2LELA

Structure of cu(i)cu(ii)-copk from cupriavidus metallidurans ch34
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
b'VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper resistance protein K
publication title Molecular basis of the cooperative binding of Cu(I) and Cu(II) to the CopK protein from Cupriavidus metallidurans CH34.
pubmed doi rcsb
source organism Cupriavidus metallidurans
molecule tags Metal binding protein
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2lelA00
3DSPA 3N7DA 2K0QA 2LELA 3N7EA 2KM0A 3DSOA
chains in the Genus database with same CATH superfamily
1HPGA 4I86A 5LGOA 2ZQ1A 4FXGH 1UK4A 2BVXH 5C5NA 2IJD1 1GMCF 3OFND 6ESTA 1AFQB 1GJ7B 1GI1A 2JH6D 1YLCA 5HM2A 1C1RA 3RMMH 1Y5UT 1D6WA 2W3KA 2A45B 1AN1E 1QHRB 1GJCB 4KELA 5GPIB 1ETSH 1GI5A 2G00A 1QL9A 2XNDD 2FDAA 1XUIA 1KXBA 4Z6AH 1JWTA 1EZSC 1QY6A 1EJMA 1MMJN 1SR5C 4ZUHA 1PYTD 2FOHA 4CRBA 4X1PU 1D9IA 1QB9A 1TONA 1Y5AT 2EI7A 1C1UH 4H42U 3E16B 2QE7D 4HI3A 1WCZA 1O2OA 1F92A 1TPAE 2OQ5A 2BD5A 4YOIA 1V2KT 4K8BA 1O2YA 4I31A 1XUFA 4H6SB 4ZXYH 3MH4A 3FP8E 2UWPA 1BTZA 2XOKD 3N7OA 4O3UA 1WV7H 1A1RA 1A3EH 3BG4B 1UTNA 2UUFB 1NRQH 3LIWA 3P92A 3RXFA 1GI0A 2UUJB 1LHEH 3V13A 2BD3A 3RXAA 5ABWA 1B7XB 3U8RH 2AMDA 1Y3UA 3RXJA 2ZHDA 3V12A 1BRUP 2ZDMA 1SL3A 5T3HA 5A8XA 2J98B 3MU0A 1J17T 2BOHB 2AGIX 1V3XA 1F0UA 4YO9A 1K1IA 1NRPH 4Y71A 4CRGA 3K2UA 1ZMNA 3F2FA 1F2SE 1LQEA 1AE5A 1UCYK 2P8OB 4Y8ZA 3URDA 2B9LA 4Z1MD 1HJ8A 1BHXB 2FI3E 2AEIH 2A4GA 1SLWB 1UCYE 4K1SA 4UONA 2NU0E 3MH7A 4I33A 5BPEA 3U1JB 1KTSB 3AW1A 3MH6A 1TA6A 2IPQX 1C5UA 2QC2A 1C4Y2 2XCFA 3UTUH 1V2RT 1YPEH 2JIZD 1A5HA 4FUFA 1V2LT 4X6PA 3F9HA 4RKJB 2VWOA 2GCHG 1NM6A 1JIRA 1IOEA 2IPHA 4BANB 4IGDA 1ETRH 2FM2A 1TMTH 1A2CH 1CE5A 2WSSD 4P02A 4HG6A 4NFFA 2FESH 4RSPA 1GL1A 2A32A 3U8TH 3JZ1B 5F53A 2TPIZ 3ZVBA 1C5RA 3STJA 1GI8B 5GCHF 3ATWA 4NA7A 3BTQE 3PMBB 1GHBG 3DSPA 4I8JA 1CT4E 2P3UB 2FOFA 2VVUA 3UR6A 2ZGHA 1O3JA 3TNSA 4LZ1H 1KIGH 2F9PA 4WH8A 1CA0C 4X6MA 4BAMB 1LPKB 2Z9IA 1O39A 3KYGA 4NG9H 1V2TT 2GCTC 5BRRE 2KFWA 4HGCA 1K1LA 2FIRH 1UCYH 1CA8B 1GBHA 2XBWA 2FP7B 4OGYA 1GHBF 3H7OA 4BTTB 1ZSKA 1NC6A 3SV9A 1J9CH 2BX4A 4X2WA 2J38A 1O33A 2BVRH 1AUJA 1QJ7B 4UDWH 4SGAE 1TMUH 3BTDE 3QZRA 3RXDA 3M61U 3VXEH 3RXRA 3ZZBA 3TH4H 5T6FA 1TA2A 1JBUH 2RDEA 1ELCA 2STBE 3PYHA 4FUDA 4IMZA 3TITA 2J98A 1ARBA 2J5UA 2F83A 3R3GB 3ITIA 2J9NA 2ZU1A 1C5MD 3ZVCA 1O2KA 1D3PB 1V2NT 1PPZA 1GCTC 1UJ1A 4BAOB 1P2JA 3E3TA 1RGQA 4A1XA 2J94A 2BDHA 2Z6BD 2QYIA 2XCNA 1YPJH 2C8XB 4ZKSU 5DPAA 3I77A 1SGCA 2R2WU 3A7VA 5HIZA 2PGQB 1G3EA 1O2PA 1QL7A 1C5WB 2HVYB 1N1LA 1WXRA 1DDJA 2GZ8A 2ZDVH 2C3SA 1ZSLA 1SGQE 4TPYA 3GCHC 5A0AE 1EFRD 1ZTLA 1NZQH 1O31A 4X8TH 2PW8H 1BTYA 2OBOA 2PP6A 1ELBA 1V6DA 5FX5A 3M5LA 1HDTH 5DP7A 5JDUB 1ZRBA 1LPGB 4NIWA 3QN7A 1OWHA 1H9IE 2A5AA 3QUMP 4MPUA 3EE0B 2AGGX 1RTFB 3E6PH 5C5OA 3SGQE 5FCKA 1P2KA 3NWUA 4OM9A 4UFGH 3TGIE 3BTTE 6CHAB 1AZZA 1O37A 1OWKA 5CDFE 1HAGE 1O2LA 2ZHFH 1HBTH 3NKKA 4J2YB 3ZZDA 1GHXH 1GHWH 4F4OC 1KMHB 1O2SA 2KX4A 2FX4A 3P6ZB 1Z7KA 1DOJA 5EPYA 2VWLA 3EQ0H 1GMDG 1TBZH 2XXLA 4X1NU 4AZ2B 2WPDD 2BLOA 1TNIA 2QXIA 1BMFD 4CRFA 3SV6A 5A8YA 2Q6GA 1YBWA 1OOKB 1P2IA 2JETB 5DP5A 1CGJE 2ULLA 1GBEA 1RIWC 3RU4D 2H6MA 1GMDF 3PRBA 1NRRH 1ZHPA 1YPHC 4NZLA 4CHAB 2HNTE 1C2GA 4FVDA 1D4PB 3ZVFA 2D26C 2PSXA 5EODA 3HGNA 2VNTA 4YOJA 2IN2A 5L30H 1E1RD 4YT6H 4JYTA 1YGCH 2VJ1A 4CRCA 3DFLA 2A4RA 1D3QB 1CHOG 1IHSH 2L74A 1P57B 1T4VH 2ZU4A 3SOSA 2G51A 2P94A 4MPVA 1W14U 4ABDA 1KXEA 1GJ4H 2FOAA 1HAYB 1ELGA 1HLTH 4GPGA 3BTGE 5LPFA 1Y5BT 1UW7A 1O2HA 5A2MH 1VJ9U 3U8OH 3FP6E 3VG8A 1BTHH 2Y5GA 5B6LA 5FBEA 4E06H 1AUTC 1FY3A 1CA0B 2FS8A 2Y6TA 2TBSA 1WAYB 4DT7B 2WUBA 2GCTB 5HXFA 2EI8A 2OC1A 2VIWA 3ZZ7A 1EZQA 2G8TA 2C4FH 1SGEE 1HUTH 2ANKH 3FKSD 2BD8A 3GISB 3GY6A 4TWWA 1LHCH 1L1NA 1ZGVA 5EJLA 1HRTH 2PV9B 3H5CB 4IMQA 1H8HD 2VVVA 5LPEA 4AX9H 2GMTC 3VB4A 4D9RA 1FAXA 3HPTB 3ZYDA 5DJ7A 1E37B 4BAKB 4GUXA 4OS4A 1C4V2 3GICB 5FX6A 1UTPA 2J34A 1BDAA 1GBMA 1TB6H 2H5DA 2OQUA 3E90B 1TRMA 4XBBA 4J1YA 1CGHA 2VVCA 3O8CA 2IJOB 1ZMJA 1GCTB 1W7GH 3RXOA 2Z9LA 1IQLA 1EB1H 3F6UH 2R0KA 3RMOH 1GL0E 1XMNB 9LPRA 3EA7A 1EB2A 1QQ4A 2EEKA 3U98H 1ACBE 2C8ZB 1VCWA 5H4IB 2J97A 2KCOA 1O5FH 1BRBE 1V2UT 1Q31A 2ALPA 2OBQA 4FUBA 1O3GA 2PTNA 1S5SA 4DCDA 4HZHA 2V6NA 1VGCB 4BXSA 5C0UA 3GCHB 5EQRA 4E7RG 3S0NA 3PO1B 4K1EA 1O5DH 4DJZB 1ESTA 3A86A 3STIA 4KKDA 1MAYA 2AIQA 3SNAA 2ZDAH 1FMGA 3W1EA 5EJ1A 2BXUH 1K21H 3LC3A 4NA9H 3UOUA 4AB9A 4O9VA 2I6SA 1C9TA 1V2ST 1WU1A 1XUJA 1GHAF 3S9AA 1SHHB 1UTKA 1FNIA 1AQ7A 1JOUB 1W11U 3MNXA 2HNTF 3QX5H 1GJ9B 1BJVA 1QBVH 2ZPRA 2OINA 4B2CA 1FV9A 1C2IA 1SGFG 3GCTF 4UE7H 2BY9X 3OTJE 2J2UA 2ZU3A 1CT2E 2Z9GA 5KECA 1NT1A 3RXVA 3TNTA 3L3TA 1ZGIA 1K1OA 3AASA 4JZDH 2NWNA 2G55A 5FCRA 4O97A 3A7TA 2K8IA 1SGRE 3A8AA 2D1JA 3SO3A 1RIWB 2A4OA 2XBVA 4U2WA 5K0HA 4B1TA 1VITH 4YM9A 1BHXF 3M5MA 3TK9A 1TGTA 1HCGA 1OXGA 4ISNA 1S82A 4ABGA 3SGBE 2KAIB 5G4BA 2XC5A 3SGAE 5C1UA 1YCPM 1OSSA 3S9BA 1HJ9A 1G36A 1HV7A 5I25A 1A5IA 1NTPA 1UTQA 4BAQB 1EXFA 1SGNE 1YP9A 4Q4LA 2PTCE 2CMYA 2QF5A 4OS6A 3RP2A 4DIIH 2Y7XA 3SUFA 3E0PB 5IYTA 3SU3A 2CHAC 4UD9H 1L4DA 1PPEE 2ODPA 3Q3XA 3QDZB 1D3TB 3SNEA 1MD8A 1UVOA 3A88A 4TYDA 3MO9A 2NU2E 2XYAA 3MH5A 3A8BA 1P2NA 1E36B 2ZDNA 3M5NA 1FN8A 2CGAA 1BRAA 2ANWA 5F8TA 3N7EA 1ZRKA 1AWHB 2GMTB 3M35A 3TK5A 1SGYE 1JIMA 1O5EH 2VBCA 4K3JA 1E34B 4LK4A 5C67A 1UO6A 3M3VA 1P3CA 2BQ6B 1ELFA 3D65E 1JXPA 1EQ9A 3ZYEA 1G3BA 2OP9A 1PFXC 2V0BA 1GVKB 1A0JA 1GBTA 2Z3EA 3ATLA 3GYMA 3HK3B 3IITA 1Z8JB 3ZVDA 3DFJA 5L2ZH 1C2FA 1WSSH 1ETTH 2KCAA 1VITF 4CH8B 3SU2A 1GWAA 4AGKA 3CS0A 5TCAA 1GJ5H 5A0BA 2K0QA 3VFEA 1O38A 3RXBA 1H4WA 3QK1A 1EP6A 4D7GA 1XKAC 3RXHA 4GSOA 3D23A 5FPSA 4NSYA 1LVMA 2FXRA 2Z3CA 1TWXB 1TIOA 1DY8A 1Z6EA 3NCLA 3SV8A 2QIQA 5JPMH 4Q2KA 2SGDE 4TY6A 3MYWA 1LVYA 3UQOA 