3G01A

Structure of grc mutant e192r/e193g
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
227
structure length
211
Chain Sequence
b'IIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHCKGRSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECYVAGWGKVKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDGDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWIKKTMKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme C
publication title Structure of granzyme C reveals an unusual mechanism of protease autoinhibition
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 42
structure length 211
sequence length 227
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3g01A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3g01A02
1V2VT 1W13U 2SGAA 1TGSZ 3A89A 3PLKA 1NU7B 2UUKB 4XBBA 1GBHA 5I25A 3A84A 1SVPA 1EAWA 4E7RG 3M61U 3VGCC 3SGBE 1O3FA 3P95A 1O5GH 1RTKA 1OKXA 2TGPZ 1SQAA 1Z8RA 3AASA 3G01A 1G37A 1SOTA 2O8UA 1D6WA 1B7XB 1ELBA 1O34A 1RD3B 2WPJS 1VCWA 5HMAA 3RXQA 2BHGA 1GG6B 1GI1A 3LDXH 1S0QA 1O2XA 3SJIA 1MCVA 1S0RA 3BTDE 2HALA 2P16A 2ZHEH 3R0FA 5A8YA 5GJ4B 4U2WA 2BX4A 3TH3H 3MMGA 3QX5H 2GVFA 3U69H 1SB1H 1C1RA 2SFAA 1SGRE 4B2AA 1SBWA 2PV9B 1F5KU 3L6PA 3ZZDA 1MKXK 1HIAA 2FWWA 1MQ5A 2UUFB 2F9PA 5C5NA 4IW4E 1GHXH 3EQ0H 3IWMA 4B75A 1C1UH 4A1VA 1ZHMA 2QCYA 1BRBE 1FONA 5EU8A 3M7UA 4YOIA 2VWLA 3A8CA 4IC6A 1ETSH 1TPAE 4X0WU 3RXDA 1IQEA 1FI8A 3AW1A 1MAXA 3RC6A 5HM9A 4GUXA 1TRYA 1TNGA 3VFEA 1N8OC 4CBOA 3VXEH 1C5NH 4AYYB 2GP9B 3ITIA 1FY5A 3SBKA 3UQVA 2P3TB 2BLOA 1UTQA 1FAXA 3MHWU 5L6NH 1O5FH 4MNWA 1P01A 3ZVEA 1CT0E 1QBVH 4R0IA 1SR5C 3UR6A 1V2PT 2C8YB 3ZVBA 3RP2A 3ZVFA 2OXSA 1Z8IB 4CH2B 1IOEA 3B9FH 3OTJE 3I77A 5L2ZH 3BTQE 3SNCA 1EZUC 1P2JA 2XC5A 2WPIS 3A7WA 1HRTH 1AB9C 3MO9A 4OGXA 4BANB 3GY3A 4NIXA 1ZMLA 2TIOA 5EQQA 1K2I1 3VGCB 1K1JA 1HAVA 1L1NA 4THNH 2BZ6H 3QZQA 1DDJA 1HBTH 1C2GA 5C1UA 2ESTE 2BDAA 3P8FA 1MTUA 2BQWB 1H9LB 2J34A 2QXHA 1NPMA 3TIUA 1GHYH 4ISNA 1UTPA 1YP9A 3MNCA 2FS8A 4Z0KA 3DT0H 1NRRH 2ALVA 3SV9A 4JCNA 1TOCB 2GCTC 3E0PB 1TA2A 5ABWA 1GDQA 2ANMH 2AIPA 1H4WA 1WU1A 1UJ1A 3PMJA 5JYIA 4AYVB 4Y6DA 3E1XB 4YO9A 1G2LA 4O9VA 2XBVA 3M5LA 4X2XA 3U8OH 3ZVDA 2AMPA 4BAHB 2JH6D 2ZECA 1XUJA 2LNCA 1RIWC 1O2PA 4SGAE 3GCOA 3KIDU 1FAKH 4H4FA 1O2GH 4K69A 4AFQA 2FOBA 4DCDA 2BY9X 5C20A 1EP6A 3Q00A 1F0UA 4D8NA 3Q3KA 3L33A 2GZ8A 1F7ZA 3LH1A 4X1SU 4AORA 1N8OB 1JMOH 2ZGJA 2ZPSA 4UFDH 4FVBA 1YPJH 1Z1JA 4GSOA 1QHRB 3UIRA 1LDTT 2BDIA 1H9IE 6GCHF 3KL6A 1O2UA 1GJCB 3D62A 1AD8H 1AN1E 3D65E 4FXGH 4DIHH 1LVOA 1V2KT 1T31A 4F49A 1P2IA 2O8LA 3SUEA 2WINI 3TK9A 2VVCA 3E6PH 3TU7H 5LGOA 1CHOF 1AQ7A 3SU6A 1GBIA 2ZU3A 2Z3DA 1NRNH 2ANKH 1ELVA 4X2YA 4AN7A 3PV4A 3WY8A 3KHVA 4B74A 1F5RA 2OINA 3KGPA 1HXEH 5C67A 2WPHS 1QIXB 1AB9B 