2LELA

Structure of cu(i)cu(ii)-copk from cupriavidus metallidurans ch34
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Copper resistance protein K
publication title Molecular basis of the cooperative binding of Cu(I) and Cu(II) to the CopK protein from Cupriavidus metallidurans CH34.
pubmed doi rcsb
source organism Cupriavidus metallidurans
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2lelA00
2LELA 3DSOA 2KM0A 3N7DA 3N7EA 3DSPA 2K0QA
chains in the Genus database with same CATH superfamily
5L2ZH 2GZ9A 1IQGA 1CBWB 1QB1A 1THPB 3LPRA 1FPCH 1T4VH 2P3FH 2SGDE 1K1OA 3RMNH 2G5VA 1Z1IA 2ZEBA 4ZKSU 1XUFA 3RXLA 3A83A 1A0LA 4K8BA 2BVXH 1NFXA 1YPGH 2OXSA 1TFXA 2HPQH 1E1RD 1DWBH 1VJ9U 2FX6A 2GTBA 4KELA 1SGFG 2FOEA 3RXKA 1TX8A 4ESTE 5E0GA 4XE4A 4DY7B 1VITH 3PWBA 2VNTA 1NROH 4OGYA 3M5OA 4HG6A 3EE0B 1GBMA 1SQRA 1MMJN 3BG8A 4NIVA 5DGJA 3BTFE 3P92A 2OBOA 8GCHF 1BTHH 1ORFA 4Y8ZA 2O8LA 1JRTA 4CRDA 1D6RA 3P8FA 1P02A 1O5DH 1FX0B 1FY5A 1V2MT 4O3UA 1NC6A 3A8AA 4O97A 4LZ1H 3NRLA 1ESAA 3WWBA 4Q80A 1C9PA 2ZU2A 3GDUA 4DURA 5JDUB 2FOAA 2BHGA 1GI0A 4YT7H 3ZZ6A 5I25A 3H09A 5FPSA 4NSVA 1GHXH 4X8VH 1LPKB 1QCPA 1GMDF 2WZQA 3OFND 3QX5H 2PUXB 5FPYA 3UNSA 5GIBA 2B8OH 1HAPH 2V7QD 3ZZCA 2YMSC 1ZPBA 1OPHB 3KYGA 1O2QA 1C1TA 1JXPA 1RIWC 1BBRE 2QE7D 1FI8A 2ZGBH 2A2QH 2TGAA 2ZFTA 4I32A 3PM3A 2RCEA 1ZJDA 2STBE 3RXTA 3QGJA 2A4OA 4R8TB 3F9GA 1T8MA 1A5IA 1V2OT 3CS7A 2GDEH 2GKVE 2BLQA 3T27A 1AFQC 2FYQA 4WJG2 8KME2 1CA0B 3PMAB 4D9RA 3IG6B 1OP8A 1TMUH 2FLBH 2ZI2H 4B74A 1F92A 5EW2H 2TGTA 1G32B 2UWOA 1FDPA 1GBCA 3FN8A 3V0XA 3QLPH 3RXDA 4LZ4B 1GJ9B 3VXFH 1TBZH 4NG9H 1JOUB 1GBEA 4TY7A 3UUZA 3PO1C 6GCHF 3BV9B 1P10A 2AFQB 1GI8B 5A8YA 1ACBE 1WQVH 3RC4A 1IQIA 5FX6A 2BY7X 4ZKRU 1QL7A 1UTPA 1O3MA 4FU9A 1SQAA 1O2GH 4OM9A 1S83A 2BDYA 1FN6A 3SJKA 1ZTJA 4IC5A 3S69A 4FUCA 1C1UH 1XUIA 2PKAB 5SGAE 2GT8A 1U6QA 4JZ1A 4R0IA 3ZZ4A 1FIWA 1BBRH 4WWYA 2Z6BD 5HM2A 3BTME 2IJOB 3OTPA 2XCFA 3F6UH 4IGDA 3UQVA 1QQ4A 1LPGB 3OE7D 3D62A 1O3LA 1F7ZA 3IWMA 1XXFA 4IS5A 4J2YB 1B5GH 3Q3KA 2UUYA 3ATMA 3L3TA 2G81E 2C8WB 1TRYA 2FOMB 3LC5A 1WV7H 1AIXH 1O2HA 2QXGA 1B7XB 2A7HA 2IOTA 1BB0B 3E16B 3T26A 1JBUH 3BTEE 1N1LA 1MTVA 2BDAA 1C5RA 4DG4A 2HALA 1SGIB 1XUKA 2BB4A 1C1RA 5FBIA 4ZHAA 2HVXA 2Z9GA 4INKA 3SJ9A 1QFKH 1KYNA 4ABAA 5EJLA 5PTPA 4Z1MD 1CQQA 1GI1A 1XMNB 1UK4A 4WH8A 4HFPB 4AB9A 1GWAA 1DFPA 1L1NA 2P8OB 1BMNH 3EA8A 1HUTH 3N7OA 2PSYA 4AG2A 3EDXB 7GCHF 4GCHF 2BVSH 2ZKSA 3DA9B 3FO8D 4X1SU 2LELA 3LGTA 1TOMH 1GVZA 1L4DA 1F0TA 1B0EA 1P2NA 4B73A 5EXMA 4CRCA 4D76A 2J98A 1VITF 1ZLRA 1GI3A 2BXUH 2VH6A 2ZHQH 3NCLA 5DP4A 1KLTA 1Z8RA 5T6FA 4CR5A 1HJAC 1O2ZA 3A8DA 4CHAC 4YLQH 1HXFH 2AIQA 2ZFRH 1A1RA 3ZVAA 3PB1E 7LPRA 2A5IA 1QBOA 5EQRA 1NZQH 1H9LB 5C3NA 1J17T 3MMGA 1XM1A 5ESTE 2R3YA 3UWJH 1K0HA 1H1BA 2AMDA 3HKJB 2J4IA 7KMEH 4X8TH 4K5ZA 1WU1A 4X2VA 2AGEX 3ZVDA 5FPTA 4SGBE 1ESBA 1GDQA 3ZVFA 1AKSA 3SW2B 2BZ6H 2QA9E 1BRAA 6ESTA 3RXQA 1O33A 1W7XH 1O31A 2GCHG 1JWTA 2FESH 3N99A 1O3NA 1UVSH 4UD9H 2VGCB 4DIHH 1D3PB 1GGDB 1QBNA 3TJVA 2BLWA 3FAOA 2XBXA 4FUBA 1HAVA 2ASUB 3BTKE 3F9HA 3SHAH 3U8TH 3SNBA 3PYHA 2ZQ2A 1RTFB 2B7DH 2GD4B 1G2LA 1T8LA 1EB1H 1FLEE 1O3EA 4DT4A 3A88A 3M35A 2V3HH 1HFDA 1RRKA 3C27B 3LOXA 3WY8A 3ZIAD 1O3KA 2GMTC 2WV4A 3PRDA 3U69H 2VWNA 1O3JA 1CT2E 2CXVA 1SLUB 2PWXA 1GBAA 1O32A 2CHAC 1C4Y2 2ZDAH 4JK6A 4NIXA 2CV3A 3DHKH 1CGHA 3W95A 1M9UA 4INLA 4WVPE 4B76A 1WXRA 3E0PB 4I8HA 3BF6H 3SNDA 2PW8H 1C2EA 4GSOA 4E06H 4ABBA 4JYTA 1AWHB 3SU2A 2KR7A 4ISOA 1W7GH 1INCA 1ZTLA 1NU7B 3PMHB 4YOJA 2XNDD 1V2LT 2BX4A 1KSNA 2FO9A 1GJ4H 3PLKA 1IQMA 1GBJA 1YP9A 2FOBA 2W5EA 1DY9A 1MH0A 2GZ7A 1YC0A 4ZKOU 1E36B 3BTQE 3GCNA 3ZVEA 1UVOA 1XX9A 1Q31A 1JIRA 2H5CA 2SGPE 2PUQH 1GHVH 1E1QD 1TLDA 4UFGH 4B2AA 1OWHA 1O2YA 1FY3A 1GG6C 2HNTF 3SHCH 4ABHA 4ISLA 3QN7A 4JZFH 4TWWA 5ESBA 5EJZA 1LCYA 2W3KA 2BD4A 5FBEA 3M7TA 1NS3A 5HGGA 3RU4T 1YLNA 4RT0A 3Q76A 2CMYA 2XOKD 4OS1A 1FV9A 1ID5H 4J1YA 3MH4A 3ZVCA 4A5TS 2FI5E 1GJAB 1V2VT 2H6MA 2WPLS 2VVVA 1PFXC 1OXGA 3SUDA 1CGIE 2JKHA 2ZPRA 2WHXA 4DCDA 2IJD1 1OYTH 3FP7E 3RMMH 1AFEH 1P2JA 1OP0A 2VIQA 1ZGVA 1GI2A 2F91A 3PWCA 3RXEA 1GCTB 2XC5A 3L33A 1H8HD 1W0ZU 3E6PH 2F9UA 3KQCA 2FODA 1EASA 1MKWK 3F9EA 4X1PU 3S7KB 1GBDA 3RXRA 1GHWH 1VJAU 4D7FA 4LOYH 3EE7A 2ZGCA 2VJ1A 4X1QU 4Y6DA 4BANB 5KGOA 1EAWA 3TK5A 4INHA 3MO3A 2OD3B 1ESTA 3QZQA 3SUFA 2QGRA 3PV2A 3HK6B 2IPQX 5K0HA 3RXAA 4YOIA 1GMDG 2O8TA 1ELGA 1FIZA 3ZVBA 4WXVA 3UAIC 5TCCA 4XD7D 3KEEA 3NKKA 3S7HB 1AB9C 1MTWA 1KXAA 1C2LA 2G52A 3QO6A 2TGPZ 3VXEH 5B6OA 3LDXH 1H9IE 4H4FA 3UPEA 3SU5A 3DD2H 4K1EA 2SGAA 1HAGE 1DLEA 1O3PB 1UJ1A 1EZUC 4YM9A 2FOCA 3GICB 5FCRA 2BY6X 2WSSD 1TIOA 2NU4E 2A0QB 2M2AA 2W7UA 5FAHA 3RXGA 3GS9A 1MUEB 2FX4A 1X7AC 2J2UA 1PPFE 3RXOA 1TGTA 5E2PA 1TPPA 1D4PB 5B6LA 2ZO3H 5EG4A 4X0WU 2OC1A 1GVKB 2B9LA 1KXEA 3ZZBA 3F0PA 1OHHD 3SV9A 2FI4E 5HIYA 3U8RH 2TIOA 4Q7XA 2XC0A 3UFAA 1CBWC 1T31A 1E34B 5DK1A 2WUBA 1UO6A 2V3OH 1HAIH 2ZDKA 3NZIA 3VGCB 1GBIA 1THSH 2EQNA 4Y8XA 1P2KA 3MTYA 3SORA 3DSOA 1J14A 1O2LA 4NWLA 1BIOA 3M3VA 3M5MA 5KECA 1MTNB 3TH2H 2FS9A 2J97A 3M36A 1NT1A 3BTDE 1SLVB 1DWDH 3M7QA 3MU5A 2FLRH 4NA8A 1CO7E 3FVFB 4JK5A 2CK3D 1W11U 5J4SA 1SPJA 1O5AB 4NGAH 3TIUA 1P11E 2K1QA 1Y5AT 1DLKB 3GDVA 2A7CA 3MFJA 1WTGH 3P8NA 1QB6A 1GJ8B 1C5LH 1NRQH 1EAUA 4OGXA 2AHME 2CGAA 3EAJA 1A3EH 1IHSH 1CA8B 3A7WA 3K9XB 4KGAA 4F4OC 2H5DA 1C1QA 1DS2E 2HWLB 2GCHF 1L2EA 1W3CA 2A4RA 8ESTE 1K1LA 3MU1A 5GWZA 1SGRE 2VWMA 2VWLA 2KX4A 2PP6A 2Y7XA 3SNAA 2YNAA 3V7TA 2ZDMA 2KAIB 4IMQA 1S85A 3Q3XA 2VVUA 1PPCE 3LIWA 1EJMA 1CHOG 1O3AA 1V2NT 1RXPA 4GPGA 5HIZA 4DGJA 3BN9A 3P6ZB 5C1UA 2BVRH 1UVUH 2TGDA 3UR9A 4X8UH 3ZZ9A 1UCYH 6LPRA 3NPSA 4CRAA 2K0QA 3HK3B 1AKSB 5ABWA 1S6LA 1Y3WA 5C1XA 1ETTH 1GI7B 3RXCA 1TALA 2WYGA 4BTUB 2WPMS 3RM2H 1K1MA 1LDTT 4GCHG 4SGAE 2Z3DA 2FIRH 3VG8A 