA 1ID5H 1FPCH 4A1TA 4MPWA 1MMJN 2GDEH 4H6TA 4RN6A 2ZGCA 1C1VH 1HJ8A 1BIOA 1MCTA 2Z3CA 5F8XA 3KCGH 2Y5GA 1F2SE 1TGTA 3MH6A 4NA8A 3A89A 3ITIA 1FUJA 3ZZ6A 5EQQA 2ANYA 4UFEH 1FJSA 2R9PA 2VWMA 1O3JA 2HLCA 1Y3VA 4XOJA 4ABGA 1SVPA 4FUFA 1NFWA 3P17H 5A0BA 3OFND 1QIXB 1SOZA 1NO9H 4K60A 5FBIA 1HPGA 1SGRE 7ESTE 1UTOA 3OE7D 1ZRBA 2DUCA 2J97A 3BG4C 5DP6A 4X1SU 1XUIA 1CGJE 3SJOA 4CR5A 1UVSH 2ZA5A 3QO6A 1BOQA 1OOKB 4JMYA 2BTCE 3E1XB 2GTBA 4XRNA 1YCPK 1C2JA 1NRNH 1AFEH 2FOEA 2O8MA 3H09A 4Y7BA 1D3QB 3SU0A 1EXFA 2XW9A 1EZUC 1OWKA 1E1QD 1CHGA 4F55A 1SMFE 3TK6A 1O2LA 2YMSC 3HK3B 4TWYA 2TPIZ 3TGJE 2BD5A 1GMHF 2A7JA 2F9VA 2QCYA 2ZDMA 3UY9A 3TVJB 1TA6A 5F8TA 2FX4A 1GVLA 4X2XA 5CHAB 3RMOH 4BANB 2W3KA 1X7AC 1HAZB 3Q76A 3UUZA 2FM2A 4WY3A 1UHBB 2ZPQA 2B0FA 7KMEH 1QQUA 3D49H 3FN8A 2WPMS 1TIOA 4I86A 3SNEA 4BTIB 5I25A 2QC2A 1P9UA 3MO9A 3A8CA 1ZJKA 2ZFFH 3A88A 1HAPH 3SJIA 4IW4E 3S9BA 1O0DH 1W0ZU 1YCPM 2BVXH 1ZMJA 1BMNH 1W8BH 3O8BA 5AHGH 1GBBA 4YXWD 1ANDA 1GBHA 2A4QA 2ZP0H 2WV5A 5KGOA 1BTPA 3RLYH 3VB5A 2BQ7B 2F9NA 2NWNA 4SGBE 1NESE 2WPLS 1D9IA 3TNSA 4NIVA 2KCAA 2OUAA 4K2YA 3RXOA 1SLUB 3SU2A 2Z7FE 5JBTA 2QIQA 4MG3A 2ZHDA 1C1TA 2VIDA 1DWDH 1QJ1B 7GCHF 4YTAA 1H8ED 1E1RD 1UVOA 1EB2A 1EPTC 1V3XA 4CBOA 3U69H 1NRPH 3ATMA 2CGAA 3GCHC 5TCAA 1SQAA 8KME2 4A5TS 4E7NA 3BTME 1OP8A 1N6XA 4U32A 1MKWK 3SJ9A 1K0HA 1DDJA 2ODQA 2ALVA 5FBEA 1FNIA 2Y7XA 3RDZA 3RXVA 6ESTA 4Y8ZA 4NGAH 4FUCA 1YPHE 5DP5A 5HM2A 1HDTH 4SGAE 1GG6C 2I6SA 4H4FA 5HGGA 3GY4A 2WYGA 5EPNA 3MU4A 4DOQA 3F6UH 1L1JA 3F9FA 1GI4A 2PHBA 4OS7A 5FCKA 2D2DA 3QGJA 1A5HA 1AKSA 1BRCE 2OC0A 2C8YB 2Q1JA 3N7DA 3KF2A 3MYWA 3AAUA 3LPRA 2B7DH 3SNDA 5K0HA 5E8EH 1TNLA 1GI6A 2XYAA 4HFPB 1YWUA 1ESTA 2FOBA 1FV9A 1HIAB 1C2KA 1DS2E 1O3MA 1QBNA 1QRWA 1UVTH 3V12A 4BAHB 1CHOG 