1DITH 4Y7AA 5GPIB 4YZUA 1QGFA 1PYTD 3UPEA 3O8DA 2J92A 1DXWA 5CE1A 4NIYA 2ZGBH 5A2MH 4A92A 1O3CA 3NPSA 2PTCE 2FX4A 1SL3A 4F4OC 1P05A 1HAYB 1PQAA 1XUGA 3BEFB 1N1LA 1P2OA 2FEQH 1L0ZA 3HKIB 1O2QA 2F9OA 5E8EH 2GTBA 2GCTB 2UUYA 2B9LA 2Z9KA 1J14A 3LC3A 1QFKH 4RN6A 1UCYE 4E06H 2H5DA 2ZCKP 3PTBA 2PFEA 1WQVH 4K2YA 2ZFPH 1ELAA 5F8ZA 1YPHC 4I8LA 1HUTH 2Q6GA 2Q6DA 1AU8A 1D3DB 1GJBB 2ZTYA 1UHBA 1W3CA 4JZFH 2BY5X 2FI5E 1KDQA 1FY8E 2FTLE 1EASA 1DLEA 4JMYA 3A87A 1RIWB 1MAYA 5A0BA 7KMEH 4K8BA 1P0SH 5LPFA 2FOFA 2F9VA 1HAOH 1UTMA 2OCVB 1FY4A 4GPGA 1QL8A 1KXCA 2W3KA 2GGVB 1BTHH 4NZQA 2R0KA 2GZ9A 1DY8A 3QGJA 1EZSC 3SU1A 3ODFA 2A0QB 2ZQ2A 2VIQA 4DVAU 1BTXA 1ESBA 1GMDF 2TGAA 1QB6A 4IGDA 3M5OA 1V2OT 1C5VA 2QC2A 2ZDKA 1GL1A 4ZHAA 2LPRA 4OGYA 1DICA 3SN8A 4CRCA 1M9UA 2ZGXH 1ZPCA 2ZFSA 5TCCA 1T8OA 3MNBA 1BJUA 4E05H 1O35A 3TJUA 3BN9A 1MTVA 3BTEE 2EA3A 1CA8B 1KLIH 1GI8B 1GI4A 2A7JA 1BZXE 3K65B 1TWXB 1XUFA 4X8SH 1GBTA 4FUFA 1TGBA 3DFLA 1DM4B 3RXRA 3SV2H 2TBSA 3H5CB 4JYTA 1FPCH 3UQOA 1A0JA 1P12E 4Q2KA 1LO6A 3SU4A 1HAIH 3BSQA 2ALPA 4Q7XA 1ESAA 5T6DA 3UTUH 1A4WH 4I32A 1ZHRA 5JBCS 2A1DB 1PQ5A 1DE7H 2H9TH 4AGJA 3SNEA 8GCHG 2D2DA 4RSPA 1PQ8A 4ZUHA 1O3OA 1C2EA 4A1TA 4MPUA 2FIRH 2XW9A 3LPRA 3RXPA 1GI6A 2BLQA 1XX9A 3VB4A 4ABFA 4HGCA 4ZMAH 1F0SA 1VJAU 3A82A 3A86A 4AX9H 4HI3A 1IQKA 1SGPE 3PMBB 4LOYH 2XRCA 1ORFA 4B71A 1K1PA 1MU6B 2ZCLP 1GBDA 1BHXB 2P93A 1N6YA 3A8AA 3T25A 2B5TB 2ZDNA 1GJ8B 1Q31A 1T4UH 1ETRH 4KKDA 4OS2A 1O2YA 2G52A 2FOAA 3U8RH 1GCDA 1TX6A 2G51A 4I31A 4JK6A 2C8WB 2B7DH 2ZKSA 3DUXH 3QTOH 1JWTA 3BTFE 1XVMA 1Y5UT 1T4VH 3SOSA 1UK3A 4WMDA 3O8BA 1HJ9A 3UY9A 4IMQA 1XUIA 3SORA 1DX5M 2HRVA 4B2CA 2CGAA 1P11E 1OX1A 2QY0B 1LPZB 3GDVA 5GWZA 3N7OA 4NSYA 1ZJDA 3RLYH 2JH5D 4X1PU 5EQSA 2OC0A 2YOLA 2CF8H 1O0DH 2ZU1A 1RTLA 2ZDMA 5HM2A 3Q3YA 1T8MA 2VJ1A 2HVXA 1GDUA 1INCA 1NT1A 1FN8A 1TE0A 1S85A 1QL9A 1V6DA 1IHSH 1UHBB 1TB6H 5CMXH 1W0YH 1IQLA 1AVGH 1KDQB 7ESTE 4IMZA 2UWPA 1SPJA 4XE4A 1P10A 2VIPA 5HGGA 3QGNB 4X6NA 4Y71A 2O8WA 4YM9A 4GLYA 3PMHB 1J8AA 1RFNA 8KME2 1CSOE 1YPHE 1K1IA 3BV9B 4TPYA 2V35A 3ATMA 3SNAA 4D7FA 1G36A 1S82A 1UTLM 3GCTG 4LXBH 5TJXA 1A5IA 1MMJN 2HNTC 5LH8A 2ZWLH 1IQFA 4GVUA 4TWYA 2W7UA 4CRBA 1KSNA 3ZZ8A 4K1EA 4AG2A 2ZA5A 4Y8XA 2HGTH 1SHYA 3SJ8A 2XYAA 1TIOA 2F9NA 1YCPH 2PLXA 1SOZA 1EJAA 2ANWA 3KCGH 3ZZ7A 4ISOA 4JK5A 1P2NA 1AWHB 2ULLA 3GYLB 4WJG2 3SGQE 5FX5A 3ZZBA 5AHGH 3SHCH 1A0LA 1O3LA 1TQ7B 4FU7A 2BXUH 3S0NA 3RMNH 2RG3A 3QUMP 5LPRA 1DS2E 1DWDH 2ZDLA 1MUEB 1JIMA 1HAHH 2NU1E 4VGCC 1THSH 5DG6A 1EQ9A 3T26A 3SJ9A 3DHKH 3MI4A 1GVKB 4BAOB 1AHTH 1C2JA 1G3EA 1MD7A 2PKAA 1LKBA 2ZHQH 1LKAA 5DP6A 3RXAA 2H5CA 1HLTH 1NFUA 3PLPA 3SNBA 3V13A 4BXWA 4BXSA 3UFAA 3URDA 2XBYA 3S9BA 1B5GH 2ZC9H 2OC8A 1A2CH 1XXDA 4M7GA 3GY8A 5T6GA 1QNJA 2BOKA 1PFXC 