3G01A

Structure of grc mutant e192r/e193g
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
227
structure length
211
Chain Sequence
IIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHCKGRSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECYVAGWGKVKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDGDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWIKKTMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme C
publication title Structure of granzyme C reveals an unusual mechanism of protease autoinhibition
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 42
structure length 211
sequence length 227
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3g01A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3g01A02
4AORA 5LGOA 2SGEE 1XM1A 1GI7B 3B8JA 2Z3CA 4X8TH 2ZF0H 2PKAB 1MD7A 1PQAA 2FTMA 2D8WA 3GCHC 1WU1A 1RIWB 1N6XA 3RXUA 3NWUA 4B74A 1THSH 5JBAS 4B2CA 3BTWE 1TGTA 3SNAA 1UCYE 2ZWLH 3KIDU 2Z3EA 2FOFA 4YT7H 2VNTA 1ZZZA 3L33A 2Z9GA 1DWBH 1B0FA 1YC0A 3GY3A 1EZSC 4O03A 1DWDH 2ZFFH 2G51A 2ZC9H 1XX9A 3U9AH 3RLYH 1AVWA 3RXMA 1ETTH 4DY7B 1Y5UT 1MTWA 2ZNKH 1VGCC 2QAAA 1TYNA 3GY7A 4UONA 1RTLA 2VH0A 4NWKA 2WUBA 3VB7A 4LK4A 2KAIB 1AE5A 4NSYA 1HAVB 1DWCH 4O97A 1Y3UA 3S69A 1C5XB 2ZECA 3P8OA 3WY8A 3AAUA 1O34A 1OP0A 1EAUA 5FBEA 2PW8H 2Y7XA 3G01A 3BSQA 2R0LA 5C5OA 3DD2H 2FI4E 3PLBA 1ACBE 3SUEA 1NPMA 1ETSH 4MNXA 1WOFA 2UUYA 2BB4A 3A81A 1DITH 2UWLA 2H9EH 1DWEH 1IQHA 2LNCA 1X7AC 1N1LA 1SFQB 4LXBH 4B75A 4K8YA 1DFPA 2AMQA 1GBEA 2JKHA 1PQ7A 1UTLM 5T6DA 4SGAE 1O3GA 1UMAH 3RXLA 3LGVA 1VCPA 1W2KH 2F9UA 1AU8A 4R8TB 4X6PA 4IN1A 1G30B 3K65B 2AYWA 3R3GB 1DY9A 3SU6A 2AGEX 2P95A 2ZQ1A 2UUJB 4IW4E 4FUEA 2XBYA 2XWAA 3GY2A 1DM4B 1UTJA 1Q31A 3T28A 4BXWA 3BTGE 3IG6B 1TNIA 1ELDE 4K1SA 4YLUA 5TCCA 1MKWK 1P57B 4X1QU 1BTXA 1BUIA 5C5NA 1SQTA 2B8OH 4DT7B 1T7CA 3C27B 3RXAA 1HAHH 4IN2A 1TBRH 1ELFA 1A4WH 1O3NA 2FX4A 4UD9H 3BIVH 2XBWA 1BTZA 1O3EA 3F68H 3RMNH 1Z8RA 3MYWA 3BG4B 2ZFSA 3EDXB 1K1LA 2VWLA 1C5RA 4WF8A 1ELCA 1CGIE 1T8LA 4FUIA 1L4ZA 1LVYA 2W7UA 4NIXA 1F5KU 2RCEA 2AIPA 2R9PA 1AWHB 2ZHWH 1GMHG 3RMMH 2QXJA 1ZJKA 1JRSA 5A8XA 1CA8B 3A7ZA 3M7TA 3SOSA 3TH3H 5F03A 1C2HA 2KAIA 3OY5U 4YLQH 3PO1B 1GHBG 1F7ZA 1HAVA 5T3HA 1LHCH 2GT7A 4OS6A 2M5TA 3KN2A 3HK3B 1C9TA 1O2YA 1BHXB 1JWTA 2NU0E 3PMHB 4JZ1A 3VXFH 1BJVA 4E7RG 1C1SA 4FUGA 4NG9H 1TALA 4Y0ZE 1GHZA 1GL0E 1ZRKA 2BY9X 3LC3A 3B23B 3GY4A 1UVUH 1O30A 2BY8X 1P2QA 4YT6H 1ZJDA 4ABHA 2Z9IA 1LKAA 2A5AA 4JYUH 4Q2KA 3FZZA 1CQQA 3U69H 1A0JA 1S0QA 2ZDVH 1DX5M 1MBQA 2ZHDA 3T29A 1W0ZU 2A32A 4E06H 3SJ8A 4HFPB 3F9HA 3GYLB 4DVAU 5TJXA 3PM3A 3SGBE 3U8OH 1GI4A 1F92A 1O2QA 5G4BA 5EU8A 1GI5A 2BXTH 3UWJH 1Z1JA 4TY6A 3ITIA 1QRZA 4MG3A 3I29A 1O3HA 1FUJA 5BPEA 1C5LH 3PTBA 1LHDH 1V2UT 3PB1E 1P2IA 1BOQA 1GJAB 3RXEA 1WBGB 3O8DA 2YNBA 2SGQE 4UFFH 1ELGA 4GAWA 3MU4A 2GV7A 3UTUH 1DSTA 1O5EH 2BOHB 1BTPA 1NZQH 3TK9A 3URCA 2OC1A 1T8NA 4DG4A 1GBTA 2B0FA 2SNVA 3L3TA 1CE5A 3GYMA 5EW2H 1Y5AT 3ZVGA 1LDTT 3A87A 1Z71A 1BMNH 3A89A 5L30H 3DHKH 1C5VA 1D3DB 1O3DA 3T27A 3V13A 3W95A 1BBRK 4BOHA 1RS0A 1GBFA 1PPFE 2QYIA 1EOLA 1GCDA 3RXQA 3PWCA 1WYKA 3PMBB 2WPKS 4I7YH 3ZZDA 1SLWB 1VCWA 1HPGA 4X0WU 1SGRE 1SMFE 1HYLA 1KDQB 2VGCC 3ZZCA 1D9IA 4ZXYH 1W12U 1GJCB 2BD8A 3SU4A 2O8WA 3A8BA 1P2JA 5EXNA 1LVOA 2FWWA 1IQEA 1XUGA 3GY5A 4JZDH 1O3JA 4XDEA 1BQYA 1PFXC 3TGIE 2A4RA 3ZZ4A 1ABJH 1GMHF 2FESH 1YPLH 1AI8H 1G32B 2ZG0H 1S6HA 2C3SA 1TOCB 2XWBI 2ZU1A 2CV3A 2H1UA 2PGBB 2VWOA 3BEIB 3UOPA 1GVKB 1C5NH 2OINA 4X1RU 2QY0B 4FXGH 1VJ9U 2Y6TA 8ESTE 2BYAX 1AWFH 1V2WT 1CO7E 1C2KA 2QIQA 2OD3B 1P9UA 1C4Y2 8LPRA 2VWNA 1FY3A 3ELAH 3TH4H 1AD8H 1TNKA 2A4GA 5AHGH 1JXPA 2HOBA 1EPTB 3MOCA 2BVSH 4I8LA 3DFLA 3A80A 1L1NA 1GVZA 1C5ZB 1K22H 1SLVB 4LZ4B 5HGGA 1NFYA 2ZU2A 4U01A 5CHAB 1DDJA 1XKBC 5ESBA 3BN9A 3VB5A 1AUJA 4NGAH 1O2OA 3MI4A 1FIZA 3RXTA 2VIPA 3RXSA 3SNDA 1ID5H 2CHAC 4ZKOU 3V0XA 2V3HH 2VIVA 2WYGA 1ARCA 2QXHA 9ESTA 1ZMNA 4Q7XA 1TA6A 4XE4A 1FPCH 2Q1JA 3GDUA 5A8YA 4B73A 1FNIA 1O2ZA 3QO6A 2GCTC 1TX6A 1K21H 1YPGH 1NO9H 1JIMA 1T32A 2CXVA 5PTPA 3OYPA 4VGCB 1HAGE 3MO9A 3OY6U 6CHAC 4TPYA 2R3UA 2H2ZA 3ATWA 1AFEH 1JRTA 4PROA 1GI3A 1EUFA 2Q6GA 3SN8A 1E35B 1FONA 3E16B 4CH8B 4WMFA 1Y3XA 2YOLA 2UUFB 1SGNE 4NZLA 3MNXA 1DVAH 3A7YA 4UFDH 1K9OE 4IGDA 4Y10E 1K2I1 4A1XA 3SUDA 2J34A 4SGBE 1EKBB 4WY3A 2A5IA 1MTSA 1KDQA 1DXWA 1UTPA 4K5ZA 1F5LA 5IYTA 1TQ7B 1ESAA 3VGCC 3LH1A 2BOKA 1BMLA 1QBVH 2NU2E 1IAUA 3RM2H 2PKSC 3SGQE 1LVBA 4MNWA 1N6YA 1MTUA 1DY8A 2ODPA 3BV9B 1Y8TA 1H9LB 1ELTA 1A5GH 1O31A 3HPTB 4FVDA 1UJ1A 2D2DA 3EYDA 3SQEE 1P0SH 1TMUH 3LPRA 2JH5D 3I77A 3A85A 1O2WA 1TBZH 3HGPA 1NS3A 1FLEE 3QTOH 4ESTE 4KTUA 1NFXA 2QXIA 1IQIA 1QB1A 4MPVA 1MCVA 2FTLE 3VXEH 1TMTH 4K1TA 1RJXB 3RU4D 3KQEA 2ANYA 3GOVB 1P3CA 3MH5A 1SPJA 1O5BB 2ZCLP 1TA2A 1QQ4A 2Z6BD 1O2KA 1QA0A 1DANH 1EPTA 1CGJE 4Y7BA 2CN0H 4I8KA 4BXSA 3F9FA 3SV8A 1NN6A 1TGSZ 2JETC 2THFB 2P93A 3A8AA 3BIUH 3F1SB 3RXBA 1FQ3A 3CS7A 3FFGA 4OS5A 1EJAA 3GISB 4Y8YA 2GMTB 2XC0A 4YO9A 3ODDA 1TGCA 4RN6A 1IOEA 1QY6A 4B2BA 1FAXA 5H4IB 1Q3XA 3RP2A 2A31A 1ZRBA 3SI3H 1DE7H 2G5VA 1L1GA 4DIHH 3SUFA 3M3SA 