1O3LA 1QBOA 2GCHG 1PPZA 5FX6A 2PGQB 1NT1A 1AI8H 4MQAA 4CRFA 1PYTD 4D76A 1G3DA 3S7HB 3F9GA 2Y80A 3BTKE 1UK2A 4WH8A 2R0KA 1IQHA 2GZ7A 3R3GB 1RTLA 4ZHAA 3PTNA 1NM6A 4FVBA 2STBE 3NCLA 2RDLA 2VWNA 3MU8A 1WU1A 3T25A 1UTMA 1AGJA 1ZTKA 1G36A 2DE9A 4XE4A 2RA0A 1K1PA 5IDKA 1LPZB 1O2IA 3EA7A 1D3PB 1EZSC 1O3PB 1GI3A 4B75A 2CV3A 3TH3H 4INKA 1EQ9A 1TYNA 1SGTA 1RJXB 4IBLH 5L30H 4NCYA 4X1RU 1FY4A 1AHTH 4AZ2B 3A87A 4IN2A 3KQEA 3I77A 3DCLA 1WYKA 5EQRA 3SGBE 1FI8A 3QZRA 2NU4E 1GBEA 5A8ZA 2FWWA 1J15A 2Q6FA 1GBJA 2QA9E 1QNJA 4CREA 2XC0A 1COWD 3GCTG 3ZZ4A 1VITF 2V3MA 4D9RA 2TGTA 2GP9B 1SOTA 3PO1C 3P92A 1QY6A 2FTLE 1PPGE 1DWBH 2ZI2H 2EA3A 3ZYEA 1AZ8A 3M61U 1C2EA 1O38A 2XBYA 2AFQB 1DITH 3TNTA 2J2UA 2NU1E 1QB6A 1NBME 1TB6H 1OP0A 1IHTH 2JDID 1THSH 3P8GA 3H5CB 4NG9H 3RC5A 5EU8A 3OSYA 2PLXA 2UUKB 2TBSA 4WXVA 2Y82A 5AFZH 2GDDA 1SC8U 1AIXH 1VJ9U 2ZPRA 3W94A 1SQOA 1C5TA 1HRTH 2EEKA 3F2FA 3IITA 1GBDA 3VXFH 2SGPE 2FX6A 4YT6H 2F4LA 1GHBG 4X2WA 1W0JD 1LVBA 1TPPA 1RFNA 1TQ0B 2IJOB 1ZPZA 1LMWB 2BLVA 5EXNA 1V6DA 3NPSA 3KHVA 5LPEA 2PWXA 3M5MA 3UNRA 1RD3B 4FOUC 1FXYA 2FTMA 4Y76A 1BJUA 1TX7A 1V2WT 2BLQA 3TH4H 1WUNH 3BTDE 2ZGBH 5EQSA 3E0NB 1XX9A 4RI0A 4P00A 1W10U 1SQRA 1SLXB 4ISNA 1DT2A 4LOYH 2AGIX 4XDEA 1CSOE 1YPMH 2BY8X 1E37B 1C2LA 3KQCA 1EAWA 3E8LA 4MNYA 1O32A 2BXUH 2QN5T 2A32A 2NU2E 2B9LA 4KGAA 1NFXA 1V2MT 4Q7ZA 3EA9A 1UCYH 2AEIH 2A2XH 3GY5A 5DPAA 2G4TA 3VB3A 1GHAF 3V13A 2W6ID 5C1XA 3RXUA 1P12E 1IQEA 5IK2D 1K9OE 2AIQA 1MU8B 1U6QA 2WHXA 3M7UA 2G55A 3KGPA 3WWFA 1P04A 1GI0A 3BG4B 4BXSA 3A7ZA 3WY8A 4OS4A 2FIRH 3JZ2B 1JXPA 1SGFA 1Z8RA 3HPTB 1HAYB 3DFLA 3SNCA 2BM2A 3U98H 4CRAA 1DVAH 2VWOA 2CF9H 2VIWA 3RMLH 1ELFA 3B8JA 1EAIA 4JCNA 2WINI 2IOTA 4INHA 2ZEBA 3EA8A 1CT4E 2ZIQH 3A7XA 3HKIB 2SNWA 2BDYA 3C1KA 2YMSB 3RU4T 