4DIIH 3GY3A 3TGIE 5EPYA 4ACAA 4F48B 1HIAA 1MQ5A 1CA0C 2WPJS 4AORA 1GDUA 1IQNA 4M7GA 1HAVB 1VITG 2JJ1D 1XKBC 1AI8H 1OWKA 2BLOA 3HPTB 4KTCA 5DP8A 4TT3D 2AIPA 4KP0A 1K1NA 1QRXA 1TPAE 5HKKD 1AWFH 2XBWA 1FMGA 2VIWA 2J9NA 2JH5D 3P8GA 2ZHDA 4U01A 3VB3A 1BMFD 1PYTC 1AN1E 1QBVH 1S81A 1UK2A 4B71A 1GL1A 1C5TA 1P3CA 1QQUA 3BTHE 5JB8S 1SHHB 1YCPM 3M5LA 4GLYA 1Z7KA 2XYAA 1C1PA 4NFFA 2WPDD 2BDHA 2BY9X 2UWPA 2XW9A 4A92A 1O2WA 2ODYB 1GJCB 5FCKA 3OAAD 2OP9A 3U9AH 1D3QB 3M7UA 4B1TA 4FVDA 4FOUC 1EOJA 1EJNA 4NSYA 1N6YA 2ZCLP 5CHAB 3AW1A 3PLBA 1BRBE 2PKSB 2PV9B 2W6ID 2AH4X 5C0TA 1GJBB 3LC3A 1GHZA 1PPBH 3ZV9A 1OP2A 1SHYA 1ANBA 1B0FA 1XUGA 1A7SA 1YPHE 2V0BA 1C1OA 1HAZB 1TQ0B 2C8XB 1O39A 2A32A 1DUAA 2SGFE 2H9HA 1P12E 3R0FA 1SR5C 1P05A 3ODFA 2WV9A 3EA9A 1EXFA 1SKYE 2AYWA 2A2XH 2HPPH 3RXIA 5A8XA 1T7CA 1DY8A 4TWYA 4GHQA 3OX7U 1C9TA 1HLTH 1QB9A 1ELEE 1G2MA 1A61H 4B6FA 1QL8A 1O2SA 2J34A 2PGQB 1KXDA 2CJIA 1CVWH 3TITA 1AVXA 1E0FD 3C1KA 2PHBA 3MNXA 2VBCA 2GCTB 3STJA 2D1JA 4UE7H 1C1SA 1SGPE 4E05H 2P8OC 1NY22 3RU4E 2LP6A 3SZNA 1MU8B 1TQ7B 4LXBH 4MLFB 3S9BA 3ATIA 1C2FA 1LHFH 1Z71A 1MZAA 1Y3YA 2PR3A 2ZHEH 3KQEA 1K22H 2H1UA 2Z9JA 4MPWA 1MBMA 1ZSLA 6CHAC 2VH0A 3Q3YA 4I8LA 4CRFA 4XBCA 1IOEA 2BD8A 2C8ZB 3R3GB 5EJ1A 2ZU1A 4NWKA 1MAXA 3MU4A 5GCHG 4WMEA 4I8JA 3T5FH 5DN6D 1HGTH 4MVNA 5HMAA 1DPOA 3SJIA 1O2JA 3DFJA 3A85A 1VCWA 1MKXK 3T2NA 5F6MA 2RA0A 2ZQ1A 5F03A 4Q63A 4BXWA 3BIVH 2Y6TA 3RUOA 4IMZA 3BG4B 3SYJA 2Q1JA 1N8OC 4P02A 3V3MA 2A5KA 2UUJB 1AU8A 1UVPA 2G4TA 4JCNA 2HNTE 4U2WA 1MTUA 1MD8A 2G8TA 4BAKB 5TCAA 1Y59T 5I46H 2GJGA 3GISB 5GDSH 2ZFQH 3KIDU 4A1TA 1COWD 3A84A 1AZZA 3OEED 4FUHA 2KCYA 1GMCG 4YLUA 2OC8A 1L1JA 1YYY1 1S82A 3O8RA 2VGCC 1H9HE 3UIRA 1GGDC 1AGJA 1KIGH 2ZDNA 4AN7A 2PTNA 3S9CA 1Z1JA 5T1VA 1EZSC 2ZU5A 1OKXA 1ZPZA 3SNCA 4OS2A 3MU8A 1BJUA 1SQTA 1C2DA 1F5RA 1UTOA 3TK9A 2Y80A 3ATWA 1EZXC 1DANH 1G3DA 2ZA5A 1QY6A 2LPRA 1LTOA 3A8BA 2BY5X 2TRMA 4RT1A 1IQLA 5DP7A 1LVMA 2Y7ZA 1RTKA 4ZMAH 2BYAX 2L74A 1YPLH 2GV6A 3GCOA 1TGCA 1YCPH 4X6MA 2EI6A 2KCAA 1BTWA 2BX3A 1OYQA 1O0DH 4X8SH 1GHBG 4ISNA 2P93A 3BEUA 1P2OA 3SGQE 1HJ9A 1RTLA 1TBQH 1O2RA 4ZXXH 4TPYA 4A1XA 4BAMB 2BLVA 3E1XB 1KMHB 3JZ2B 3M61U 4K69A 5CDFE 1DOJA 5FL7D 1OOKB 3RXMA 3U1JB 1SMFE 4CRBA 4B2BA 3UWIA 1CHOF 2I6QA 4K3JA 1T4UH 1BITA 1AVGH 3O8CA 4Y0YE 1TA6A 3MO6A 4YXWD 5LGOA 3KL6A 1EAXA 1BZXE 1BTXA 1GBTA 1SGCA 4F49A 1W13U 1Y5UT 5C67A 3BTWE 3VB5A 1AHTH 1FY8E 2ZFSA 3KCGH 5K7RA 1OWEA 3RU4D 2RFKC 2THFB 4XRNA 1A5GH 2QF5A 1BMAA 3O8DA 1HPGA 3A8CA 3LGIA 1HNEE 4DW2U 3UNQA 4GVUA 5T6DA 4FUFA 2ZWLH 1C2MA 1C5UA 1OX1A 2C8YB 1PJPA 1HRTH 2P3TB 2ZTXA 5FXLA 2BY8X 2ZF0H 5AFYH 4A6LA 1O3IA 1TONA 2BXTH 1A0JA 3FFGA 4IN1A 1BRCE 1G37A 2AMQA 2C90B 2KAIA 1XVOA 1SGQE 1F2SE 1O5BB 2VIOA 3PROA 1GCTC 2A7JA 2R0KA 4BTTB 4NCYA 1ZR0A 4I86A 1G3EA 1QJ6B 1E37B 1DX5M 5E0JA 2JETC 1F0UA 2F9NA 1HIAB 4OS5A 1UTQA 2FPZA 2QY0B 1ABIH 5FHTA 1YKTA 1C5SA 1O3GA 3GY4A 1LHCH 1C1MA 2B5TB 3K65B 1YBWA 3KYFA 5JYIA 3MQKC 5L2YH 1MCTA 2F43B 1P2QA 1HCGA 4VGCB 3U1IB 5GXPA 3LH1A 1XUJA 1VCQA 1ELFA 1K2I1 1ZRKA 3HGNA 3ELAH 1CSOE 1LHGH 1TNIA 2C3SA 4THNH 2WYJA 2W6JD 3ZZ3A 1FXYA 1P09A 3TH3H 5FX5A 2Z3EA 1DSTA 2OINA 5IK2D 4FVBA 3K2UA 1W12U 1BRUP 3RXUA 2ZTZA 1O38A 2ANYA 1OWJA 1QA0A 1G9IE 1O2KA 3UR6A 4AGJA 2SGEE 3O8BA 1IQEA 1UCYK 3F2FA 2D26C 2C93B 1ELDE 3GY5A 3SQEE 1UTLM 1SG8B 1SGTA 1V2WT 5T3HA 1HAOH 2STAE 4X6PA 3PMBB 1T8OA 3SNEA 1PPEE 4B6EA 1GI6A 2Z94A 1G3CA 4E7RG 1W0JD 4WY3A 1OSSA 2F9BH 2QCYA 2XWBI 1EPTA 1GJ7B 1PPZA 3TLOA 3P70B 4DJZB 2FEQH 1FZZA 2F9OA 2QC2A 2XC4A 2HLCA 3A7TA 4IW4E 1C5OH 1TPSA 1NPMA 1KXFA 3ZZDA 3VGCC 1Z6EA 1SC8U 5GCHF 3E8LA 1MTNC 3F1SB 2W3IA 1L0ZA 1O2MA 4AYYB 1YPKH 4B75A 1NRNH 2YMSD 4Q4LA 1QRZA 1SSXA 3P95A 2TPIZ 3TJUA 3G01A 4FUJA 4D9QA 5AVDA 1BTPA 1Z8IB 3T29A 1XVMA 2A5AA 2P16A 2WV5A 2FOFA 2F3CE 2GZ8A 3N7DA 1UK3A 3A7ZA 5C1YA 2ANKH 2CF9H 3TVJB 3RC6A 3AAUA 1NBMD 1HAHH 2M5TA 3SQHE 1UTNA 1J15A 2OTVA 9LPRA 1GMCF 1UVTH 3H7TA 1K1PA 1DVAH 2FOHA 4O9VA 4ABDA 4AZ2B 2EI7A 1MBQA 3SU0A 2QV1A 3DCLA 1ZTKA 5C94A 5L30H 5LH8A 2NU0E 4ASUD 4K8YA 1MABB 1WTHD 2VIPA 1LVBA 4ZH8A 4XFQA 4UFEH 2I6SA 3V13A 3VB7A 3F9FA 3OTJE 4BAQB 1TABE 3SJ8A 1P01A 4ZHLU 1YY3A 1C4U2 3SN8A 3LKWA 1SGFA 3SV8A 5JBTA 3QZRA 4BXSA 5JPMH 2ANMH 2EY4C 4U30A 1QTFA 1QA7A 1A2CH 4FU8A 5EIYA 2FYRA 2XCNA 2IN2A 2HLDD 2GVFA 4FETA 1GHBF 1TA2A 1EZQA 3S9AA 1TGSZ 1EB2A 3B23B 1UMAH 3LGYA 1O36A 1SGNE 5HXFA 4BAHB 4O3TA 2OCVB 1C2HA 1D6WA 4Y79A 4ABIA 5AF9H 4ZKNU 3SBKA 4DOQA 3IITA 3GOVB 3V12A 4JYVH 3TPIZ 3HATH 1ELBA 1CE5A 4ZHMU 3GCHC 2Q6DA 3LONA 3ODDA 5A8ZA 5A0AE 1QR3E 1WYKA 1GBLA 2GDDA 2QIQA 4UDWH 1K21H 2IPHA 1QZ8A 1TRNA 1C2JA 3D65E 3P8OA 1A46H 3EYDA 4TYDA 2BD3A 4YO9A 1BTUA 3KNXA 2QXHA 1TX7A 3CENA 1A0HB 1WCZA 3QTVH 2EI8A 1O2VA 3KQ5A 4WH6A 5EQQA 3OYPA 1G36A 1AUJA 1GBBA 1FN8A 1FAKH 1IQHA 1V3XA 3DFLA 1K9OE 1NRSH 2JDID 5CHAC 4QT8C 5JB9S 1DM4B 1GVLA 2PKSC 2D2DA 2G51A 1CGJE 2Y81A 2O8WA 1CU1A 1DDJA 1FQ3A 2YNBA 5DG6A 1MD7A 1PQAA 1NU9A 1EJAA 2BQWB 3I77A 4Y0ZE 1O2OA 5DP3A 4D7GA 2WPKS 1O34A 1TNJA 2ZGXH 1FY1A 1KXCA 2J38A 3QGNB 1ETSH 1ZGIA 1GHAG 1PPHE 4H6TA 4ABGA 1GG6B 1AMHA 1G30B 1V2TT 2XBYA 1GI4A 2OUAA 2GV7A 3CNRA 1IQFA 1O3HA 1SGYE 5EU8A 2W26A 4MNXA 1BBRK 3N7EA 2GCTC 2P94A 2FP7B 3A87A 1NESE 2BD5A 2OQ5A 1E38B 2O9QA 3A89A 4I31A 1LKBA 4UFFH 2PSXA 3VFEA 2BOHB 4D8NA 2Y5HA 2Q6GA 1UTKA 2JIZD 1ELAA 1WSSH 1P57B 4PROA 1HJ8A 1VR1H 1YPHC 2Y5FA 1SOZA 2ZECA 3D49H 1TE0A 2QAAA 3B9FH 3BEFB 1QGFA 2Y82A 1W0KD 1SFQB 1QHRB 1BHXB 3QDZB 4Z0KA 1LQEA 3WWFA 1SLXB 1QIXB 2SFAA 3BEIB 3RXVA 2ZDLA 3ZV8A 2FM2A 3E91A 3FZDA 2VVCA 2PLXA 3TJNA 3AAVA 2G55A 3RLWH 4RN6A 1RFNA 1D3TB 1SGEE 2ANWA 3KN2A 2VIDA 3UNRA 3GYLB 1P0SH 1YF4A 2F83A 4YOGA 5LPRA 1F5KU 1T32A 3BG4C 4IC6A 3MH5A 1P04A 2NU3E 4AG1A 2V3MA 1EUFA 2A1DB 3MHWU 4XBDA 4UONA 2NU2E 3PLPA 2G4UA 1UW7A 2QF0A 5H4IB 