3TITA 4Y71A 1Y5BT 1GGDC 4OGYA 4UFGH 4CRBA 3U8TH 2RA3A 4LOYH 1BBRH 1P2NA 4XBCA 1MAXA 2WPHS 2ZPRA 4K69A 3UQVA 5EG4A 4X1SU 5EQRA 1CA0B 3SV9A 2V3OH 2WYJA 2BX4A 2WPIS 5C1UA 1PQ8A 2BDYA 2A1DB 1TGBA 3SJKA 3P6ZB 1MTNB 1AB9C 3E1XB 3F9GA 3EA8A 4LZ1H 2Y82A 2H9HA 2AGGX 4WJG2 1DT2A 1LMWB 1BMMH 2QC2A 1ANCA 3LGYA 1ESTA 5JBBS 1BA8B 1EX3A 2BD9A 2VVUA 3E8LA 3FP7E 1TIOA 5J4SA 3IWMA 1TQ0B 3F6UH 2VINA 4ZXXH 2ZKSA 2YNAA 2UWPA 1C9PA 1C5MD 1GBIA 1QL8A 2ESTE 1C5YB 1ELAA 1C1QA 3ESTA 4ISNA 4THNH 1O5CB 1A3EH 3TIUA 2Z9LA 3SU1A 3FAOA 4K3JA 1ZGVA 4BNRA 1Z8GA 2R0KA 2BD2A 1S83A 1GBJA 3QZRA 1G36A 1O3LA 1P3EA 1A0HB 3SQHE 1BDAA 5GPIB 5HXFA 1ZR0A 3HGNA 2B7DH 1TPOA 1SHHB 1CBWB 1CSOE 1UCYK 2V6NA 4JYVH 4Y8ZA 1C2IA 1SGTA 1MU8B 2ZFRH 1O32A 4OS2A 4DW2U 5GXPA 1GCTB 1ORFA 3UNSA 1GDUA 1NM6A 1ZPZA 1SVPA 4MPWA 1V6DA 1N8OC 2Z7FE 3SGAE 1DPOA 4XBDA 1W7XH 1YCPH 4WWYA 3PMAB 1ABIH 2ZA5A 1A0LA 2ZP0H 3P8FA 5DK1A 1O3AA 1T31A 1SLUB 5F8TA 2HRVA 1K1MA 2P94A 3MNBA 2I6QA 5J4QA 2FS9A 1XKAC 2BLWA 1TPPA 1NFUA 5C1XA 1FXYA 3AW0A 3K9XB 2A2QH 3UNQA 4NA9H 3TGJE 3GCHB 3I78A 3Q3YA 1GDNA 1GDQA 1K28D 4U2WA 1TNJA 1ZYOA 4X2VA 3K6ZA 1E37B 1P12E 3QWCH 2WUCA 4FU8A 1J17T 1SR5C 1SSXA 1Y3WA 1Z8IB 1GI8B 2PGQB 2ZHQH 3RXIA 1GJ6A 3BTEE 1CHOF 2O8UA 2BD5A 4CHAC 3ATMA 1SGIB 1AO5A 1O5GH 2UWOA 2IN2A 2AIQA 4BAMB 1BZXE 1HCGA 1QL9A 3KHVA 3LGUA 3N7OA 2OLGA 3UOUA 3ENSB 2ZDAH 1B5GH 4ABGA 1VGCB 1KXFA 2ANWA 2SGAA 3LJOA 4GPGA 2FLRH 4FUHA 4Z0KA 1V2PT 1IQNA 1J16A 4O3UA 4ZHLU 1UVOA 1AFQC 4BTIB 1P8VC 2WINI 1D3PB 2ZCHP 4DURA 2ZGJA 3BEUA 2R3YA 5HMAA 5DPAA 1IHSH 1GJ8B 2TRMA 4YZUA 3DUXH 2C4FH 2PKAA 1SGEE 3T5FH 4I8JA 1NFWA 1XMNB 1GG6C 2ODYB 5JB9S 2GTBA 2FYRA 1SGCA 1WV7H 1G37A 2GVFA 2VIWA 3A88A 3AVZA 1O3IA 1L1JA 2ASUB 2TIOA 3TNTA 2QN5T 1MMJN 1KLTA 5ETXA 4J1YA 3V12A 2C8WB 1U6QA 5FX5A 1BIOA 4HI3A 4AYVB 1HGTH 5DG6A 3STIA 1J8AA 2R2WU 4OGXA 4KELA 1HAXB 2GX4A 3M3VA 1O3BA 3KCGH 4CRCA 1FY4A 1EAXA 3URDA 1MU6B 3ATKA 5CE1A 1BITA 1DLKB 3TVJB 4F49A 1EZXC 1HAYB 2ZTZA 1UTOA 1AIXH 1B0EA 4KKDA 3CS0A 3HATH 5EXMA 2P3UB 1C5PA 3UREA 1P2MA 1AN1E 2ZGBH 2BQ7B 1V2VT 2RDLA 3PMJA 1OSSA 2Z9KA 1RRKA 1C2LA 2PHBA 4I32A 4GHTA 2FM2A 3U1JB 4CBNA 1YF4A 1KSNA 1O3CA 1C2MA 3AAVA 1AUTC 1GI6A 3MMGA 4GHQA 2OUAA 3RDZA 1F0SA 2A7CA 1DS2E 1ZSJA 3ZZ6A 2QF0A 3P95A 1W3CA 3O8BA 3U1IB 1THRH 1LHEH 1BHXF 3A7VA 2Y5HA 2GD4B 2HALA 3SW2B 1HDTH 1ZTKA 4IC5A 2QGRA 5DP5A 4FUJA 5SGAE 3D62A 1FY5A 2ZFTA 2EEKA 3P17H 5EXLA 1K1PA 3UUZA 1ZHRA 5DO4H 2Q6DA 3GICB 3ZZ3A 1FI8A 5E2PA 3SO3A 1V2JT 1C1RA 1THPB 5L2YH 4ZHAA 1C1UH 1ANDA 1QJ7B 3M5NA 3QUMP 5B6OA 4A1TA 3RXVA 4HTCH 1O2IA 4NCYA 4U30A 1G3BA 1BCUH 4ABJA 3EQ0H 1P04A 1W10U 2SGFE 1ZHPA 3TJUA 1TAWA 1Z6JH 1RFNA 2BXUH 1AMHA 4ZMAH 4J2YB 2ZGHA 1WUNH 3M5MA 4X1NU 1SGQE 1GJ4H 4TY7A 2HPQH 1ETRH 1GHAG 1UCYH 3OTJE 1HJAC 3RXPA 2V35A 1VR1H 2QA9E 2J95A 5AFZH 1MZDA 4AGKA 1AKSB 3A7TA 1ELBA 4ABIA 4H6SB 1YYY1 1P10A 1NROH 1VITH 3LIWA 5EODA 3TLOA 3KQDA 2ZDKA 4H4FA 5C20A 4TWYA 2QCYA 2SFAA 2FZZA 2BDBA 2FOGA 1WAYB 1GHXH 1ZOMA 2BHGA 1CT0E 1A2CH 1QNJA 2ZHEH 4KGAA 2EA3A 1PPCE 2BD3A 1QB6A 3SV7A 5A09A 4QT8C 2ZU4A 2Y80A 1CGHA 1C1PA 3V3MA 2GDDA 1C1WH 4ZKSU 3MU0A 1KXEA 3ZZ9A 1GHWH 4NIYA 4AB8A 2ZU5A 2FP7B 5JB8S 1H8DH 1BMAA 1UK2A 1T4VH 1C1OA 1A7SA 1H9IE 1EASA 4UDWH 3RU4E 3HKJB 1O3PB 2ZO3H 4JK6A 2BY5X 4JMYA 2FIRH 3DA9B 2OP9A 2Q6FA 4TWWA 1OWDA 4CR5A 3GCNA 2G4TA 2ZFPH 5E0GA 3TGKE 3QTVH 2B9LA 4NA7A 4FU9A 2WPJS 1TRMA 1H9HE 2HPPH 1T8OA 3QDZB 1TNGA 4NFFA 1O5FH 4KP0A 5T6FA 1YPHE 4GLYA 5HYOA 1RTKA 3KEEA 1TRNA 1GHBF 1S6FA 1FJSA 3A84A 4Y0YE 3FANA 3MU5A 3MO6A 1ARBA 1V3XA 3FVFB 2FOAA 3NPSA 3K6YA 1O3KA 1P06A 3PLKA 3U98H 1O2VA 4X2XA 2GP9B 2OQ5A 4CH2B 2GCHG 1NRSH 2F9BH 4ABFA 5AFYH 1MKWH 2A5KA 2FDAA 2WPMS 3UR6A 2C93B 3K2UA 2J92A 1SGYE 2V0BA 4NIWA 1K1OA 3ZZ5A 3DFJA 1MCTA 3SU2A 1IQLA 1QJ6B 2F9OA 3M7QA 3RU4T 1TPSA 3MWIU 3MU1A 1V2LT 3TNSA 2VGCB 1SFIA 1ELEE 4ABEA 5FPSA 1NRQH 3H5CB 1TNHA 3SU3A 1J15A 7ESTE 4JK5A 3A86A 2FI5E 2A4QA 2F91A 1HJ9A 2AGIX 2SNWA 3TPIZ 4NFEA 4K1EA 3LU9B 6LPRA 1SQOA 1C2GA 4MLFB 1QBNA 1AKSA 3BTHE 1JMOH 2P8OC 4BTUB 4DOQA 4D7GA 2G00A 1OWKA 3UIRA 5FXLA 1LPGB 1LTOA 1EB1H 1Z6EA 1O2MA 2AFQB 1AY6H 1BRUP 1MQ5A 4WH8A 2DE8A 2HWLB 1E0FD 2A45B 2CJIA 4IMZA 4B2AA 3M35A 1OWIA 1ZSKA 3RMLH 2ZDLA 3ZZBA 4JCNA 4NSVA 1GHAF 2OC8A 2QV1A 3FZDA 1W11U 3VPKA 1J9CH 3SV2H 5FCKA 1VITG 1O3FA 4NIVA 2W5EA 3MU8A 1KTTB 5FPYA 2STAE 2OXSA 3LOXA 3Q3KA 3E0PB 3KQCA 1A61H 4FUCA 1F0TA 2XCNA 1TFXA 4D76A 2TGTA 3C1KA 2CHAB 4A6LA 1D3QB 3M61U 1TOMH 4K2YA 1C2DA 1UVSH 3MNCA 4WMEA 5A2MH 3STJA 3BG8A 3TU7H 4AFUA 2ULLA 4OS1A 1C4V2 2GCTB 4OS7A 4Q7ZA 4Z6AH 4CRAA 1W13U 2FMJA 2F9VA 3M5LA 1BRBE 5E0HA 2ZTYA 1QRXA 1PJPA 2OTVA 1HIAB 2NU3E 2H6MA 2Z3DA 3MNSA 2W7SA 6CHAB 1C5UA 1HFDA 4BAKB 4CRFA 4MPXA 1L0ZA 2ALPA 1SGDE 5E8EH 4X2WA 2PUQH 4B76A 4ISOA 5GIBA 5LPFA 1GHVH 3UQOA 1P03A 1UHBB 5DKMA 5L6NH 1ESBA 1S84A 3LH3A 1O33A 2P3TB 3LJJA 3PROA 5DGJA 5LPRA 2C8ZB 1NRNH 1WSSH 1UTMA 2A2XH 2CGAA 3A8DA 3VGCB 2ANMH 3NK8A 3M3TA 1GBCA 1QURH 3FP6E 3QGJA 1FY1A 2ZPSA 3E6PH 1OP8A 2NWNA 1P09A 2PKSB 2C8YB 5C67A 1XUJA 1XVMA 1O2GH 2HNTF 4MDSA 1FN6A 3E91A 1FY8E 1OKXA 1TPAE 2F9NA 5GWZA 2GCHF 1KXDA 1OYTH 