5L6NH 1ACBE 2UUYA 4AGKA 3N99A 3SORA 1J17T 3BV9B 4FVDA 1BTYA 1RTFB 2ZKSA 1BRBE 2KX4A 1JOUB 1O2KA 2GCTC 3SZNA 1EJMA 1XVMA 2QV1A 3VGCC 4AC9A 1V2VT 1MKXH 2G5VA 1MABB 4Z0KA 1DOJA 2C93B 5JPMH 1IQLA 4A1XA 1S0QA 2XOKD 1TQ7B 1C2HA 1DWCH 1DXWA 3ZV9A 1TALA 3OU0A 3RXSA 2V35A 2XWAA 5T3HA 4OGYA 3ZZ7A 1TNKA 1GHWH 4NSVA 1NU7B 4NWKA 2OXSA 3ZYDA 1C2GA 2OC7A 4IMZA 4AYVB 1SGFG 4FUEA 1GL1A 1S6LA 3RXIA 1ABIH 1UJ1A 2UUFB 4B2CA 4DG4A 4RT1A 2ILNA 1O2MA 1SGPE 1VCPA 3ODFA 2FMJA 3RC6A 1KXEA 4B6EA 2K8IA 1O2SA 1DXPA 1TE0A 4ZCNA 3SO3A 4CBNA 1UK3A 4I31A 2W3IA 1NC6A 1Y3WA 1EPTB 3MI4A 2P93A 2VIPA 2CN0H 3GCHB 5AFYH 2Z3DA 5ESBA 2CMYA 1AY6H 5I46H 1GBLA 1MU6B 5ABWA 4E05H 1MZDA 2CF8H 3NZIA 3TLOA 4I8HA 2BXTH 4GPGA 4Y6DA 1GG6B 3FO8D 4KTCA 4OS1A 2F9UA 1P09A 1TFXA 2FPZA 2KR7A 2O9QA 4MLFB 5C5OA 3T62A 3T29A 4B71A 1JBUH 3GYLB 2QF3A 3SNAA 1ETRH 4UONA 1B0EA 2HVXA 2R0LA 3FP7E 4ACAA 4CRCA 8GCHG 4GCHF 5K7RA 1PQAA 3BSQA 3VB4A 2FXRA 3ZIAD 1AVXA 1V2UT 2SGFE 1NZQH 1ZRKA 1NFUA 3A7YA 2AYWA 1Q31A 2FI4E 2PTCE 4XBCA 1YLDA 2VIVA 1TBZH 5FXLA 1KTTB 1C5OH 1ETTH 1QRXA 4IC6A 4YOGA 4DURA 4I33A 1S6FA 3TITA 2A7CA 1UTJA 1Y5AT 1Y59T 2RDEA 1GMDF 3B9FH 1BZXE 3ZZBA 4ISIH 1QURH 2O8TA 1A0HB 1HGTH 2A0QB 1EKBB 3SU4A 4TPIZ 5GIBA 1P2QA 3PV4A 1E79D 1T8NA 1A46H 1TNIA 3LC3A 4JYTA 4X6OA 1JRSA 1ZYOA 3PWBA 1AVWA 1KXBA 2ZHEH 1G32B 3ENSB 2J34A 5DG6A 3PMAB 2AH4X 3DSGA 2FODA 1FZZA 1F5LA 1FLEE 1O2PA 2F9PA 3SUEA 2OK5A 2AS9A 4Y8XA 2PR3A 1ELGA 3F0PA 1HYLA 1EPTA 3UB0A 5F6MA 3UWJH 2FDAA 1NRRH 1BRUP 3STIA 1QL9A 1LHDH 3O8DA 1C4V2 1KXFA 3GYMA 4UD9H 2BDGA 5A2MH 1B0FA 1VZQH 1XUKA 2BDAA 1TGCA 4IGDA 4X0WU 2Z6BD 4KKDA 1OP2A 1LQDB 1FY1A 1THRH 3QN7A 1O35A 1AWFH 3KN2A 1BJVA 3BTTE 2LELA 3UNQA 1W12U 1GHZA 2GCHF 3FZZA 2XCNA 1BMMH 1GJDB 1VGCC 1GL0E 5HMAA 3PO1B 2VB0A 2XCFA 5ESTE 