3QWCH 5HYOA 1AZ8A 3ATKA 1ARCA 3URCA 5HM9A 5EXNA 4Q7YA 2VINA 3SU6A 1P2MA 1S0RA 1TMBH 4NFEA 3MYWA 3LH3A 1GCDA 1P8VC 2XBVA 3ATLA 4JZDH 1HV7A 1TBRH 1VZQH 2ZP0H 2PFEA 4FXGH 5E0HA 4Q2KA 2K8IA 3SI3H 1DXWA 3I78A 4X2YA 5G4BA 4NZQA 3A81A 1HXEH 3ITIA 2YOLA 1EX3A 4B2CA 1AO5A 4YZUA 2GGVB 2J94A 1XKAC 1ZZZA 4NA9H 1ZHPA 3PRBA 1O5EH 1NFYA 1EPTB 3M37A 4Y7AA 3SU3A 1AE5A 4AFSA 1EFRD 2QF4A 2FTMA 4CR9A 2OQUA 3OU0A 3LJJA 1DWEH 1KDQB 1C1WH 2UUFB 3SOSA 1D9IA 1WUNH 3KF2A 1BJVA 2ZU3A 1MKWH 2SGQE 3DSPA 5DP9A 1Y3XA 3NUMA 1ARBA 1F0RA 4O03A 3VEQB 4XSKU 5GJ4B 1EP5A 3T25A 1WQSA 3MH7A 4KTUA 1JRSA 1ANEA 3RC5A 5F8ZA 3F0OA 4TSFD 2OBQA 3UY9A 2QN5T 2Z9LA 1Y8TA 2V6NA 4RI0A 5LPFA 4A1VA 1E79D 1P03A 2AGIX 2JH6D 1W10U 3RLYH 4AB8A 1HAXB 3M5NA 1YWUA 2WPHS 3AW0A 1PQ5A 3RXJA 2XRCA 1GBHA 1DUEA 2PTCE 3VB4A 1SVPA 3WW7A 2ZG0H 4I33A 1FPHH 1O3OA 2BD7A 3W1EA 4I8KA 2JH0D 3SI4H 1Z6JH 2ALVA 3K6YA 1VGCB 1J8AA 3MNSA 2ZCKP 1C2KA 4CH8B 4RSPA 4IBLH 4K60A 4P00A 2FS8A 1SQOA 2QXJA 1K28D 3ZZ7A 1LO6A 4NIWA 5GPIB 1GBKA 1RD3B 1S0QA 1TOCB 5EODA 3SV2H 3BTGE 3TGJE 1HBTH 1ZMJA 2J95A 4MDSA 2BDIA 2NWNA 1QL9A 2FXRA 1AUTC 2FI3E 5EPNA 1DWCH 3RMOH 5C20A 4HGCA 2GT7A 3MNBA 4ISIH 1WAYB 3M3SA 1YLCA 1GMHG 3PTNA 4KKDA 4VGCC 4XBBA 1O2TA 1OWIA 3PMJA 4CBOA 2R2WU 5A09A 1BMLA 2SNWA 4WMDA 3VPKA 2DE9A 1KXBA 2AERH 2G5NA 3A7VA 1L4ZA 1ZYOA 1O37A 1MZDA 1QNJA 5EOKA 1Z8GA 1J16A 3GYMA 1J9CH 4ZCNA 4AOQA 1BHXF 4BOHA 2G00A 3PTBA 1V2ST 1C5QA 2ZNKH 3Q00A 2BM2A 2ZFPH 3PV5A 1GHAF 1O2XA 2KCPA 1IQJA 4X2WA 3P17H 5ETXA 1L1GA 1ETRH 1O35A 3ZYDA 1AE8H 4GUXA 1NRPH 1V6DA 4BNRA 1O2NA 1TGBA 3SU4A 3AVZA 3SUGA 1SFIA 4TPIZ 2DE8A 1YPMH 2FDAA 4ZAEA 5F8XA 2BOKA 1UTMA 1K1JA 2OLGA 1KTSB 3UOPA 1ZSJA 4M9FA 2L6OA 1FY4A 3U98H 2C4FH 4LK4A 4MPUA 4OS4A 1BA8B 1F0SA 1FONA 1ZOMA 1ZRBA 3ZZ8A 1KLIH 2J5UA 3B8JA 2O8UA 2ZC9H 1PPGE 4K2YA 1C5ZB 2H2ZA 3ESTA 1BQYA 2R2MB 1AQ7A 5T6GA 2KM0A 2RA3A 1THRH 1DICA 3URDA 1V2RT 1NTPA 2CN0H 4XOJA 2EC9H 3TH4H 4ABEA 1C1NA 1GBFA 1O5CB 4FUGA 1H8DH 1TNLA 3GCTF 3LU9B 1NBME 2H9TH 5DP5A 1HDTH 1SBWA 3BIUH 3RMLH 1SLWB 5JBAS 1UHBB 1P9SA 2ZZUH 2BDBA 1C5XB 1KLJH 1TRMA 7ESTE 3CP7A 2KCOA 5L6NH 4CBNA 2ODQA 1IAUA 2Z7FE 4FUEA 1EAIA 6CHAB 2ILNA 1W14U 1V2QT 4MTBA 1AVWA 4K1SA 2YMSB 4WXIA 1PYTD 1WOFA 1ZSKA 1RIWB 4X2XA 1V2UT 5EW1H 3LGVA 2BQ6B 4WF8A 2ZHFH 1BDAA 2BTCE 2P95A 1TX6A 3FKSD 1C5PA 1BT7A 2BDGA 4Z6AH 1O3FA 3LGUA 1VKYA 3TGKE 5EGMA 1AFQB 5BPEA 2A45B 1N8OB 4X1NU 4GAWA 2DUCA 2PGBB 3ZYEA 1EATA 1TGNA 1XUHA 2Z3CA 2ZTYA 4AFQA 1ZMNA 5CMXH 5E8EH 1FAXA 3FZZA 3H7OA 2BMGB 2F4LA 1SI5H 1GL0E 4AX9H 1H8ED 2A4QA 3MNCA 1W8BH 3TK6A 3PO1B 3U8OH 5DO4H 4I8GA 1O3CA 2AMPA 5AFZH 1MTSA 1QURH 3GY2A 1Y3VA 5A0BA 1AD8H 4UFDH 4MPXA 3U28C 1YPJH 5C5OA 3GY6A 1GI9B 1BTZA 3A7XA 1MQ6A 5CHBA 2FMJA 1ZJKA 3BSQA 5F53A 2CF8H 2ZGHA 1HB0B 2QF3A 3AK5A 2HVYB 1BMMH 1P9UA 1W0YH 4JMYA 1GJ6A 4KTSA 3A86A 3SV7A 1P3EA 3T62A 2KFWA 4XDEA 1F5LA 2AEIH 3RP2A 3RDZA 1C4V2 3DT0H 3Q77A 1YM0A 2WUCA 1O5FH 2UUKB 3HGPA 2ALPA 2BD9A 1IQKA 1O30A 3LJOA 1C1VH 1VCPA 1GPZA 2TBSA 1KDQA 1NFUA 3E3TA 5EQSA 5GNDA 3NXPA 5C0UA 1PQ7A 5F8TA 3LGWA 3MI4A 1GJDB 4JZIA 4NIYA 2R0LA 3NK8A 2ZPQA 4MNYA 4Y71A 4AYVB 1TNGA 2HGTH 2ZIQH 1O2IA 2NU1E 1KTTB 3TJOA 1GDNA 2OC0A 5C5NA 2ZDVH 4X6NA 1GI5A 4MPVA 1CT4E 1MKXH 1C5MD 1TMTH 2FOGA 2D8WA 1DITH 1QJ1B 4OS6A 4ZXYH 4CREA 3NWUA 4MNVA 3HKIB 1FJSA 1DE7H 1PQ8A 4U32A 1Z8JB 1YGCH 3LT3A 5JBCS 1ABJH 1BCUH 3ZVGA 1BUIA 4ASHA 2UWLA 1C2GA 1LMWB 1YPEH 3PV4A 1SGDE 1ELTA 3BTTE 4YTAA 1TPOA 3F3BA 2HOBA 3L6PA 1A5HA 2QXIA 3GDSA 1NM6A 1GMHF 3OY5U 4ABJA 1BOQA 1S84A 3H5CB 1Y3UA 3MH6A 2H9EH 1C5NH 1HJAB 2VWOA 2FTLE 4CHAB 1NRRH 2R9PA 1MCVA 2ZPSA 3OEHD 3MU0A 3MOCA 1V2KT 3E90B 3VB6A 1WDIA 3FP6E 4JYUH 3DUXH 2B0FA 1V2PT 3A82A 1ELCA 1ELVA 3A7YA 3UTUH 4HTCH 2ULLA 1FNIA 4CH2B 3EQ0H 2JETB 4NA7A 3TNSA 1P06A 3QK1A 4I7YH 8GCHG 1FUJA 3OSYA 3TNTA 3DSGA 4ISHH 4GHTA 1TB6H 1EKBB 3JZ1B 1LQDB 4X1RU 2AS9A 2Y5GA 2EEKA 4WMFA 3SJOA 1LVOA 4HI3A 1LHDH 5J4QA 2ZCHP 4AC9A 5AHGH 2OC7A 1QRWA 1S6FA 1BTYA 2BD2A 4MQAA 1O2PA 1SOTA 1RJXB 1NO9H 3UREA 1E35B 1YLDA 5TJXA 3D23A 2Q6FA 2P3UB 4DVAU 5A2MH 5DJ7A 2GMTB 4BAOB 4JZEH 4OS7A 4Y11E 2CHAB 1UTJA 1RS0A 3T28A 1SB1H 2V35A 2RDEA 3FOAA 1DXPA 2VB0A 4H6SB 2GP9B 5A0CA 5C2ZA 4F55A 2VU8E 1MAYA 2Z9IA 4HZHA 3TU7H 1MU6B 2OK5A 3SZEA 1RGQA 5EXLA 5DPAA 2PKAA 1EPTC 3CS0A 2XXLA 2A4GA 5C17A 3EA7A 3F2HA 1ZHRA 2BZAA 4FUIA 1ANCA 4A7IB 2W7SA 1LHEH 2F9VA 1ANDA 3FANA 6GCHG 2HRVA 3E0NB 1TNHA 4UEHH 3SUEA 5CE1A 3MO9A 1S6HA 4IN2A 4X6OA 2FZZA 2P59A 2XTTB 2BDCA 2SNVA 1A3BH 1DSUA 1ZPCA 4Y10E 1UCYE 4AFZA 1ZHMA 3GY7A 2GX4A 4E7NA 1H4WA 1SL3A 2JJ2D 8LPRA 5DSFA 2J92A 1GHYH 3F68H 4H42U 2WPIS 1A4WH 4ZUHA 1HYLA 3GY8A 3KGPA 1ZMLA 1YCPK 4RKOB 1LPZB 2ESTE 2RG3A 2QYIA 1S5SA 3F2GA 3RXBA 3RXSA 1OWDA 1D3DB 3SO3A 3MWIU 3OY6U 4DT7B 1T8NA 1V2JT 3EGKH 1LKAA 4FUDA 1EOLA 5IYTA 3SU1A 2XNIA 5JBBS 1OS8A 1NFWA 4ZROA 3A80A 3S0NA 5DP6A 1O3BA 1G3BA 2F9PA 2ZHWH 1AY6H 1KY9A 1UHBA 4YESB 4AGKA 3RXFA 2J98B 3W94A 1K1IA 2FWWA 2RDLA 3FP8E 1TWXB 1WBGB 1HAYB 1N6XA 4AFUA 5LPEA 1H8IH 5KEDA 1Q2WA 5E2OA 1O2UA 3RM0H 2ODPA 1VGCC 9ESTA 2KZ4A 4TY6A 1TAWA 3ZZ5A 4Y8YA 4YT6H 2A31A 4ACBA 4K1TA 1Y5BT 2ZGJA 1O5GH 3GCTG 3KQDA 3QUMP 3ZZAA 3I29A 4MNWA 2EA3A 4CRGA 2LNCA 3SGBE 3UQOA 1IHTH 5BRRE 1CT0E 1C5VA 1Q3XA 1W2KH 7GCHG 2XWAA 3K6ZA 2VIVA 3M3TA 1JMOH 5IDKA 3QTOH 3SGAE 1C2IA 1NN6A 4Y7BA 4Y76A 4Q7ZA 3ENSB 1AB9B 2R3UA 2ZFFH 2BQ7B 3RXPA 1C5YB 1TNKA 2WINI 2AGGX 1QJ7B 1XXDA 1GJ5H 4NZLA 1EQ9A 2ZU4A 3STIA 3SV6A 3UOUA 1P2IA 4FU7A 3KHVA 4MG3A 5DKMA 1DT2A 1O3DA 1C5WB 3RXHA 1CHGA 3GCHB 1JIMA 1EP6A 1LVYA 2HNTC 3KQBA 2Z9KA 1TYNA 4RKJB 2O8MA 4ABFA 3AASA 3UB0A 4BTIB
chains in the Genus database with same CATH topology