1X7AC 1GJ9B 2DUCA 3SU3A 1C2HA 4MLFB 3SO3A 3GY2A 4MNYA 4A5TS 1O36A 1P09A 3BF6H 2RCEA 1GBLA 1HAGE 1O5AB 2WYJA 3T62A 1JOUB 2FYQA 2J9NA 4BNRA 2VIWA 4X1QU 2PHBA 2VVVA 2HOBA 1THPB 4KTCA 1V2NT 3PROA 2H9HA 1ANEA 6ESTA 3ATWA 3GDSA 2VGCB 4X6MA 4Y76A 3F68H 2ZTXA 3VB5A 4CR5A 1BBRH 2DE9A 4TY7A 1MTWA 2BQ7B 3RLWH 3TJVA 3RXFA 3ZZAA 1A5GH 1KTSB 3LGWA 2QF0A 1J9CH 2CJIA 3TGIE 4X1NU 3F6UH 1EAIA 1P8VC 2PGQB 2XXLA 3EA7A 3HK3B 1AFEH 5F03A 3P8OA 6GCHG 4NFEA 3LT3A 3MWIU 4JZ1A 1BDAA 2ZF0H 3A8DA 1Y59T 3GY4A 2GV6A 1WCZA 1TPPA 2GMTC 1CHOG 1CU1A 1AKSA 1C4U2 1YLCA 3ZYEA 1EJMA 4Y10E 1CT4E 5C5OA 1W14U 3HPTB 1HAZB 3MH4A 2J95A 4CRGA 1TRNA 3RXMA 2FPZA 1YPLH 2SNVA 3ODDA 8ESTE 2EEKA 1ZPZA 4MTBA 3GY5A 4X2VA 2HPQH 2SGDE 4VGCB 1ZRKA 4X1RU 3BG4C 4H6TA 4AFSA 1NM6A 2FMJA 1E0FD 1SFIA 6CHAC 1TRMA 1SI5H 5F8TA 1TNLA 1FNIA 1YLDA 3TH4H 2PUQH 2FX6A 1SGTA 5GCHG 3D49H 2Z7FE 4D9RA 4KTSA 2BD5A 4X8VH 6LPRA 3GY6A 5DP7A 1CGIE 1GBFA 2AFQB 3RXTA 1O3IA 1MTSA 1HXFH 2FLBH 2FOEA 5AF9H 2BMGB 2PTNA 3ZZ4A 1WV7H 2VINA 2GCHF 2ZO3H 3A7ZA 1SC8U 1O2WA 2SGFE 4ABBA 2TGDA 1LMWB 2D8WA 3V0XA 1DFPA 4Y8YA 3CS0A 3LGUA 3VPKA 1BJVA 2C8XB 5IDKA 4DURA 1ARBA 3ELAH 3ZZ9A 1LVBA 1QQUA 1PPEE 1EXFA 3HATH 1ZRBA 5SGAE 1BOQA 1NTPA 1P3CA 2BDHA 1GMCF 1EAUA 2HNTE 2JKHA 3GISB 4DT7B 1K1MA 2F9UA 2FO9A 3PO1C 4FUBA 4WF8A 1BRAA 2STAE 1MTNC 2FXRA 1W7GH 4NWKA 1SG8B 3LC5A 1YCPK 1BMAA 4ABGA 3AW0A 2Y82A 4OS1A 1TPOA 2PWXA 1GMDG 4ABHA 4D76A 1ZSLA 1IQMA 3F9EA 4TWWA 3RXBA 5HYOA 1K28D 1LPKB 1LQEA 2GMTB 3I78A 3NZIA 3R3GB 4CHAC 3ATLA 1O3KA 4I8GA 2GD4B 4OS5A 2KAIB 4WH6A 3T2NA 4YOGA 5DK1A 4RKJB 4U01A 3QLPH 3SV7A 5E0JA 3S69A 3STIA 1C5PA 2OLGA 1OS8A 1UVPA 3TK6A 1LHEH 1F5LA 4LZ4B 3BG4B 1EZQA 1HPGA 4ISLA 1O3MA 1J16A 2BYAX 2PW8H 2CV3A 1MD8A 1IQJA 2BTCE 6CHAB 1OWJA 1C5YB 5EPYA 2FI4E 3PWBA 3TJOA 3GOVB 5G4BA 1WQSA 1DXPA 3QZRA 4B73A 5C2ZA 3ZVCA 4CRDA 3MU0A 3EGKH 1FY3A 1YKTA 3M5NA 4K1TA 1C2KA 3QO6A 3IITA 1LQDB 1BMLA 1OYQA 2WUBA 2ZU4A 3O8RA 3SGAE 1WSSH 3FFGA 5JBBS 1J17T 1H8DH 1ZSJA 3RMLH 3SU5A 2V3HH 4NA7A 3RXEA 1E36B 2Z3CA 4NWLA 1P04A 1C4Y2 2Z9IA 3EAJA 4AFZA 1SGYE 1YGCH 1BBRK 2AEIH 4GAWA 2QYIA 3M7TA 5FAHA 2BY8X 2J4IA 1TNKA 2WPMS 2G81E 1W8BH 2EI8A 4INLA 1C4V2 1HV7A 5I46H 2XCNA 3PTNA 5CHAC 1TAWA 5EODA 2QA9E 2BD9A 3PO1B 1ZYOA 1HIAB 1MTNB 1Q3XA 3NXPA 3GYMA 1F2SE 3MU5A 3NCLA 4I8KA 3QK1A 4ABEA 3TITA 4TPIZ 1AY6H 3NK8A 3C27B 4RKOB 1T32A 1DUAA 1XUHA 1L4DA 1EOJA 4NFFA 2AS9A 1O3BA 1Y8TA 1GI3A 2P3FH 4WVPE 1TLDA 1P03A 2PSYA 4K60A 1XM1A 1DOJA 2Z94A 1NN6A 2C8ZB 4BAMB 4OS4A 1DY9A 5DJ7A 3DA9B 4U30A 3A83A 1BCUH 2NU3E 2ZPQA 5FCRA 1GBEA 2CXVA 3B8JA 1O2RA 1D9IA 1NRSH 1C1WH 2WV5A 4ZROA 1Y5AT 1QA0A 1CE5A 3ZZ5A 3GY7A 4ZAEA 1AO5A 4R8TB 2QGRA 1BHXF 1E37B 1YPKH 1AE5A 2THFB 1BA8B 1T8LA 1ELFA 7GCHF 1O2JA 3F1SB 4OS7A 1YPMH 2IN2A 1HAVB 1ELTA 2PUXB 