2BMGB 3SU6A 3PWCA 2PKSB 5DP6A 3EYDA 4ACAA 1NFWA 2Q6FA 3OEED 3W95A 2JKHA 1Y8TA 3QZQA 2RA3A 5AVDA 3SNCA 1BBRK 1DE7H 2BTCE 1C2HA 1SGDE 1L2EA 3PLKA 3RXMA 3F2HA 2XNIA 2Z3DA 3RC4A 4DT4A 1S6LA 2J95A 1E79D 1G2LA 1BBRE 2GTBA 2A0QB 2QF0A 2ZECA 4K2YA 2KAIA 3H09A 5LPRA 1A4WH 3W94A 1G2MA 2EA3A 1HB0B 2ZFRH 4MG3A 2ILNA 4Y0ZE 1NFUA 1PQ7A 1EUFA 1NRSH 3C1KA 1XKBC 3K65B 3LPRA 1DX5M 2PR3A 2F3CE 3EE7A 4XE4A 1GMCG 2SGQE 1ELTA 1T8NA 3PB1E 4AYYB 3BG8A 1V2PT 3T29A 1K2I1 4TSFD 1MKWH 3GDUA 1INCA 1C5PA 1SVPA 1QJ1B 1O2XA 1W0YH 1P06A 1E0FD 3TH3H 2JH0D 2PSYA 3E1XB 1SGPE 2AMPA 1NY22 5KEDA 3SU4A 2RG3A 1MBMA 3U28C 3K6ZA 3NK8A 2FS9A 1ZPCA 1ABIH 4ACBA 3P17H 5CHAC 1F0SA 3NXPA 1AGJA 1O3OA 1DWEH 3BV9B 2F9BH 3F9FA 5EOKA 2GDEH 3QO6A 3MI4A 2ZCHP 1TGCA 3SZNA 1O3KA 4HFPB 1AD8H 1DUEA 3MO6A 3A85A 4X1RU 4GLYA 3M3TA 2FZZA 1UMAH 1UVSH 1A3BH 1Y3XA 1BBRH 1GHYH 2PHBA 2ZFQH 2VINA 5E0GA 1C1TA 1DUAA 1NRNH 1P2MA 3M3SA 4FU9A 2V3HH 1SQOA 3HK6B 3A8CA 3N7DA 2CV3A 4TY7A 7GCHF 1HYLA 2J92A 3ESTA 4ZHMU 4XSKU 3MU5A 3KIDU 5EXLA 2CHAB 2A7HA 1ZSJA 1UVUH 4NSVA 2O8WA 1F0TA 3P95A 1HAZB 4WY3A 2Z7FE 2FPZA 2ZHWH 1SHYA 3TIUA 4ISLA 1EAUA 2HWLB 1E38B 2Q6DA 4WH6A 1FLEE 1WQSA 1S0RA 5DK1A 2VB0A 3EAJA 1N6YA 1Q2WA 4MTBA 3F0PA 1DITH 1VKYA 4K60A 4WJG2 1M9UA 4U01A 4D7FA 3MMGA 1NFXA 1O2JA 2FX6A 5A0CA 1J16A 3RXIA 1LVBA 1MH0A 1AFEH 1ABJH 3F2GA 3E0NB 2QA9E 5DP4A 4X2XA 1LDTT 2ZTYA 2OTVA 1GJDB 4XOJA 1C5YB 4ABHA 2GX4A 1FPHH 2QXHA 4NZQA 2BVSH 1GVLA 1YY3A 3RXSA 1P2QA 1QCPA 3CP7A 3S9CA 1DANH 1MTNC 1XUKA 3CS7A 2ZDKA 3LGTA 5GCHG 1RJXB 1WBGB 4YESB 1O2UA 1WTHD 1C2KA 1TX8A 3ZV8A 1P10A 5L2YH 1O3PB 4MLFB 4YZUA 3NRLA 1C2EA 1C5XB 1C2LA 1QNJA 1O3AA 3KQBA 4I8GA 2AS9A 1EOLA 2BLWA 3VGCB 2H9TH 1VCPA 3PTNA 4Q80A 1ESBA 1C5NH 2VGCC 1H9LB 1N8OB 2QV1A 1AKSB 4RT1A 3MFJA 2VWNA 1RXPA 2WPJS 2BZ6H 3BTFE 1GBLA 2ODQA 1IQFA 2GZ9A 2BZAA 3VPKA 2TGDA 3ZVGA 1K1MA 5JBBS 1CO7E 1NBMD 3KYFA 1Z1IA 4I8HA 4K8YA 4ZKNU 1SMFE 3T26A 4AGJA 1RTLA 1UVTH 2OC8A 3LGVA 4H6TA 3TVJB 5AF9H 1LHDH 2HVXA 5CHAB 2A4QA 1FIWA 2BY7X 2KCPA 4BOHA 3EDXB 3UUZA 2QAAA 2K1QA 3FANA 3KQCA 5T1VA 4X8VH 1DS2E 1O3BA 2ZEBA 2BD7A 4X6NA 3SU0A 1L1JA 2YMSC 1Q3XA 3MNBA 3SI3H 5J4QA 1YC0A 5GDSH 1S83A 1GI3A 3KN2A 1SI5H 1A0HB 3VB7A 1IQJA 1QBOA 1ZTJA 5KGOA 1MZDA 4AFSA 4CR9A 4ASUD 2HPQH 1TLDA 5EGMA 2Y82A 4E7NA 5TJXA 1RFNA 3T25A 2ZCKP 4BTUB 4Y10E 3OSYA 2ZNKH 1GDUA 3CNRA 2FTMA 1L1GA 2WV5A 4ISOA 5E0JA 5TCCA 1XUGA 1C5TA 3BEUA 3VB6A 2P3FH 2WINI 3G01A 1OYTH 3SJIA 3Q00A 4ABBA 1ZJDA 1QRZA 3DCLA 1DM4B 5PTPA 3KGPA 4OS1A 1QQUA 4MDSA 3GOVB 2BD4A 3A81A 3M36A 2WYJA 4JZEH 1QTFA 3F9EA 3MU8A 2AYWA 3BTKE 1LPZB 1AIXH 2VIQA 2CF9H 1BMNH 3BSQA 3UOPA 2O8UA 4DIHH 1J15A 1MU8B 4Y76A 5EXNA 2Y81A 1MTUA 1O2WA 5JBTA 2QCYA 2W7SA 1TGBA 3LKWA 4ZCNA 1FZZA 4NIYA 1FUJA 2OCVB 3LGYA 4JCNA 3P8GA 1MTVA 4X2YA 1K1NA 1AKSA 1XVOA 3A84A 4X1SU 2PLXA 2SGPE 4Y0YE 1MKXH 4CREA 4D76A 3FO8D 1O2GH 4OS7A 1O3HA 3SV7A 2YOLA 1O3NA 1MTNB 4E05H 4WMFA 5IK2D 4NCYA 4UFEH 1MBQA 2G52A 4Y7AA 3RC5A 1A5GH 1FQ3A 1P12E 2STAE 2BY5X 2WUCA 1N6XA 3GCNA 3HGPA 2FLBH 3PM3A 1GBKA 2V3MA 2WPMS 4ZH8A 1Y3WA 1GI4A 4ISHH 4M7GA 1BTPA 1KLJH 4F55A 2M5TA 1BB0B 1O0DH 3MNSA 1LKAA 2JJ2D 5F8XA 2FYQA 1BTXA 1CT0E 1SFIA 5C20A 1DLEA 2ZA5A 2C8WB 3P8FA 1TNHA 1K22H 3L6PA 3EA9A 1DWCH 1U6QA 1ZJKA 2SFAA 3FZZA 1LKBA 1SPJA 3O8DA 1DXPA 2NU1E 1O2NA 2KM0A 4WF8A 2GP9B 3B23B 4X2VA 3NZIA 1G37A 1ARCA 1FY8E 2C93B 3ZVAA 2WPKS 1C1WH 4B6EA 5AFZH 3AVZA 1O36A 3M7TA 1CSOE 2THFB 1HAVB 1C1MA 1H9HE 1DICA 1T8MA 1YPKH 2F9UA 2V35A 4WMDA 1DWDH 3RM0H 2O8MA 3QLPH 4K69A 2WPIS 1W3CA 2TGAA 2A7JA 1GPZA 1C4U2 2BD9A 1DT2A 5GWZA 1AWFH 2Y7ZA 1G9IE 5FAHA 1GBJA 4UEHH 5HM9A 4R8TB 4THNH 1TPSA 1SG8B 5F8ZA 1VR1H 1Z6JH 3A7WA 1EP5A 2R0LA 3RLWH 5I46H 3EGKH 2VIDA 1P02A 4LZ4B 1S84A 1TE0A 4WWYA 3OY5U 3IWMA 3B9FH 4O03A 1BTUA 4TPIZ 1C5VA 5C3NA 2H1UA 1AB9C 2WPLS 4X8UH 1AO5A 2FOEA 4KTUA 2GVFA 1GHAG 1QGFA 4F49A 2WZQA 4FUJA 2BQ7B 3ZZ4A 4Q7XA 1GBIA 5HKKD 3T28A 4XRNA 2J4IA 1BQYA 4K5ZA 1FIZA 5FPYA 4IN2A 2ZDLA 1AVXA 4A92A 3PMHB 2XBXA 3GCTG 3F1SB 4I8LA 1SB1H 1O35A 2BB4A 5HMAA 5IDKA 1EAWA 1TBRH 2OLGA 1SLXB 4IBLH 2ZQ2A 1AE8H 3I29A 3V0XA 4FVBA 4FUIA 1W2KH 2A2QH 4A1VA 2QXJA 1T8OA 3MU4A 2BD2A 1SFQB 3AW0A 5HGGA 1UTMA 1TX7A 1GBDA 1TFXA 5DO4H 1W0ZU 3UWJH 1RD3B 2ZGJA 1LQDB 1YKTA 3PV5A 1LMWB 1AZ8A 2ZU5A 3A8DA 1G3CA 2BLVA 2F9OA 2UUYA 1TBQH 3SW2B 2RFKC 8KME2 1K0HA 1BZXE 3TU7H 2SGEE 1TPOA 8LPRA 1F5RA 4NGAH 1P2OA 3KCGH 3MNCA 3RXEA 1W13U 1J14A 4FETA 2A31A 2RCEA 1KXFA 1MUEB 1YPLH 4MNXA 3TJUA 4XFQA 1XXFA 4O3TA 4YLUA 3BTME 1SQTA 2GJGA 3PLBA 1GDNA 1EAXA 1GJ6A 3UNQA 1T31A 3ZZ6A 3SJKA 2BDGA 1AMHA 4X6OA 1YLNA 1O30A 2UWOA 1SGTA 1C1PA 1OX1A 1SLVB 5DGJA 1KTTB 2ZO3H 1K28D 2FOBA 5ETXA 4AOQA 3WWBA 1IQIA 2VIVA 5C94A 4ABAA 4IN1A 1VITG 2G4TA 3UFAA 2ZTXA 4Y8YA 2CN0H 1PPCE 1W7XH 4TWYA 5C0TA 2CXVA 1KY9A 1QURH 4PROA 1V2JT 2HRVA 3OAAD 5L6NH 2EQNA 1ZLRA 4RT0A 1JMOH 3F0OA 1AVGH 4ABIA 3TJOA 1WDIA 2A5KA 1D3DB 2HNTC 2PGBB 1S0QA 1W0JD 3RXUA 1EZUC 4AN7A 1DWBH 4IC5A 1YPGH 2Z94A 3GY3A 3K6YA 8ESTE 4Y7BA 1MKWK 4LOYH 3UWIA 1HXEH 1ZHRA 1QRWA 2B8OH 2R3YA 2QGRA 2VWMA 1MCVA 2XW9A 4B2BA 2ZFSA 1RRKA 2GGVB 3OEHD 2ZP0H 1HAIH 1C1QA 2XTTB 1O2RA 1AB9B 2DE8A 4AG2A 1YM0A 2XWBI 2XBYA 3NUMA 5J4SA 1H8ED 1Z1JA 2PFEA 1HIAB 1L4ZA 2OC7A 1HJAC 3OX7U 1P0SH 4B76A 1FDPA 1T8LA 2ANYA 5C1XA 4IC6A 3VB3A 4Q63A 3Q3KA 1GI6A 2BM2A 2BQWB 2HLCA 2IOTA 2G5NA 4WXIA 1O5CB 3OTPA 2BY6X 4AORA 2JDID 3RU4E 4DGJA 4AC9A 3GY4A 5FXLA 1C1VH 1YCPK 3PMAB 4ABJA 1BIOA 4IS5A 3SUDA 1QBNA 3FOAA 1AU8A 4INKA 2O8LA 3MWIU 4FUGA 2GT8A 3NPSA 4MVNA 3HATH 3OY6U 5EQQA 3QWCH 1AVWA 1TRYA 4MPXA 2R2MB 1P05A 2QY0B 2FOCA 2YNAA 3LGUA 3A87A 3BTHE 1DVAH 1C5SA 4Y6DA 4X8SH 5LH8A 3FAOA 1W0KD 1SSXA 1O3CA 2V7QD 5GIBA 2ANMH 5HYOA 2ZI2H 3F68H 4DOQA 2ZFPH 4CRAA 3DUXH 1BCUH 3PMJA 3ENSB 4ZXXH 1SOZA 1KYNA 3K9XB 4TT3D 4XD7D 3V7TA 1H8DH 3D62A 3RXPA 9ESTA 1SKYE 1CQQA 2QF3A 