5EQRA 1W0JD 3SV9A 3F2GA 4U01A 3F0OA 1BMFD 4TSFD 1NS3A 2OBQA 2QF5A 4Q63A 3O8DA 2XOKD 3RC4A 3SU1A 2XNIA 3KN2A 4RI0A 4A1VA 4B71A 5CHBA 1E79D 4M9FA 3SYJA 2L6OA 5F53A 4K8BA 3M5LA 3LONA 5FPTA 3DSOA 2WPDD 3M5NA 4NWLA 4OM9A 3M5MA 3SUDA 1E1RD 4A92A 2WHXA 3AK5A 4A1TA 2IJD1 1COWD 2J5UA 3OEED 3OAAD 2KCYA 3P8OA 5H4IB 3WW7A 4B75A 4I33A 2OC8A 2YMSD 3EYDA 4JMYA 3N99A 4Q4LA 4TYDA 3W1EA 3SV7A 2CK3D 3KNXA 2KFWA 2KM0A 3O8RA 1H8HD 4WH6A 3M5OA 5EQQA 2F9UA 2OC7A 3OTPA 2IJOB 3OYPA 2XCFA 3RC5A 2K1QA 2KZ4A 5T1VA 2OBOA 2JDID 3SU6A 3P8NA 3OE7D 2W6ID 5C0TA 2AHME 3N7DA 5GPIB 3E90B 1NBME 1FX0B 1CU1A 4DT4A 3RC6A 1NBMD 3NRLA 5EQSA 5GNDA 5C0UA 3LOXA 2FOMB 3UB0A 2K8IA 3ZIAD 3PRDA 3WWBA 1DXWA 1W3CA 2A4RA 2KCOA 3SU0A 3FOAA 5EPNA 1DXPA 2YOLA 3SUFA 2QV1A 2WV9A 3DCLA 3H09A 5FPSA 2F43B 3PV2A 2GGVB 1SKYE 4F55A 1N1LA 3U1IB 5IDKA 1DY8A 2OC0A 2WZQA 3OFND 5FPYA 4B76A 4ASUD 1WXRA 2KCAA 3PRBA 2YMSB 2OK5A 1MABB 3SZEA 1RGQA 2V7QD 4XD7D 2YMSC 3KEEA 4B6FA 3SU3A 4Z1MD 1JXPA 2KR7A 2QE7D 3SU2A 2W6JD 1RTLA 2VBCA 1EFRD 2QF4A 2A4GA 4WH8A 5C17A 2XNDD 4I32A 3F2HA 3N7EA 3SU5A 2OINA 4WF8A 2FP7B 5IK2D 2K0QA 3SV6A 4A1XA 2F9VA 3FKSD 1S6LA 3LKWA 4R8TB 1KMHB 1BT7A 4I31A 3SV8A 3F3BA 1DY9A 3SUEA 4ZCNA 2WSSD 2P59A 3FO8D 3L6PA 2M2AA 3VG8A 2LELA 5CDFE 3KF2A 5FL7D 3U1JB 3PV5A 2JIZD 5EPYA 3GS9A 4B73A 2KCPA 3O8BA 1E1QD 2XCNA 3F2FA 5ETXA 2HLDD 2GVFA 2O8MA 4FETA 2JJ2D 4B74A 5DSFA 3O8CA 2JJ1D 3DSPA 1W0KD 3FN8A 4NWKA 4YXWD 2F4LA 4KTCA 4TT3D 3SU4A 4B6EA 5B6LA 1H8ED 2A4QA 3WWFA 3SUGA 2OC1A 3OEHD 5DN6D 5ESBA 5GJ4B 1A1RA 2FM2A 5HKKD 3F0PA 1OHHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEL A;  3DSO A;  2KM0 A;  3N7D A;  3N7E A;  3DSP A;  2K0Q A; 
#chains in the Genus database with same CATH topology
 5L2Z H;  2GZ9 A;  1IQG A;  1CBW B;  1QB1 A;  1THP B;  3LPR A;  1FPC H;  1T4V H;  2P3F H;  2SGD E;  1K1O A;  3RMN H;  2G5V A;  1Z1I A;  2ZEB A;  4ZKS U;  1XUF A;  3RXL A;  3A83 A;  1A0L A;  4K8B A;  2BVX H;  1NFX A;  1YPG H;  2OXS A;  1TFX A;  2HPQ H;  1E1R D;  1DWB H;  1VJ9 U;  2FX6 A;  2GTB A;  4KEL A;  1SGF G;  2FOE A;  3RXK A;  1TX8 A;  4EST E;  5E0G A;  4XE4 A;  4DY7 B;  1VIT H;  3PWB A;  2VNT A;  1NRO H;  4OGY A;  3M5O A;  4HG6 A;  3EE0 B;  1GBM A;  1SQR A;  1MMJ N;  3BG8 A;  4NIV A;  5DGJ A;  3BTF E;  3P92 A;  2OBO A;  8GCH F;  1BTH H;  1ORF A;  4Y8Z A;  2O8L A;  1JRT A;  4CRD A;  1D6R A;  3P8F A;  1P02 A;  1O5D H;  1FX0 B;  1FY5 A;  1V2M T;  4O3U A;  1NC6 A;  3A8A A;  4O97 A;  4LZ1 H;  3NRL A;  1ESA A;  3WWB A;  4Q80 A;  1C9P A;  2ZU2 A;  3GDU A;  4DUR A;  5JDU B;  2FOA A;  2BHG A;  1GI0 A;  4YT7 H;  3ZZ6 A;  5I25 A;  3H09 A;  5FPS A;  4NSV A;  1GHX H;  4X8V H;  1LPK B;  1QCP A;  1GMD F;  2WZQ A;  3OFN D;  3QX5 H;  2PUX B;  5FPY A;  3UNS A;  5GIB A;  2B8O H;  1HAP H;  2V7Q D;  3ZZC A;  2YMS C;  1ZPB A;  1OPH B;  3KYG A;  1O2Q A;  1C1T A;  1JXP A;  1RIW C;  1BBR E;  2QE7 D;  1FI8 A;  2ZGB H;  2A2Q H;  2TGA A;  2ZFT A;  4I32 A;  3PM3 A;  2RCE A;  1ZJD A;  2STB E;  3RXT A;  3QGJ A;  2A4O A;  4R8T B;  3F9G A;  1T8M A;  1A5I A;  1V2O T;  3CS7 A;  2GDE H;  2GKV E;  2BLQ A;  3T27 A;  1AFQ C;  2FYQ A;  4WJG 2;  8KME 2;  1CA0 B;  3PMA B;  4D9R A;  3IG6 B;  1OP8 A;  1TMU H;  2FLB H;  2ZI2 H;  4B74 A;  1F92 A;  5EW2 H;  2TGT A;  1G32 B;  2UWO A;  1FDP A;  1GBC A;  3FN8 A;  3V0X A;  3QLP H;  3RXD A;  4LZ4 B;  1GJ9 B;  3VXF H;  1TBZ H;  4NG9 H;  1JOU B;  1GBE A;  4TY7 A;  3UUZ A;  3PO1 C;  6GCH F;  3BV9 B;  1P10 A;  2AFQ B;  1GI8 B;  5A8Y A;  1ACB E;  1WQV H;  3RC4 A;  1IQI A;  5FX6 A;  2BY7 X;  4ZKR U;  1QL7 A;  1UTP A;  1O3M A;  4FU9 A;  1SQA A;  1O2G H;  4OM9 A;  1S83 A;  2BDY A;  1FN6 A;  3SJK A;  1ZTJ A;  4IC5 A;  3S69 A;  4FUC A;  1C1U H;  1XUI A;  2PKA B;  5SGA E;  2GT8 A;  1U6Q A;  4JZ1 A;  4R0I A;  3ZZ4 A;  1FIW A;  1BBR H;  4WWY A;  2Z6B D;  5HM2 A;  3BTM E;  2IJO B;  3OTP A;  2XCF A;  3F6U H;  4IGD A;  3UQV A;  1QQ4 A;  1LPG B;  3OE7 D;  3D62 A;  1O3L A;  1F7Z A;  3IWM A;  1XXF A;  4IS5 A;  4J2Y B;  1B5G H;  3Q3K A;  2UUY A;  3ATM A;  3L3T A;  2G81 E;  2C8W B;  1TRY A;  2FOM B;  3LC5 A;  1WV7 H;  1AIX H;  1O2H A;  2QXG A;  1B7X B;  2A7H A;  2IOT A;  1BB0 B;  3E16 B;  3T26 A;  1JBU H;  3BTE E;  1N1L A;  1MTV A;  2BDA A;  1C5R A;  4DG4 A;  2HAL A;  1SGI B;  1XUK A;  2BB4 A;  1C1R A;  5FBI A;  4ZHA A;  2HVX A;  2Z9G A;  4INK A;  3SJ9 A;  1QFK H;  1KYN A;  4ABA A;  5EJL A;  5PTP A;  4Z1M D;  1CQQ A;  1GI1 A;  1XMN B;  1UK4 A;  4WH8 A;  4HFP B;  4AB9 A;  1GWA A;  1DFP A;  1L1N A;  2P8O B;  1BMN H;  3EA8 A;  1HUT H;  3N7O A;  2PSY A;  4AG2 A;  3EDX B;  7GCH F;  4GCH F;  2BVS H;  2ZKS A;  3DA9 B;  3FO8 D;  4X1S U;  2LEL A;  3LGT A;  1TOM H;  1GVZ A;  1L4D A;  1F0T A;  1B0E A;  1P2N A;  4B73 A;  5EXM A;  4CRC A;  4D76 A;  2J98 A;  1VIT F;  1ZLR A;  1GI3 A;  2BXU H;  2VH6 A;  2ZHQ H;  3NCL A;  5DP4 A;  1KLT A;  1Z8R A;  5T6F A;  4CR5 A;  1HJA C;  1O2Z A;  3A8D A;  4CHA C;  4YLQ H;  1HXF H;  2AIQ A;  2ZFR H;  1A1R A;  3ZVA A;  3PB1 E;  7LPR A;  2A5I A;  1QBO A;  5EQR A;  1NZQ H;  1H9L B;  5C3N A;  1J17 T;  3MMG A;  1XM1 A;  5EST E;  2R3Y A;  3UWJ H;  1K0H A;  1H1B A;  2AMD A;  3HKJ B;  2J4I A;  7KME H;  4X8T H;  4K5Z A;  1WU1 A;  4X2V A;  2AGE X;  3ZVD A;  5FPT A;  4SGB E;  1ESB A;  1GDQ A;  3ZVF A;  1AKS A;  3SW2 B;  2BZ6 H;  2QA9 E;  1BRA A;  6EST A;  3RXQ A;  1O33 A;  1W7X H;  1O31 A;  2GCH G;  1JWT A;  2FES H;  3N99 A;  1O3N A;  1UVS H;  4UD9 H;  2VGC B;  4DIH H;  1D3P B;  1GGD B;  1QBN A;  3TJV A;  2BLW A;  3FAO A;  2XBX A;  4FUB A;  1HAV A;  2ASU B;  3BTK E;  3F9H A;  3SHA H;  3U8T H;  3SNB A;  3PYH A;  2ZQ2 A;  1RTF B;  2B7D H;  2GD4 B;  1G2L A;  1T8L A;  1EB1 H;  1FLE E;  1O3E A;  4DT4 A;  3A88 A;  3M35 A;  2V3H H;  1HFD A;  1RRK A;  3C27 B;  3LOX A;  3WY8 A;  3ZIA D;  1O3K A;  2GMT C;  2WV4 A;  3PRD A;  3U69 H;  2VWN A;  1O3J A;  1CT2 E;  2CXV A;  1SLU B;  2PWX A;  1GBA A;  1O32 A;  2CHA C;  1C4Y 2;  2ZDA H;  4JK6 A;  4NIX A;  