1C2FA 1HBTH 5E2OA 4A92A 4CREA 1OPHB 5JYIA 1LCYA 1LKBA 1SHYA 4INLA 4O3TA 1NU9A 1LPKB 4MPUA 1RD3B 2A7HA 3RXKA 1PPBH 1SGFG 1EZUC 1D4PB 1RIWC 3NXPA 1PQ5A 1GVLA 5DP9A 5EW1H 1OWEA 4IBLH 1MKXK 5DP7A 2ZFQH 1QIXB 2XC4A 2OQUA 1Y59T 2EI8A 2ZU3A 3SHAH 1P11E 1O35A 3Q76A 4YOIA 1HJ8A 1SOTA 2JETB 4XSKU 1AVGH 5FPTA 4E05H 4X6NA 1K1IA 1HAPH 3RXOA 3M37A 1A5HA 1FN8A 4I33A 5DP8A 5K7RA 1BTHH 3KNXA 1CU1A 2LPRA 3BTME 3GCOA 4Y11E 4FUFA 1GBAA 1O37A 1A3BH 1C5WB 3GCTG 3GDSA 3QK1A 4AFZA 4INHA 2JH6D 1K1JA 2B5TB 5AF9H 1SLXB 3S7KB 3TJVA 3LKWA 1H1BA 3AASA 1A1RA 1GI9B 2PUXB 4A1VA 1OWJA 1GGDB 2FOBA 2A4OA 2VIOA 3UY9A 3Q3XA 4MVNA 5A0AE 3AW1A 2P16A 3T25A 3PLPA 4UE7H 4DCDA 2BDCA 1O2UA 2XCFA 4ZH8A 4Y8XA 1WQSA 2W3IA 1ANBA 1HIAA 1VITF 1EZQA 1DICA 1P01A 1O2LA 2A0QB 4Y79A 3NUMA 5F6MA 2OC0A 3DT0H 1NTPA 3TK6A 1TLDA 1O2SA 2FODA 5EQQA 2HVXA 1HXEH 4BAOB 4KTCA 1MBMA 1AB9B 4X6OA 2PLXA 1V2KT 1PPHE 3RMOH 1HV7A 3JZ2B 1UHBA 4WVPE 1QB9A 1UTNA 2ZHFH 2VIDA 2XNIA 4D7FA 4RKOB 1YKTA 2BX3A 2QXGA 4DJZB 1GJ5H 1YPKH 2EI6A 2XC5A 2BDHA 4NZQA 3EGKH 5LH8A 1SL3A 1KLIH 1MH0A 1SB1H 1V2QT 3BEFB 3RC6A 5FHTA 2FO9A 1W0YH 1Z1IA 3NKKA 1CT2E 2K1QA 4BTTB 3ZYDA 1T4UH 5JPMH 1TE0A 3HK6B 4R0IA 2F3CE 2C8XB 4XBBA 4AX9H 3VFEA 5C2ZA 3GDVA 2BQWB 2FOMB 4ABAA 1MUEB 1O2HA 1UTKA 3OU0A 4JZIA 4UFEH 4D8NA 2O8MA 1GBMA 3RC5A 3LONA 1QA7A 3E3TA 3ODFA 3RXGA 1TMBH 2AMPA 2BQ6B 3BTDE 4TPIZ 1IQKA 1GBHA 3SI4H 4TYDA 3A8CA 3O8CA 2UUKB 5DP3A 1V2ST 2W3KA 3OX7U 2SGPE 3BG4C 4AFSA 3O8RA 1YPMH 1HXFH 1P2OA 4ISLA 2ZQ2A 2ZTXA 1G9IE 3JZ1B 4WXIA 4HGCA 4AOQA 2FS8A 4GSOA 3SNEA 3EA9A 2XBXA 1OS8A 3VB4A 4CR9A 1LPZB 1O2NA 1CT4E 5EPYA 2O9QA 4ISHH 1LQDB 2HLCA 1TX7A 4AFQA 3P8GA 3SHCH 1KLJH 2ZCKP 1RXPA 2J4IA 1N8OB 4ASHA 1ANEA 1WTGH 1FPHH 2VVVA 1V2TT 1W8BH 1YGCH 3A83A 2OCVB 1BTUA 1JBUH 1O38A 3RM0H 3SNCA 2P3FH 1CHGA 4GVUA 3PO1C 3SV6A 5I46H 2VJ1A 2J94A 4YESB 1S81A 1O2JA 1FDPA 1BTWA 1FAKH 2G5NA 1XXFA 5LPEA 3RXJA 5DP6A 4FUBA 1RTFB 4D9QA 3E0NB 1TONA 5ESTE 3P92A 3M36A 1G3EA 1TX8A 2WV4A 3PTNA 1PYTD 1MQ6A 3S0NA 3ZVBA 1UVTH 3GY8A 1QRWA 3M7UA 5BRRE 3PV4A 1A46H 1OYQA 1AGJA 2DUCA 2XYAA 3QLPH 1TNLA 3SJ9A 4K60A 4FU7A 3TJNA 3EA7A 5FAHA 1M9UA 3GCTF 2PFEA 3ATIA 4CHAB 1HAIH 1NRRH 4MTBA 1BTYA 2CF8H 2FLBH 1KXCA 2BD7A 1O2XA 1OWHA 4INKA 3D49H 1C5SA 1AQ7A 1EAWA 4Y7AA 2J9NA 2ZI2H 3KL6A 4JYTA 5C1YA 3OSYA 3UWIA 3D23A 3LGIA 1OP2A 5GJ4B 1ZPCA 2H5CA 4AGJA 1QBOA 3HKIB 1AFQB 3P8NA 2BMGB 2RA0A 1XVOA 2AMDA 4I31A 3TK5A 1C1VH 2TGAA 4H6TA 4ZKNU 1D6RA 3CENA 7LPRA 1C2EA 2FI3E 1GBDA 1GBKA 1WTHD 3KF2A 1PPZA 2JH0D 1MKXH 2ZGXH 4CBOA 1AHTH 1GG6B 9LPRA 7GCHG 2R2MB 2DE9A 1FZZA 1TBQH 3PWBA 2P59A 1QL7A 4FVBA 4NA8A 3UPEA 2H5DA 5EPNA 2PTCE 1S82A 1O36A 4B71A 1T8MA 1NU7B 1J14A 1SOZA 3TH2H 1TRYA 1JIRA 5GDSH 2HGTH 1W14U 3S9CA 2G55A 4Q7YA 4MNYA 1LQEA 3FP8E 4XOJA 1E34B 3H7OA 4X8SH 1NESE 1O2TA 3MH6A 5JBCS 3UNRA 1YPHC 1WQVH 3KQBA 1G3CA 3NCLA 2G81E 1V2OT 3BTQE 3SUGA 1VCQA 1SGFA 4OS4A 2ALVA 1GI0A 3BTFE 1B7XB 1F0RA 1XUIA 2BLQA 4GUXA 1DUAA 1YPEH 2Z94A 2ZZUH 3L6PA 1GMDG 3H7TA 2NU1E 3SU0A 4AB9A 2TGPZ 4AYYB 4WXVA 2VU8E 3T2NA 2IPHA 2EI7A 2ZDMA 1TABE 2G8TA 2RG3A 5L2ZH 1GI1A 1NC6A 4CRGA 3IITA 2A7JA 2D1JA 1MAYA 4X8VH 2F9PA 1DXPA 3ZV8A 4E7NA 1MD8A 2XXLA 5HM2A 2BLVA 2O8TA 2Y81A 2Z9JA 2BVXH 1SC8U 3UR9A 8GCHG 2PR3A 5FCRA 4XFQA 6GCHG 2W26A 2TPIZ 4X8UH 3Q77A 3VB6A 1YCPM 1PPGE 4JZEH 1ZMLA 1BT7A 5A0CA 3ZZAA 5FX6A 1H8IH 1DOJA 3U8RH 1S0RA 1XUKA 1IQJA 5EGMA 3T26A 5F8ZA 5A8ZA 4X1PU 1BB0B 1BBRE 3LDXH 1QR3E 1S85A 4BAHB 1EPTC 1MZAA 1E36B 2NU4E 1SG8B 5I25A 2XRCA 1FMGA 1C5QA 1Y3YA 1KIGH 1Z8JB 1KTSB 1V2NT 1ZTLA 1GL1A 2XTTB 2OBQA 5CHAC 1YM0A 1SQAA 2BDGA 2J38A 4YOJA 4I8GA 1V2RT 3EE0B 4IC6A 3ZV9A 5FBIA 1GMCG 2AH4X 4Y76A 2ANKH 1HJAB 1Q2WA 6ESTA 2GGVB 1JOUB 1SGPE 2VH6A 2VIQA 3LT3A 1IQGA 1KXBA 1YLCA 5K0HA 1KXAA 3ZVDA 2FOCA 1HAZB 2AEIH 2J2UA 2FOHA 5IDKA 3S9AA 3MFJA 4FUDA 1EP5A 3A7XA 1QCPA 1YP9A 1RGQA 3RXDA 4X6MA 2GZ8A 3SNBA 1DLEA 3P70B 1C5OH 4MNVA 1G2LA 1SBWA 4A7IB 2GT8A 2QF3A 4VGCC 1C1MA 4BANB 2GKVE 2WPLS 1XUHA 5GCHG 1L2EA 2ZEBA 2Y7ZA 2ZPQA 1LHFH 3D65E 2PSXA 4K8BA 1TGNA 1VZQH 1UVPA 3M5OA 2BY6X 4MQAA 4ZHMU 1LVMA 1GI2A 2OC7A 1FV9A 1GBLA 3ZZ7A 7GCHF 1ZTJA 1QJ1B 2TBSA 2Y5FA 1IHTH 1ELVA 1P2KA 2I6SA 1CVWH 5HM9A 5C3NA 1GJ7B 4Y6DA 3B9FH 2BD4A 1ZPBA 1EJMA 1G2MA 5EOKA 3QN7A 3VB3A 4GCHG 3SU5A 3SZNA 3A82A 2GV6A 3T62A 3BTKE 3ATLA 5AVDA 4YTAA 3LGTA 4H42U 4IMQA 1O39A 1ZSLA 4AG1A 2BDIA 1HB0B 2XBVA 3LC5A 1P05A 1ZMJA 5E0JA 1C4U2 1YBWA 1C1NA 3RXRA 2BM2A 2GDEH 4X2YA 5T6GA 1YCPK 3RXCA 3ZVFA 1GMDF 2PV9B 1QFKH 1O5AB 1BRAA 1PPEE 1NRPH 1EJNA 2FPZA 1QTFA 3S7HB 1SI5H 1EP6A 1O3OA 1INCA 3UFAA 4F4OC 2IJOB 4AZ2B 3NZIA 1O3MA 1EOJA 4RSPA 4RKJB 4I8HA 2GZ7A 1HLTH 4AN7A 3QGNB 5JDUB 3R0FA 2TGDA 7KMEH 3ZVAA 1AE8H 1UK4A 8GCHF 4ABDA 1IQMA 1S5SA 2GMTC 3CP7A 6GCHF 2HNTC 1GJBB 2VVCA 1GHYH 1O2RA 4YOGA 3E90B 2CF9H 2BZ6H 1C1TA 1GBBA 2ZIQH 4B1TA 3EAJA 1GPZA 2O8LA 1PYTC 1P9SA 1GWAA 2OBOA 3MTYA 2PTNA 4HZHA 1XUFA 1C5TA 3MH4A 2P8OB 3TJOA 1E38B 2SGDE 4DIIH 1TB6H 1W7GH 2Y5GA 5JBTA 2CMYA 3RXHA 4WMDA 1CA0C 3RUOA 1K1NA 3ZYEA 4ABBA 5F8XA 1L4DA 3ZVEA 2ZDNA 1XXDA 1BRCE 1NY22 3F9EA 1D6WA 1QQUA 3PYHA 2WV5A 1MTNC 3A7WA 1GMCF 2ILNA 1V2MT 