1PYTC 2FOHA 2VINA 2R2WU 2VVVA 2ESTE 1P10A 1P2KA 2ODPA 2NU3E 4FU9A 3Q77A 1MTWA 1O34A 4ZXYH 1AWHB 1LVMA 4NZQA 1K1OA 1O3OA 4DIIH 1TOCB 4UFDH 2BHGA 2ANWA 1EJAA 1HAGE 5HKKD 3DA9B 1O39A 3A8DA 1AFQC 1C5QA 2WPHS 1O30A 1MTNC 2JJ1D 2K1QA 1EATA 1V2RT 2JKHA 1T31A 3OYPA 3S9CA 2HRVA 1AD8H 3F2HA 9ESTA 1F7ZA 3OX7U 3B23B 1Z6EA 5EXMA 1C2FA 3TU7H 2SGAA 3K6ZA 3RXBA 1PQ7A 3VXEH 5FL7D 3GDSA 4NZLA 1YP9A 2BX4A 3P8NA 1O2TA 2V0BA 2WUCA 1HJAC 2OC1A 4DCDA 2GV6A 2EY4C 1ARCA 1MBQA 1WTHD 2SNVA 1T8LA 4F48B 3KNXA 1OYTH 1XVOA 4BXWA 2GVFA 2A7HA 1XMNB 3SI3H 1BTZA 2FOCA 3RXKA 3BN9A 1A1RA 4AB8A 3SN8A 2DE8A 3ZVEA 2GMTC 1J9CH 4BTTB 3UQVA 5LPFA 5E0JA 1TLDA 3DSOA 3VPKA 3T27A 3KQBA 3U1IB 5EW1H 5EW2H 3K6YA 3M5OA 3RXQA 1XUGA 3LJOA 1AKSB 3U8OH 2WPKS 4K5ZA 2WSSD 3MNXA 2BOKA 2FOFA 3PRDA 2V3OH 1L2EA 4CH8B 1XM1A 1GJCB 4HG6A 2FLBH 1YPJH 1O3NA 1GDNA 2UWPA 2XNIA 3MH7A 5LPRA 1H8IH 3AW1A 3ZVGA 5C67A 3RXPA 1O5BB 4B1TA 2OTVA 5J4SA 5A09A 2JH0D 3MH5A 2ZHFH
chains in the Genus database with same CATH topology
1CBWC 2D8WA 6GCHG 2GCTB 3VGCB 1S0RA 4AFUA 1MTSA 1RIWC 2FYRA 2HWLB 1NU9A 1AUJA 1CA0C 4D7GA 3LKWA 3UFAA 3L3TA 1HAVA 1C5ZB 1GJ5H 4ZKRU 4O03A 3MHWU 4JZIA 1HXFH 2GZ8A 2YNAA 5PTPA 3O8CA 2BD4A 1O2OA 1A4WH 2OBQA 4Y10E 5DP4A 1K1LA 1YPKH 4U30A 1GJAB 3MMGA 4NWLA 3FVFB 2R3UA 1EP5A 2ASUB 3SW2B 1NTPA 1JRTA 1TNGA 3M37A 1NRSH 3MNSA 2B5TB 1C1UH 1GI5A 3PYHA 2FI3E 2WYJA 2UUJB 1C5SA 2D1JA 1G3CA 1O31A 1W0YH 1IQGA 1RTKA 2JH5D 5JB9S 4R8TB 2ZTYA 3MOCA 4FU7A 1FY8E 2ZDAH 4MNVA 1FONA 1Z8GA 2AGGX 2ZHQH 2A5KA 2OBOA 2C4FH 4FUGA 1OS8A 4X8TH 1GJ4H 1KTSB 2OINA 2WV4A 3LGVA 1S84A 3GCOA 1EZQA 1YGCH 2IPHA 3I78A 1YLCA 3RU4E 4DY7B 3Q3XA 5L2ZH 1P57B 2ZGJA 3A82A 1O3DA 1Z1JA 3DHKH 4K1EA 6CHAC 3RM0H 3SU3A 1K28D 5F03A 2RA3A 1TPOA 1C1PA 2PKSC 3A8AA 5HYOA 1O3EA 1KSNA 