1AHTH 7GCHG 1ELAA 4ZKOU 3BN9A 2H9EH 2A1DB 1NESE 4ISIH 1CHGA 3RXTA 1O3FA 3WWFA 2SGAA 2ZIQH 3QGJA 3ATKA 2FI4E 4U30A 1UHBB 4GCHG 2AERH 1LO6A 3WW7A 5FHTA 1BUIA 4NA8A 8GCHF 1O3DA 4OGXA 4HTCH 1O3LA 4M9FA 3ZZ8A 5CMXH 4GHTA 1SBWA 4BNRA 1YCPH 1PPFE 1IQKA 1QIXB 4JZIA 1TNJA 5EJZA 3LT3A 2XC0A 1KXAA 1K9OE 1NU7B 1WQVH 4GCHF 1O3MA 3LGWA 1EPTC 6GCHG 5JYIA 1S81A 1HIAA 2FOGA 3KQEA 4FUCA 3PRDA 1O32A 1C1NA 1QA7A 1TOMH 2OUAA 3LU9B 4Y8XA 1IQEA 4A7IB 5E2OA 4LXBH 1YPHE 3RXKA 3O8BA 2W5EA 3F9GA 4WXVA 4X0WU 1S6HA 1DPOA 1XUHA 2F9NA 6GCHF 1GI2A 5SGAE 1LHGH 1UK3A 1IQGA 3KQDA 3LOXA 1OWIA 3LGIA 3SV2H 1BITA 2M2AA 2BDYA 1A46H 2ZKSA 1B5GH 2W6ID 1P11E 4B71A 1UVPA 5AHGH 2ZZUH 2LP6A 1ZMLA 5FL7D 1W8BH 1Y59T 4ASHA 6CHAC 4P00A 4B74A 1SC8U 1C2MA 2ZFTA 1OWDA 3UNSA 2G5VA 1ESAA 1EX3A 1UTJA 3SUGA 5EW2H 3TGJE 2W6JD 1HJAB 1SLUB 2AHME 2YNBA 1TMBH 3A7ZA 3GYLB 3SJ8A 1AI8H 3TH2H 1ID5H 1MTWA 3GDSA 4CH2B 4GVUA 1MU6B 4ABEA 4XDEA 4H4FA 4CBNA 4F48B 1JRTA 2JETC 2OC0A 3TJVA 4DG4A 3RUOA 4ZHLU 1KSNA 1J8AA 1A0LA 3E91A 3FFGA 4CHAC 1FAKH 3KQ5A 1UHBA 3L33A 4Y11E 3TPIZ 1FI8A 1W10U 1XVMA 2HGTH 2SGFE 3M37A 4NWKA 1ZOMA 3UY9A 1F5LA 1XXDA 4OS2A 1C2DA 2R3UA 5FPTA 3ZZCA 1EKBB 3P70B 2BDAA 5JB9S 3LC5A 3TK6A 2GV7A 4NWLA 3T62A 2Z9JA 4GAWA 1EJNA 2GCHF 2B5TB 2AIPA 1OKXA 1SOTA 2RA0A 3EA8A 1BMLA 1QFKH 5HIYA 4ZAEA 3A83A 2VIOA 5EIYA 4AB8A 1QA0A 4I32A 3QGNB 1VJAU 1V2MT 1GJBB 2O8TA 1NU9A 1W12U 1SQRA 3A82A 5GNDA 4YXWD 1H8IH 3FZDA 4KTCA 1A61H 1MTSA 4Q7YA 5DP9A 1BMMH 1TX6A 3I78A 3UIRA 2H9HA 2BDIA 1VZQH 3MU1A 3OYPA 1C5QA 3RDZA 3RXGA 1K1PA 3T5FH 2AH4X 3UR9A 1Y3YA 2QF4A 2VH6A 4AFQA 1MKXK 2BX3A 3SU1A 3PV2A 5JB8S 4B6FA 1LTOA 1XM1A 1OP2A 1TNLA 3P8NA 1QB1A 2VIPA 3M7UA 3PWBA 1GG6C 1YLDA 3VXFH 2Y5HA 2SNVA 2KCYA 1ANEA 1HAPH 1O2TA 1V2OT 1T4UH 1FY5A 1GJ8B 2WV9A 2ZCLP 5E8EH 2A7CA 5C1YA 3KHVA 1EPTB 2TIOA 1DSTA 1P9SA 1TAWA 2GD4B 2FWWA 1O5GH 2W3IA 1GBBA 1SGFA 2ZTZA 1UTLM 2P3TB 1GHVH 4ZHAA 3OE7D 1X7AC 5E0HA 1IQHA 3A7XA 4ZMAH 2LNCA 4DVAU 3H7TA 7LPRA 2ZGXH 2HOBA 1O3IA 1BTWA 2EY4C 3FP7E 3FVFB 2GKVE 1G32B 1SQAA 3RM2H 3ZZAA 4D9QA 3BTWE 5JBAS 1HAOH 3PV4A 3LJJA 1VGCC 1HXFH 4AYVB 4MNWA 3RXQA 3PO1C 1FONA 1IQMA 2XRCA 3RLYH 5A8ZA 1IAUA 1NO9H 5T6DA 3VEQB 2JJ1D 3BIUH 1BT7A 1K1JA 4WMEA 1AY6H 3ODFA 4VGCC 2AMQA 2P95A 1ZPZA 1QRXA 1OWEA 3KNXA 2C8YB 2RDLA 3RMLH 2GV6A 1OPHB 4JYVH 5EG4A 4ZKRU 2HALA 2GT7A 3KEEA 1S6FA 1DY9A 1UK2A 1GBCA 1NROH 5F6MA 4RKOB 2CJIA 2UWLA 1TNKA 1DFPA 3LJOA 1THPB 4IW4E 1TABE 5A09A 4XBDA 1V2QT 5JBCS 1O5AB 4FU7A 2BLQA 2KZ4A 3GDVA 1ZZZA 4A5TS 3GY7A 1RTKA 1PPGE 4Y79A 1C1SA 1V2VT 1EZXC 1T32A 2YMSD 3ATIA 2WYGA 1FJSA 2BDBA 1YYY1 5C2ZA 1G3DA 4NIVA 1GVZA 2VU8E 3ODDA 1O2QA 2GZ7A 1TALA 2FYRA 2AGEX 1B0EA 2DE9A 3ZZ5A 1MQ6A 1ZPBA 1QR3E 2FI5E 3S7HB 3KF2A 2FLRH 1HAXB 1MZAA 2H5CA 2VGCB 3QTVH 4RI0A 1NS3A 1DSUA 4BTIB 2XC4A 2ZG0H 1V2WT 3T2NA 1OP8A 1OHHD 3UB0A 1QJ6B 1Z8RA 2NU4E 2P59A 4JK6A 3SHCH 3CENA 3SZEA 4K1TA 1HAHH 1GGDC 2ASUB 4UFFH 5K7RA 1EPTA 1CBWC 1SGIB 2SNWA 1GI7B 4AFZA 3DD2H 1H1BA 4MNYA 2BDCA 5ESBA 1BMAA 2HLDD 3ZVEA 4U32A 1E35B 3A89A 4JK5A 4JMYA 1B0FA 2I6QA 4ABFA 1CHOF 1ZYOA 2BOKA 2V3OH 1FY1A 1OWJA 1IQNA 3RU4T 2VH0A 1L0ZA 4SGBE 3SBKA 1F5KU 4INHA 4MPWA 2Z9KA 2YMSB 1DLKB 2Y5FA 1MD7A 4NFEA 3SQEE 2P16A 3MHWU 1EATA 2FOMB 2KR7A 1MQ5A 1GBAA 3TLOA 1P09A 2ODYB 3IG6B 3RXLA 1C9PA 3SNBA 1GG6B 1O34A 3HKJB 4CBOA 1Z71A 3OU0A 1TYNA 3GY8A 2A2XH 4Z0KA 3PLPA 4R0IA 1T7CA 4INLA 1TOCB 2BYAX 2NU3E 4D8NA 1A7SA 5C17A 2DUCA 3MTYA 1BRCE 3ZV9A 3B8JA 5ESTE 3SJOA 1EASA 1FN6A 1GHZA 1O2MA 1ORFA 1TPPA 3M5OA 4GHQA 4UFDH 4CR5A 2W7UA 2F4LA 3S69A 2PKSC 5GXPA 3SN8A 1MCTA 2GDDA 5DP8A 2BY8X 4KGAA 3BTEE 1HNEE 1BJUA 1P04A 2EC9H 3JZ2B 1CU1A 2LPRA 2Q1JA 4VGCB 5EU8A 3UREA 1OS8A 3BF6H 2ESTE 1PQ8A 1UTOA 2PUXB 1O5BB 3A80A 2TGTA 4AFUA 4B2AA 2BHGA 4CRDA 1KDQB 2C90B 1HFDA 3E8LA 1QZ8A 2AFQB 1YWUA 2D2DA 4DURA 3PTBA 2ZWLH 1MABB 2ZFFH 1KXCA 3C27B 3AK5A 1NN6A 5EQSA 3GY5A 2P93A 4DY7B 4QT8C 5DN6D 1HAVA 3P8OA 2ZF0H 1P01A 3SYJA 3TJNA 4YT7H 1TRNA 3KL6A 1GBFA 1NBME 1DXWA 1O3EA 2ALVA 1VCQA 2ZGBH 2L6OA 2B7DH 5CE1A 3LH3A 1EAIA 2A5IA 1E1QD 1D6RA 3ATMA 3UPEA 5DSFA 1C1OA 4MNVA 2CF8H 1NPMA 2ZPSA 1AFQC 2ZHEH 1ANBA 1ANCA 4B75A 3GY2A 1Z8IB 3Q77A 3SU5A 2W26A 2FO9A 1YF4A 2OXSA 3HKIB 4A1TA 1XX9A 2LELA 1CGIE 1GI9B 2FEQH 1F7ZA 2XWAA 5F03A 1THSH 1GGDB 1WTGH 3T27A 2OD3B 3U1IB 2HPPH 3Q76A 1CBWB 1ZHMA 5EPNA 3SJ9A 1P9UA 1ELEE 4BXWA 1KXDA 1ZTKA 2TGPZ 3GCOA 3SQHE 4B73A 3S7KB 1NFYA 2G4UA 3UQVA 1TQ0B 2PUQH 1FPCH 3ZZ9A 3ZZ3A 4JZ1A 4KP0A 3Q3YA 3WY8A 3BIVH 3F3BA 3N99A 2PKAB 1LVOA 3SORA 4DW2U 5EXMA 1QB6A 3MQKC 3RXCA 1EOJA 2R9PA 3BG4C 5GJ4B 1P03A 2D8WA 3TGKE 2OK5A 3DSOA 2FMJA 4I8KA 1THRH 4YLQH 1IHTH 6LPRA 2WHXA 1ANDA 2EI6A 2G81E 1COWD 3MOCA 1Z8GA 1MAXA 1PQAA 2QN5T 4KTSA 3RC6A 4BAHB 3A7YA 3LDXH 1OYQA 3GS9A 1EJAA 3AAVA 1WOFA 3URCA 1ELVA 3QTOH 1TNGA 4FOUC 1Y3VA 1WYKA 4YOGA 1YPMH 3DSGA 5CHBA 7ESTE 1KDQA 1C5ZB 2ZU2A 3DHKH 4ZROA 4ESTE 2P8OC 1C5LH 1LHFH 1O2ZA 3MO3A 2WV4A 1PYTC 3PROA 1GCDA 4MQAA 3DT0H 4RN6A 3AAUA 1GJAB 7KMEH 2CK3D 3U69H 3LONA 1O2VA 1RS0A 4JZFH 3UNRA 4XBCA 3R0FA 1C5OH 1FX0B 2F91A 4YTAA 2F9VA 1TQ7B 2BXTH 1F0RA 2B0FA 1GDQA 1KLTA 1PPHE 5T6GA 1GMHG 2ZPQA 3DA9B 5FBIA 3UAIC 4Q7ZA 5E2PA 2WPHS 4I7YH 3D49H 2JH5D 3LH1A 4WVPE 3SHAH 1P8VC 1O2IA 1ZR0A 1C2JA 3BEIB 5B6OA 1JRSA 1OP0A 4FUHA 1LCYA 2O9QA 3SNDA 2PWXA 1GMHF 3RMNH 3SI4H 1HGTH 5AFYH 4OS5A 1P3EA 1CVWH 2FODA 3BEFB 4A6LA 1G30B 1S85A 3VGCC 3ELAH 4FU8A 2UUKB 1KLIH 1PQ5A 1WUNH 5EW1H 1TGNA 4JYUH 2ZC9H 3O8RA 1TGSZ 2Y80A 1PJPA 1N8OC 1BA8B 2ZHQH 8GCHG 3FN8A 5DP3A 2QXGA 2TRMA 1FXYA 1FY4A 3M7QA 2H2ZA 1ELDE 2ZGCA 3ZIAD 2FTLE 1PPBH 1QL8A 4AG1A 3U9AH 3SUEA 5DG6A 4X1QU 5DKMA 3VB5A 3V3MA 2F43B 2PKAA 1BOQA 4NIXA 4FUEA
chains in the Genus database with same CATH topology