2H9TH 1YPJH 2C90B 1EB2A 4ZROA 3RLWH 1EXFA 2BTCE 3ZZ8A 4D9RA 1NT1A 1C2JA 5ABWA 2VWMA 4ZAEA 1MTVA 1H4WA 3QZQA 4YM9A 1VJAU 4Q80A 1UTQA 1F5RA 2FX6A 4ISIH 1QHRB 8KME2 1DUEA 1F2SE 2FXRA 1CHOG 1OX1A 3MHWU 2PWXA 1Y3VA 2BVRH 5GCHF 3RC4A 1WCZA 1LO6A 1O5DH 1TWXB 4ZKRU 4BAQB 1AZZA 1YLDA 2FOEA 1OXGA 2ZGCA 1FIWA 2ODQA 1IQFA 2FYQA 2F83A 3GY6A 2BY7X 1O0DH 1OOKB 2D26C 4UEHH 1EAIA 1AVXA 1BJUA 3W94A 3VEQB 1O2PA 2PSYA 1ZHMA 3BF6H 1UO6A 1LHGH 4U32A 1CBWC 1HAOH 2IOTA 2HNTE 4JZFH 1AZ8A 4KTSA 1A5IA 2XW9A 4IS5A 1P02A 4GCHF 1ZLRA 1G3DA 3V7TA 2G4UA 3BTTE 3Q00A 4O9VA 4AG2A 2BDAA 1GJ9B 1GCTC 3MH7A 3QX5H 3SJIA 4WH6A 4NWLA 5TCAA 1EATA 4CRDA 1Z7KA 1KY9A 3S9BA 1HUTH 4A5TS 2GZ9A 4DGJA 1QGFA 2G52A 3SBKA 1KYNA 1ZGIA 5CMXH 3SORA 5EQSA 2EC9H 1HRTH 2AS9A 4M7GA 5DJ7A 3ZVCA 5DP4A 4ZUHA 3KGPA 2BLOA 3LGWA 3RXFA 2FEQH 2AERH 1GJDB 3MO3A 1EQ9A 1F0UA 1HNEE 1UK3A 1D3TB 5A0BA 1DSUA 2STBE 2BZAA 2VB0A 3SJOA
chains in the Genus database with same CATH superfamily
4AORA 5LGOA 2SGEE 1XM1A 1GI7B 3B8JA 5T1VA 2Z3CA 4X8TH 2ZF0H 2PKAB 1MD7A 1PQAA 2FTMA 3F0PA 2D8WA 3GCHC 1WU1A 2JJ1D 1RIWB 1N6XA 3RXUA 3NWUA 4B74A 1THSH 5JBAS 4B2CA 3BTWE 1TGTA 3SNAA 1UCYE 2ZWLH 3KIDU 2Z3EA 2FOFA 3PRDA 2VNTA 1ZZZA 3L33A 4YT7H 2Z9GA 3H09A 1DWBH 1B0FA 1YC0A 3GY3A 1EZSC 4O03A 1DWDH 2ZFFH 2G51A 2ZC9H 3F2GA 1XX9A 3U9AH 3RLYH 1AVWA 3RXMA 1ETTH 4DY7B 1Y5UT 1MTWA 2ZNKH 1VGCC 2QAAA 1TYNA 3GY7A 4UONA 1RTLA 2VH0A 4NWKA 2WUBA 3VB7A 4LK4A 2KAIB 1AE5A 4NSYA 1HAVB 1DWCH 3EE7A 4O97A 1Y3UA 3S69A 1C5XB 2ZECA 2LP6A 3P8OA 3WY8A 3AAUA 1O34A 1OP0A 1EAUA 5FBEA 2PW8H 2Y7XA 3G01A 3BSQA 2R0LA 5C5OA 3DD2H 2FI4E 3PLBA 1ACBE 3SUEA 1NPMA 1ETSH 4MNXA 1WOFA 2UUYA 2BB4A 3A81A 1DITH 2UWLA 2H9EH 1DWEH 1IQHA 2LNCA 1X7AC 1N1LA 1SFQB 4LXBH 4B75A 4K8YA 1DFPA 2AMQA 1GBEA 2JKHA 1PQ7A 1UTLM 5T6DA 4SGAE 1O3GA 1UMAH 4RI0A 3RXLA 3LGVA 1VCPA 1W2KH 2F9UA 1AU8A 2RDEA 4R8TB 4X6PA 4IN1A 1G30B 3K65B 2AYWA 3R3GB 1DY9A 3SU6A 2AGEX 2P95A 2ZQ1A 2UUJB 4IW4E 4FUEA 2XBYA 2XWAA 3GY2A 1DM4B 1UTJA 1Q31A 3T28A 4BXWA 3BTGE 3IG6B 1TNIA 1ELDE 4K1SA 4YLUA 5TCCA 1MKWK 1P57B 3CNRA 4X1QU 1BTXA 1BUIA 5C5NA 1SQTA 2B8OH 4DT7B 1T7CA 3C27B 2F43B 3RXAA 1HAHH 4IN2A 1TBRH 1ELFA 1A4WH 1O3NA 2FX4A 4UD9H 3BIVH 2XBWA 1BTZA 1O3EA 3F68H 3RMNH 1Z8RA 3MYWA 3BG4B 3PRBA 4P00A 2ZFSA 3EDXB 1K1LA 2VWLA 1C5RA 4WF8A 1ELCA 1CGIE 1T8LA 4FUIA 1L4ZA 1LVYA 2W7UA 4NIXA 1F5KU 2RCEA 2AIPA 2R9PA 1AWHB 2ZHWH 1GMHG 3RMMH 2QXJA 1ZJKA 1JRSA 5A8XA 1CA8B 3A7ZA 3M7TA 3SOSA 3TH3H 5F03A 5GNDA 4YXWD 1C2HA 2KAIA 3OY5U 4YLQH 3PO1B 1GHBG 1F7ZA 1HAVA 5T3HA 1LHCH 2GT7A 4OS6A 2M5TA 3KN2A 3HK3B 1C9TA 1O2YA 1BHXB 1JWTA 2NU0E 3PMHB 4JZ1A 3VXFH 1BJVA 4E7RG 1C1SA 4FUGA 4NG9H 1TALA 4Y0ZE 1GHZA 1GL0E 1ZRKA 2BY9X 3LC3A 3B23B 3GY4A 1UVUH 1O30A 2BY8X 1P2QA 4YT6H 1ZJDA 4ABHA 2Z9IA 1LKAA 2A5AA 4JYUH 4Q2KA 3FZZA 1CQQA 3U69H 1A0JA 1S0QA 2ZDVH 1DX5M 1MBQA 2ZHDA 3T29A 1W0ZU 2A32A 4E06H 3SJ8A 4HFPB 3F9HA 3GYLB 4DVAU 5TJXA 3PM3A 3SGBE 3U8OH 1GI4A 1F92A 1O2QA 1E79D 5G4BA 5EU8A 1GI5A 2BXTH 3UWJH 1Z1JA 4TY6A 3ITIA 1QRZA 4MG3A 3I29A 1O3HA 2XNDD 1FUJA 5BPEA 1C5LH 3PTBA 1LHDH 1V2UT 3PB1E 1P2IA 1BOQA 1GJAB 3RXEA 1WBGB 3O8DA 2YNBA 2SGQE 4UFFH 1ELGA 4GAWA 3MU4A 2GV7A 3UTUH 1DSTA 1O5EH 2BOHB 1BTPA 1NZQH 3TK9A 3URCA 2OC1A 1T8NA 4DG4A 1GBTA 2B0FA 2SNVA 3L3TA 1CE5A 3GYMA 5EW2H 1Y5AT 3ZVGA 1LDTT 3A87A 1Z71A 1BMNH 3N7EA 3A89A 5L30H 3DHKH 1C5VA 1D3DB 1O3DA 3T27A 5EJZA 3V13A 3W95A 1BBRK 4BOHA 1RS0A 1GBFA 1PPFE 2QYIA 1EOLA 1GCDA 2J5UA 3RXQA 3PWCA 1WYKA 3PMBB 2WPKS 4I7YH 3NRLA 3ZZDA 1SLWB 1VCWA 1HPGA 4X0WU 1SGRE 1SMFE 1HYLA 1KDQB 2VGCC 3ZZCA 1D9IA 4ZXYH 1W12U 1GJCB 2W6ID 2BD8A 3SU4A 2O8WA 3A8BA 1P2JA 5EXNA 1LVOA 2FWWA 1IQEA 1XUGA 3GY5A 4JZDH 2XOKD 2VBCA 1O3JA 4XDEA 1BQYA 1PFXC 3TGIE 2A4RA 3ZZ4A 1ABJH 1GMHF 2FESH 1YPLH 1AI8H 1G32B 2ZG0H 2WHXA 1S6HA 2C3SA 1TOCB 2XWBI 2ZU1A 2CV3A 2H1UA 1OHHD 2PGBB 2VWOA 3BEIB 1GVKB 3UOPA 1C5NH 2OINA 4X1RU 2QY0B 4FXGH 1VJ9U 2Y6TA 4Q4LA 8ESTE 2IJD1 2BYAX 1AWFH 1V2WT 1CO7E 1C2KA 2QIQA 2OD3B 1P9UA 1C4Y2 8LPRA 2VWNA 1FY3A 3ELAH 3TH4H 1AD8H 1TNKA 2A4GA 5AHGH 1JXPA 2HOBA 1EPTB 3MOCA 2BVSH 4I8LA 3DFLA 3A80A 1L1NA 2YMSD 1GVZA 1C5ZB 1K22H 1SLVB 4LZ4B 1SKYE 1NFYA 5HGGA 2ZU2A 3FKSD 4U01A 5CHAB 1DDJA 1XKBC 5ESBA 3BN9A 3VB5A 1AUJA 4NGAH 1O2OA 3MI4A 1FIZA 3RXTA 2VIPA 3RXSA 3SNDA 1ID5H 2CHAC 4ZKOU 3V0XA 2V3HH 2VIVA 2WYGA 1ARCA 2QXHA 9ESTA 1ZMNA 4Q7XA 1TA6A 4XE4A 1FPCH 2Q1JA 2HVYB 3GDUA 5A8YA 4B73A 1FNIA 1O2ZA 3QO6A 2GCTC 1TX6A 1K21H 1YPGH 1NO9H 1JIMA 1T32A 2CXVA 5PTPA 3OYPA 4VGCB 1HAGE 3MO9A 3OY6U 6CHAC 4TPYA 2R3UA 2H2ZA 3ATWA 2OK5A 1AFEH 1JRTA 4PROA 1GI3A 1EUFA 2Q6GA 3SN8A 1E35B 1FONA 3E16B 4CH8B 4WMFA 1Y3XA 2YOLA 2UUFB 1SGNE 4NZLA 1NBMD 3MNXA 1DVAH 3A7YA 4UFDH 1K9OE 4IGDA 3F0OA 4Y10E 1K2I1 4HG6A 4A1XA 3SUDA 2J34A 4SGBE 1EKBB 4WY3A 2A5IA 1MTSA 1KDQA 1DXWA 1UTPA 4K5ZA 1F5LA 5IYTA 1TQ7B 1ESAA 3VGCC 3LH1A 2BOKA 1BMLA 1QBVH 1IAUA 2NU2E 2WSSD 3RM2H 2PKSC 3SGQE 1LVBA 4MNWA 1N6YA 1MTUA 1DY8A 2ODPA 3BV9B 1Y8TA 1H9LB 1ELTA 1A5GH 1O31A 3HPTB 4FVDA 1UJ1A 2D2DA 3EYDA 3SQEE 1P0SH 1TMUH 3LPRA 2JH5D 3I77A 3A85A 1O2WA 2L74A 1TBZH 3HGPA 1NS3A 1FLEE 3QTOH 4ESTE 2QE7D 4KTUA 1NFXA 2QXIA 