2CV3 A;  3DHK H;  1CGH A;  3W95 A;  1M9U A;  4INL A;  4WVP E;  4B76 A;  1WXR A;  3E0P B;  4I8H A;  3BF6 H;  3SND A;  2PW8 H;  1C2E A;  4GSO A;  4E06 H;  4ABB A;  4JYT A;  1AWH B;  3SU2 A;  2KR7 A;  4ISO A;  1W7G H;  1INC A;  1ZTL A;  1NU7 B;  3PMH B;  4YOJ A;  2XND D;  1V2L T;  2BX4 A;  1KSN A;  2FO9 A;  1GJ4 H;  3PLK A;  1IQM A;  1GBJ A;  1YP9 A;  2FOB A;  2W5E A;  1DY9 A;  1MH0 A;  2GZ7 A;  1YC0 A;  4ZKO U;  1E36 B;  3BTQ E;  3GCN A;  3ZVE A;  1UVO A;  1XX9 A;  1Q31 A;  1JIR A;  2H5C A;  2SGP E;  2PUQ H;  1GHV H;  1E1Q D;  1TLD A;  4UFG H;  4B2A A;  1OWH A;  1O2Y A;  1FY3 A;  1GG6 C;  2HNT F;  3SHC H;  4ABH A;  4ISL A;  3QN7 A;  4JZF H;  4TWW A;  5ESB A;  5EJZ A;  1LCY A;  2W3K A;  2BD4 A;  5FBE A;  3M7T A;  1NS3 A;  5HGG A;  3RU4 T;  1YLN A;  4RT0 A;  3Q76 A;  2CMY A;  2XOK D;  4OS1 A;  1FV9 A;  1ID5 H;  4J1Y A;  3MH4 A;  3ZVC A;  4A5T S;  2FI5 E;  1GJA B;  1V2V T;  2H6M A;  2WPL S;  2VVV A;  1PFX C;  1OXG A;  3SUD A;  1CGI E;  2JKH A;  2ZPR A;  2WHX A;  4DCD A;  2IJD 1;  1OYT H;  3FP7 E;  3RMM H;  1AFE H;  1P2J A;  1OP0 A;  2VIQ A;  1ZGV A;  1GI2 A;  2F91 A;  3PWC A;  3RXE A;  1GCT B;  2XC5 A;  3L33 A;  1H8H D;  1W0Z U;  3E6P H;  2F9U A;  3KQC A;  2FOD A;  1EAS A;  1MKW K;  3F9E A;  4X1P U;  3S7K B;  1GBD A;  3RXR A;  1GHW H;  1VJA U;  4D7F A;  4LOY H;  3EE7 A;  2ZGC A;  2VJ1 A;  4X1Q U;  4Y6D A;  4BAN B;  5KGO A;  1EAW A;  3TK5 A;  4INH A;  3MO3 A;  2OD3 B;  1EST A;  3QZQ A;  3SUF A;  2QGR A;  3PV2 A;  3HK6 B;  2IPQ X;  5K0H A;  3RXA A;  4YOI A;  1GMD G;  2O8T A;  1ELG A;  1FIZ A;  3ZVB A;  4WXV A;  3UAI C;  5TCC A;  4XD7 D;  3KEE A;  3NKK A;  3S7H B;  1AB9 C;  1MTW A;  1KXA A;  1C2L A;  2G52 A;  3QO6 A;  2TGP Z;  3VXE H;  5B6O A;  3LDX H;  1H9I E;  4H4F A;  3UPE A;  3SU5 A;  3DD2 H;  4K1E A;  2SGA A;  1HAG E;  1DLE A;  1O3P B;  1UJ1 A;  1EZU C;  4YM9 A;  2FOC A;  3GIC B;  5FCR A;  2BY6 X;  2WSS D;  1TIO A;  2NU4 E;  2A0Q B;  2M2A A;  2W7U A;  5FAH A;  3RXG A;  3GS9 A;  1MUE B;  2FX4 A;  1X7A C;  2J2U A;  1PPF E;  3RXO A;  1TGT A;  5E2P A;  1TPP A;  1D4P B;  5B6L A;  2ZO3 H;  5EG4 A;  4X0W U;  2OC1 A;  1GVK B;  2B9L A;  1KXE A;  3ZZB A;  3F0P A;  1OHH D;  3SV9 A;  2FI4 E;  5HIY A;  3U8R H;  2TIO A;  4Q7X A;  2XC0 A;  3UFA A;  1CBW C;  1T31 A;  1E34 B;  5DK1 A;  2WUB A;  1UO6 A;  2V3O H;  1HAI H;  2ZDK A;  3NZI A;  3VGC B;  1GBI A;  1THS H;  2EQN A;  4Y8X A;  1P2K A;  3MTY A;  3SOR A;  3DSO A;  1J14 A;  1O2L A;  4NWL A;  1BIO A;  3M3V A;  3M5M A;  5KEC A;  1MTN B;  3TH2 H;  2FS9 A;  2J97 A;  3M36 A;  1NT1 A;  3BTD E;  1SLV B;  1DWD H;  3M7Q A;  3MU5 A;  2FLR H;  4NA8 A;  1CO7 E;  3FVF B;  4JK5 A;  2CK3 D;  1W11 U;  5J4S A;  1SPJ A;  1O5A B;  4NGA H;  3TIU A;  1P11 E;  2K1Q A;  1Y5A T;  1DLK B;  3GDV A;  2A7C A;  3MFJ A;  1WTG H;  3P8N A;  1QB6 A;  1GJ8 B;  1C5L H;  1NRQ H;  1EAU A;  4OGX A;  2AHM E;  2CGA A;  3EAJ A;  1A3E H;  1IHS H;  1CA8 B;  3A7W A;  3K9X B;  4KGA A;  4F4O C;  2H5D A;  1C1Q A;  1DS2 E;  2HWL B;  2GCH F;  1L2E A;  1W3C A;  2A4R A;  8EST E;  1K1L A;  3MU1 A;  5GWZ A;  1SGR E;  2VWM A;  2VWL A;  2KX4 A;  2PP6 A;  2Y7X A;  3SNA A;  2YNA A;  3V7T A;  2ZDM A;  2KAI B;  4IMQ A;  1S85 A;  3Q3X A;  2VVU A;  1PPC E;  3LIW A;  1EJM A;  1CHO G;  1O3A A;  1V2N T;  1RXP A;  4GPG A;  5HIZ A;  4DGJ A;  3BN9 A;  3P6Z B;  5C1U A;  2BVR H;  1UVU H;  2TGD A;  3UR9 A;  4X8U H;  3ZZ9 A;  1UCY H;  6LPR A;  3NPS A;  4CRA A;  2K0Q A;  3HK3 B;  1AKS B;  5ABW A;  1S6L A;  1Y3W A;  5C1X A;  1ETT H;  1GI7 B;  3RXC A;  1TAL A;  2WYG A;  4BTU B;  2WPM S;  3RM2 H;  1K1M A;  1LDT T;  4GCH G;  4SGA E;  2Z3D A;  2FIR H;  3VG8 A;  4DII H;  3GY3 A;  3TGI E;  5EPY A;  4ACA A;  4F48 B;  1HIA A;  1MQ5 A;  1CA0 C;  2WPJ S;  4AOR A;  1GDU A;  1IQN A;  4M7G A;  1HAV B;  1VIT G;  2JJ1 D;  1XKB C;  1AI8 H;  1OWK A;  2BLO A;  3HPT B;  4KTC A;  5DP8 A;  4TT3 D;  2AIP A;  4KP0 A;  1K1N A;  1QRX A;  1TPA E;  5HKK D;  1AWF H;  2XBW A;  1FMG A;  2VIW A;  2J9N A;  2JH5 D;  3P8G A;  2ZHD A;  4U01 A;  3VB3 A;  1BMF D;  1PYT C;  1AN1 E;  1QBV H;  1S81 A;  1UK2 A;  4B71 A;  1GL1 A;  1C5T A;  1P3C A;  1QQU A;  3BTH E;  5JB8 S;  1SHH B;  1YCP M;  3M5L A;  4GLY A;  1Z7K A;  2XYA A;  1C1P A;  4NFF A;  2WPD D;  2BDH A;  2BY9 X;  2UWP A;  2XW9 A;  4A92 A;  1O2W A;  2ODY B;  1GJC B;  5FCK A;  3OAA D;  2OP9 A;  3U9A H;  1D3Q B;  3M7U A;  4B1T A;  4FVD A;  4FOU C;  1EOJ A;  1EJN A;  4NSY A;  1N6Y A;  2ZCL P;  5CHA B;  3AW1 A;  3PLB A;  1BRB E;  2PKS B;  2PV9 B;  2W6I D;  2AH4 X;  5C0T A;  1GJB B;  3LC3 A;  1GHZ A;  1PPB H;  3ZV9 A;  1OP2 A;  1SHY A;  1ANB A;  1B0F A;  1XUG A;  1A7S A;  1YPH E;  2V0B A;  1C1O A;  1HAZ B;  1TQ0 B;  2C8X B;  1O39 A;  2A32 A;  1DUA A;  2SGF E;  2H9H A;  1P12 E;  3R0F A;  1SR5 C;  1P05 A;  3ODF A;  2WV9 A;  3EA9 A;  1EXF A;  1SKY E;  2AYW A;  2A2X H;  2HPP H;  3RXI A;  5A8X A;  1T7C A;  1DY8 A;  4TWY A;  4GHQ A;  3OX7 U;  1C9T A;  1HLT H;  1QB9 A;  1ELE E;  1G2M A;  1A61 H;  4B6F A;  1QL8 A;  1O2S A;  2J34 A;  2PGQ B;  1KXD A;  2CJI A;  1CVW H;  3TIT A;  1AVX A;  1E0F D;  3C1K A;  2PHB A;  3MNX A;  2VBC A;  2GCT B;  3STJ A;  2D1J A;  4UE7 H;  1C1S A;  1SGP E;  4E05 H;  2P8O C;  1NY2 2;  3RU4 E;  2LP6 A;  3SZN A;  1MU8 B;  1TQ7 B;  4LXB H;  4MLF B;  3S9B A;  3ATI A;  1C2F A;  1LHF H;  1Z71 A;  1MZA A;  1Y3Y A;  2PR3 A;  2ZHE H;  3KQE A;  1K22 H;  2H1U A;  2Z9J A;  4MPW A;  1MBM A;  1ZSL A;  6CHA C;  2VH0 A;  3Q3Y A;  4I8L A;  4CRF A;  4XBC A;  1IOE A;  2BD8 A;  2C8Z B;  3R3G B;  5EJ1 A;  2ZU1 A;  4NWK A;  1MAX A;  3MU4 A;  5GCH G;  4WME A;  4I8J A;  3T5F H;  5DN6 D;  1HGT H;  4MVN A;  5HMA A;  1DPO A;  3SJI A;  1O2J A;  3DFJ A;  3A85 A;  1VCW A;  1MKX K;  3T2N A;  5F6M A;  2RA0 A;  2ZQ1 A;  5F03 A;  4Q63 A;  