3SQHE 1GGDC 2NWNA 3BIUH 1KLTA 3A80A 4DOQA 5A8ZA 3VEQB 4OS6A 2GX4A 1F0RA 3FP7E 1VZQH 3LOXA 2A4RA 1EX3A 1EUFA 1HAXB 1LVMA 1CGHA 1UVTH 4PROA 3ZZ6A 2BDBA 4AZ2B 5FPSA 1SSXA 3A7XA 1XKBC 1IQIA 3MH7A 5TCAA 4XOJA 3M3TA 5CHAB 1OYTH 4K1SA 1ANCA 4MPWA 1CBWC 1LHCH 1BTUA 5LPEA 1NS3A 1FQ3A 5AFYH 2Z6BD 4AG1A 3SW2B 4GCHF 5ESTE 1GHAF 5GXPA 2ZTZA 4GHTA 2VIDA 1ZOMA 2BY7X 1MU8B 4MDSA 2A2QH 1XXFA 1DANH 2ANYA 1PQ7A 2AGGX 1GI7B 1O5BB 1O5DH 3E8LA 1C5XB 1WTHD 1OWIA 4IC5A 2VU8E 3LJOA 4ZKRU 3AVZA 5EXLA 1SGCA 3U1IB 2ZI2H 2NU2E 4ASHA 4DY7B 1FXYA 1V2JT 2G4UA 3OY5U 3RM2H 2Q6FA 2AMQA 3TH2H 1DWBH 2C3SA 2A4OA 1QRXA 4NIWA 5A0CA 4H42U 3RDZA 1V2MT 3JZ2B 2OUAA 3FVFB 2AGEX 1DUEA 3RXUA 3UOPA 1C5TA 1C1QA 3ZYDA 4ZXXH 5FPYA 4DJZB 4UE7H 3LGTA 1O2ZA 3A85A 2YNBA 5FXLA 1PPGE 1XUKA 3BTTE 3ZVAA 3OSYA 1YCPM 2W7SA 2HLCA 1Z6EA 5E2OA 1NO9H 2NU4E 4BTIB 3EE0B 2W3IA 3E0NB 5BPEA 3RXVA 1O3GA 3UUZA 1O39A 2CHAC 1O5EH 2G00A 5DP4A 4UD9H 1GGDB 1KY9A 1GJ7B 1TMUH 1TBRH 2IJOB 3RXIA 5FBIA 5E0HA 3UREA 2Y7ZA 3HKJB 1V2LT 2GDDA 1S6FA 1PPFE 1O2IA 3FZZA 4ZHLU 1FY1A 1O32A 2OBOA 4ABJA 1AWFH 2ZNKH 1SFQB 4Q7ZA 1QB1A 1ZGIA 2FS9A 3FP6E 3MNXA 4X2WA 1TNJA 4NA9H 5EPNA 1KTTB 1BTYA 1HJAC 1RJXB 1C5OH 1MKXH 1P2MA 1TOMH 1QR3E 1ABJH 2WPLS 3RXGA 1CBWB 1C1SA 1VITF 3CENA 2W5EA 5DP8A 3MTYA 4D9QA 4J1YA 4DW2U 1GWAA 1HGTH 2QXJA 1G30B 9ESTA 3M37A 1GI2A 4DGJA 2P3UB 4HFPB 1ZLRA 5FBEA 3HK6B 1A1RA 1THRH 3AAUA 1UMAH 1C2IA 2BB4A 3MFJA 1ANDA 1V3XA 2A5AA 3GCNA 1ZGVA 1YF4A 5EXNA 1G9IE 2PGBB 4YLQH 3W94A 1OP0A 3SZNA 2ODQA 1A3EH 4JZEH 1BTZA 3K6ZA 4X8UH 1O2KA 4MQAA 5L2YH 1SMFE 1LPGB 3RC5A 3RC4A 3MYWA 2VNTA 1K1NA 3TGKE 2GCHG 2FLRH 2HNTF 2G8TA 4TYDA 3UOUA 1Y3YA 2CN0H 1D3QB 3UNSA 2P95A 2BQ6B 1GPZA 3KF2A 3TGJE 2FZZA 2P59A 1GCTC 2ZQ1A 3MU1A 3ATKA 1OSSA 3RXOA 2BLWA 4HTCH 1RTFB 4I8HA 3QWCH 1W2KH 5IYTA 1QJ1B 1QTFA 2R3YA 1AUJA 3F9GA 5EXMA 3KNXA 3TNTA 1GMCG 2H6MA 1C5MD 2J38A 5A8XA 1QURH 3E91A 1CO7E 2R2MB 1UK4A 3BIVH 4KELA 1GHBF 1V2ST 1TGCA 1WAYB 1XMNB 1HFDA 1FDPA 3MNSA 2H9EH 2BDGA 2BVXH 2FM2A 2H2ZA 5PTPA 1TFXA 2FOGA 1FIWA 1EZXC 2QXIA 4J2YB 3AAVA 2VB0A 3L3TA 2A45B 4NCYA 1C5WB 3VB7A 1S6HA 2BVSH 1ESTA 2QF3A 2XBWA 3CS7A 1TMTH 1RGQA 2XC4A 5EGMA 2BD7A 2A5IA 1C2DA 1MQ6A 1MKWH 1QRZA 5C3NA 3ZVGA 1CT2E 2GV7A 1AI8H 2K1QA 1EB1H 3PWCA 5C1XA 1D3PB 2OP9A 4JYUH 3KEEA 5EW1H 1C5QA 1TQ0B 1VJ9U 1Z1IA 3BEUA 1C9PA 1P2QA 2O9QA 1LHDH 1UK2A 2M5TA 2ZPRA 1G3DA 4SGBE 2R2WU 3HGPA 1BIOA 3A7YA 3P6ZB 2PKSC 4AGKA 3K9XB 2ZDVH 1RS0A 3Q3XA 4ZKNU 3S7KB 4FUGA 3MH6A 2A5KA 1JIRA 3FAOA 3BTWE 3GCHC 3I29A 1BT7A 4IS5A 3RUOA 1WYKA 3SI4H 5HXFA 1GBAA 1S83A 1P2KA 1UVSH 2B0FA 4CRFA 5L30H 2ZIQH 3TLOA 1O30A 1ELDE 3LJJA 2ASUB 2F9BH 4INKA 4O03A 1S84A 3E3TA 2GKVE 5T6FA 1T8NA 1UTKA 1IHTH 3F9FA 2Y5FA 4E7NA 1QL7A 1XKAC 2ODPA 3KQCA 3JZ1B 5BRRE 3SV8A 2XBXA 3Q76A 1NROH 