1IQIA 1QB1A 4MPVA 1MCVA 2FTLE 3VXEH 1WDIA 1TMTH 4K1TA 1RJXB 3RU4D 3KQEA 2ANYA 2KCAA 3GOVB 4XD7D 1P3CA 3MH5A 1SPJA 1O5BB 2ZCLP 1TA2A 1QQ4A 2Z6BD 1O2KA 1QA0A 1DANH 5IK2D 1EPTA 1CGJE 4Y7BA 2CN0H 4I8KA 4BXSA 3F9FA 3SV8A 1NN6A 1TGSZ 1VKYA 2JETC 2THFB 2GJGA 2P93A 3A8AA 3BIUH 3F1SB 3RXBA 1FQ3A 3CS7A 3FFGA 4OS5A 1EJAA 3GISB 4Y8YA 2GMTB 2XC0A 4YO9A 3ODDA 1TGCA 4RN6A 1IOEA 1QY6A 4B2BA 1FAXA 5H4IB 1Q3XA 3RP2A 2A31A 1ZRBA 3SI3H 1DE7H 2G5VA 1L1GA 4DIHH 4RT1A 3SUFA 3M3SA 3TITA 4Y71A 1Y5BT 1GGDC 4OGYA 4UFGH 4CRBA 3U8TH 2RA3A 4LOYH 1BBRH 1P2NA 4XBCA 1MAXA 2WPHS 2ZPRA 4K69A 3AK5A 3UQVA 5EG4A 4X1SU 5EQRA 1CA0B 3SV9A 2V3OH 2WYJA 2BX4A 2WPIS 5C1UA 1PQ8A 2BDYA 2A1DB 1TGBA 3SJKA 3P6ZB 1MTNB 1AB9C 3E1XB 3F9GA 3EA8A 4LZ1H 1UW7A 2Y82A 2H9HA 2KFWA 2AGGX 4WJG2 1DT2A 1LMWB 1BMMH 2QC2A 1ANCA 3LGYA 1ESTA 5JBBS 1BA8B 1EX3A 4M9FA 2BD9A 2VVUA 3E8LA 3FP7E 1TIOA 5J4SA 3IWMA 5C0UA 1TQ0B 3F6UH 5B6LA 2VINA 4ZXXH 2ZKSA 2YNAA 2K8IA 2UWPA 1C9PA 1C5MD 1GBIA 1QL8A 2ESTE 1C5YB 1ELAA 1C1QA 3ESTA 4ISNA 4THNH 3OEED 1O5CB 1A3EH 3TIUA 2Z9LA 3SU1A 4ASUD 3FAOA 2LELA 4K3JA 1ZGVA 4BNRA 1Z8GA 2R0KA 2BD2A 1S83A 1GBJA 3QZRA 1G36A 1O3LA 1P3EA 1A0HB 3SQHE 1BDAA 5FL7D 5GPIB 5HXFA 1ZR0A 3HGNA 2B7DH 1TPOA 1SHHB 1CBWB 1CSOE 1UCYK 2V6NA 4JYVH 4Y8ZA 1C2IA 1SGTA 2KR7A 1MU8B 2ZFRH 1O32A 4OS2A 4DW2U 5GXPA 1GCTB 1ORFA 3OFND 3UNSA 1GDUA 1NM6A 1ZPZA 1SVPA 4MPWA 1V6DA 1N8OC 2Z7FE 3SGAE 1DPOA 4XBDA 1W7XH 4AC9A 1YCPH 4WWYA 3PMAB 1ABIH 2ZA5A 1A0LA 2ZP0H 3P8FA 5DK1A 5DSFA 1O3AA 1T31A 1SLUB 5F8TA 2HRVA 1K1MA 2P94A 3MNBA 1YWUA 2I6QA 5J4QA 2FS9A 1XKAC 2BLWA 2WZQA 1TPPA 1NFUA 5C1XA 1FXYA 3AW0A 3K9XB 2A2QH 2V7QD 3UNQA 4NA9H 3TGJE 3GCHB 3I78A 3Q3YA 1GDNA 1GDQA 2WV9A 1K28D 4U2WA 1TNJA 1ZYOA 4X2VA 3K6ZA 1E37B 1P12E 3QWCH 2WUCA 4FU8A 1J17T 1SR5C 1SSXA 1Y3WA 1Z8IB 4TT3D 1GI8B 2PGQB 2ZHQH 4ACAA 3RXIA 1GJ6A 3BTEE 1CHOF 2O8UA 2BD5A 4CHAC 3ATMA 1SGIB 2YMSC 3OAAD 1AO5A 1O5GH 2UWOA 2IN2A 2AIQA 4BAMB 1BZXE 1HCGA 1QL9A 3KHVA 3LGUA 3N7OA 2OLGA 3UOUA 3ENSB 2ZDAH 1B5GH 4ABGA 1VGCB 4ACBA 1KXFA 2ANWA 2SGAA 3LJOA 4GPGA 2FLRH 4FUHA 4Z0KA 1S6LA 1V2PT 1IQNA 1J16A 4O3UA 4ZHLU 1UVOA 1AFQC 4BTIB 1P8VC 2WINI 1D3PB 2ZCHP 4DURA 2ZGJA 3BEUA 2R3YA 5HMAA 5DPAA 1IHSH 1GJ8B 2TRMA 4YZUA 3DUXH 2C4FH 2PKAA 1SGEE 3T5FH 4I8JA 1NFWA 1XMNB 1GG6C 2ODYB 5JB9S 2GTBA 2FYRA 1SGCA 1WV7H 1G37A 2GVFA 2VIWA 3A88A 3AVZA 1O3IA 1L1JA 2ASUB 2TIOA 3TNTA 2QN5T 1MMJN 1KLTA 5ETXA 4J1YA 3V12A 3FOAA 2C8WB 1U6QA 5FX5A 1BIOA 4HI3A 4AYVB 1HGTH 5DG6A 3STIA 1J8AA 2R2WU 4OGXA 4KELA 1HAXB 2GX4A 1H8HD 3M3VA 1O3BA 3KCGH 4CRCA 1FY4A 1EAXA 4ZCNA 3URDA 1MU6B 3ATKA 5CE1A 1BITA 1DLKB 3TVJB 4F49A 3PV5A 1EZXC 1HAYB 2ZTZA 1UTOA 1AIXH 1B0EA 4KKDA 3CS0A 3HATH 1SQRA 5EXMA 2P3UB 2F4LA 1C5PA 3UREA 1P2MA 1AN1E 2ZGBH 2BQ7B 1V2VT 2RDLA 3PMJA 1OSSA 2Z9KA 1RRKA 1C2LA 2PHBA 4I32A 4GHTA 2FM2A 3U1JB 4CBNA 1YF4A 1KSNA 1O3CA 1C2MA 3AAVA 1AUTC 1GI6A 2QF4A 3MMGA 2OUAA 4GHQA 3RDZA 1K0HA 1F0SA 2A7CA 1DS2E 1ZSJA 3ZZ6A 3N99A 2QF0A 3P95A 1W3CA 3O8BA 3U1IB 1THRH 3SYJA 1LHEH 1BHXF 5C17A 3A7VA 2Y5HA 2GD4B 2J98B 2HALA 3SW2B 1HDTH 1ZTKA 4IC5A 2QGRA 5DP5A 4FUJA 5SGAE 3D62A 1FY5A 2ZFTA 2EEKA 3FO8D 3P17H 5EXLA 1K1PA 3UUZA 1ZHRA 5DO4H 2Q6DA 3GICB 3ZZ3A 1FI8A 5E2PA 3SO3A 1V2JT 1C1RA 2JIZD 1THPB 5L2YH 4ZHAA 1C1UH 1ANDA 1QJ7B 3M5NA 3QUMP 5B6OA 4A1TA 3RXVA 4TSFD 4HTCH 1O2IA 4NCYA 4U30A 1G3BA 1BCUH 4ABJA 3EQ0H 1P04A 1W10U 2SGFE 1ZHPA 3TJUA 1TAWA 1Z6JH 1RFNA 2BXUH 1AMHA 5C0TA 4ZMAH 4J2YB 2ZGHA 1WUNH 3M5MA 4X1NU 1SGQE 1GJ4H 4TY7A 2HPQH 3UAIC 1ETRH 1GHAG 1UCYH 3OTJE 1NBME 1HJAC 4P02A 3RXPA 2V35A 1VR1H 2QA9E 2J95A 5AFZH 4B6EA 1MZDA 4AGKA 1AKSB 3A7TA 1ELBA 4ABIA 1H8ED 4H6SB 1YYY1 1P10A 1NROH 1VITH 3LIWA 5EODA 3TLOA 3KQDA 2ZDKA 4H4FA 5C20A 4TWYA 2QCYA 3WW7A 2SFAA 2FZZA 2BDBA 2FOGA 1WAYB 1GHXH 1ZOMA 2BHGA 1CT0E 1A2CH 1QNJA 2ZHEH 4KGAA 2EA3A 1PPCE 2BD3A 1QB6A 3SV7A 5A09A 4QT8C 2ZU4A 2Y80A 3KQ5A 1CGHA 1C1PA 3V3MA 2GDDA 1C1WH 4ZKSU 3MU0A 1KXEA 3ZZ9A 1GHWH 4NIYA 4AB8A 2ZU5A 2FP7B 5JB8S 1H8DH 1BMAA 1UK2A 1T4VH 1C1OA 2QF5A 1A7SA 1H9IE 1EASA 4UDWH 3RU4E 3HKJB 1O3PB 5CHBA 2ZO3H 4JK6A 2BY5X 4JMYA 2FIRH 3DA9B 2OP9A 2Q6FA 4TWWA 1OWDA 4CR5A 3GCNA 2G4TA 2ZFPH 5E0GA 3TGKE 3QTVH 2B9LA 4NA7A 4FU9A 2WPJS 1TRMA 1H9HE 2HPPH 1T8OA 3QDZB 1TNGA 2J98A 4NFFA 1O5FH 4KP0A 5T6FA 1YPHE 4GLYA 5HYOA 1RTKA 3KEEA 1TRNA 1GHBF 1S6FA 1FJSA 3A84A 4Y0YE 3FANA 3MU5A 3MO6A 1ARBA 1V3XA 3FVFB 2FOAA 3NPSA 3K6YA 1O3KA 1P06A 3PLKA 3U98H 2EY4C 5KEDA 1O2VA 4X2XA 2GP9B 2OQ5A 4CH2B 2GCHG 5EIYA 1NRSH 2F9BH 4ABFA 5AFYH 1MKWH 2A5KA 2FDAA 2WPMS 3UR6A 2C93B 3K2UA 2J92A 1SGYE 2V0BA 4NIWA 1K1OA 3ZZ5A 3DFJA 1MCTA 3SU2A 1IQLA 1QJ6B 2F9OA 3M7QA 3RU4T 1TPSA 3MWIU 3MU1A 1YLNA 1V2LT 3TNSA 2VGCB 1SFIA 1ELEE 4ABEA 5FPSA 5KGOA 1NRQH 3H5CB 1TNHA 3SU3A 3DSGA 1J15A 7ESTE 4JK5A 3A86A 2FI5E 2A4QA 2F91A 1HJ9A 2AGIX 2SNWA 3TPIZ 1EFRD 4NFEA 4K1EA 3LU9B 6LPRA 1SQOA 1C2GA 4MLFB 1QBNA 1AKSA 3BTHE 1JMOH 2P8OC 4BTUB 4DOQA 4D7GA 2G00A 1OWKA 3UIRA 5FXLA 1LPGB 1LTOA 1EB1H 1Z6EA 1O2MA 2AFQB 1AY6H 1BRUP 1MQ5A 4WH8A 2DE8A 2HWLB 1E0FD 2A45B 2CJIA 4IMZA 4B2AA 3M35A 1OWIA 1ZSKA 3RMLH 2ZDLA 3ZZBA 4JCNA 3WWBA 4NSVA 1GHAF 2OC8A 2QV1A 3FZDA 