1CVWH 1EASA 2QAAA 4JZEH 2Z9GA 3TK5A 1L1NA 1V2LT 2GGVB 1EAUA 1YM0A 3EGKH 3V0XA 3G01A 2XBXA 3K2UA 2ZQ1A 3GCNA 3QLPH 1OWHA 2ULLA 2R3YA 2QXIA 3GY6A 1M9UA 1P2OA 4A1VA 1O2YA 3A85A 1LPGB 1GMCF 2FEQH 3FANA 1O3KA 2UWLA 2VVCA 1PFXC 4WMFA 4X6MA 1DSTA 1IQJA 1A61H 1SFIA 1ZMLA 1G9IE 4AFZA 3UTUH 3A86A 1T8MA 4ABIA 3RXFA 1UCYK 3ZZDA 1O3AA 3TGIE 1A3BH 1O3CA 1NPMA 1GI7B 3ATIA 2F91A 1AN1E 3GY2A 1XXFA 2HNTC 1OWEA 2Z9JA 1H4WA 1FIWA 1FY3A 5ETXA 1QA7A 3TJVA 2ZU1A 3E90B 4LXBH 4D7FA 4MPVA 1DLEA 4YT7H 3F9HA 4WF8A 1ZOMA 3W95A 1LHEH 4THNH 1UTPA 2AMDA 5SGAE 3PMBB 1F0SA 2HALA 1ANEA 3RXDA 2STAE 3BF6H 2ZDLA 3V3MA 3A7VA 3RXAA 3PB1E 3UIRA 1N6YA 5DO4H 1O3FA 4AGJA 4ASHA 1E35B 2P8OB 1RRKA 4UDWH 4AORA 2AMPA 2ZECA 2BDBA 4FUHA 2PSYA 4AB9A 4DGJA 1OPHB 1C1WH 1DPOA 4O3TA 2GZ9A 1FY5A 1MKXK 3ZVBA 2BD9A 1VGCB 3SV6A 2C90B 2WPIS 4JK6A 1LQEA 2ZCLP 1BDAA 2W7UA 4Y0YE 2Z9LA 3EAJA 1V2TT 4OS6A 3MU1A 2XC4A 3SUFA 1QBVH 1SGIB 1GJ7B 4WJG2 4KP0A 1ELDE 3SV9A 5T6GA 1YC0A 2BY6X 3QK1A 1VCQA 5C3NA 1GMHG 1TRNA 2HGTH 2ZFRH 1BHXB 2FZZA 2B8OH 4NIWA 1AFQB 4NFFA 2BDHA 2BB4A 2BY7X 1CO7E 1MTNB 5C1YA 1TOMH 3LONA 1G3BA 1EJNA 2H9EH 1T7CA 2G4UA 2M5TA 2F3CE 3U9AH 2XWBI 1P2IA 1KLIH 1SGQE 2QXGA 3V7TA 1DM4B 1D6RA 4OS5A 1W11U 3QZQA 1TA2A 2NU0E 2ZPSA 1UTNA 1ZSKA 1WOFA 1GDQA 4AFQA 1CE5A 2R2MB 3AW0A 4HGCA 4JYVH 2VIQA 1ZSJA 1HJAB 4BOHA 1FQ3A 1GJ6A 2H5DA 2VH6A 4Y71A 5FHTA 4YLQH 2A5IA 2BQWB 1ELBA 1EX3A 1YPLH 3CS0A 2ZU4A 1J14A 1KYNA 3ESTA 1O2ZA 5GCHG 1IQIA 1F5RA 3FP8E 4J1YA 1Y3YA 3E16B 3KL6A 2BDIA 1D6WA 2KAIA 1CU1A 1EP6A 1UCYE 1GI2A 1SGDE 2JH6D 2GMTB 1ELAA 3GY8A 7GCHG 3MNBA 1TABE 2HNTE 3NUMA 4O97A 1LKAA 1FPHH 5B6OA 1C4U2 3SQEE 1GBMA 1P11E 1GJBB 3A7TA 4WMDA 2PTNA 3T28A 3LH3A 4F4OC 4F49A 1WBGB 3FFGA 1GJ9B 2XXLA 1MUEB 2Y6TA 3PWCA 2PKAA 2O8LA 3T26A 2A45B 1LHGH 