4I32A 1H8ED 3O8DA 3PRDA 5GJ4B 1DXPA 4ASUD 2F4LA 2OC7A 2FM2A 2KM0A 2IJD1 2WSSD 3DSOA 3OFND 3E90B 4WF8A 5GNDA 2OK5A 4YXWD 4B76A 3PV5A 2WHXA 2YMSD 5F53A 1COWD 4Q63A 4OM9A 4KTCA 3O8CA 2IJOB 3O8BA 3RC6A 4B6EA 3GS9A 5CDFE 3OTPA 5GPIB 2JDID 4Q4LA 3OYPA 1CU1A 2QF5A 2XNDD 4TSFD 3SUFA 1KMHB 2QF4A 3DSPA 2F9UA 3KF2A 3LOXA 3SU1A 3PV2A 5EPYA 3SU3A 4RI0A 4B6FA 3SUDA 3DCLA 2O8MA 1NS3A 3FOAA 5H4IB 2KCOA 5CHBA 4FETA 3SU4A 2WPDD 2M2AA 1W3CA 3P8NA 4WH8A 4TYDA 2OBQA 1BMFD 2QE7D 1OHHD 3SV6A 3UB0A 5EQQA 2W6ID 3M5NA 2KFWA 2P59A 4K8BA 4B71A 5C0UA 2KCYA 1MABB 5EQRA 3N7EA 4I31A 3AK5A 4R8TB 3SZEA 2WV9A 5EQSA 2FP7B 3NRLA 2VBCA 2CK3D 3LONA 5FL7D 5DN6D 2XOKD 3P8OA 5ESBA 2HLDD 3SV9A 4B74A 3PRBA 3M5OA 3SYJA 3W1EA 1JXPA 1A1RA 1FX0B 4JMYA 1NBME 3SUGA 1DXWA 1W0KD 3LKWA 3OE7D 4ZCNA 2F9VA 2W6JD 2L6OA 2AHME 1E1RD 2V7QD 5ETXA 2KCAA 3SU2A 1E1QD 2QV1A 5DSFA 2A4RA 3WWBA 3N7DA 2K0QA 3FO8D 2GVFA 4TT3D 4XD7D 2YMSB 2WZQA 3SV7A 2J5UA 2YOLA 5FPSA 1SKYE 5HKKD 5IK2D 5C0TA 2OINA 2OC0A 4B75A 1DY8A 5FPYA 3VG8A 2FOMB 2KR7A 3F2FA 3OAAD 3SV8A 5B6LA 3RC5A 1RGQA 4A1XA 1NBMD 2JJ1D 1BT7A 3SU5A 4A92A 3WWFA 2XCNA 3F0OA 3SU6A 1RTLA 2OC8A 3EYDA 4A1TA 4Z1MD 3KNXA 3WW7A 2LELA 2OC1A 1W0JD 3OEED 2A4QA 4NWKA 2A4GA 2KCPA 5IDKA 4WH6A 3U1IB 2K1QA 4F55A 3KEEA 4M9FA 3O8RA 2K8IA 3FKSD 4I33A 1DY9A 5EPNA 5FPTA 5T1VA 5C17A 1N1LA 1WXRA 3U1JB 2JJ2D 3FN8A 4NWLA 1H8HD 3F0PA 3F2HA 3SU0A 4B73A 2XCFA 3M5MA 2XNIA 1EFRD 2YMSC 3ZIAD 4A1VA 2JIZD 3RC4A 1S6LA 4U01A 4DT4A 1E79D 3L6PA 3SUEA 2GGVB 3OEHD 2OBOA 2F43B 3H09A 3KN2A 3M5LA 3F3BA 3N99A 2KZ4A 3F2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSP A;  3N7D A;  2K0Q A;  2LEL A;  3N7E A;  2KM0 A;  3DSO A; 
#chains in the Genus database with same CATH topology
 1HPG A;  4I86 A;  5LGO A;  2ZQ1 A;  4FXG H;  1UK4 A;  2BVX H;  5C5N A;  2IJD 1;  1GMC F;  3OFN D;  6EST A;  1AFQ B;  1GJ7 B;  1GI1 A;  2JH6 D;  1YLC A;  5HM2 A;  1C1R A;  3RMM H;  1Y5U T;  1D6W A;  2W3K A;  2A45 B;  1AN1 E;  1QHR B;  1GJC B;  4KEL A;  5GPI B;  1ETS H;  1GI5 A;  2G00 A;  1QL9 A;  2XND D;  2FDA A;  1XUI A;  1KXB A;  4Z6A H;  1JWT A;  1EZS C;  1QY6 A;  1EJM A;  1MMJ N;  1SR5 C;  4ZUH A;  1PYT D;  2FOH A;  4CRB A;  4X1P U;  1D9I A;  1QB9 A;  1TON A;  1Y5A T;  2EI7 A;  1C1U H;  4H42 U;  3E16 B;  2QE7 D;  4HI3 A;  1WCZ A;  1O2O A;  1F92 A;  1TPA E;  2OQ5 A;  2BD5 A;  4YOI A;  1V2K T;  4K8B A;  1O2Y A;  4I31 A;  1XUF A;  4H6S B;  4ZXY H;  3MH4 A;  3FP8 E;  2UWP A;  1BTZ A;  2XOK D;  3N7O A;  4O3U A;  1WV7 H;  1A1R A;  1A3E H;  3BG4 B;  1UTN A;  2UUF B;  1NRQ H;  3LIW A;  3P92 A;  3RXF A;  1GI0 A;  2UUJ B;  1LHE H;  3V13 A;  2BD3 A;  3RXA A;  5ABW A;  1B7X B;  3U8R H;  2AMD A;  1Y3U A;  3RXJ A;  2ZHD A;  3V12 A;  1BRU P;  2ZDM A;  1SL3 A;  5T3H A;  5A8X A;  2J98 B;  3MU0 A;  1J17 T;  2BOH B;  2AGI X;  1V3X A;  1F0U A;  4YO9 A;  1K1I A;  1NRP H;  4Y71 A;  4CRG A;  3K2U A;  1ZMN A;  3F2F A;  1F2S E;  1LQE A;  1AE5 A;  1UCY K;  2P8O B;  4Y8Z A;  3URD A;  2B9L A;  4Z1M D;  1HJ8 A;  1BHX B;  2FI3 E;  2AEI H;  2A4G A;  1SLW B;  1UCY E;  4K1S A;  4UON A;  2NU0 E;  3MH7 A;  4I33 A;  5BPE A;  3U1J B;  1KTS B;  3AW1 A;  3MH6 A;  1TA6 A;  2IPQ X;  1C5U A;  2QC2 A;  1C4Y 2;  2XCF A;  3UTU H;  1V2R T;  1YPE H;  2JIZ D;  1A5H A;  4FUF A;  1V2L T;  4X6P A;  3F9H A;  4RKJ B;  2VWO A;  2GCH G;  1NM6 A;  1JIR A;  1IOE A;  2IPH A;  4BAN B;  4IGD A;  1ETR H;  2FM2 A;  1TMT H;  1A2C H;  1CE5 A;  2WSS D;  4P02 A;  4HG6 A;  4NFF A;  2FES H;  4RSP A;  1GL1 A;  2A32 A;  3U8T H;  3JZ1 B;  5F53 A;  2TPI Z;  3ZVB A;  1C5R A;  3STJ A;  1GI8 B;  5GCH F;  3ATW A;  4NA7 A;  3BTQ E;  3PMB B;  1GHB G;  3DSP A;  4I8J A;  1CT4 E;  2P3U B;  2FOF A;  2VVU A;  3UR6 A;  2ZGH A;  1O3J A;  3TNS A;  4LZ1 H;  1KIG H;  2F9P A;  4WH8 A;  1CA0 C;  4X6M A;  4BAM B;  1LPK B;  2Z9I A;  1O39 A;  3KYG A;  4NG9 H;  1V2T T;  2GCT C;  5BRR E;  2KFW A;  4HGC A;  1K1L A;  2FIR H;  1UCY H;  1CA8 B;  1GBH A;  2XBW A;  2FP7 B;  4OGY A;  1GHB F;  3H7O A;  4BTT B;  1ZSK A;  1NC6 A;  3SV9 A;  1J9C H;  2BX4 A;  4X2W A;  2J38 A;  1O33 A;  2BVR H;  1AUJ A;  1QJ7 B;  4UDW H;  4SGA E;  1TMU H;  3BTD E;  3QZR A;  3RXD A;  3M61 U;  3VXE H;  3RXR A;  3ZZB A;  3TH4 H;  5T6F A;  1TA2 A;  1JBU H;  2RDE A;  1ELC A;  2STB E;  3PYH A;  4FUD A;  4IMZ A;  3TIT A;  2J98 A;  1ARB A;  2J5U A;  2F83 A;  3R3G B;  3ITI A;  2J9N A;  2ZU1 A;  1C5M D;  3ZVC A;  1O2K A;  1D3P B;  1V2N T;  1PPZ A;  1GCT C;  1UJ1 A;  4BAO B;  1P2J A;  3E3T A;  1RGQ A;  4A1X A;  2J94 A;  2BDH A;  2Z6B D;  2QYI A;  2XCN A;  1YPJ H;  2C8X B;  4ZKS U;  5DPA A;  3I77 A;  1SGC A;  2R2W U;  3A7V A;  5HIZ A;  2PGQ B;  1G3E A;  1O2P A;  1QL7 A;  1C5W B;  2HVY B;  1N1L A;  1WXR A;  1DDJ A;  2GZ8 A;  2ZDV H;  2C3S A;  1ZSL A;  1SGQ E;  4TPY A;  3GCH C;  5A0A E;  1EFR D;  1ZTL A;  1NZQ H;  1O31 A;  4X8T H;  2PW8 H;  1BTY A;  2OBO A;  2PP6 A;  1ELB A;  1V6D A;  5FX5 A;  3M5L A;  1HDT H;  5DP7 A;  5JDU B;  1ZRB A;  1LPG B;  4NIW A;  3QN7 A;  1OWH A;  1H9I E;  2A5A A;  3QUM P;  4MPU A;  3EE0 B;  2AGG X;  1RTF B;  3E6P H;  5C5O A;  3SGQ E;  5FCK A;  1P2K A;  3NWU A;  4OM9 A;  4UFG H;  3TGI E;  3BTT E;  6CHA B;  1AZZ A;  1O37 A;  1OWK A;  5CDF E;  1HAG E;  1O2L A;  2ZHF H;  1HBT H;  3NKK A;  4J2Y B;  3ZZD A;  1GHX H;  1GHW H;  4F4O C;  1KMH B;  1O2S A;  2KX4 A;  2FX4 A;  3P6Z B;  1Z7K A;  1DOJ A;  5EPY A;  2VWL A;  3EQ0 H;  1GMD G;  1TBZ H;  2XXL A;  4X1N U;  4AZ2 B;  2WPD D;  2BLO A;  1TNI A;  2QXI A;  1BMF D;  4CRF A;  3SV6 A;  5A8Y A;  2Q6G A;  1YBW A;  1OOK B;  1P2I A;  2JET B;  5DP5 A;  1CGJ E;  2ULL A;  1GBE A;  1RIW C;  3RU4 D;  2H6M A;  1GMD F;  3PRB A;  1NRR H;  1ZHP A;  1YPH C;  4NZL A;  4CHA B;  2HNT E;  1C2G A;  4FVD A;  1D4P B;  3ZVF A;  2D26 C;  2PSX A;  5EOD A;  3HGN A;  2VNT A;  4YOJ A;  2IN2 A;  5L30 H;  1E1R D;  4YT6 H;  4JYT A;  1YGC H;  2VJ1 A;  4CRC A;  3DFL A;  2A4R A;  1D3Q B;  