1W11U 3VPKA 1J9CH 3SV2H 5FCKA 1VITG 1O3FA 4NIVA 2W5EA 3MU8A 1KTTB 5FPYA 2STAE 2OXSA 3LOXA 3Q3KA 3E0PB 3KQCA 1A61H 4FUCA 2CK3D 1F0TA 2XCNA 1TFXA 4D76A 2TGTA 3C1KA 2KCOA 2CHAB 4A6LA 1D3QB 3M61U 1TOMH 4K2YA 1C2DA 1UVSH 3MNCA 4WMEA 5A2MH 3STJA 3BG8A 3TU7H 4AFUA 2ULLA 4OS1A 1C4V2 2GCTB 4OS7A 4Q7ZA 4Z6AH 4CRAA 1W13U 2FMJA 2F9VA 3M5LA 1BRBE 5E0HA 2ZTYA 1QRXA 1PJPA 2OTVA 1HIAB 2NU3E 5KECA 2H6MA 2Z3DA 3MNSA 2W7SA 6CHAB 1C5UA 1HFDA 4BAKB 3OE7D 4CRFA 4MPXA 1L0ZA 2ALPA 1SGDE 5E8EH 4X2WA 2PUQH 4B76A 4ISOA 5GIBA 5LPFA 1GHVH 3KYFA 3UQOA 1P03A 1UHBB 5DKMA 5L6NH 1ESBA 1S84A 3LH3A 1O33A 2P3TB 3LJJA 3PROA 5DGJA 5LPRA 2C8ZB 1NRNH 1WSSH 1UTMA 2A2XH 2CGAA 3A8DA 3VGCB 2ANMH 3NK8A 3M3TA 1GBCA 1QURH 3FP6E 3QGJA 1FY1A 2ZPSA 3E6PH 1OP8A 2RFKC 2NWNA 1P09A 2PKSB 2C8YB 5C67A 1XUJA 1XVMA 4Q63A 4XRNA 1O2GH 2HNTF 4MDSA 1FN6A 3E91A 1FY8E 1OKXA 1TPAE 2F9NA 2WPDD 5GWZA 2GCHF 1KXDA 1OYTH 1C2FA 1HBTH 5E2OA 4A92A 4CREA 1WXRA 1OPHB 5JYIA 1LCYA 1LKBA 1SHYA 4INLA 4O3TA 1NU9A 3VG8A 1LPKB 4MPUA 4F55A 1RD3B 2A7HA 3RXKA 1PPBH 1SGFG 1EZUC 1D4PB 1RIWC 3NXPA 1PQ5A 1GVLA 5DP9A 5EW1H 1OWEA 4IBLH 1MKXK 5DP7A 2ZFQH 1QIXB 2XC4A 2OQUA 1Y59T 2EI8A 2ZU3A 3SHAH 1P11E 1O35A 3Q76A 4YOIA 1HJ8A 1SOTA 2JETB 4XSKU 1AVGH 4DT4A 5FPTA 4E05H 4X6NA 1K1IA 2PP6A 1HAPH 3RXOA 3M37A 1A5HA 1FN8A 4I33A 5DP8A 5K7RA 1BTHH 3KNXA 1CU1A 2LPRA 3BTME 3GCOA 4Y11E 4FUFA 1GBAA 1O37A 1A3BH 1C5WB 2L6OA 3GCTG 3GDSA 3QK1A 4AFZA 4INHA 2JH6D 1K1JA 2B5TB 5AF9H 1SLXB 3S7KB 3TJVA 3LKWA 1H1BA 3AASA 1A1RA 1GI9B 2PUXB 4A1VA 1OWJA 1GGDB 2FOBA 2A4OA 2VIOA 3UY9A 3Q3XA 4MVNA 5A0AE 3AW1A 2P16A 3T25A 3PLPA 4UE7H 4DCDA 2BDCA 1O2UA 2XCFA 4ZH8A 4Y8XA 1WQSA 2W3IA 1ANBA 1HIAA 1VITF 1EZQA 1DICA 1P01A 1O2LA 2A0QB 4Y79A 3NUMA 5F6MA 2OC0A 3DT0H 3DSPA 1NTPA 3FN8A 3TK6A 1TLDA 1O2SA 2FODA 5EQQA 2HVXA 1YY3A 1HXEH 4BAOB 4KTCA 1MBMA 1AB9B 4X6OA 2PLXA 3ZIAD 3N7DA 1V2KT 1PPHE 3RMOH 1HV7A 3JZ2B 1UHBA 4WVPE 1QB9A 1UTNA 2ZHFH 2VIDA 2XNIA 4D7FA 4RKOB 1YKTA 2BX3A 2QXGA 4DJZB 4F48B 1GJ5H 1YPKH 2EI6A 2XC5A 2BDHA 4NZQA 3EGKH 5LH8A 1SL3A 1KLIH 1MH0A 1SB1H 1V2QT 2HLDD 3BEFB 3RC6A 5FHTA 2FO9A 1W0YH 1Z1IA 3NKKA 1CT2E 2K1QA 4BTTB 3ZYDA 1T4UH 5JPMH 1TE0A 3HK6B 4R0IA 2F3CE 2C8XB 4XBBA 4AX9H 3VFEA 5C2ZA 3GDVA 2BQWB 2FOMB 4ABAA 1MUEB 1O2HA 1UTKA 3OU0A 4JZIA 3F2FA 4UFEH 4D8NA 2O8MA 1GBMA 3RC5A 3LONA 1QA7A 3E3TA 3ODFA 3RXGA 1TMBH 2AMPA 2BQ6B 3BTDE 4TPIZ 1IQKA 1GBHA 3SI4H 4B6FA 4TYDA 3A8CA 3O8CA 2UUKB 5DP3A 1V2ST 2W3KA 3OX7U 2SGPE 3BG4C 4AFSA 2AHME 3O8RA 1YPMH 1HXFH 1P2OA 4ISLA 2ZQ2A 2ZTXA 1G9IE 3JZ1B 4WXIA 4HGCA 4AOQA 2FS8A 4GSOA 3SNEA 3EA9A 2XBXA 1OS8A 3F3BA 3VB4A 4CR9A 1LPZB 1O2NA 1CT4E 5EPYA 2O9QA 4ISHH 1LQDB 2HLCA 1TX7A 4AFQA 3P8GA 3SHCH 1KLJH 2ZCKP 1RXPA 2J4IA 1N8OB 4ASHA 1ANEA 1WTGH 1FPHH 2VVVA 1V2TT 1W8BH 1YGCH 3A83A 2OCVB 1BTUA 1JBUH 1O38A 3RM0H 3SNCA 2P3FH 1CHGA 4GVUA 3PO1C 3SV6A 5I46H 2VJ1A 2J94A 4YESB 1S81A 1O2JA 1FDPA 1BTWA 1FAKH 2G5NA 1XXFA 2K0QA 5LPEA 3RXJA 2KX4A 5DP6A 4FUBA 1RTFB 4D9QA 3E0NB 1TONA 5ESTE 3P92A 3M36A 1G3EA 1TX8A 2WV4A 3PTNA 1PYTD 1MQ6A 3S0NA 3ZVBA 1UVTH 3GY8A 1QRWA 3M7UA 5BRRE 3PV4A 1A46H 1OYQA 1AGJA 2DUCA 2XYAA 3QLPH 1TNLA 3SJ9A 4K60A 2JDID 4FU7A 3TJNA 3EA7A 4Z1MD 5FAHA 1M9UA 3GCTF 2PFEA 3ATIA 4CHAB 1HAIH 1NRRH 4MTBA 1BTYA 2CF8H 2YMSB 2FLBH 1KXCA 2BD7A 1O2XA 1OWHA 4INKA 3D49H 1C5SA 1AQ7A 1EAWA 4Y7AA 2J9NA 2ZI2H 3KL6A 4JYTA 5CDFE 5C1YA 3OSYA 3UWIA 3D23A 3LGIA 1OP2A 1W0KD 5GJ4B 1E1QD 1ZPCA 2H5CA 4AGJA 1QBOA 3HKIB 1AFQB 3P8NA 2BMGB 2RA0A 1XVOA 2AMDA 2KCPA 4I31A 3TK5A 1C1VH 2TGAA 4FOUC 4H6TA 4ZKNU 1D6RA 3CENA 7LPRA 1C2EA 2FI3E 1GBDA 1GBKA 1WTHD 3MQKC 3KF2A 1PPZA 2KM0A 2JH0D 1MKXH 2ZGXH 4CBOA 1AHTH 1GG6B 9LPRA 7GCHG 2R2MB 2DE9A 1FZZA 1TBQH 3PWBA 2P59A 1QL7A 4FVBA 4NA8A 3UPEA 1BMFD 2H5DA 5EPNA 2PTCE 1S82A 1O36A 4B71A 1T8MA 1NU7B 1J14A 1SOZA 3TH2H 1TRYA 1JIRA 5GDSH 2HGTH 1W14U 3S9CA 2G55A 4Q7YA 4MNYA 1LQEA 3FP8E 4XOJA 1E34B 3H7OA 4X8SH 1NESE 5EJ1A 1O2TA 3MH6A 5JBCS 2JJ2D 1YPHC 1WQVH 3KQBA 3UNRA 1G3CA 3NCLA 2G81E 1V2OT 3BTQE 3SUGA 1VCQA 1SGFA 4OS4A 2ALVA 1GI0A 3BTFE 1B7XB 1F0RA 1XUIA 2BLQA 4GUXA 1DUAA 1YPEH 2Z94A 2ZZUH 3L6PA 1GMDG 3H7TA 2NU1E 3SU0A 4AB9A 2TGPZ 4AYYB 4WXVA 2VU8E 3T2NA 2IPHA 2EI7A 2ZDMA 1TABE 2G8TA 2RG3A 5L2ZH 1GI1A 1NC6A 4CRGA 3IITA 2A7JA 2D1JA 1MAYA 4X8VH 2F9PA 1DXPA 2KZ4A 3ZV8A 1MD8A 4E7NA 2XXLA 5HM2A 2BLVA 3W1EA 2O8TA 2Y81A 2Z9JA 2BVXH 1SC8U 3UR9A 8GCHG 2PR3A 5FCRA 4XFQA 6GCHG 2W26A 2TPIZ 4X8UH 3Q77A 3VB6A 1YCPM 1PPGE 4JZEH 1ZMLA 1BT7A 5A0CA 3ZZAA 5FX6A 1H8IH 1DOJA 3U8RH 1S0RA 1XUKA 1IQJA 5EGMA 3T26A 5F8ZA 5A8ZA 4X1PU 1BB0B 1BBRE 3LDXH 1QR3E 1S85A 4BAHB 1EPTC 1MZAA 1E36B 2NU4E 1SG8B 5I25A 2XRCA 1FMGA 1C5QA 1Y3YA 1KIGH 1Z8JB 5DN6D 1KTSB 1V2NT 1ZTLA 1GL1A 2XTTB 2OBQA 5CHAC 1YM0A 3GS9A 1SQAA 2BDGA 1KMHB 2J38A 4YOJA 4I8GA 1V2RT 3EE0B 4IC6A 3WWFA 3ZV9A 5FBIA 1GMCG 2AH4X 4Y76A 2IPQX 2ANKH 5C94A 1HJAB 1Q2WA 6ESTA 2GGVB 1JOUB 1SGPE 2VH6A 2VIQA 3LT3A 1IQGA 1KXBA 1YLCA 5K0HA 1KXAA 3ZVDA 2FOCA 1HAZB 2AEIH 2J2UA 2FOHA 5IDKA 3S9AA 3MFJA 4FUDA 1EP5A 3A7XA 1QCPA 1YP9A 1RGQA 3RXDA 4X6MA 2GZ8A 3SNBA 1DLEA 3P70B 1C5OH 4MNVA 1G2LA 1SBWA 2EQNA 4A7IB 2GT8A 2QF3A 4VGCC 