1VITH 1GCTB 2F83A 4WMFA 3SUGA 4IN1A 2BDCA 1VGCC 4NGAH 1GVLA 2OBQA 2BD3A 5AFZH 3SUFA 1BITA 3IG6B 3OU0A 1Y3UA 5FX6A 4CRAA 1ZTKA 1TGTA 1ARCA 1C5UA 1OOKB 1H1BA 1IQNA 4JZIA 1QBOA 2ZEBA 1EPTA 1Z8GA 1BBRE 1SLWB 1YPEH 5JDUB 2J2UA 4WXIA 4X8TH 1YPGH 1W0ZU 3C1KA 3LONA 4B2BA 5J4QA 1YC0A 2PR3A 1CHGA 2UWOA 3U9AH 2AMDA 4BTTB 2XNIA 1TX8A 4ZHMU 1V2RT 1C1NA 2TPIZ 5ESBA 4IBLH 4BOHA 5GDSH 2ZHFH 1IQGA 4D7GA 1A3BH 1SLVB 2DE8A 4FUEA 2ZFRH 1O2LA 3BTME 5F6MA 1Y5BT 3GCTF 3PM3A 3SHAH 5JPMH 2B8OH 1GI9B 3VB6A 2PKSB 1RXPA 4ABDA 4ZKSU 2D26C 1B0FA 3P8NA 2FOHA 3ZZCA 3P92A 2XTTB 4A7IB 1CQQA 1MCTA 1HJ8A 4ESTE 1TPSA 1GBJA 4FUIA 2RA3A 1GJ5H 1ANBA 4KP0A 4B76A 3GCHB 3BEIB 2QN5T 2C90B 2TGTA 4CREA 3UWJH 1L4ZA 3FANA 4QT8C 8LPRA 1G3CA 4ZKOU 1ABIH 4YOJA 1QBNA 7GCHG 1GMHF 3V3MA 3BTKE 2D1JA 3A8BA 3SV6A 3SJKA 1ELGA 1Q2WA 4FUHA 3U98H 1HYLA 4CR9A 1EPTC 3TNSA 2ZFTA 3EA9A 2PKAB 1SGFG 2A32A 2QXGA 3M3VA 3OX7U 2AGIX 4YLUA 1GI5A 3RXCA 1SGNE 1K21H 1WOFA 2ZHWH 4H6SB 1F92A 3A7VA 2IOTA 1BMMH 5AVDA 1EB2A 4DG4A 5EQRA 5F8XA 3SUDA 1AZ8A 1QQ4A 3KN2A 2F3CE 1VGCB 2UWLA 4UDWH 4NIVA 2J94A 1V2QT 3LIWA 2ZU2A 3H7TA 1KXAA 1NFXA 1GBMA 1G3BA 1O5CB 1SQOA 2ZGHA 5H4IB 1E38B 1H8IH 1ZR0A 4AOQA 2H1UA 1AE8H 2ZFFH 1O3AA 2RDLA 1P02A 5FPTA 3LGIA 1ID5H 2ZHDA 1GHAG 4GCHG 3TJNA 4I7YH 2P94A 1LVYA 4AFUA 4TY6A 1GBBA 2SGQE 1O2TA 1MKWK 1Y3XA 1DLKB 1TYNA 4LZ1H 4NZLA 5DP9A 1N6XA 4MG3A 3NUMA 2G5VA 2Z3EA 4YT6H 3BG8A 1K1LA 4XBCA 1IAUA 1K22H 1LTOA 2CF9H 4WY3A 4Y8ZA 4UFFH 2BZAA 1GI0A 1VCQA 1Z8JB 1TMBH 3U1JB 1GDNA 2RA0A 1DPOA 1O3HA 4YTAA 1L2EA 3E90B 2FYRA 1O31A 3SQEE 5E0GA 1GJ4H 2O8TA 2A4QA 1O3PB 1FIZA 1HDTH 4BAQB 3M3SA 3B23B 1KXBA 1O38A 1G2MA 2YNAA 4AB8A 1UCYH 4MNXA 1AKSB 1DT2A 3UWIA 1Z6JH 4GHQA 3EDXB 2FDAA 5K7RA 1PPZA 2BD2A 2XWAA 1NESE 2SGPE 1BMNH 3NKKA 3S9CA 1NZQH 1UTJA 1C9TA 1EPTB 1ZSKA 1SGFA 2Y6TA 2BVRH 1DVAH 1PPBH 2AIQA 1AUTC 3TPIZ 1EAXA 1TNIA 3MH5A 3KQEA 5DP3A 4XDEA 3V7TA 2VH0A 4CHAB 1S81A 1U6QA 2EC9H 5DKMA 1NRPH 1QA7A 4AB9A 3URCA 1GVZA 1EKBB 3M7QA 1UTOA 3P70B 1FV9A 1LHFH 3QDZB 5GCHF 2Y5GA 1TGNA 3RXSA 3K2UA 1H9HE 1QY6A 2A31A 2SGEE 2IPHA 1VITG 3A7TA 4XSKU 4CBNA 2QAAA 1KXFA 2AH4X 1Z71A 2G55A 1GJDB 2R3UA 1UVOA 1WTGH 2Y81A 1O2HA 1FN6A 1K1OA 1MH0A 1QJ7B 4LK4A 1OP8A 2FP7B 3RM0H 1A61H 1AZZA 1NRQH 1BRCE 3LH3A 1DWCH 2VVUA 1NC6A 4IN2A 2TRMA 3PLBA 5FCKA 1JRSA 1BB0B 2FODA 1AGJA 4WH8A 1O2MA 1W11U 4K8YA 3T29A 4WXVA 1SGQE 1GBKA 2WUCA 1QCPA 2ZG0H 3CP7A 1QJ6B 1IQHA 3PYHA 3O8CA 1KYNA 2WV4A 5DP5A 5JBTA 2XWBI 3ENSB 1TX7A 4FUCA 1G32B 2AERH 1Y3VA 3MU8A 2QV1A 3RU4T 4K3JA 1OWKA 1E34B 3U8TH 1O3JA 3ZZ3A 1JRTA 2BDYA 4INHA 3EA8A 2UUJB 2F91A 1FLEE 4ZH8A 2EI6A 4UFEH 1K9OE 2ZU5A 1C2MA 2ILNA 4NSVA 4JZDH 1F0TA 3F9HA 2VH6A 2ZGCA 2ZFQH 4ISHH 4UEHH 4ZXYH 3UNRA 1RRKA 1SHHB 1HB0B 1MZDA 4HZHA 9LPRA 3Q77A 5EW2H 2FI3E 1BTPA 