4Q2KA 3DD2H 3LT3A 4UE7H 4ISOA 5JDUB 1P02A 1SQTA 1P05A 3LGUA 4FXGH 3ELAH 2Z94A 1GBAA 4YOIA 1QGFA 1O33A 5FPYA 3NWUA 3PROA 1EOJA 1CBWB 1OKXA 4X6PA 1AQ7A 1ZPCA 3GDVA 1RIWB 1CA0B 1JMOH 4X1PU 3URCA 1DSUA 3GISB 3S0NA 1YYY1 1QL8A 1QRZA 2P59A 1QB1A 4E7RG 4B73A 3P6ZB 1TRMA 2G8TA 4ZKSU 3VB6A 1O5AB 3A84A 3ODDA 2BYAX 3HK6B 1W2KH 1O5DH 2H6MA 3P8FA 4MVNA 2QY0B 1Q2WA 4YZUA 3TJOA 1C2DA 1HLTH 3ATLA 2VH0A 1P8VC 2ZDVH 3TJUA 1GJ8B 1BA8B 5E0HA 2BVRH 1S6HA 4KTUA 3KEEA 4X8VH 1ANBA 4TPYA 1UVPA 3BTEE 3U1JB 1YKTA 1O3GA 5C2ZA 2ZFTA 1DUAA 1BQYA 3E6PH 3S69A 4ESTE 5A0AE 1V2KT 2VVUA 3UPEA 4GVUA 4BNRA 1BT7A 5FPTA 1C1QA 1O2VA 5E2OA 5DKMA 1K21H 3TPIZ 6CHAB 1F0UA 3SHCH 3OY5U 2Z9KA 2CHAC 1HCGA 4FUJA 1C1OA 5EGMA 4GAWA 1TGSZ 2FI5E 2PKSB 2HNTF 1Q3XA 4JZ1A 1LHFH 2BD7A 4YLUA 2G51A 1VITG 2Y5FA 2JETB 3A80A 3K65B 3TH2H 9LPRA 3MU5A 1AE8H 5A8XA 2FO9A 1UK4A 4IS5A 1GI8B 1ABJH 1SLWB 4MNXA 3GY7A 2Z9IA 4AX9H 2P95A 3C27B 2HPQH 1TPSA 2LPRA 1PPCE 1FMGA 4DJZB 1C5MD 1S85A 2OQ5A 1N1LA 2O8UA 5HM9A 1QTFA 2ZHWH 1G2LA 5DK1A 1SHHB 4MDSA 1P06A 1BUIA 1VJAU 1IHSH 3QWCH 1MBMA 1ETSH 3AASA 2A2QH 4IC5A 5FCRA 3HGNA 1F0TA 5EPYA 1Y3UA 2VNTA 1XKBC 1DX5M 2FYQA 3SHAH 4J2YB 1L0ZA 1ZLRA 4ISHH 3UQOA 2GT7A 1ZSLA 4B2AA 1C1RA 3RMMH 1A5GH 5JYIA 1DY8A 3BG8A 1QL7A 3E3TA 4B2BA 2BY5X 1OWJA 1IQNA 1C1SA 2GX4A 3MFJA 1P2NA 3PLPA 3RXCA 3N7OA 2CJIA 1G37A 3LGWA 4RKJB 2P8OC 3LJJA 1ESBA 4ABAA 3LDXH 1E34B 1CGIE 3QX5H 1CHOF 1MAYA 3E0PB 4JZFH 2VU8E 1OYQA 2VJ1A 1J16A 2QYIA 2Y5HA 3ATKA 2PW8H 1MZAA 1GHAG 2P16A 1CT2E 4ISLA 2GT8A 3PLKA 3LGTA 3DFJA 3M3TA 5F8ZA 3A83A 3SNBA 1GVKB 4AG2A 4AN7A 1B7XB 1KXCA 1BTUA 3UOUA 5GJ4B 1ZGIA 1GBCA 1NS3A 4JK5A 4WMEA 2ZG0H 3SU5A 1N8OC 2ZGXH 1DE7H 4Y7AA 2RCEA 5FX5A 2ZFSA 2AIPA 3HGPA 3LGYA 3MO6A 1AMHA 1TMTH 4OS2A 1C1MA 1TGNA 1PPFE 1LHCH 