1C1MA 4BANB 2W6JD 2GKVE 2WPLS 1XUHA 5GCHG 1L2EA 2ZEBA 2Y7ZA 2ZPQA 1LHFH 3D65E 2PSXA 4K8BA 1TGNA 3DSOA 1VZQH 1UVPA 3M5OA 2BY6X 4MQAA 4ZHMU 1LVMA 1GI2A 2OC7A 3OEHD 1FV9A 1GBLA 3ZZ7A 7GCHF 1ZTJA 1QJ1B 2TBSA 2Y5FA 1IHTH 1ELVA 1P2KA 2I6SA 1CVWH 3DCLA 5HM9A 5C3NA 1GJ7B 4Y6DA 3OTPA 3B9FH 2BD4A 1ZPBA 2M2AA 1EJMA 1G2MA 5EOKA 3QN7A 3VB3A 4GCHG 3SU5A 3SZNA 3A82A 4I86A 2GV6A 3T62A 3UB0A 3BTKE 1E1RD 3ATLA 5AVDA 4YTAA 3LGTA 4H42U 4IMQA 1O39A 1ZSLA 4AG1A 2BDIA 1HB0B 2XBVA 1COWD 1P05A 1ZMJA 3LC5A 5E0JA 1C4U2 1YBWA 1C1NA 3RXRA 2BM2A 2GDEH 5F53A 4X2YA 5T6GA 1YCPK 3RXCA 3ZVFA 1GMDF 2PV9B 1QFKH 1O5AB 1BRAA 1PPEE 1NRPH 1EJNA 2FPZA 1QTFA 3S7HB 1SI5H 3KYGA 1EP6A 1W0JD 1O3OA 1INCA 3UFAA 4F4OC 2IJOB 4AZ2B 3NZIA 1O3MA 1EOJA 4RSPA 4RKJB 3F2HA 4I8HA 2GZ7A 1HLTH 4AN7A 3QGNB 5JDUB 3R0FA 2TGDA 7KMEH 3ZVAA 1AE8H 1UK4A 8GCHF 4ABDA 1IQMA 1S5SA 2GMTC 3CP7A 6GCHF 2HNTC 1GJBB 2VVCA 1GHYH 1O2RA 4YOGA 3E90B 2CF9H 2BZ6H 1C1TA 1GBBA 2ZIQH 4B1TA 3EAJA 1GPZA 2O8LA 1PYTC 1P9SA 1GWAA 1MABB 2OBOA 3MTYA 2PTNA 4HZHA 1XUFA 1C5TA 3MH4A 2P8OB 3TJOA 1E38B 2SGDE 4DIIH 1TB6H 1W7GH 2KCYA 2Y5GA 5JBTA 2CMYA 2J97A 3RXHA 4WMDA 1CA0C 3RUOA 1K1NA 3ZYEA 4ABBA 5F8XA 1L4DA 3ZVEA 2ZDNA 1XXDA 1BRCE 1NY22 3F9EA 1D6WA 1QQUA 3PYHA 2WV5A 1MTNC 3A7WA 1GMCF 2ILNA 1V2MT 2H9TH 1YPJH 2C90B 1EB2A 4ZROA 3RLWH 4OM9A 1EXFA 2BTCE 3ZZ8A 4D9RA 1NT1A 1C2JA 2V3MA 1QZ8A 5ABWA 2VWMA 5HIZA 4ZAEA 1MTVA 1H4WA 3QZQA 3SZEA 1VJAU 4Q80A 4YM9A 1UTQA 1F5RA 2FX6A 4ISIH 1QHRB 8KME2 1DUEA 1F2SE 2FXRA 1CHOG 1OX1A 3MHWU 2PWXA 1Y3VA 2BVRH 5GCHF 3RC4A 1WCZA 1LO6A 1O5DH 1TWXB 4ZKRU 4BAQB 1AZZA 1YLDA 2FOEA 1OXGA 2ZGCA 1FIWA 2ODQA 1IQFA 2FYQA 2F83A 3GY6A 2BY7X 1O0DH 1OOKB 2D26C 4UEHH 1EAIA 1AVXA 1BJUA 3W94A 3VEQB 1O2PA 2PSYA 1FX0B 1ZHMA 3BF6H 5EJLA 1UO6A 4FETA 1LHGH 4U32A 1CBWC 1HAOH 2IOTA 2HNTE 4JZFH 1AZ8A 4KTSA 1A5IA 2XW9A 4IS5A 1P02A 4GCHF 1ZLRA 1G3DA 3V7TA 2G4UA 3BTTE 3Q00A 4O9VA 4AG2A 2BDAA 1GJ9B 1GCTC 3MH7A 3QX5H 3SJIA 4WH6A 4NWLA 5TCAA 1EATA 4CRDA 1Z7KA 1KY9A 3S9BA 1HUTH 4A5TS 2GZ9A 4DGJA 1QGFA 2G52A 3SBKA 1KYNA 1ZGIA 5HIYA 5CMXH 3SORA 5EQSA 2EC9H 1HRTH 2AS9A 4M7GA 4RT0A 5DJ7A 3ZVCA 5HKKD 5DP4A 4ZUHA 3KGPA 2BLOA 3LGWA 3PV2A 3RXFA 2FEQH 2AERH 1GJDB 3MO3A 1EQ9A 1F0UA 1HNEE 1UK3A 1D3TB 5A0BA 1DSUA 3U28C 2STBE 2BZAA 2VB0A 3SJOA
chains in the Genus database with same CATH topology
4AORA 5LGOA 2SGEE 1XM1A 1GI7B 3B8JA 2Z3CA 4X8TH 2ZF0H 2PKAB 1MD7A 1PQAA 2FTMA 2D8WA 3GCHC 1WU1A 1RIWB 1N6XA 3RXUA 3NWUA 4B74A 1THSH 5JBAS 4B2CA 3BTWE 1TGTA 3SNAA 1UCYE 2ZWLH 3KIDU 2Z3EA 2FOFA 4YT7H 2VNTA 1ZZZA 3L33A 2Z9GA 1DWBH 1B0FA 1YC0A 3GY3A 1EZSC 4O03A 1DWDH 2ZFFH 2G51A 2ZC9H 1XX9A 3U9AH 3RLYH 1AVWA 3RXMA 1ETTH 4DY7B 1Y5UT 1MTWA 2ZNKH 1VGCC 2QAAA 1TYNA 3GY7A 4UONA 1RTLA 2VH0A 4NWKA 2WUBA 3VB7A 4LK4A 2KAIB 1AE5A 4NSYA 1HAVB 1DWCH 4O97A 1Y3UA 3S69A 1C5XB 2ZECA 3P8OA 3WY8A 3AAUA 1O34A 1OP0A 1EAUA 5FBEA 2PW8H 2Y7XA 3G01A 3BSQA 2R0LA 5C5OA 3DD2H 2FI4E 3PLBA 1ACBE 3SUEA 1NPMA 1ETSH 4MNXA 1WOFA 2UUYA 2BB4A 3A81A 1DITH 2UWLA 2H9EH 1DWEH 1IQHA 2LNCA 1X7AC 1N1LA 1SFQB 4LXBH 4B75A 4K8YA 1DFPA 2AMQA 1GBEA 2JKHA 1PQ7A 1UTLM 5T6DA 4SGAE 1O3GA 1UMAH 3RXLA 3LGVA 1VCPA 1W2KH 2F9UA 1AU8A 4R8TB 4X6PA 4IN1A 1G30B 3K65B 2AYWA 3R3GB 1DY9A 3SU6A 2AGEX 2P95A 2ZQ1A 2UUJB 4IW4E 4FUEA 2XBYA 2XWAA 3GY2A 1DM4B 1UTJA 1Q31A 3T28A 4BXWA 3BTGE 3IG6B 1TNIA 1ELDE 4K1SA 4YLUA 5TCCA 1MKWK 1P57B 4X1QU 1BTXA 1BUIA 5C5NA 1SQTA 2B8OH 4DT7B 1T7CA 3C27B 3RXAA 1HAHH 4IN2A 1TBRH 1ELFA 1A4WH 1O3NA 2FX4A 4UD9H 3BIVH 2XBWA 1BTZA 1O3EA 3F68H 3RMNH 1Z8RA 3MYWA 3BG4B 2ZFSA 3EDXB 1K1LA 2VWLA 1C5RA 4WF8A 1ELCA 1CGIE 1T8LA 4FUIA 1L4ZA 1LVYA 2W7UA 4NIXA 1F5KU 2RCEA 2AIPA 2R9PA 1AWHB 2ZHWH 1GMHG 3RMMH 2QXJA 1ZJKA 1JRSA 5A8XA 1CA8B 3A7ZA 3M7TA 3SOSA 3TH3H 5F03A 1C2HA 2KAIA 3OY5U 4YLQH 3PO1B 1GHBG 1F7ZA 1HAVA 5T3HA 1LHCH 2GT7A 4OS6A 2M5TA 3KN2A 3HK3B 1C9TA 1O2YA 1BHXB 1JWTA 2NU0E 3PMHB 4JZ1A 3VXFH 1BJVA 4E7RG 1C1SA 4FUGA 4NG9H 1TALA 4Y0ZE 1GHZA 1GL0E 1ZRKA 2BY9X 3LC3A 3B23B 3GY4A 1UVUH 1O30A 2BY8X 1P2QA 4YT6H 1ZJDA 4ABHA 2Z9IA 1LKAA 2A5AA 4JYUH 4Q2KA 3FZZA 1CQQA 3U69H 1A0JA 1S0QA 2ZDVH 1DX5M 1MBQA 2ZHDA 3T29A 1W0ZU 2A32A 4E06H 3SJ8A 4HFPB 3F9HA 3GYLB 4DVAU 5TJXA 3PM3A 3SGBE 3U8OH 1GI4A 1F92A 1O2QA 5G4BA 5EU8A 1GI5A 2BXTH 3UWJH 1Z1JA 4TY6A 3ITIA 1QRZA 4MG3A 3I29A 1O3HA 1FUJA 5BPEA 1C5LH 3PTBA 1LHDH 1V2UT 3PB1E 1P2IA 1BOQA 1GJAB 3RXEA 1WBGB 3O8DA 2YNBA 2SGQE 4UFFH 1ELGA 4GAWA 3MU4A 2GV7A 3UTUH 1DSTA 1O5EH 2BOHB 1BTPA 1NZQH 3TK9A 3URCA 2OC1A 1T8NA 4DG4A 1GBTA 2B0FA 2SNVA 3L3TA 1CE5A 3GYMA 5EW2H 1Y5AT 3ZVGA 1LDTT 3A87A 1Z71A 1BMNH 3A89A 5L30H 3DHKH 1C5VA 1D3DB 1O3DA 3T27A 3V13A 3W95A 1BBRK 4BOHA 1RS0A 1GBFA 1PPFE 2QYIA 1EOLA 1GCDA 3RXQA 3PWCA 1WYKA 3PMBB 2WPKS 4I7YH 3ZZDA 1SLWB 1VCWA 1HPGA 4X0WU 1SGRE 1SMFE 1HYLA 1KDQB 2VGCC 3ZZCA 1D9IA 4ZXYH 1W12U 1GJCB 2BD8A 3SU4A 2O8WA 3A8BA 1P2JA 5EXNA 1LVOA 2FWWA 1IQEA 1XUGA 3GY5A 4JZDH 1O3JA 4XDEA 1BQYA 1PFXC 3TGIE 2A4RA 3ZZ4A 1ABJH 1GMHF 2FESH 1YPLH 1AI8H 1G32B 2ZG0H 1S6HA 2C3SA 1TOCB 2XWBI 2ZU1A 2CV3A 2H1UA 2PGBB 2VWOA 3BEIB 3UOPA 1GVKB 1C5NH 2OINA 4X1RU 2QY0B 4FXGH 1VJ9U 2Y6TA 8ESTE 2BYAX 1AWFH 