4Q7YA 2OTVA 1DSTA 1C5ZB 1KLJH 1OWDA 5B6OA 1GHBG 1KXDA 1O2SA 4BAKB 1O3EA 2VIVA 4O3TA 3SNDA 1FUJA 2JETC 3FP8E 1NFWA 3QN7A 1ELCA 3ESTA 1YM0A 1T7CA 1L1JA 4NA8A 3VB3A 1OWEA 2ODYB 4FVDA 3M36A 1AFQC 2OD3B 5EOKA 2NU0E 1UTNA 1VCPA 1J15A 2G4TA 4FUDA 1C1TA 4FU9A 2FOMB 3T5FH 1GBCA 2BOHB 1TNHA 4I8JA 2VIOA 1QRWA 1EJNA 4Y7BA 4KTUA 4A1XA 1P3EA 3FZDA 4Y79A 1TALA 3RXHA 4KGAA 5JB9S 4Y11E 1TABE 1ZJKA 1P9UA 2XCFA 1SGEE 3DFJA 1UVUH 1GHWH 1ZHPA 2GT8A 1TBZH 5K0HA 3W95A 4DIIH 3MU4A 3DD2H 1O2NA 1XVOA 7LPRA 3A81A 3MO3A 2O8MA 1W7XH 4UFGH 1A46H 4MPXA 1D6RA 3VXFH 2OC7A 4MPVA 3TVJB 1A0HB 1FMGA 4Z6AH 1GHZA 5ETXA 2EI7A 1FZZA 3RXLA 1HAPH 2VWOA 1SLUB 2FTMA 2PSXA 3SI3H 1A7SA 1WUNH 3OY6U 1W12U 3RXKA 1C1MA 3LGYA 3PMAB 4A6LA 2BD8A 1QB9A 5A09A 1Y3WA 1C2LA 1UCYK 1ZZZA 1E35B 3MOCA 2I6SA 1BUIA 2R0LA 2V3OH 1C5RA 3UNQA 1ZMNA 1EATA 1O3DA 3LKWA 4YT7H 1TONA 1CA0C 1LCYA 1BTWA 2C4FH 1EP5A 4Y0ZE 3STJA 5J4SA 3QTVH 5T3HA 3D23A 1AMHA 1V2TT 1SLXB 4BTUB 2GT7A 2SNWA 2CMYA 5GIBA 1ETTH 2ZZUH 3PB1E 1DWEH 3GDUA 1C1VH 1TBQH 1CGJE 4WWYA 2BY6X 1HNEE 4NG9H 2Y5HA 3UR9A 2OC1A 1ELEE 3H7OA 2P8OC 1EOLA 2VWNA 1DSUA 4MNVA 3RMOH 4UONA 1C1PA 1O2OA 1AIXH 1A5HA 1NFYA 3S7HB 3M35A 2JETB 5E2PA 1V2WT 1C2FA 1D4PB 3A88A 4JYVH 4MVNA 1GL0E 4O97A 1PPHE 3LGVA 1MBMA 4WMEA 1SGDE 2V6NA 3LU9B 1AVXA 4I33A 1OXGA 1AFQB 2Z9GA 4U32A 1P57B 1L1GA 1ACBE 4X6PA 3RMMH 1JXPA 5FHTA 2A7HA 5JBAS 2Z9LA 1PJPA 2W26A 1NY22 5A0AE 2VGCC 1MZAA 2I6QA 1O2VA 2R9PA 3KQDA 2A7CA 3T28A 4YESB 1YBWA 1GHVH 1UO6A 3MO6A 3M5MA 3SU2A 4ABAA 3RU4E 2HPPH 3SJOA 3RXJA 1WBGB 2C93B 2OQ5A 1SQTA 3ZV9A 1NU9A 1P9SA 4ABIA 1GG6C 3E16B 4FUJA 4Q80A 1C5LH 2BLVA 4CH8B 2WPKS 1ZTLA 1JBUH 1FPHH 2CHAB 1V2UT 1KIGH 3HGNA 3BTHE 1W10U 1C5SA 2QIQA 1OPHB 4XFQA 5C1YA 2Q1JA 1TA6A 3RU4D 1KXEA 3NWUA 1GMHG 1OWHA 2A2XH 1B0EA 2OQUA 2AYWA 1C1OA 1AVWA 3GICB 1O33A 4ISIH 3ATIA 1D3TB 2BXTH 2STBE 1BRUP 1CA0B 4XBDA 4FU8A 2WYGA 1BQYA 1PPCE 2BM2A 1VR1H 3EYDA 1O37A 1FJSA 3SU0A 1SGIB 1HJAB 2XC0A 5DO4H 4B1TA 3P17H 5EG4A 2FOCA 2BX3A 8GCHF 2Y7XA 2GDEH 3K6YA 1OP2A 1ZTJA 5DPAA 1LHGH 4Y0YE 1MBQA 1Z7KA 3BTGE 2ZP0H 1ZPBA 2VWMA 3S9AA 5DGJA 1ZMJA 5JB8S 1HCGA 2KAIA 3KQBA 2P8OB 3TK5A 2ZDAH 2FESH 1S5SA 3P8GA 2Z9JA 1P06A 2HWLB 3ZV8A 1GJAB 4X6OA 3T27A 1YYY1 1CVWH 2ZCHP 3OYPA 4O3UA 2Y80A 3V12A 2BD4A 1GJ6A 1O3NA 2V0BA 2GZ7A 2G5NA 4K5ZA 1PYTC 2A4GA 2JH0D
chains in the Genus database with same CATH superfamily