1CHO G;  1IHS H;  2L74 A;  1P57 B;  1T4V H;  2ZU4 A;  3SOS A;  2G51 A;  2P94 A;  4MPV A;  1W14 U;  4ABD A;  1KXE A;  1GJ4 H;  2FOA A;  1HAY B;  1ELG A;  1HLT H;  4GPG A;  3BTG E;  5LPF A;  1Y5B T;  1UW7 A;  1O2H A;  5A2M H;  1VJ9 U;  3U8O H;  3FP6 E;  3VG8 A;  1BTH H;  2Y5G A;  5B6L A;  5FBE A;  4E06 H;  1AUT C;  1FY3 A;  1CA0 B;  2FS8 A;  2Y6T A;  2TBS A;  1WAY B;  4DT7 B;  2WUB A;  2GCT B;  5HXF A;  2EI8 A;  2OC1 A;  2VIW A;  3ZZ7 A;  1EZQ A;  2G8T A;  2C4F H;  1SGE E;  1HUT H;  2ANK H;  3FKS D;  2BD8 A;  3GIS B;  3GY6 A;  4TWW A;  1LHC H;  1L1N A;  1ZGV A;  5EJL A;  1HRT H;  2PV9 B;  3H5C B;  4IMQ A;  1H8H D;  2VVV A;  5LPE A;  4AX9 H;  2GMT C;  3VB4 A;  4D9R A;  1FAX A;  3HPT B;  3ZYD A;  5DJ7 A;  1E37 B;  4BAK B;  4GUX A;  4OS4 A;  1C4V 2;  3GIC B;  5FX6 A;  1UTP A;  2J34 A;  1BDA A;  1GBM A;  1TB6 H;  2H5D A;  2OQU A;  3E90 B;  1TRM A;  4XBB A;  4J1Y A;  1CGH A;  2VVC A;  3O8C A;  2IJO B;  1ZMJ A;  1GCT B;  1W7G H;  3RXO A;  2Z9L A;  1IQL A;  1EB1 H;  3F6U H;  2R0K A;  3RMO H;  1GL0 E;  1XMN B;  9LPR A;  3EA7 A;  1EB2 A;  1QQ4 A;  2EEK A;  3U98 H;  1ACB E;  2C8Z B;  1VCW A;  5H4I B;  2J97 A;  2KCO A;  1O5F H;  1BRB E;  1V2U T;  1Q31 A;  2ALP A;  2OBQ A;  4FUB A;  1O3G A;  2PTN A;  1S5S A;  4DCD A;  4HZH A;  2V6N A;  1VGC B;  4BXS A;  5C0U A;  3GCH B;  5EQR A;  4E7R G;  3S0N A;  3PO1 B;  4K1E A;  1O5D H;  4DJZ B;  1EST A;  3A86 A;  3STI A;  4KKD A;  1MAY A;  2AIQ A;  3SNA A;  2ZDA H;  1FMG A;  3W1E A;  5EJ1 A;  2BXU H;  1K21 H;  3LC3 A;  4NA9 H;  3UOU A;  4AB9 A;  4O9V A;  2I6S A;  1C9T A;  1V2S T;  1WU1 A;  1XUJ A;  1GHA F;  3S9A A;  1SHH B;  1UTK A;  1FNI A;  1AQ7 A;  1JOU B;  1W11 U;  3MNX A;  2HNT F;  3QX5 H;  1GJ9 B;  1BJV A;  1QBV H;  2ZPR A;  2OIN A;  4B2C A;  1FV9 A;  1C2I A;  1SGF G;  3GCT F;  4UE7 H;  2BY9 X;  3OTJ E;  2J2U A;  2ZU3 A;  1CT2 E;  2Z9G A;  5KEC A;  1NT1 A;  3RXV A;  3TNT A;  3L3T A;  1ZGI A;  1K1O A;  3AAS A;  4JZD H;  2NWN A;  2G55 A;  5FCR A;  4O97 A;  3A7T A;  2K8I A;  1SGR E;  3A8A A;  2D1J A;  3SO3 A;  1RIW B;  2A4O A;  2XBV A;  4U2W A;  5K0H A;  4B1T A;  1VIT H;  4YM9 A;  1BHX F;  3M5M A;  3TK9 A;  1TGT A;  1HCG A;  1OXG A;  4ISN A;  1S82 A;  4ABG A;  3SGB E;  2KAI B;  5G4B A;  2XC5 A;  3SGA E;  5C1U A;  1YCP M;  1OSS A;  3S9B A;  1HJ9 A;  1G36 A;  1HV7 A;  5I25 A;  1A5I A;  1NTP A;  1UTQ A;  4BAQ B;  1EXF A;  1SGN E;  1YP9 A;  4Q4L A;  2PTC E;  2CMY A;  2QF5 A;  4OS6 A;  3RP2 A;  4DII H;  2Y7X A;  3SUF A;  3E0P B;  5IYT A;  3SU3 A;  2CHA C;  4UD9 H;  1L4D A;  1PPE E;  2ODP A;  3Q3X A;  3QDZ B;  1D3T B;  3SNE A;  1MD8 A;  1UVO A;  3A88 A;  4TYD A;  3MO9 A;  2NU2 E;  2XYA A;  3MH5 A;  3A8B A;  1P2N A;  1E36 B;  2ZDN A;  3M5N A;  1FN8 A;  2CGA A;  1BRA A;  2ANW A;  5F8T A;  3N7E A;  1ZRK A;  1AWH B;  2GMT B;  3M35 A;  3TK5 A;  1SGY E;  1JIM A;  1O5E H;  2VBC A;  4K3J A;  1E34 B;  4LK4 A;  5C67 A;  1UO6 A;  3M3V A;  1P3C A;  2BQ6 B;  1ELF A;  3D65 E;  1JXP A;  1EQ9 A;  3ZYE A;  1G3B A;  2OP9 A;  1PFX C;  2V0B A;  1GVK B;  1A0J A;  1GBT A;  2Z3E A;  3ATL A;  3GYM A;  3HK3 B;  3IIT A;  1Z8J B;  3ZVD A;  3DFJ A;  5L2Z H;  1C2F A;  1WSS H;  1ETT H;  2KCA A;  1VIT F;  4CH8 B;  3SU2 A;  1GWA A;  4AGK A;  3CS0 A;  5TCA A;  1GJ5 H;  5A0B A;  2K0Q A;  3VFE A;  1O38 A;  3RXB A;  1H4W A;  3QK1 A;  1EP6 A;  4D7G A;  1XKA C;  3RXH A;  4GSO A;  3D23 A;  5FPS A;  4NSY A;  1LVM A;  2FXR A;  2Z3C A;  1TWX B;  1TIO A;  1DY8 A;  1Z6E A;  3NCL A;  3SV8 A;  2QIQ A;  5JPM H;  4Q2K A;  2SGD E;  4TY6 A;  3MYW A;  1LVY A;  3UQO A;  2BMG B;  3SU6 A;  3PWC A;  2PKS B;  5DP6 A;  3EYD A;  4ACA A;  1NFW A;  2Q6F A;  3OEE D;  3W95 A;  2JKH A;  1Y8T A;  3QZQ A;  2RA3 A;  5AVD A;  3SNC A;  1BBR K;  1DE7 H;  2BTC E;  1C2H A;  1SGD E;  1L2E A;  3PLK A;  3RXM A;  3F2H A;  2XNI A;  2Z3D A;  3RC4 A;  4DT4 A;  1S6L A;  2J95 A;  1E79 D;  1G2L A;  1BBR E;  2GTB A;  2A0Q B;  2QF0 A;  2ZEC A;  4K2Y A;  2KAI A;  3H09 A;  5LPR A;  1A4W H;  3W94 A;  1G2M A;  2EA3 A;  1HB0 B;  2ZFR H;  4MG3 A;  2ILN A;  4Y0Z E;  1NFU A;  1PQ7 A;  1EUF A;  1NRS H;  3C1K A;  1XKB C;  3K65 B;  3LPR A;  1DX5 M;  2PR3 A;  2F3C E;  3EE7 A;  4XE4 A;  1GMC G;  2SGQ E;  1ELT A;  1T8N A;  3PB1 E;  4AYY B;  3BG8 A;  1V2P T;  3T29 A;  1K2I 1;  4TSF D;  1MKW H;  3GDU A;  1INC A;  1C5P A;  1SVP A;  1QJ1 B;  1O2X A;  1W0Y H;  1P06 A;  1E0F D;  3TH3 H;  2JH0 D;  2PSY A;  3E1X B;  1SGP E;  2AMP A;  1NY2 2;  5KED A;  3SU4 A;  2RG3 A;  1MBM A;  3U28 C;  3K6Z A;  3NK8 A;  2FS9 A;  1ZPC A;  1ABI H;  4ACB A;  3P17 H;  5CHA C;  1F0S A;  3NXP A;  1AGJ A;  1O3O A;  1DWE H;  3BV9 B;  2F9B H;  3F9F A;  5EOK A;  2GDE H;  3QO6 A;  3MI4 A;  2ZCH P;  1TGC A;  3SZN A;  1O3K A;  4HFP B;  1AD8 H;  1DUE A;  3MO6 A;  3A85 A;  4X1R U;  4GLY A;  3M3T A;  2FZZ A;  1UMA H;  1UVS H;  1A3B H;  1Y3X A;  1BBR H;  1GHY H;  2PHB A;  2ZFQ H;  2VIN A;  5E0G A;  1C1T A;  1DUA A;  1NRN H;  1P2M A;  3M3S A;  4FU9 A;  2V3H H;  1SQO A;  3HK6 B;  3A8C A;  3N7D A;  2CV3 A;  4TY7 A;  7GCH F;  1HYL A;  2J92 A;  3EST A;  4ZHM U;  4XSK U;  3MU5 A;  3KID U;  5EXL A;  2CHA B;  2A7H A;  1ZSJ A;  1UVU H;  4NSV A;  2O8W A;  1F0T A;  3P95 A;  1HAZ B;  4WY3 A;  2Z7F E;  2FPZ A;  2ZHW H;  1SHY A;  3TIU A;  4ISL A;  1EAU A;  2HWL B;  1E38 B;  2Q6D A;  4WH6 A;  1FLE E;  1WQS A;  1S0R A;  5DK1 A;  2VB0 A;  3EAJ A;  1N6Y A;  1Q2W A;  4MTB A;  3F0P A;  1DIT H;  1VKY A;  4K60 A;  4WJG 2;  1M9U A;  4U01 A;  4D7F A;  3MMG A;  1NFX A;  1O2J A;  2FX6 A;  5A0C A;  1J16 A;  3RXI A;  1LVB A;  1MH0 A;  1AFE H;  1ABJ H;  3F2G A;  3E0N B;  2QA9 E;  5DP4 A;  4X2X A;  1LDT T;  2ZTY A;  2OTV A;  1GJD B;  4XOJ A;  1C5Y B;  4ABH A;  2GX4 A;  1FPH H;  2QXH A;  4NZQ A;  2BVS H;  1GVL A;  1YY3 A;  3RXS A;  1P2Q A;  1QCP A;  