1V2WT 1CO7E 1C2KA 2QIQA 2OD3B 1P9UA 1C4Y2 8LPRA 2VWNA 1FY3A 3ELAH 3TH4H 1AD8H 1TNKA 2A4GA 5AHGH 1JXPA 2HOBA 1EPTB 3MOCA 2BVSH 4I8LA 3DFLA 3A80A 1L1NA 1GVZA 1C5ZB 1K22H 1SLVB 4LZ4B 5HGGA 1NFYA 2ZU2A 4U01A 5CHAB 1DDJA 1XKBC 5ESBA 3BN9A 3VB5A 1AUJA 4NGAH 1O2OA 3MI4A 1FIZA 3RXTA 2VIPA 3RXSA 3SNDA 1ID5H 2CHAC 4ZKOU 3V0XA 2V3HH 2VIVA 2WYGA 1ARCA 2QXHA 9ESTA 1ZMNA 4Q7XA 1TA6A 4XE4A 1FPCH 2Q1JA 3GDUA 5A8YA 4B73A 1FNIA 1O2ZA 3QO6A 2GCTC 1TX6A 1K21H 1YPGH 1NO9H 1JIMA 1T32A 2CXVA 5PTPA 3OYPA 4VGCB 1HAGE 3MO9A 3OY6U 6CHAC 4TPYA 2R3UA 2H2ZA 3ATWA 1AFEH 1JRTA 4PROA 1GI3A 1EUFA 2Q6GA 3SN8A 1E35B 1FONA 3E16B 4CH8B 4WMFA 1Y3XA 2YOLA 2UUFB 1SGNE 4NZLA 3MNXA 1DVAH 3A7YA 4UFDH 1K9OE 4IGDA 4Y10E 1K2I1 4A1XA 3SUDA 2J34A 4SGBE 1EKBB 4WY3A 2A5IA 1MTSA 1KDQA 1DXWA 1UTPA 4K5ZA 1F5LA 5IYTA 1TQ7B 1ESAA 3VGCC 3LH1A 2BOKA 1BMLA 1QBVH 2NU2E 1IAUA 3RM2H 2PKSC 3SGQE 1LVBA 4MNWA 1N6YA 1MTUA 1DY8A 2ODPA 3BV9B 1Y8TA 1H9LB 1ELTA 1A5GH 1O31A 3HPTB 4FVDA 1UJ1A 2D2DA 3EYDA 3SQEE 1P0SH 1TMUH 3LPRA 2JH5D 3I77A 3A85A 1O2WA 1TBZH 3HGPA 1NS3A 1FLEE 3QTOH 4ESTE 4KTUA 1NFXA 2QXIA 1IQIA 1QB1A 4MPVA 1MCVA 2FTLE 3VXEH 1TMTH 4K1TA 1RJXB 3RU4D 3KQEA 2ANYA 3GOVB 1P3CA 3MH5A 1SPJA 1O5BB 2ZCLP 1TA2A 1QQ4A 2Z6BD 1O2KA 1QA0A 1DANH 1EPTA 1CGJE 4Y7BA 2CN0H 4I8KA 4BXSA 3F9FA 3SV8A 1NN6A 1TGSZ 2JETC 2THFB 2P93A 3A8AA 3BIUH 3F1SB 3RXBA 1FQ3A 3CS7A 3FFGA 4OS5A 1EJAA 3GISB 4Y8YA 2GMTB 2XC0A 4YO9A 3ODDA 1TGCA 4RN6A 1IOEA 1QY6A 4B2BA 1FAXA 5H4IB 1Q3XA 3RP2A 2A31A 1ZRBA 3SI3H 1DE7H 2G5VA 1L1GA 4DIHH 3SUFA 3M3SA 3TITA 4Y71A 1Y5BT 1GGDC 4OGYA 4UFGH 4CRBA 3U8TH 2RA3A 4LOYH 1BBRH 1P2NA 4XBCA 1MAXA 2WPHS 2ZPRA 4K69A 3UQVA 5EG4A 4X1SU 5EQRA 1CA0B 3SV9A 2V3OH 2WYJA 2BX4A 2WPIS 5C1UA 1PQ8A 2BDYA 2A1DB 1TGBA 3SJKA 3P6ZB 1MTNB 1AB9C 3E1XB 3F9GA 3EA8A 4LZ1H 2Y82A 2H9HA 2AGGX 4WJG2 1DT2A 1LMWB 1BMMH 2QC2A 1ANCA 3LGYA 1ESTA 5JBBS 1BA8B 1EX3A 2BD9A 2VVUA 3E8LA 3FP7E 1TIOA 5J4SA 3IWMA 1TQ0B 3F6UH 2VINA 4ZXXH 2ZKSA 2YNAA 2UWPA 1C9PA 1C5MD 1GBIA 1QL8A 2ESTE 1C5YB 1ELAA 1C1QA 3ESTA 4ISNA 4THNH 1O5CB 1A3EH 3TIUA 2Z9LA 3SU1A 3FAOA 4K3JA 1ZGVA 4BNRA 1Z8GA 2R0KA 2BD2A 1S83A 1GBJA 3QZRA 1G36A 1O3LA 1P3EA 1A0HB 3SQHE 1BDAA 5GPIB 5HXFA 1ZR0A 3HGNA 2B7DH 1TPOA 1SHHB 1CBWB 1CSOE 1UCYK 2V6NA 4JYVH 4Y8ZA 1C2IA 1SGTA 1MU8B 2ZFRH 1O32A 4OS2A 4DW2U 5GXPA 1GCTB 1ORFA 3UNSA 1GDUA 1NM6A 1ZPZA 1SVPA 4MPWA 1V6DA 1N8OC 2Z7FE 3SGAE 1DPOA 4XBDA 1W7XH 1YCPH 4WWYA 3PMAB 1ABIH 2ZA5A 1A0LA 2ZP0H 3P8FA 5DK1A 1O3AA 1T31A 1SLUB 5F8TA 2HRVA 1K1MA 2P94A 3MNBA 2I6QA 5J4QA 2FS9A 1XKAC 2BLWA 1TPPA 1NFUA 5C1XA 1FXYA 3AW0A 3K9XB 2A2QH 3UNQA 4NA9H 3TGJE 3GCHB 3I78A 3Q3YA 1GDNA 1GDQA 1K28D 4U2WA 1TNJA 1ZYOA 4X2VA 3K6ZA 1E37B 1P12E 3QWCH 2WUCA 4FU8A 1J17T 1SR5C 1SSXA 1Y3WA 1Z8IB 1GI8B 2PGQB 2ZHQH 3RXIA 1GJ6A 3BTEE 1CHOF 2O8UA 2BD5A 4CHAC 3ATMA 1SGIB 1AO5A 1O5GH 2UWOA 2IN2A 2AIQA 4BAMB 1BZXE 1HCGA 1QL9A 3KHVA 3LGUA 3N7OA 2OLGA 3UOUA 3ENSB 2ZDAH 1B5GH 4ABGA 1VGCB 1KXFA 2ANWA 2SGAA 3LJOA 4GPGA 2FLRH 4FUHA 4Z0KA 1V2PT 1IQNA 1J16A 4O3UA 4ZHLU 1UVOA 1AFQC 4BTIB 1P8VC 2WINI 1D3PB 2ZCHP 4DURA 2ZGJA 3BEUA 2R3YA 5HMAA 5DPAA 1IHSH 1GJ8B 2TRMA 4YZUA 3DUXH 2C4FH 2PKAA 1SGEE 3T5FH 4I8JA 1NFWA 1XMNB 1GG6C 2ODYB 5JB9S 2GTBA 2FYRA 1SGCA 1WV7H 1G37A 2GVFA 2VIWA 3A88A 3AVZA 1O3IA 1L1JA 2ASUB 2TIOA 3TNTA 2QN5T 1MMJN 1KLTA 5ETXA 4J1YA 3V12A 2C8WB 1U6QA 5FX5A 1BIOA 4HI3A 4AYVB 1HGTH 5DG6A 3STIA 1J8AA 2R2WU 4OGXA 4KELA 1HAXB 2GX4A 3M3VA 1O3BA 3KCGH 4CRCA 1FY4A 1EAXA 3URDA 1MU6B 3ATKA 5CE1A 1BITA 1DLKB 3TVJB 4F49A 1EZXC 1HAYB 2ZTZA 1UTOA 1AIXH 1B0EA 4KKDA 3CS0A 3HATH 5EXMA 2P3UB 1C5PA 3UREA 1P2MA 1AN1E 2ZGBH 2BQ7B 1V2VT 2RDLA 3PMJA 1OSSA 2Z9KA 1RRKA 1C2LA 2PHBA 4I32A 4GHTA 2FM2A 3U1JB 4CBNA 1YF4A 1KSNA 1O3CA 1C2MA 3AAVA 1AUTC 1GI6A 3MMGA 4GHQA 2OUAA 3RDZA 1F0SA 2A7CA 1DS2E 1ZSJA 3ZZ6A 2QF0A 3P95A 1W3CA 3O8BA 3U1IB 1THRH 1LHEH 1BHXF 3A7VA 2Y5HA 2GD4B 2HALA 3SW2B 1HDTH 1ZTKA 4IC5A 2QGRA 5DP5A 4FUJA 5SGAE 3D62A 1FY5A 2ZFTA 2EEKA 3P17H 5EXLA 1K1PA 3UUZA 1ZHRA 5DO4H 2Q6DA 3GICB 3ZZ3A 1FI8A 5E2PA 3SO3A 1V2JT 1C1RA 1THPB 5L2YH 4ZHAA 1C1UH 1ANDA 1QJ7B 3M5NA 3QUMP 5B6OA 4A1TA 3RXVA 4HTCH 1O2IA 4NCYA 4U30A 1G3BA 1BCUH 4ABJA 3EQ0H 1P04A 1W10U 2SGFE 1ZHPA 3TJUA 1TAWA 1Z6JH 1RFNA 2BXUH 1AMHA 4ZMAH 4J2YB 2ZGHA 1WUNH 3M5MA 4X1NU 1SGQE 1GJ4H 4TY7A 2HPQH 1ETRH 1GHAG 1UCYH 3OTJE 1HJAC 3RXPA 2V35A 1VR1H 2QA9E 2J95A 5AFZH 1MZDA 4AGKA 1AKSB 3A7TA 1ELBA 4ABIA 4H6SB 1YYY1 1P10A 1NROH 1VITH 3LIWA 5EODA 3TLOA 3KQDA 2ZDKA 4H4FA 5C20A 4TWYA 2QCYA 2SFAA 2FZZA 2BDBA 2FOGA 1WAYB 1GHXH 1ZOMA 2BHGA 1CT0E 1A2CH 1QNJA 2ZHEH 4KGAA 2EA3A 1PPCE 2BD3A 1QB6A 3SV7A 5A09A 4QT8C 2ZU4A 2Y80A 1CGHA 1C1PA 3V3MA 2GDDA 1C1WH 4ZKSU 3MU0A 1KXEA 3ZZ9A 1GHWH 4NIYA 4AB8A 2ZU5A 2FP7B 5JB8S 1H8DH 1BMAA 1UK2A 1T4VH 1C1OA 1A7SA 1H9IE 1EASA 4UDWH 3RU4E 3HKJB 1O3PB 2ZO3H 4JK6A 2BY5X 4JMYA 2FIRH 3DA9B 2OP9A 2Q6FA 4TWWA 1OWDA 4CR5A 3GCNA 2G4TA 2ZFPH 5E0GA 3TGKE 3QTVH 2B9LA 4NA7A 4FU9A 2WPJS 1TRMA 1H9HE 2HPPH 1T8OA 3QDZB 1TNGA 4NFFA 1O5FH 4KP0A 5T6FA 1YPHE 4GLYA 5HYOA 1RTKA 3KEEA 1TRNA 1GHBF 1S6FA 1FJSA 3A84A 4Y0YE 3FANA 3MU5A 3MO6A 1ARBA 1V3XA 3FVFB 2FOAA 3NPSA