1TX6A 1JWTA 2ZF0H 4I8JA 1GBKA 3P70B 3HATH 1LTOA 4WXIA 1SGCA 3QTVH 4HZHA 1HAVB 4Q7YA 2ZWLH 3H7OA 4FUIA 4RSPA 1NRQH 1Z7KA 5EOKA 2Y7ZA 3QTOH 1LPKB 3A7WA 5TJXA 4A6LA 1PPEE 3BTQE 1EAXA 1B5GH 1W7GH 4DIHH 4YESB 1S5SA 5EG4A 4Z6AH 1YPHC 1IAUA 3BTFE 4ZMAH 2H2ZA 1DANH 2G5NA 3GCTF 2FOAA 1HB0B 3NK8A 2J94A 1OWDA 5L2YH 3R0FA 1A5IA 3ZZ3A 5BRRE 1KXDA 3S9AA 3CS7A 3M35A 1P0SH 1ELVA 2CXVA 1GHVH 3SGAE 3PTBA 1MTVA 1S83A 1C5NH 3BEIB 1GBTA 4A7IB 4UEHH 2J95A 3CP7A 2BOHB 4NA9H 1ZGVA 1K1MA 3MNCA 2SGEE 1ELTA 5DGJA 5A8YA 1BBRK 1O5CB 5JB8S 1MQ5A 1P01A 2FOGA 2OQUA 1Z71A 4NIYA 1GHBF 2XRCA 4X1QU 8ESTE 3RP2A 3URDA 2G81E 2J9NA 1T4VH 2G52A 4ZUHA 1G2MA 1HAIH 1ZHPA 4LK4A 1DFPA 2A1DB 3GDUA 1KIGH 1P2JA 4LZ1H 1C1NA 5CMXH 2OP9A 5DP3A 2ZGHA 1P2MA 3LGIA 1V2OT 1YPGH 3D65E 1BITA 1O2GH 2Y81A 1W3CA 3RXMA 3SV7A 3MO3A 1BTHH 1FIZA 1KDQA 1FN8A 1QQ4A 2RG3A 3GY3A 5EODA 2XBVA 2SGDE 1G30B 1FAKH 2F9OA 2FLRH 3RXGA 1NY22 4ABEA 4BAKB 3TK9A 2BY9X 1SFQB 1T4UH 1Z1IA 3HKJB 4DT7B 1O2RA 2IN2A 5H4IB 1E38B 1HJ9A 1K2I1 3Q00A 4GCHG 2ZFQH 1SHYA 1VITH 2BD2A 4YOJA 2ZU3A 3BEFB 1ZZZA 2P3TB 2A5AA 1LCYA 1BB0B 1JIMA 2H1UA 1E36B 2OC8A 4GSOA 5GCHF 2FOMB 1XUFA 1CQQA 1K22H 1ZMNA 3SI4H 2ZTXA 5JBAS 1GMDG 1XKAC 4HI3A 4MNWA 5C1UA 1L1GA 1THPB 4TYDA 1S81A 3SBKA 1GWAA 3UWIA 1AE5A 1GDUA 1OXGA 1W7XH 3E91A 5T6FA 5IYTA 2BZAA 1V2NT 4GUXA 4K8BA 1TONA 4NSYA 4D8NA 2PUQH 1MCVA 1ELEE 1WCZA 1BBRH 4XBDA 1SPJA 7LPRA 1YCPH 3TIUA 2ANMH 1SGEE 1Z8IB 1EZXC 1MTUA 2ZFPH 4UFFH 4XFQA 2JETC 2PUXB 1AO5A 2ZCHP 5GDSH 4WH6A 1MQ6A 1BTWA 1O5EH 1O5FH 2ZDNA 3GICB 2ZCKP 1PJPA 2V6NA 3SJKA 1GHYH 1MH0A 1V2PT 1XUHA 1UHBA 3EDXB 2C8XB 2CHAB 1LO6A 2P94A 3ZZCA 1INCA 1J8AA 4H42U 1GCTC 1VCWA 1WSSH 6LPRA 1RS0A 3M7TA 4MPUA 5FAHA 1FN6A 4TY6A 3U8TH 3BIVH 3VFEA 3PM3A 2ALPA 1BBRE 4X2YA 3UR9A 1CA8B 1WV7H 