3CP7 A;  3S9C A;  1DAN H;  1MTN C;  1XUK A;  3CS7 A;  2ZDK A;  3LGT A;  5GCH G;  1RJX B;  1WBG B;  4YES B;  1O2U A;  1WTH D;  1C2K A;  1TX8 A;  3ZV8 A;  1P10 A;  5L2Y H;  1O3P B;  4MLF B;  4YZU A;  3NRL A;  1C2E A;  1C5X B;  1C2L A;  1QNJ A;  1O3A A;  3KQB A;  4I8G A;  2AS9 A;  1EOL A;  2BLW A;  3VGC B;  2H9T H;  1VCP A;  3PTN A;  4Q80 A;  1ESB A;  1C5N H;  2VGC C;  1H9L B;  1N8O B;  2QV1 A;  1AKS B;  4RT1 A;  3MFJ A;  2VWN A;  1RXP A;  2WPJ S;  2BZ6 H;  3BTF E;  1GBL A;  2ODQ A;  1IQF A;  2GZ9 A;  2BZA A;  3VPK A;  2TGD A;  3ZVG A;  1K1M A;  5JBB S;  1CO7 E;  1NBM D;  3KYF A;  1Z1I A;  4I8H A;  4K8Y A;  4ZKN U;  1SMF E;  3T26 A;  4AGJ A;  1RTL A;  1UVT H;  2OC8 A;  3LGV A;  4H6T A;  3TVJ B;  5AF9 H;  1LHD H;  2HVX A;  5CHA B;  2A4Q A;  1FIW A;  2BY7 X;  2KCP A;  4BOH A;  3EDX B;  3UUZ A;  2QAA A;  2K1Q A;  3FAN A;  3KQC A;  5T1V A;  4X8V H;  1DS2 E;  1O3B A;  2ZEB A;  2BD7 A;  4X6N A;  3SU0 A;  1L1J A;  2YMS C;  1Q3X A;  3MNB A;  3SI3 H;  5J4Q A;  1YC0 A;  5GDS H;  1S83 A;  1GI3 A;  3KN2 A;  1SI5 H;  1A0H B;  3VB7 A;  1IQJ A;  1QBO A;  1ZTJ A;  5KGO A;  1MZD A;  4AFS A;  4CR9 A;  4ASU D;  2HPQ H;  1TLD A;  5EGM A;  2Y82 A;  4E7N A;  5TJX A;  1RFN A;  3T25 A;  2ZCK P;  4BTU B;  4Y10 E;  3OSY A;  2ZNK H;  1GDU A;  3CNR A;  2FTM A;  1L1G A;  2WV5 A;  4ISO A;  5E0J A;  5TCC A;  1XUG A;  1C5T A;  3BEU A;  3VB6 A;  2P3F H;  2WIN I;  3G01 A;  1OYT H;  3SJI A;  3Q00 A;  4ABB A;  1ZJD A;  1QRZ A;  3DCL A;  1DM4 B;  5PTP A;  3KGP A;  4OS1 A;  1QQU A;  4MDS A;  3GOV B;  2BD4 A;  3A81 A;  3M36 A;  2WYJ A;  4JZE H;  1QTF A;  3F9E A;  3MU8 A;  2AYW A;  3BTK E;  1LPZ B;  1AIX H;  2VIQ A;  2CF9 H;  1BMN H;  3BSQ A;  3UOP A;  2O8U A;  4DIH H;  1J15 A;  1MU8 B;  4Y76 A;  5EXN A;  2Y81 A;  1MTU A;  1O2W A;  5JBT A;  2QCY A;  2W7S A;  1TGB A;  3LKW A;  4ZCN A;  1FZZ A;  4NIY A;  1FUJ A;  2OCV B;  3LGY A;  4JCN A;  3P8G A;  1MTV A;  4X2Y A;  1K1N A;  1AKS A;  1XVO A;  3A84 A;  4X1S U;  2PLX A;  2SGP E;  4Y0Y E;  1MKX H;  4CRE A;  4D76 A;  3FO8 D;  1O2G H;  4OS7 A;  1O3H A;  3SV7 A;  2YOL A;  1O3N A;  1MTN B;  4E05 H;  4WMF A;  5IK2 D;  4NCY A;  4UFE H;  1MBQ A;  2G52 A;  4Y7A A;  3RC5 A;  1A5G H;  1FQ3 A;  1P12 E;  2STA E;  2BY5 X;  2WUC A;  1N6X A;  3GCN A;  3HGP A;  2FLB H;  3PM3 A;  1GBK A;  2V3M A;  2WPM S;  4ZH8 A;  1Y3W A;  1GI4 A;  4ISH H;  4M7G A;  1BTP A;  1KLJ H;  4F55 A;  2M5T A;  1BB0 B;  1O0D H;  3MNS A;  1LKA A;  2JJ2 D;  5F8X A;  2FYQ A;  1BTX A;  1CT0 E;  1SFI A;  5C20 A;  1DLE A;  2ZA5 A;  2C8W B;  3P8F A;  1TNH A;  1K22 H;  3L6P A;  3EA9 A;  1DWC H;  1U6Q A;  1ZJK A;  2SFA A;  3FZZ A;  1LKB A;  1SPJ A;  3O8D A;  1DXP A;  2NU1 E;  1O2N A;  2KM0 A;  4WF8 A;  2GP9 B;  3B23 B;  4X2V A;  3NZI A;  1G37 A;  1ARC A;  1FY8 E;  2C93 B;  3ZVA A;  2WPK S;  1C1W H;  4B6E A;  5AFZ H;  3AVZ A;  1O36 A;  3M7T A;  1CSO E;  2THF B;  1HAV B;  1C1M A;  1H9H E;  1DIC A;  1T8M A;  1YPK H;  2F9U A;  2V35 A;  4WMD A;  1DWD H;  3RM0 H;  2O8M A;  3QLP H;  4K69 A;  2WPI S;  1W3C A;  2TGA A;  2A7J A;  1GPZ A;  1C4U 2;  2BD9 A;  1DT2 A;  5GWZ A;  1AWF H;  2Y7Z A;  1G9I E;  5FAH A;  1GBJ A;  4UEH H;  5HM9 A;  4R8T B;  4THN H;  1TPS A;  1SG8 B;  5F8Z A;  1VR1 H;  1Z6J H;  3A7W A;  1EP5 A;  2R0L A;  3RLW H;  5I46 H;  3EGK H;  2VID A;  1P02 A;  4LZ4 B;  1S84 A;  1TE0 A;  4WWY A;  3OY5 U;  3IWM A;  3B9F H;  4O03 A;  1BTU A;  4TPI Z;  1C5V A;  5C3N A;  2H1U A;  1AB9 C;  2WPL S;  4X8U H;  1AO5 A;  2FOE A;  4KTU A;  2GVF A;  1GHA G;  1QGF A;  4F49 A;  2WZQ A;  4FUJ A;  2BQ7 B;  3ZZ4 A;  4Q7X A;  1GBI A;  5HKK D;  3T28 A;  4XRN A;  2J4I A;  1BQY A;  4K5Z A;  1FIZ A;  5FPY A;  4IN2 A;  2ZDL A;  1AVX A;  4A92 A;  3PMH B;  2XBX A;  3GCT G;  3F1S B;  4I8L A;  1SB1 H;  1O35 A;  2BB4 A;  5HMA A;  5IDK A;  1EAW A;  1TBR H;  2OLG A;  1SLX B;  4IBL H;  2ZQ2 A;  1AE8 H;  3I29 A;  3V0X A;  4FVB A;  4FUI A;  1W2K H;  2A2Q H;  4A1V A;  2QXJ A;  1T8O A;  3MU4 A;  2BD2 A;  1SFQ B;  3AW0 A;  5HGG A;  1UTM A;  1TX7 A;  1GBD A;  1TFX A;  5DO4 H;  1W0Z U;  3UWJ H;  1RD3 B;  2ZGJ A;  1LQD B;  1YKT A;  3PV5 A;  1LMW B;  1AZ8 A;  2ZU5 A;  3A8D A;  1G3C A;  2BLV A;  2F9O A;  2UUY A;  1TBQ H;  3SW2 B;  2RFK C;  8KME 2;  1K0H A;  1BZX E;  3TU7 H;  2SGE E;  1TPO A;  8LPR A;  1F5R A;  4NGA H;  1P2O A;  3KCG H;  3MNC A;  3RXE A;  1W13 U;  1J14 A;  4FET A;  2A31 A;  2RCE A;  1KXF A;  1MUE B;  1YPL H;  4MNX A;  3TJU A;  4XFQ A;  1XXF A;  4O3T A;  4YLU A;  3BTM E;  1SQT A;  2GJG A;  3PLB A;  1GDN A;  1EAX A;  1GJ6 A;  3UNQ A;  1T31 A;  3ZZ6 A;  3SJK A;  2BDG A;  1AMH A;  4X6O A;  1YLN A;  1O30 A;  2UWO A;  1SGT A;  1C1P A;  1OX1 A;  1SLV B;  5DGJ A;  1KTT B;  2ZO3 H;  1K28 D;  2FOB A;  5ETX A;  4AOQ A;  3WWB A;  1IQI A;  2VIV A;  5C94 A;  4ABA A;  4IN1 A;  1VIT G;  2G4T A;  3UFA A;  2ZTX A;  4Y8Y A;  2CN0 H;  1PPC E;  1W7X H;  4TWY A;  5C0T A;  2CXV A;  1KY9 A;  1QUR H;  4PRO A;  1V2J T;  2HRV A;  3OAA D;  5L6N H;  2EQN A;  1ZLR A;  4RT0 A;  1JMO H;  3F0O A;  1AVG H;  4ABI A;  3TJO A;  1WDI A;  2A5K A;  1D3D B;  2HNT C;  2PGB B;  1S0Q A;  1W0J D;  3RXU A;  1EZU C;  4AN7 A;  1DWB H;  4IC5 A;  1YPG H;  2Z94 A;  3GY3 A;  3K6Y A;  8EST E;  4Y7B A;  1MKW K;  4LOY H;  3UWI A;  1HXE H;  1ZHR A;  1QRW A;  2B8O H;  2R3Y A;  2QGR A;  2VWM A;  1MCV A;  2XW9 A;  4B2B A;  2ZFS A;  1RRK A;  2GGV B;  3OEH D;  2ZP0 H;  1HAI H;  1C1Q A;  2XTT B;  1O2R A;  1AB9 B;  2DE8 A;  4AG2 A;  1YM0 A;  2XWB I;  2XBY A;  3NUM A;  5J4S A;  1H8E D;  1Z1J A;  2PFE A;  1HIA B;  1L4Z A;  2OC7 A;  1HJA C;  3OX7 U;  1P0S H;  4B76 A;  1FDP A;  1T8L A;  2ANY A;  5C1X A;  4IC6 A;  3VB3 A;  4Q63 A;  3Q3K A;  1GI6 A;  2BM2 A;  2BQW B;  2HLC A;  2IOT A;  2G5N A;  4WXI A;  1O5C B;  3OTP A;  2BY6 X;  4AOR A;  2JDI D;  