4BXW A;  3BIV H;  2Y6T A;  3RUO A;  4IMZ A;  3BG4 B;  3SYJ A;  2Q1J A;  1N8O C;  4P02 A;  3V3M A;  2A5K A;  2UUJ B;  1AU8 A;  1UVP A;  2G4T A;  4JCN A;  2HNT E;  4U2W A;  1MTU A;  1MD8 A;  2G8T A;  4BAK B;  5TCA A;  1Y59 T;  5I46 H;  2GJG A;  3GIS B;  5GDS H;  2ZFQ H;  3KID U;  4A1T A;  1COW D;  3A84 A;  1AZZ A;  3OEE D;  4FUH A;  2KCY A;  1GMC G;  4YLU A;  2OC8 A;  1L1J A;  1YYY 1;  1S82 A;  3O8R A;  2VGC C;  1H9H E;  3UIR A;  1GGD C;  1AGJ A;  1KIG H;  2ZDN A;  4AN7 A;  2PTN A;  3S9C A;  1Z1J A;  5T1V A;  1EZS C;  2ZU5 A;  1OKX A;  1ZPZ A;  3SNC A;  4OS2 A;  3MU8 A;  1BJU A;  1SQT A;  1C2D A;  1F5R A;  1UTO A;  3TK9 A;  2Y80 A;  3ATW A;  1EZX C;  1DAN H;  1G3D A;  2ZA5 A;  1QY6 A;  2LPR A;  1LTO A;  3A8B A;  2BY5 X;  2TRM A;  4RT1 A;  1IQL A;  5DP7 A;  1LVM A;  2Y7Z A;  1RTK A;  4ZMA H;  2BYA X;  2L74 A;  1YPL H;  2GV6 A;  3GCO A;  1TGC A;  1YCP H;  4X6M A;  2EI6 A;  2KCA A;  1BTW A;  2BX3 A;  1OYQ A;  1O0D H;  4X8S H;  1GHB G;  4ISN A;  2P93 A;  3BEU A;  1P2O A;  3SGQ E;  1HJ9 A;  1RTL A;  1TBQ H;  1O2R A;  4ZXX H;  4TPY A;  4A1X A;  4BAM B;  2BLV A;  3E1X B;  1KMH B;  3JZ2 B;  3M61 U;  4K69 A;  5CDF E;  1DOJ A;  5FL7 D;  1OOK B;  3RXM A;  3U1J B;  1SMF E;  4CRB A;  4B2B A;  3UWI A;  1CHO F;  2I6Q A;  4K3J A;  1T4U H;  1BIT A;  1AVG H;  3O8C A;  4Y0Y E;  1TA6 A;  3MO6 A;  4YXW D;  5LGO A;  3KL6 A;  1EAX A;  1BZX E;  1BTX A;  1GBT A;  1SGC A;  4F49 A;  1W13 U;  1Y5U T;  5C67 A;  3BTW E;  3VB5 A;  1AHT H;  1FY8 E;  2ZFS A;  3KCG H;  5K7R A;  1OWE A;  3RU4 D;  2RFK C;  2THF B;  4XRN A;  1A5G H;  2QF5 A;  1BMA A;  3O8D A;  1HPG A;  3A8C A;  3LGI A;  1HNE E;  4DW2 U;  3UNQ A;  4GVU A;  5T6D A;  4FUF A;  2ZWL H;  1C2M A;  1C5U A;  1OX1 A;  2C8Y B;  1PJP A;  1HRT H;  2P3T B;  2ZTX A;  5FXL A;  2BY8 X;  2ZF0 H;  5AFY H;  4A6L A;  1O3I A;  1TON A;  2BXT H;  1A0J A;  3FFG A;  4IN1 A;  1BRC E;  1G37 A;  2AMQ A;  2C90 B;  2KAI A;  1XVO A;  1SGQ E;  1F2S E;  1O5B B;  2VIO A;  3PRO A;  1GCT C;  2A7J A;  2R0K A;  4BTT B;  4NCY A;  1ZR0 A;  4I86 A;  1G3E A;  1QJ6 B;  1E37 B;  1DX5 M;  5E0J A;  2JET C;  1F0U A;  2F9N A;  1HIA B;  4OS5 A;  1UTQ A;  2FPZ A;  2QY0 B;  1ABI H;  5FHT A;  1YKT A;  1C5S A;  1O3G A;  3GY4 A;  1LHC H;  1C1M A;  2B5T B;  3K65 B;  1YBW A;  3KYF A;  5JYI A;  3MQK C;  5L2Y H;  1MCT A;  2F43 B;  1P2Q A;  1HCG A;  4VGC B;  3U1I B;  5GXP A;  3LH1 A;  1XUJ A;  1VCQ A;  1ELF A;  1K2I 1;  1ZRK A;  3HGN A;  3ELA H;  1CSO E;  1LHG H;  1TNI A;  2C3S A;  4THN H;  2WYJ A;  2W6J D;  3ZZ3 A;  1FXY A;  1P09 A;  3TH3 H;  5FX5 A;  2Z3E A;  1DST A;  2OIN A;  5IK2 D;  4FVB A;  3K2U A;  1W12 U;  1BRU P;  3RXU A;  2ZTZ A;  1O38 A;  2ANY A;  1OWJ A;  1QA0 A;  1G9I E;  1O2K A;  3UR6 A;  4AGJ A;  2SGE E;  3O8B A;  1IQE A;  1UCY K;  3F2F A;  2D26 C;  2C93 B;  1ELD E;  3GY5 A;  3SQE E;  1UTL M;  1SG8 B;  1SGT A;  1V2W T;  5T3H A;  1HAO H;  2STA E;  4X6P A;  3PMB B;  1T8O A;  3SNE A;  1PPE E;  4B6E A;  1GI6 A;  2Z94 A;  1G3C A;  4E7R G;  1W0J D;  4WY3 A;  1OSS A;  2F9B H;  2QCY A;  2XWB I;  1EPT A;  1GJ7 B;  1PPZ A;  3TLO A;  3P70 B;  4DJZ B;  2FEQ H;  1FZZ A;  2F9O A;  2QC2 A;  2XC4 A;  2HLC A;  3A7T A;  4IW4 E;  1C5O H;  1TPS A;  1NPM A;  1KXF A;  3ZZD A;  3VGC C;  1Z6E A;  1SC8 U;  5GCH F;  3E8L A;  1MTN C;  3F1S B;  2W3I A;  1L0Z A;  1O2M A;  4AYY B;  1YPK H;  4B75 A;  1NRN H;  2YMS D;  4Q4L A;  1QRZ A;  1SSX A;  3P95 A;  2TPI Z;  3TJU A;  3G01 A;  4FUJ A;  4D9Q A;  5AVD A;  1BTP A;  1Z8I B;  3T29 A;  1XVM A;  2A5A A;  2P16 A;  2WV5 A;  2FOF A;  2F3C E;  2GZ8 A;  3N7D A;  1UK3 A;  3A7Z A;  5C1Y A;  2ANK H;  2CF9 H;  3TVJ B;  3RC6 A;  3AAU A;  1NBM D;  1HAH H;  2M5T A;  3SQH E;  1UTN A;  1J15 A;  2OTV A;  9LPR A;  1GMC F;  1UVT H;  3H7T A;  1K1P A;  1DVA H;  2FOH A;  4O9V A;  4ABD A;  4AZ2 B;  2EI7 A;  1MBQ A;  3SU0 A;  2QV1 A;  3DCL A;  1ZTK A;  5C94 A;  5L30 H;  5LH8 A;  2NU0 E;  4ASU D;  4K8Y A;  1MAB B;  1WTH D;  2VIP A;  1LVB A;  4ZH8 A;  4XFQ A;  4UFE H;  2I6S A;  3V13 A;  3VB7 A;  3F9F A;  3OTJ E;  4BAQ B;  1TAB E;  3SJ8 A;  1P01 A;  4ZHL U;  1YY3 A;  1C4U 2;  3SN8 A;  3LKW A;  1SGF A;  3SV8 A;  5JBT A;  3QZR A;  4BXS A;  5JPM H;  2ANM H;  2EY4 C;  4U30 A;  1QTF A;  1QA7 A;  1A2C H;  4FU8 A;  5EIY A;  2FYR A;  2XCN A;  2IN2 A;  2HLD D;  2GVF A;  4FET A;  1GHB F;  1TA2 A;  1EZQ A;  3S9A A;  1TGS Z;  1EB2 A;  3B23 B;  1UMA H;  3LGY A;  1O36 A;  1SGN E;  5HXF A;  4BAH B;  4O3T A;  2OCV B;  1C2H A;  1D6W A;  4Y79 A;  4ABI A;  5AF9 H;  4ZKN U;  3SBK A;  4DOQ A;  3IIT A;  3GOV B;  3V12 A;  4JYV H;  3TPI Z;  3HAT H;  1ELB A;  1CE5 A;  4ZHM U;  3GCH C;  2Q6D A;  3LON A;  3ODD A;  5A8Z A;  5A0A E;  1QR3 E;  1WYK A;  1GBL A;  2GDD A;  2QIQ A;  4UDW H;  1K21 H;  2IPH A;  1QZ8 A;  1TRN A;  1C2J A;  3D65 E;  3P8O A;  1A46 H;  3EYD A;  4TYD A;  2BD3 A;  4YO9 A;  1BTU A;  3KNX A;  2QXH A;  1TX7 A;  3CEN A;  1A0H B;  1WCZ A;  3QTV H;  2EI8 A;  1O2V A;  3KQ5 A;  4WH6 A;  5EQQ A;  3OYP A;  1G36 A;  1AUJ A;  1GBB A;  1FN8 A;  1FAK H;  1IQH A;  1V3X A;  3DFL A;  1K9O E;  1NRS H;  2JDI D;  5CHA C;  4QT8 C;  5JB9 S;  1DM4 B;  1GVL A;  2PKS C;  2D2D A;  2G51 A;  1CGJ E;  2Y81 A;  2O8W A;  1CU1 A;  1DDJ A;  1FQ3 A;  2YNB A;  5DG6 A;  1MD7 A;  1PQA A;  1NU9 A;  1EJA A;  2BQW B;  3I77 A;  4Y0Z E;  1O2O A;  5DP3 A;  4D7G A;  2WPK S;  1O34 A;  1TNJ A;  2ZGX H;  1FY1 A;  1KXC A;  2J38 A;  3QGN B;  1ETS H;  1ZGI A;  1GHA G;  1PPH E;  4H6T A;  4ABG A;  1GG6 B;  1AMH A;  1G30 B;  1V2T T;  2XBY A;  1GI4 A;  2OUA A;  2GV7 A;  3CNR A;  1IQF A;  1O3H A;  1SGY E;  5EU8 A;  2W26 A;  4MNX A;  1BBR K;  3N7E A;  2GCT C;  2P94 A;  2FP7 B;  3A87 A;  1NES E;  2BD5 A;  2OQ5 A;  1E38 B;  2O9Q A;  3A89 A;  4I31 A;  1LKB A;  4UFF H;  2PSX A;  3VFE A;  