1WAYB 3RXTA 4A92A 4ABJA 1GI1A 3RUOA 1TPAE 4X1NU 1C5RA 2H5CA 3RLWH 1C2IA 1DY9A 1SI5H 1A0JA 1K1NA 3ZVDA 4VGCC 4ZAEA 1O2HA 1Y5BT 1LKBA 1IQKA 1W14U 2A4OA 4CHAC 4X6NA 1KY9A 4TY7A 3DUXH 1GI9B 1MD8A 1SB1H 1GGDC 5G4BA 1TGBA 4I8KA 1SR5C 4ZKOU 8LPRA 2W7SA 4NIXA 2VGCB 2ZC9H 1O3BA 1MAXA 5DP7A 1BHXF 1AVGH 4K1TA 1YPEH 1ZTJA 1JIRA 4B76A 4AFSA 1H9LB 1YF4A 1C5PA 3GOVB 2HOBA 4K8YA 2D26C 2BX3A 2ZTZA 5CE1A 2KAIB 1C5LH 1GPZA 2LNCA 4BAOB 3NXPA 3NKKA 4AG1A 8GCHF 3AVZA 2J38A 4DW2U 1MKWH 4IN1A 4JYUH 3KQDA 3RU4D 1C5UA 3Q3KA 3ZVAA 2F9BH 2H9HA 1L4ZA 1XXDA 3Q3YA 1HXEH 1H1BA 1O37A 3VB7A 2OD3B 3MTYA 1BRAA 4O9VA 3MWIU 4LZ4B 1A2CH 1SSXA 2PKAB 5DP9A 3BEUA 1Z6JH 3UREA 3LIWA 3P95A 1AUTC 3ZVFA 2Q6DA 2XBWA 3F68H 1O2WA 4HTCH 1SLVB 3RXHA 1KLTA 1HIAA 2EI8A 1HAOH 3IG6B 3SQHE 1UTQA 4FUBA 1O3HA 1TMUH 2EC9H 1O2UA 1N8OB 3MU0A 3ZZ9A 4I8LA 5BPEA 2XTTB 1PQ5A 5JBCS 2ZO3H 1AB9C 2GKVE 1D4PB 1BMAA 2TIOA 2PSXA 1VR1H 1DUEA 2C8ZB 2BMGB 1HV7A 2FS9A 4YO9A 1WTGH 4KTSA 1C5WB 2O8WA 3D62A 1TBQH 4ABHA 2AERH 1IOEA 1KXAA 1H9IE 1S82A 2ANKH 2ZDKA 3RC4A 1SL3A 5FPSA 1P3CA 4INLA 3KIDU 2QXJA 1O36A 3SGQE 3RXLA 1T32A 2BLOA 5J4QA 1LVYA 1HUTH 1F5KU 1QCPA 4Q7XA 4GLYA 1CGHA 1PQ8A 3U8RH 3SJ8A 1ZTLA 1BCUH 5DJ7A 4CRDA 3ZVCA 2P3UB 3TGKE 1OSSA 3T5FH 3PLBA 1KLJH 1TRYA 4Y11E 3EYDA 1LVOA 5E0GA 2PV9B 1FAXA 3P8OA 5GPIB 2GD4B 3PMJA 1SGNE 3I29A 3L33A 5TCCA 3IWMA 1P9SA 4Q80A 2J4IA 1DICA 5CHAC 1OX1A 1TAWA 3SU6A 1P3EA 3MH4A 4Y79A 3M3SA 4O3UA 4X8UH 3SUGA 5C5NA 2W5EA 2A4GA 1SGYE 4CH2B 2ZU2A 3RMNH 4ABFA 1C5XB 1T8OA 5AF9H 3ZZ8A 3SU1A 5C20A 1ZHRA 1A3EH 1W13U 1Y5UT 4B74A 1HAXB 5GXPA 3F1SB 4BTUB 5AVDA 2XC5A 1ANCA 1GBFA 4KELA 1O2NA 4X2VA 2WUBA 4K3JA 3PMHB 1PPHE 2PGBB 2FP7B 1QHRB 4XBBA 4I32A 2BDCA 1TWXB 2F83A 1QB9A 1UO6A 4ZHMU 1NFYA 1ARBA 1AZZA 2A31A 2BVSH 1ELCA 1UTKA