3RU4 E;  4DGJ A;  4AC9 A;  3GY4 A;  5FXL A;  1C1V H;  1YCP K;  3PMA B;  4ABJ A;  1BIO A;  4IS5 A;  3SUD A;  1QBN A;  3FOA A;  1AU8 A;  4INK A;  2O8L A;  3MWI U;  4FUG A;  2GT8 A;  3NPS A;  4MVN A;  3HAT H;  3OY6 U;  5EQQ A;  3QWC H;  1AVW A;  1TRY A;  4MPX A;  2R2M B;  1P05 A;  2QY0 B;  2FOC A;  2YNA A;  3LGU A;  3A87 A;  3BTH E;  1DVA H;  1C5S A;  4Y6D A;  4X8S H;  5LH8 A;  3FAO A;  1W0K D;  1SSX A;  1O3C A;  2V7Q D;  5GIB A;  2ANM H;  5HYO A;  2ZI2 H;  3F68 H;  4DOQ A;  2ZFP H;  4CRA A;  3DUX H;  1BCU H;  3PMJ A;  3ENS B;  4ZXX H;  1SOZ A;  1KYN A;  3K9X B;  4TT3 D;  4XD7 D;  3V7T A;  1H8D H;  3D62 A;  3RXP A;  9EST A;  1SKY E;  1CQQ A;  2QF3 A;  1AHT H;  7GCH G;  1ELA A;  4ZKO U;  3BN9 A;  2H9E H;  2A1D B;  1NES E;  4ISI H;  1CHG A;  3RXT A;  1O3F A;  3WWF A;  2SGA A;  2ZIQ H;  3QGJ A;  3ATK A;  2FI4 E;  4U30 A;  1UHB B;  4GCH G;  2AER H;  1LO6 A;  3WW7 A;  5FHT A;  1BUI A;  4NA8 A;  8GCH F;  1O3D A;  4OGX A;  4HTC H;  1O3L A;  4M9F A;  3ZZ8 A;  5CMX H;  4GHT A;  1SBW A;  4BNR A;  1YCP H;  1PPF E;  1IQK A;  1QIX B;  4JZI A;  1TNJ A;  5EJZ A;  3LT3 A;  2XC0 A;  1KXA A;  1K9O E;  1NU7 B;  1WQV H;  4GCH F;  1O3M A;  3LGW A;  1EPT C;  6GCH G;  5JYI A;  1S81 A;  1HIA A;  2FOG A;  3KQE A;  4FUC A;  3PRD A;  1O32 A;  1C1N A;  1QA7 A;  1TOM H;  2OUA A;  3LU9 B;  4Y8X A;  1IQE A;  4A7I B;  5E2O A;  4LXB H;  1YPH E;  3RXK A;  3O8B A;  2W5E A;  3F9G A;  4WXV A;  4X0W U;  1S6H A;  1DPO A;  1XUH A;  2F9N A;  6GCH F;  1GI2 A;  5SGA E;  1LHG H;  1UK3 A;  1IQG A;  3KQD A;  3LOX A;  1OWI A;  3LGI A;  3SV2 H;  1BIT A;  2M2A A;  2BDY A;  1A46 H;  2ZKS A;  1B5G H;  2W6I D;  1P11 E;  4B71 A;  1UVP A;  5AHG H;  2ZZU H;  2LP6 A;  1ZML A;  5FL7 D;  1W8B H;  1Y59 T;  4ASH A;  6CHA C;  4P00 A;  4B74 A;  1SC8 U;  1C2M A;  2ZFT A;  1OWD A;  3UNS A;  2G5V A;  1ESA A;  1EX3 A;  1UTJ A;  3SUG A;  5EW2 H;  3TGJ E;  2W6J D;  1HJA B;  1SLU B;  2AHM E;  2YNB A;  1TMB H;  3A7Z A;  3GYL B;  3SJ8 A;  1AI8 H;  3TH2 H;  1ID5 H;  1MTW A;  3GDS A;  4CH2 B;  4GVU A;  1MU6 B;  4ABE A;  4XDE A;  4H4F A;  4CBN A;  4F48 B;  1JRT A;  2JET C;  2OC0 A;  3TJV A;  4DG4 A;  3RUO A;  4ZHL U;  1KSN A;  1J8A A;  1A0L A;  3E91 A;  3FFG A;  4CHA C;  1FAK H;  3KQ5 A;  1UHB A;  3L33 A;  4Y11 E;  3TPI Z;  1FI8 A;  1W10 U;  1XVM A;  2HGT H;  2SGF E;  3M37 A;  4NWK A;  1ZOM A;  3UY9 A;  1F5L A;  1XXD A;  4OS2 A;  1C2D A;  2R3U A;  5FPT A;  3ZZC A;  1EKB B;  3P70 B;  2BDA A;  5JB9 S;  3LC5 A;  3TK6 A;  2GV7 A;  4NWL A;  3T62 A;  2Z9J A;  4GAW A;  1EJN A;  2GCH F;  2B5T B;  2AIP A;  1OKX A;  1SOT A;  2RA0 A;  3EA8 A;  1BML A;  1QFK H;  5HIY A;  4ZAE A;  3A83 A;  2VIO A;  5EIY A;  4AB8 A;  1QA0 A;  4I32 A;  3QGN B;  1VJA U;  1V2M T;  1GJB B;  2O8T A;  1NU9 A;  1W12 U;  1SQR A;  3A82 A;  5GND A;  4YXW D;  1H8I H;  3FZD A;  4KTC A;  1A61 H;  1MTS A;  4Q7Y A;  5DP9 A;  1BMM H;  1TX6 A;  3I78 A;  3UIR A;  2H9H A;  2BDI A;  1VZQ H;  3MU1 A;  3OYP A;  1C5Q A;  3RDZ A;  3RXG A;  1K1P A;  3T5F H;  2AH4 X;  3UR9 A;  1Y3Y A;  2QF4 A;  2VH6 A;  4AFQ A;  1MKX K;  2BX3 A;  3SU1 A;  3PV2 A;  5JB8 S;  4B6F A;  1LTO A;  1XM1 A;  1OP2 A;  1TNL A;  3P8N A;  1QB1 A;  2VIP A;  3M7U A;  3PWB A;  1GG6 C;  1YLD A;  3VXF H;  2Y5H A;  2SNV A;  2KCY A;  1ANE A;  1HAP H;  1O2T A;  1V2O T;  1T4U H;  1FY5 A;  1GJ8 B;  2WV9 A;  2ZCL P;  5E8E H;  2A7C A;  5C1Y A;  3KHV A;  1EPT B;  2TIO A;  1DST A;  1P9S A;  1TAW A;  2GD4 B;  2FWW A;  1O5G H;  2W3I A;  1GBB A;  1SGF A;  2ZTZ A;  1UTL M;  2P3T B;  1GHV H;  4ZHA A;  3OE7 D;  1X7A C;  5E0H A;  1IQH A;  3A7X A;  4ZMA H;  2LNC A;  4DVA U;  3H7T A;  7LPR A;  2ZGX H;  2HOB A;  1O3I A;  1BTW A;  2EY4 C;  3FP7 E;  3FVF B;  2GKV E;  1G32 B;  1SQA A;  3RM2 H;  3ZZA A;  4D9Q A;  3BTW E;  5JBA S;  1HAO H;  3PV4 A;  3LJJ A;  1VGC C;  1HXF H;  4AYV B;  4MNW A;  3RXQ A;  3PO1 C;  1FON A;  1IQM A;  2XRC A;  3RLY H;  5A8Z A;  1IAU A;  1NO9 H;  5T6D A;  3VEQ B;  2JJ1 D;  3BIU H;  1BT7 A;  1K1J A;  4WME A;  1AY6 H;  3ODF A;  4VGC C;  2AMQ A;  2P95 A;  1ZPZ A;  1QRX A;  1OWE A;  3KNX A;  2C8Y B;  2RDL A;  3RML H;  2GV6 A;  1OPH B;  4JYV H;  5EG4 A;  4ZKR U;  2HAL A;  2GT7 A;  3KEE A;  1S6F A;  1DY9 A;  1UK2 A;  1GBC A;  1NRO H;  5F6M A;  4RKO B;  2CJI A;  2UWL A;  1TNK A;  1DFP A;  3LJO A;  1THP B;  4IW4 E;  1TAB E;  5A09 A;  4XBD A;  1V2Q T;  5JBC S;  1O5A B;  4FU7 A;  2BLQ A;  2KZ4 A;  3GDV A;  1ZZZ A;  4A5T S;  3GY7 A;  1RTK A;  1PPG E;  4Y79 A;  1C1S A;  1V2V T;  1EZX C;  1T32 A;  2YMS D;  3ATI A;  2WYG A;  1FJS A;  2BDB A;  1YYY 1;  5C2Z A;  1G3D A;  4NIV A;  1GVZ A;  2VU8 E;  3ODD A;  1O2Q A;  2GZ7 A;  1TAL A;  2FYR A;  2AGE X;  1B0E A;  2DE9 A;  3ZZ5 A;  1MQ6 A;  1ZPB A;  1QR3 E;  2FI5 E;  3S7H B;  3KF2 A;  2FLR H;  1HAX B;  1MZA A;  2H5C A;  2VGC B;  3QTV H;  4RI0 A;  1NS3 A;  1DSU A;  4BTI B;  2XC4 A;  2ZG0 H;  1V2W T;  3T2N A;  1OP8 A;  1OHH D;  3UB0 A;  1QJ6 B;  1Z8R A;  2NU4 E;  2P59 A;  4JK6 A;  3SHC H;  3CEN A;  3SZE A;  4K1T A;  1HAH H;  1GGD C;  2ASU B;  4UFF H;  5K7R A;  1EPT A;  1CBW C;  1SGI B;  2SNW A;  1GI7 B;  4AFZ A;  3DD2 H;  1H1B A;  4MNY A;  2BDC A;  5ESB A;  1BMA A;  2HLD D;  3ZVE A;  4U32 A;  1E35 B;  3A89 A;  4JK5 A;  4JMY A;  1B0F A;  2I6Q A;  4ABF A;  1CHO F;  1ZYO A;  2BOK A;  2V3O H;  1FY1 A;  1OWJ A;  1IQN A;  3RU4 T;  2VH0 A;  1L0Z A;  4SGB E;  3SBK A;  1F5K U;  4INH A;  4MPW A;  2Z9K A;  2YMS B;  1DLK B;  2Y5F A;  1MD7 A;  4NFE A;  3SQE E;  2P16 A;  3MHW U;  1EAT A;  2FOM B;  2KR7 A;  1MQ5 A;  1GBA A;  3TLO A;  1P09 A;  2ODY B;  3IG6 B;  3RXL A;  1C9P A;  3SNB A;  1GG6 B;  1O34 A;  3HKJ B;  4CBO A;  1Z71 A;  3OU0 A;  1TYN A;  3GY8 A;  2A2X H;  4Z0K A;  3PLP A;  4R0I A;  1T7C A;  4INL A;  1TOC B;  2BYA X;  2NU3 E;  4D8N A;  1A7S A;  5C17 