1V2VT 1W13U 2SGAA 3PRBA 1TGSZ 3A89A 3PLKA 1NU7B 2UUKB 4XBBA 1GBHA 5I25A 3A84A 1SVPA 1EAWA 4E7RG 4I86A 3M61U 3VGCC 3SGBE 5KECA 1O3FA 3P95A 1O5GH 1RTKA 1OKXA 2TGPZ 1SQAA 1Z8RA 3AASA 3G01A 1G37A 3PV2A 1SOTA 2O8UA 1D6WA 1B7XB 1ELBA 1O34A 1RD3B 2WPJS 1VCWA 5HMAA 3RXQA 2BHGA 1GG6B 1GI1A 3LDXH 1S0QA 1O2XA 3SJIA 1MCVA 1S0RA 3BTDE 1E1QD 2HALA 2P16A 2ZHEH 3R0FA 5A8YA 5GJ4B 4U2WA 2BX4A 3TH3H 3MMGA 3QX5H 2GVFA 3U69H 1SB1H 1C1RA 2SFAA 1SGRE 4B2AA 2VBCA 1SBWA 2PV9B 1F5KU 3L6PA 3ZZDA 1MKXK 1HIAA 2FWWA 1MQ5A 2UUFB 2F9PA 5C5NA 4IW4E 1GHXH 3EQ0H 3IWMA 4B75A 1C1UH 4A1VA 1ZHMA 2QCYA 1BRBE 1FONA 5EU8A 3M7UA 4YOIA 2VWLA 3A8CA 1W0JD 4IC6A 1ETSH 1TPAE 4X0WU 3RXDA 1IQEA 1FI8A 3AW1A 1MAXA 3RC6A 5HM9A 4GUXA 1TRYA 3F0PA 1TNGA 3VFEA 3WW7A 1N8OC 4CBOA 3VXEH 1C5NH 4AYYB 2GP9B 3ITIA 1FY5A 4RT1A 3SBKA 3UQVA 2P3TB 2WSSD 2BLOA 1UTQA 1FAXA 3MHWU 5L6NH 1O5FH 4MNWA 1P01A 3ZVEA 1CT0E 1QBVH 4R0IA 1SR5C 3UR6A 1V2PT 2C8YB 3ZVBA 2K0QA 3RP2A 3ZVFA 2OXSA 1Z8IB 4CH2B 1IOEA 3B9FH 3OTJE 3I77A 5L2ZH 3BTQE 3SNCA 1EZUC 1P2JA 2XC5A 2WPIS 3A7WA 1HRTH 1AB9C 3MO9A 4OGXA 4BANB 3GY3A 4NIXA 1ZMLA 2TIOA 5EQQA 1K2I1 3VGCB 1K1JA 1HAVA 1L1NA 4THNH 2BZ6H 3QZQA 1DDJA 1HBTH 3F2FA 1C2GA 5C1UA 2ESTE 2BDAA 3P8FA 1MTUA 2BQWB 1H9LB 2J34A 2QXHA 1NPMA 5KGOA 3TIUA 1GHYH 3UAIC 4ISNA 1UTPA 2YMSB 1YP9A 3MNCA 2FS8A 4Z0KA 3DT0H 1NRRH 2ALVA 3SV9A 4JCNA 1TOCB 2GCTC 3E0PB 1TA2A 5ABWA 1GDQA 4P02A 2ANMH 2AIPA 1H4WA 1WU1A 1UJ1A 3PMJA 5JYIA 4AYVB 4Y6DA 3E1XB 4YO9A 1G2LA 4O9VA 1BMFD 2XBVA 3M5LA 4X2XA 3U8OH 3ZVDA 2AMPA 4BAHB 2JH6D 2ZECA 1XUJA 2LNCA 1RIWC 1O2PA 4SGAE 3GCOA 3KIDU 1FAKH 4H4FA 1O2GH 4K69A 2JDID 4AFQA 2FOBA 4DCDA 2BY9X 5C20A 1EP6A 3Q00A 1NBME 1F0UA 4D8NA 3Q3KA 3L33A 2GZ8A 1F7ZA 3LH1A 4X1SU 4AORA 1N8OB 1JMOH 2ZGJA 2ZPSA 4Z1MD 4UFDH 4FVBA 1YPJH 1Z1JA 4GSOA 1QHRB 3UIRA 1LDTT 2BDIA 1H9IE 6GCHF 3KL6A 1O2UA 1GJCB 4TT3D 3D62A 1AD8H 1AN1E 3D65E 4FXGH 4DIHH 1LVOA 1V2KT 1T31A 4F49A 1P2IA 5EJZA 2KR7A 2O8LA 3SUEA 1NBMD 2WINI 3TK9A 2VVCA 3E6PH 3TU7H 3KQ5A 5LGOA 1CHOF 1AQ7A 3SU6A 1GBIA 2ZU3A 2Z3DA 1NRNH 2ANKH 1ELVA 4X2YA 4AN7A 3PV4A 3WY8A 3KHVA 4B74A 1VKYA 1F5RA 2OINA 3KGPA 1HXEH 5C67A 2QF5A 2WPHS 1QIXB 1AB9B 1DITH 2PP6A 4Y7AA 5GPIB 4YZUA 1QGFA 1PYTD 3UPEA 3O8DA 2J92A 1DXWA 5CE1A 4NIYA 2ZGBH 5A2MH 4A92A 1O3CA 3NPSA 2PTCE 2FX4A 1SL3A 4F4OC 1P05A 1HAYB 1PQAA 1XUGA 3BEFB 1N1LA 1P2OA 2FEQH 1L0ZA 3HKIB 1O2QA 2F9OA 5E8EH 2GTBA 5HIZA 2GCTB 2UUYA 2B9LA 2Z9KA 1J14A 3LC3A 1QFKH 4RN6A 1UCYE 4E06H 2H5DA 2ZCKP 3PTBA 5EIYA 1SKYE 1WQVH 2PFEA 4K2YA 2ZFPH 1ELAA 5F8ZA 5FL7D 1YPHC 4I8LA 1HUTH 2Q6GA 4B6FA 2Q6DA 1AU8A 1D3DB 1GJBB 2ZTYA 1UHBA 1W3CA 4JZFH 2BY5X 2FI5E 1KDQA 1FY8E 2FTLE 1EASA 1DLEA 4JMYA 2J97A 3A87A 1RIWB 1MAYA 5A0BA 7KMEH 4K8BA 1P0SH 5LPFA 2FOFA 3FOAA 2F9VA 1HAOH 1UTMA 2OCVB 1FY4A 4GPGA 1QL8A 1KXCA 2W3KA 2EY4C 2GGVB 1BTHH 4NZQA 2R0KA 2GZ9A 1DY8A 3QGJA 1EZSC 3SU1A 1H8ED 3ODFA 2A0QB 2ZQ2A 2VIQA 4DVAU 1BTXA 2XNDD 1ESBA 1GMDF 2TGAA 1QB6A 4IGDA 3M5OA 1V2OT 1C5VA 3U28C 2QC2A 2ZDKA 1GL1A 4ZHAA 2LPRA 4OGYA 1DICA 3SN8A 4CRCA 1M9UA 2ZGXH 1ZPCA 2ZFSA 5TCCA 1T8OA 3MNBA 1BJUA 4E05H 1O35A 3TJUA 3BN9A 1MTVA 3BTEE 2EA3A 1CA8B 1KLIH 2L74A 1GI8B 1GI4A 2A7JA 1BZXE 3K65B 