2BOH B;  4D8N A;  2Y5H A;  2Q6G A;  1UTK A;  2JIZ D;  1ELA A;  1WSS H;  1P57 B;  4PRO A;  1HJ8 A;  1VR1 H;  1YPH C;  2Y5F A;  1SOZ A;  2ZEC A;  3D49 H;  1TE0 A;  2QAA A;  3B9F H;  3BEF B;  1QGF A;  2Y82 A;  1W0K D;  1SFQ B;  1QHR B;  1BHX B;  3QDZ B;  4Z0K A;  1LQE A;  3WWF A;  1SLX B;  1QIX B;  2SFA A;  3BEI B;  3RXV A;  2ZDL A;  3ZV8 A;  2FM2 A;  3E91 A;  3FZD A;  2VVC A;  2PLX A;  3TJN A;  3AAV A;  2G55 A;  3RLW H;  4RN6 A;  1RFN A;  1D3T B;  1SGE E;  2ANW A;  3KN2 A;  2VID A;  3UNR A;  3GYL B;  1P0S H;  1YF4 A;  2F83 A;  4YOG A;  5LPR A;  1F5K U;  1T32 A;  3BG4 C;  4IC6 A;  3MH5 A;  1P04 A;  2NU3 E;  4AG1 A;  2V3M A;  1EUF A;  2A1D B;  3MHW U;  4XBD A;  4UON A;  2NU2 E;  3PLP A;  2G4U A;  1UW7 A;  2QF0 A;  5H4I B;  3QWC H;  5HYO A;  1AZ8 A;  3ATK A;  1ARC A;  3URC A;  5HM9 A;  5EXN A;  4Q7Y A;  2VIN A;  3SU6 A;  1P2M A;  1S0R A;  1TMB H;  4NFE A;  3MYW A;  3LH3 A;  1GCD A;  1P8V C;  2XBV A;  3ATL A;  4JZD H;  1HV7 A;  1TBR H;  1VZQ H;  2ZP0 H;  2PFE A;  4FXG H;  5E0H A;  4Q2K A;  2K8I A;  3SI3 H;  1DXW A;  3I78 A;  4X2Y A;  5G4B A;  4NZQ A;  3A81 A;  1HXE H;  3ITI A;  2YOL A;  1EX3 A;  4B2C A;  1AO5 A;  4YZU A;  2GGV B;  2J94 A;  1XKA C;  1ZZZ A;  4NA9 H;  1ZHP A;  3PRB A;  1O5E H;  1NFY A;  1EPT B;  3M37 A;  4Y7A A;  3SU3 A;  1AE5 A;  4AFS A;  1EFR D;  2QF4 A;  2FTM A;  4CR9 A;  2OQU A;  3OU0 A;  3LJJ A;  1DWE H;  1KDQ B;  1C1W H;  2UUF B;  3SOS A;  1D9I A;  1WUN H;  3KF2 A;  1BJV A;  2ZU3 A;  1MKW H;  2SGQ E;  3DSP A;  5DP9 A;  1Y3X A;  3NUM A;  1ARB A;  1F0R A;  4O03 A;  3VEQ B;  4XSK U;  5GJ4 B;  1EP5 A;  3T25 A;  1WQS A;  3MH7 A;  4KTU A;  1JRS A;  1ANE A;  3RC5 A;  5F8Z A;  3F0O A;  4TSF D;  2OBQ A;  3UY9 A;  2QN5 T;  2Z9L A;  1Y8T A;  2V6N A;  4RI0 A;  5LPF A;  4A1V A;  1E79 D;  1P03 A;  2AGI X;  2JH6 D;  1W10 U;  3RLY H;  4AB8 A;  1HAX B;  3M5N A;  1YWU A;  2WPH S;  3AW0 A;  1PQ5 A;  3RXJ A;  2XRC A;  1GBH A;  1DUE A;  2PTC E;  3VB4 A;  1SVP A;  3WW7 A;  2ZG0 H;  4I33 A;  1FPH H;  1O3O A;  2BD7 A;  3W1E A;  4I8K A;  2JH0 D;  3SI4 H;  1Z6J H;  2ALV A;  3K6Y A;  1VGC B;  1J8A A;  3MNS A;  2ZCK P;  1C2K A;  4CH8 B;  4RSP A;  4IBL H;  4K60 A;  4P00 A;  2FS8 A;  1SQO A;  2QXJ A;  1K28 D;  3ZZ7 A;  1LO6 A;  4NIW A;  5GPI B;  1GBK A;  1RD3 B;  1S0Q A;  1TOC B;  5EOD A;  3SV2 H;  3BTG E;  3TGJ E;  1HBT H;  1ZMJ A;  2J95 A;  4MDS A;  2BDI A;  2NWN A;  1QL9 A;  2FXR A;  1AUT C;  2FI3 E;  5EPN A;  1DWC H;  3RMO H;  5C20 A;  4HGC A;  2GT7 A;  3MNB A;  4ISI H;  1WAY B;  3M3S A;  1YLC A;  1GMH G;  3PTN A;  4KKD A;  4VGC C;  4XBB A;  1O2T A;  1OWI A;  3PMJ A;  4CBO A;  2R2W U;  5A09 A;  1BML A;  2SNW A;  4WMD A;  3VPK A;  2DE9 A;  1KXB A;  2AER H;  2G5N A;  3A7V A;  1L4Z A;  1ZYO A;  1O37 A;  1MZD A;  1QNJ A;  5EOK A;  1Z8G A;  1J16 A;  3GYM A;  1J9C H;  4ZCN A;  4AOQ A;  1BHX F;  4BOH A;  2G00 A;  3PTB A;  1V2S T;  1C5Q A;  2ZNK H;  3Q00 A;  2BM2 A;  2ZFP H;  3PV5 A;  1GHA F;  1O2X A;  2KCP A;  1IQJ A;  4X2W A;  3P17 H;  5ETX A;  1L1G A;  1ETR H;  1O35 A;  3ZYD A;  1AE8 H;  4GUX A;  1NRP H;  1V6D A;  4BNR A;  1O2N A;  1TGB A;  3SU4 A;  3AVZ A;  3SUG A;  1SFI A;  4TPI Z;  2DE8 A;  1YPM H;  2FDA A;  4ZAE A;  5F8X A;  2BOK A;  1UTM A;  1K1J A;  2OLG A;  1KTS B;  3UOP A;  1ZSJ A;  4M9F A;  2L6O A;  1FY4 A;  3U98 H;  2C4F H;  4LK4 A;  4MPU A;  4OS4 A;  1BA8 B;  1F0S A;  1FON A;  1ZOM A;  1ZRB A;  3ZZ8 A;  1KLI H;  2J5U A;  3B8J A;  2O8U A;  2ZC9 H;  1PPG E;  4K2Y A;  1C5Z B;  2H2Z A;  3EST A;  1BQY A;  2R2M B;  1AQ7 A;  5T6G A;  2KM0 A;  2RA3 A;  1THR H;  1DIC A;  3URD A;  1V2R T;  1NTP A;  2CN0 H;  4XOJ A;  2EC9 H;  3TH4 H;  4ABE A;  1C1N A;  1GBF A;  1O5C B;  4FUG A;  1H8D H;  1TNL A;  3GCT F;  3LU9 B;  1NBM E;  2H9T H;  5DP5 A;  1HDT H;  1SBW A;  3BIU H;  3RML H;  1SLW B;  5JBA S;  1UHB B;  1P9S A;  2ZZU H;  2BDB A;  1C5X B;  1KLJ H;  1TRM A;  7EST E;  3CP7 A;  2KCO A;  5L6N H;  4CBN A;  2ODQ A;  1IAU A;  2Z7F E;  4FUE A;  1EAI A;  6CHA B;  2ILN A;  1W14 U;  1V2Q T;  4MTB A;  1AVW A;  4K1S A;  2YMS B;  4WXI A;  1PYT D;  1WOF A;  1ZSK A;  1RIW B;  4X2X A;  1V2U T;  5EW1 H;  3LGV A;  2BQ6 B;  4WF8 A;  2ZHF H;  1BDA A;  2BTC E;  2P95 A;  1TX6 A;  3FKS D;  1C5P A;  1BT7 A;  2BDG A;  4Z6A H;  1O3F A;  3LGU A;  1VKY A;  3TGK E;  5EGM A;  1AFQ B;  5BPE A;  2A45 B;  1N8O B;  4X1N U;  4GAW A;  2DUC A;  2PGB B;  3ZYE A;  1EAT A;  1TGN A;  1XUH A;  2Z3C A;  2ZTY A;  4AFQ A;  1ZMN A;  5CMX H;  5E8E H;  1FAX A;  3FZZ A;  3H7O A;  2BMG B;  2F4L A;  1SI5 H;  1GL0 E;  4AX9 H;  1H8E D;  2A4Q A;  3MNC A;  1W8B H;  3TK6 A;  3PO1 B;  3U8O H;  5DO4 H;  4I8G A;  1O3C A;  2AMP A;  5AFZ H;  1MTS A;  1QUR H;  3GY2 A;  1Y3V A;  5A0B A;  1AD8 H;  4UFD H;  4MPX A;  3U28 C;  1YPJ H;  5C5O A;  3GY6 A;  1GI9 B;  1BTZ A;  3A7X A;  1MQ6 A;  5CHB A;  2FMJ A;  1ZJK A;  3BSQ A;  5F53 A;  2CF8 H;  2ZGH A;  1HB0 B;  2QF3 A;  3AK5 A;  2HVY B;  1BMM H;  1P9U A;  1W0Y H;  4JMY A;  1GJ6 A;  4KTS A;  3A86 A;  3SV7 A;  1P3E A;  3T62 A;  2KFW A;  4XDE A;  1F5L A;  2AEI H;  3RP2 A;  3RDZ A;  1C4V 2;  3DT0 H;  3Q77 A;  1YM0 A;  2WUC A;  1O5F H;  2UUK B;  3HGP A;  2ALP A;  2BD9 A;  1IQK A;  1O30 A;  3LJO A;  1C1V H;  1VCP A;  1GPZ A;  2TBS A;  1KDQ A;  1NFU A;  3E3T A;  5EQS A;  5GND A;  3NXP A;  5C0U A;  1PQ7 A;  5F8T A;  3LGW A;  3MI4 A;  1GJD B;  4JZI A;  4NIY A;  2R0L A;  3NK8 A;  2ZPQ A;  4MNY A;  4Y71 A;  4AYV B;  1TNG A;  2HGT H;  2ZIQ H;  1O2I A;  2NU1 E;  1KTT B;  3TJO A;  1GDN A;  2OC0 A;  5C5N A;  2ZDV H;  4X6N A;  1GI5 A;  4MPV A;  1CT4 E;  1MKX H;  1C5M D;  1TMT H;  2FOG A;  2D8W A;  1DIT H;  1QJ1 B;  4OS6 A;  4ZXY H;  4CRE A;  3NWU A;  4MNV A;  3HKI B;  1FJS A;  1DE7 H;  1PQ8 A;  4U32 A;  1Z8J B;  1YGC H;  3LT3 A;  5JBC S;  1ABJ H;  