A;  2DUC A;  3MTY A;  1BRC E;  3ZV9 A;  3B8J A;  5EST E;  3SJO A;  1EAS A;  1FN6 A;  1GHZ A;  1O2M A;  1ORF A;  1TPP A;  3M5O A;  4GHQ A;  4UFD H;  4CR5 A;  2W7U A;  2F4L A;  3S69 A;  2PKS C;  5GXP A;  3SN8 A;  1MCT A;  2GDD A;  5DP8 A;  2BY8 X;  4KGA A;  3BTE E;  1HNE E;  1BJU A;  1P04 A;  2EC9 H;  3JZ2 B;  1CU1 A;  2LPR A;  2Q1J A;  4VGC B;  5EU8 A;  3URE A;  1OS8 A;  3BF6 H;  2EST E;  1PQ8 A;  1UTO A;  2PUX B;  1O5B B;  3A80 A;  2TGT A;  4AFU A;  4B2A A;  2BHG A;  4CRD A;  1KDQ B;  2C90 B;  1HFD A;  3E8L A;  1QZ8 A;  2AFQ B;  1YWU A;  2D2D A;  4DUR A;  3PTB A;  2ZWL H;  1MAB B;  2ZFF H;  1KXC A;  3C27 B;  3AK5 A;  1NN6 A;  5EQS A;  3GY5 A;  2P93 A;  4DY7 B;  4QT8 C;  5DN6 D;  1HAV A;  3P8O A;  2ZF0 H;  1P01 A;  3SYJ A;  3TJN A;  4YT7 H;  1TRN A;  3KL6 A;  1GBF A;  1NBM E;  1DXW A;  1O3E A;  2ALV A;  1VCQ A;  2ZGB H;  2L6O A;  2B7D H;  5CE1 A;  3LH3 A;  1EAI A;  2A5I A;  1E1Q D;  1D6R A;  3ATM A;  3UPE A;  5DSF A;  1C1O A;  4MNV A;  2CF8 H;  1NPM A;  2ZPS A;  1AFQ C;  2ZHE H;  1ANB A;  1ANC A;  4B75 A;  3GY2 A;  1Z8I B;  3Q77 A;  3SU5 A;  2W26 A;  2FO9 A;  1YF4 A;  2OXS A;  3HKI B;  4A1T A;  1XX9 A;  2LEL A;  1CGI E;  1GI9 B;  2FEQ H;  1F7Z A;  2XWA A;  5F03 A;  1THS H;  1GGD B;  1WTG H;  3T27 A;  2OD3 B;  3U1I B;  2HPP H;  3Q76 A;  1CBW B;  1ZHM A;  5EPN A;  3SJ9 A;  1P9U A;  1ELE E;  4BXW A;  1KXD A;  1ZTK A;  2TGP Z;  3GCO A;  3SQH E;  4B73 A;  3S7K B;  1NFY A;  2G4U A;  3UQV A;  1TQ0 B;  2PUQ H;  1FPC H;  3ZZ9 A;  3ZZ3 A;  4JZ1 A;  4KP0 A;  3Q3Y A;  3WY8 A;  3BIV H;  3F3B A;  3N99 A;  2PKA B;  1LVO A;  3SOR A;  4DW2 U;  5EXM A;  1QB6 A;  3MQK C;  3RXC A;  1EOJ A;  2R9P A;  3BG4 C;  5GJ4 B;  1P03 A;  2D8W A;  3TGK E;  2OK5 A;  3DSO A;  2FMJ A;  4I8K A;  1THR H;  4YLQ H;  1IHT H;  6LPR A;  2WHX A;  1AND A;  2EI6 A;  2G81 E;  1COW D;  3MOC A;  1Z8G A;  1MAX A;  1PQA A;  2QN5 T;  4KTS A;  3RC6 A;  4BAH B;  3A7Y A;  3LDX H;  1OYQ A;  3GS9 A;  1EJA A;  3AAV A;  1WOF A;  3URC A;  1ELV A;  3QTO H;  1TNG A;  4FOU C;  1Y3V A;  1WYK A;  4YOG A;  1YPM H;  3DSG A;  5CHB A;  7EST E;  1KDQ A;  1C5Z B;  2ZU2 A;  3DHK H;  4ZRO A;  4EST E;  2P8O C;  1C5L H;  1LHF H;  1O2Z A;  3MO3 A;  2WV4 A;  1PYT C;  3PRO A;  1GCD A;  4MQA A;  3DT0 H;  4RN6 A;  3AAU A;  1GJA B;  7KME H;  2CK3 D;  3U69 H;  3LON A;  1O2V A;  1RS0 A;  4JZF H;  3UNR A;  4XBC A;  3R0F A;  1C5O H;  1FX0 B;  2F91 A;  4YTA A;  2F9V A;  1TQ7 B;  2BXT H;  1F0R A;  2B0F A;  1GDQ A;  1KLT A;  1PPH E;  5T6G A;  1GMH G;  2ZPQ A;  3DA9 B;  5FBI A;  3UAI C;  4Q7Z A;  5E2P A;  2WPH S;  4I7Y H;  3D49 H;  2JH5 D;  3LH1 A;  4WVP E;  3SHA H;  1P8V C;  1O2I A;  1ZR0 A;  1C2J A;  3BEI B;  5B6O A;  1JRS A;  1OP0 A;  4FUH A;  1LCY A;  2O9Q A;  3SND A;  2PWX A;  1GMH F;  3RMN H;  3SI4 H;  1HGT H;  5AFY H;  4OS5 A;  1P3E A;  1CVW H;  2FOD A;  3BEF B;  4A6L A;  1G30 B;  1S85 A;  3VGC C;  3ELA H;  4FU8 A;  2UUK B;  1KLI H;  1PQ5 A;  1WUN H;  5EW1 H;  1TGN A;  4JYU H;  2ZC9 H;  3O8R A;  1TGS Z;  2Y80 A;  1PJP A;  1N8O C;  1BA8 B;  2ZHQ H;  8GCH G;  3FN8 A;  5DP3 A;  2QXG A;  2TRM A;  1FXY A;  1FY4 A;  3M7Q A;  2H2Z A;  1ELD E;  2ZGC A;  3ZIA D;  2FTL E;  1PPB H;  1QL8 A;  4AG1 A;  3U9A H;  3SUE A;  5DG6 A;  4X1Q U;  5DKM A;  3VB5 A;  3V3M A;  2F43 B;  2PKA A;  1BOQ A;  4NIX A;  4FUE A; 
#chains in the Genus database with same CATH homology
 4I32 A;  1H8E D;  3O8D A;  3PRD A;  5GJ4 B;  1DXP A;  4ASU D;  2F4L A;  2OC7 A;  2FM2 A;  2KM0 A;  2IJD 1;  2WSS D;  3DSO A;  3OFN D;  3E90 B;  4WF8 A;  5GND A;  2OK5 A;  4YXW D;  4B76 A;  3PV5 A;  2WHX A;  2YMS D;  5F53 A;  1COW D;  4Q63 A;  4OM9 A;  4KTC A;  3O8C A;  2IJO B;  3O8B A;  3RC6 A;  4B6E A;  3GS9 A;  5CDF E;  3OTP A;  5GPI B;  2JDI D;  4Q4L A;  3OYP A;  1CU1 A;  2QF5 A;  2XND D;  4TSF D;  3SUF A;  1KMH B;  2QF4 A;  3DSP A;  2F9U A;  3KF2 A;  3LOX A;  3SU1 A;  3PV2 A;  5EPY A;  3SU3 A;  4RI0 A;  4B6F A;  3SUD A;  3DCL A;  2O8M A;  1NS3 A;  3FOA A;  5H4I B;  2KCO A;  5CHB A;  4FET A;  3SU4 A;  2WPD D;  2M2A A;  1W3C A;  3P8N A;  4WH8 A;  4TYD A;  2OBQ A;  1BMF D;  2QE7 D;  1OHH D;  3SV6 A;  3UB0 A;  5EQQ A;  2W6I D;  3M5N A;  2KFW A;  2P59 A;  4K8B A;  4B71 A;  5C0U A;  2KCY A;  1MAB B;  5EQR A;  3N7E A;  4I31 A;  3AK5 A;  4R8T B;  3SZE A;  2WV9 A;  5EQS A;  2FP7 B;  3NRL A;  2VBC A;  2CK3 D;  3LON A;  5FL7 D;  5DN6 D;  2XOK D;  3P8O A;  5ESB A;  2HLD D;  3SV9 A;  4B74 A;  3PRB A;  3M5O A;  3SYJ A;  3W1E A;  1JXP A;  1A1R A;  1FX0 B;  4JMY A;  1NBM E;  3SUG A;  1DXW A;  1W0K D;  3LKW A;  3OE7 D;  4ZCN A;  2F9V A;  2W6J D;  2L6O A;  2AHM E;  1E1R D;  2V7Q D;  5ETX A;  2KCA A;  3SU2 A;  1E1Q D;  2QV1 A;  5DSF A;  2A4R A;  3WWB A;  3N7D A;  2K0Q A;  3FO8 D;  2GVF A;  4TT3 D;  4XD7 D;  2YMS B;  2WZQ A;  3SV7 A;  2J5U A;  2YOL A;  5FPS A;  1SKY E;  5HKK D;  5IK2 D;  5C0T A;  2OIN A;  2OC0 A;  4B75 A;  1DY8 A;  5FPY A;  3VG8 A;  2FOM B;  2KR7 A;  3F2F A;  3OAA D;  3SV8 A;  5B6L A;  3RC5 A;  1RGQ A;  4A1X A;  1NBM D;  2JJ1 D;  1BT7 A;  3SU5 A;  4A92 A;  3WWF A;  2XCN A;  3F0O A;  3SU6 A;  1RTL A;  2OC8 A;  3EYD A;  4A1T A;  4Z1M D;  3KNX A;  3WW7 A;  2LEL A;  2OC1 A;  1W0J D;  3OEE D;  2A4Q A;  4NWK A;  2A4G A;  2KCP A;  5IDK A;  4WH6 A;  3U1I B;  2K1Q A;  4F55 A;  3KEE A;  4M9F A;  3O8R A;  2K8I A;  3FKS D;  4I33 A;  1DY9 A;  5EPN A;  5FPT A;  5T1V A;  5C17 A;  1N1L A;  1WXR A;  3U1J B;  2JJ2 D;  3FN8 A;  4NWL A;  1H8H D;  3F0P A;  3F2H A;  3SU0 A;  4B73 A;  2XCF A;  3M5M A;  2XNI A;  1EFR D;  2YMS C;  3ZIA D;  4A1V A;  2JIZ D;  3RC4 A;  1S6L A;  4U01 A;  4DT4 A;  1E79 D;  3L6P A;  3SUE A;  2GGV B;  3OEH D;  2OBO A;  2F43 B;  3H09 A;  3KN2 A;  3M5L A;  3F3B A;  3N99 A;  2KZ4 A;  3F2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...