1BCU H;  3ZVG A;  1BUI A;  4ASH A;  2UWL A;  1C2G A;  1LMW B;  1YPE H;  3PV4 A;  1SGD E;  1ELT A;  3BTT E;  4YTA A;  1TPO A;  3F3B A;  2HOB A;  3L6P A;  1A5H A;  2QXI A;  3GDS A;  1NM6 A;  1GMH F;  3OY5 U;  4ABJ A;  1BOQ A;  1S84 A;  3H5C B;  1Y3U A;  3MH6 A;  2H9E H;  1C5N H;  1HJA B;  2VWO A;  2FTL E;  4CHA B;  1NRR H;  2R9P A;  1MCV A;  2ZPS A;  3OEH D;  3MU0 A;  3MOC A;  1V2K T;  3E90 B;  3VB6 A;  1WDI A;  3FP6 E;  4JYU H;  3DUX H;  2B0F A;  1V2P T;  3A82 A;  1ELC A;  1ELV A;  3A7Y A;  3UTU H;  4HTC H;  2ULL A;  1FNI A;  4CH2 B;  3EQ0 H;  2JET B;  4NA7 A;  3TNS A;  1P06 A;  3QK1 A;  4I7Y H;  8GCH G;  1FUJ A;  3OSY A;  3TNT A;  3DSG A;  4ISH H;  4GHT A;  1TB6 H;  1EKB B;  3JZ1 B;  1LQD B;  4X1R U;  2AS9 A;  2Y5G A;  2EEK A;  4WMF A;  3SJO A;  1LVO A;  4HI3 A;  1LHD H;  5J4Q A;  2ZCH P;  4AC9 A;  5AHG H;  2OC7 A;  1QRW A;  1S6F A;  1BTY A;  2BD2 A;  4MQA A;  1O2P A;  1SOT A;  1RJX B;  1NO9 H;  3URE A;  1E35 B;  1YLD A;  5TJX A;  3D23 A;  2Q6F A;  2P3U B;  4DVA U;  5A2M H;  5DJ7 A;  2GMT B;  4BAO B;  4JZE H;  4OS7 A;  4Y11 E;  2CHA B;  1UTJ A;  1RS0 A;  3T28 A;  1SB1 H;  2V35 A;  2RDE A;  3FOA A;  1DXP A;  2VB0 A;  4H6S B;  2GP9 B;  5A0C A;  5C2Z A;  4F55 A;  2VU8 E;  1MAY A;  2Z9I A;  4HZH A;  3TU7 H;  1MU6 B;  2OK5 A;  3SZE A;  1RGQ A;  5EXL A;  5DPA A;  2PKA A;  1EPT C;  3CS0 A;  2XXL A;  2A4G A;  5C17 A;  3EA7 A;  3F2H A;  1ZHR A;  2BZA A;  4FUI A;  1ANC A;  4A7I B;  2W7S A;  1LHE H;  2F9V A;  1AND A;  3FAN A;  6GCH G;  2HRV A;  3E0N B;  1TNH A;  4UEH H;  3SUE A;  5CE1 A;  3MO9 A;  1S6H A;  4IN2 A;  4X6O A;  2FZZ A;  2P59 A;  2XTT B;  2BDC A;  2SNV A;  1A3B H;  1DSU A;  1ZPC A;  4Y10 E;  1UCY E;  4AFZ A;  1ZHM A;  3GY7 A;  2GX4 A;  4E7N A;  1H4W A;  1SL3 A;  2JJ2 D;  8LPR A;  5DSF A;  2J92 A;  1GHY H;  3F68 H;  4H42 U;  2WPI S;  1A4W H;  4ZUH A;  1HYL A;  3GY8 A;  3KGP A;  1ZML A;  1YCP K;  4RKO B;  1LPZ B;  2EST E;  2RG3 A;  2QYI A;  1S5S A;  3F2G A;  3RXB A;  3RXS A;  1OWD A;  1D3D B;  3SO3 A;  3MWI U;  3OY6 U;  4DT7 B;  1T8N A;  1V2J T;  3EGK H;  1LKA A;  4FUD A;  1EOL A;  5IYT A;  3SU1 A;  2XNI A;  5JBB S;  1OS8 A;  1NFW A;  4ZRO A;  3A80 A;  3S0N A;  5DP6 A;  1O3B A;  1G3B A;  2F9P A;  2ZHW H;  1AY6 H;  1KY9 A;  1UHB A;  4YES B;  4AGK A;  3RXF A;  2J98 B;  3W94 A;  1K1I A;  2FWW A;  2RDL A;  3FP8 E;  1TWX B;  1WBG B;  1HAY B;  1N6X A;  4AFU A;  5LPE A;  1H8I H;  5KED A;  1Q2W A;  5E2O A;  1O2U A;  3RM0 H;  2ODP A;  1VGC C;  9EST A;  2KZ4 A;  4TY6 A;  1TAW A;  3ZZ5 A;  4Y8Y A;  4YT6 H;  2A31 A;  4ACB A;  4K1T A;  1Y5B T;  2ZGJ A;  1O5G H;  3GCT G;  3KQD A;  3QUM P;  3ZZA A;  3I29 A;  4MNW A;  2EA3 A;  4CRG A;  2LNC A;  3SGB E;  3UQO A;  1IHT H;  5BRR E;  1CT0 E;  1C5V A;  1Q3X A;  1W2K H;  7GCH G;  2XWA A;  3K6Z A;  2VIV A;  3M3T A;  1JMO H;  5IDK A;  3QTO H;  3SGA E;  1C2I A;  1NN6 A;  4Y7B A;  4Y76 A;  4Q7Z A;  3ENS B;  1AB9 B;  2R3U A;  2ZFF H;  2BQ7 B;  3RXP A;  1C5Y B;  1TNK A;  2WIN I;  2AGG X;  1QJ7 B;  1XXD A;  1GJ5 H;  4NZL A;  1EQ9 A;  2ZU4 A;  3STI A;  3SV6 A;  3UOU A;  1P2I A;  4FU7 A;  3KHV A;  4MG3 A;  5DKM A;  1DT2 A;  1O3D A;  1C5W B;  3RXH A;  1CHG A;  3GCH B;  1JIM A;  1EP6 A;  1LVY A;  2HNT C;  3KQB A;  2Z9K A;  1TYN A;  4RKJ B;  2O8M A;  4ABF A;  3AAS A;  3UB0 A;  4BTI B; 
#chains in the Genus database with same CATH homology
 5EQR A;  1W0J D;  3SV9 A;  3F2G A;  4U01 A;  3F0O A;  1BMF D;  4TSF D;  1NS3 A;  2OBQ A;  2QF5 A;  4Q63 A;  3O8D A;  2XOK D;  3RC4 A;  3SU1 A;  2XNI A;  3KN2 A;  4RI0 A;  4A1V A;  4B71 A;  5CHB A;  1E79 D;  4M9F A;  3SYJ A;  2L6O A;  5F53 A;  4K8B A;  3M5L A;  3LON A;  5FPT A;  3DSO A;  2WPD D;  3M5N A;  4NWL A;  4OM9 A;  3M5M A;  3SUD A;  1E1R D;  4A92 A;  2WHX A;  3AK5 A;  4A1T A;  2IJD 1;  1COW D;  2J5U A;  3OEE D;  3OAA D;  2KCY A;  3P8O A;  5H4I B;  3WW7 A;  4B75 A;  4I33 A;  2OC8 A;  2YMS D;  3EYD A;  4JMY A;  3N99 A;  4Q4L A;  4TYD A;  3W1E A;  3SV7 A;  2CK3 D;  3KNX A;  2KFW A;  2KM0 A;  3O8R A;  1H8H D;  4WH6 A;  3M5O A;  5EQQ A;  2F9U A;  2OC7 A;  3OTP A;  2IJO B;  3OYP A;  2XCF A;  3RC5 A;  2K1Q A;  2KZ4 A;  5T1V A;  2OBO A;  2JDI D;  3SU6 A;  3P8N A;  3OE7 D;  2W6I D;  5C0T A;  2AHM E;  3N7D A;  5GPI B;  3E90 B;  1NBM E;  1FX0 B;  1CU1 A;  4DT4 A;  3RC6 A;  1NBM D;  3NRL A;  5EQS A;  5GND A;  5C0U A;  3LOX A;  2FOM B;  3UB0 A;  2K8I A;  3ZIA D;  3PRD A;  3WWB A;  1DXW A;  1W3C A;  2A4R A;  2KCO A;  3SU0 A;  3FOA A;  5EPN A;  1DXP A;  2YOL A;  3SUF A;  2QV1 A;  2WV9 A;  3DCL A;  3H09 A;  5FPS A;  2F43 B;  3PV2 A;  2GGV B;  1SKY E;  4F55 A;  1N1L A;  3U1I B;  5IDK A;  1DY8 A;  2OC0 A;  2WZQ A;  3OFN D;  5FPY A;  4B76 A;  4ASU D;  1WXR A;  2KCA A;  3PRB A;  2YMS B;  2OK5 A;  1MAB B;  3SZE A;  1RGQ A;  2V7Q D;  4XD7 D;  2YMS C;  3KEE A;  4B6F A;  3SU3 A;  4Z1M D;  1JXP A;  2KR7 A;  2QE7 D;  3SU2 A;  2W6J D;  1RTL A;  2VBC A;  1EFR D;  2QF4 A;  2A4G A;  4WH8 A;  5C17 A;  2XND D;  4I32 A;  3F2H A;  3N7E A;  3SU5 A;  2OIN A;  4WF8 A;  2FP7 B;  5IK2 D;  2K0Q A;  3SV6 A;  4A1X A;  2F9V A;  3FKS D;  1S6L A;  3LKW A;  4R8T B;  1KMH B;  1BT7 A;  4I31 A;  3SV8 A;  3F3B A;  1DY9 A;  3SUE A;  4ZCN A;  2WSS D;  2P59 A;  3FO8 D;  3L6P A;  2M2A A;  3VG8 A;  2LEL A;  5CDF E;  3KF2 A;  5FL7 D;  3U1J B;  3PV5 A;  2JIZ D;  5EPY A;  3GS9 A;  4B73 A;  2KCP A;  3O8B A;  1E1Q D;  2XCN A;  3F2F A;  5ETX A;  2HLD D;  2GVF A;  2O8M A;  4FET A;  2JJ2 D;  4B74 A;  5DSF A;  3O8C A;  2JJ1 D;  3DSP A;  1W0K D;  3FN8 A;  4NWK A;  4YXW D;  2F4L A;  4KTC A;  4TT3 D;  3SU4 A;  4B6E A;  5B6L A;  1H8E D;  2A4Q A;  3WWF A;  3SUG A;  2OC1 A;  3OEH D;  5DN6 D;  5ESB A;  5GJ4 B;  1A1R A;  2FM2 A;  5HKK D;  3F0P A;  1OHH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...