1TWXB 1XUFA 4X8SH 1GBTA 4FUFA 1TGBA 3DFLA 1DM4B 3RXRA 5IK2D 3SV2H 2TBSA 3H5CB 4JYTA 1FPCH 3UQOA 1A0JA 1P12E 4Q2KA 1LO6A 3SU4A 1HAIH 3BSQA 2ALPA 4Q7XA 1ESAA 5T6DA 3UTUH 1A4WH 1FX0B 4I32A 1ZHRA 5JBCS 2A1DB 1PQ5A 1DE7H 2H9TH 4AGJA 3SNEA 8GCHG 2D2DA 4RSPA 1PQ8A 4ZUHA 1O3OA 1C2EA 4A1TA 4MPUA 2FIRH 2XW9A 3LPRA 3RXPA 1GI6A 2BLQA 1XX9A 3VB4A 4ABFA 4HGCA 4ZMAH 1F0SA 1VJAU 3A82A 3A86A 4AX9H 4HI3A 1IQKA 1SGPE 3PMBB 4LOYH 2XRCA 1ORFA 4B71A 1K1PA 1MU6B 2ZCLP 5KEDA 1GBDA 1BHXB 1N6YA 2P93A 3DSPA 3A8AA 3T25A 2B5TB 2ZDNA 1GJ8B 1Q31A 1T4UH 1ETRH 4KKDA 4OS2A 1O2YA 2G52A 2FOAA 3U8RH 1GCDA 1TX6A 2G51A 4ZCNA 2J98A 4I31A 4JK6A 2C8WB 2JJ2D 2B7DH 2ZKSA 3DUXH 3QTOH 1JWTA 3BTFE 1XVMA 1Y5UT 1T4VH 3SOSA 3KYFA 1UK3A 4WMDA 3O8BA 1HJ9A 3UY9A 4IMQA 1XUIA 3SORA 1DX5M 2HRVA 4B2CA 2CGAA 1P11E 1OX1A 2QY0B 1LPZB 3GDVA 5GWZA 3N7OA 4NSYA 1ZJDA 3RLYH 2JH5D 4X1PU 4XRNA 5EQSA 2OC0A 2YOLA 2CF8H 1O0DH 2ZU1A 1RTLA 2ZDMA 5HM2A 3Q3YA 1T8MA 2VJ1A 2WV9A 2HVXA 1GDUA 1INCA 3WWFA 1NT1A 1FN8A 1TE0A 1S85A 1QL9A 1V6DA 1IHSH 1UHBB 1TB6H 5CMXH 1W0YH 1IQLA 1AVGH 1KDQB 7ESTE 4IMZA 2UWPA 1SPJA 3N99A 4XE4A 1P10A 4YXWD 2VIPA 5HGGA 3QGNB 4X6NA 4Y71A 2O8WA 4YM9A 4GLYA 3PMHB 1J8AA 1RFNA 8KME2 1CSOE 1YPHE 1K1IA 3BV9B 4TPYA 2V35A 3ATMA 3SNAA 4D7FA 1G36A 1S82A 1UTLM 3GCTG 4LXBH 5TJXA 1A5IA 1MMJN 1E1RD 2HNTC 5LH8A 2ZWLH 1IQFA 4GVUA 4TWYA 2W7UA 5C0TA 4CRBA 1KSNA 3ZZ8A 4K1EA 4AG2A 2ZA5A 4Y8XA 2HGTH 1SHYA 2KM0A 2XYAA 3SJ8A 1TIOA 2F9NA 4ACAA 1YCPH 2PLXA 1SOZA 1EJAA 2ANWA 3KCGH 3ZZ7A 4ISOA 4JK5A 1P2NA 2WZQA 1AWHB 2ULLA 3GYLB 4WJG2 3SGQE 5FX5A 3ZZBA 5AHGH 3SHCH 1A0LA 1O3LA 1TQ7B 4FU7A 2BXUH 3S0NA 3RMNH 2RG3A 3QUMP 5LPRA 1DS2E 1DWDH 2ZDLA 1MUEB 1JIMA 1HAHH 2NU1E 3F3BA 4VGCC 1THSH 5DG6A 1EQ9A 3T26A 3SJ9A 3DHKH 3MI4A 1GVKB 4BAOB 1AHTH 1C2JA 1G3EA 1MD7A 2PKAA 1LKBA 2ZHQH 1LKAA 2XOKD 5DP6A 3RXAA 2H5CA 1HLTH 1NFUA 3PLPA 3SNBA 3V13A 4BXWA 4BXSA 3UFAA 3URDA 2XBYA 3S9BA 1B5GH 5EJLA 2F4LA 2OC8A 1A2CH 1XXDA 2ZC9H 4M7GA 3GY8A 5T6GA 1QNJA 2BOKA 1PFXC 1X7AC 1GJ9B 3AK5A 2DUCA 3SU3A 1C2HA 4MLFB 3SO3A 3GY2A 4MNYA 4A5TS 1O36A 1P09A 3BF6H 2RCEA 1GBLA 1HAGE 1O5AB 2WYJA 3T62A 1JOUB 2FYQA 2J9NA 4BNRA 2VIWA 4X1QU 2PHBA 2VVVA 2HOBA 1THPB 4KTCA 1V2NT 3PROA 2H9HA 1ANEA 6ESTA 3ATWA 3GDSA 2VGCB 4X6MA 4Y76A 3F68H 2ZTXA 3VB5A 4CR5A 1BBRH 2DE9A 2J98B 4TY7A 1MTWA 2BQ7B 3RLWH 3TJVA 3RXFA 3ZZAA 1A5GH 1KTSB 3LGWA 2QF0A 1J9CH 2CJIA 3TGIE 4X1NU 3F6UH 1EAIA 1P8VC 2PGQB 2XXLA 3EA7A 3HK3B 1AFEH 5F03A 3P8OA 6GCHG 4NFEA 4RT0A 4DT4A 3LT3A 3MWIU 4JZ1A 1BDAA 2ZF0H 3A8DA 1Y59T 3GY4A 2GV6A 1WCZA 2LELA 1TPPA 2GMTC 1CHOG 5HIYA 1CU1A 1AKSA 1C4U2 1YLCA 3ZYEA 1EJMA 4Y10E 1CT4E 5C5OA 1W14U 3HPTB 1HAZB 3MH4A 2J95A 4CRGA 1TRNA 3RXMA 2FPZA 1YPLH 2SNVA 3ODDA 8ESTE 2EEKA 1ZPZA 4MTBA 3GY5A 4X2VA 2HPQH 2SGDE 4VGCB 1ZRKA 4X1RU 3BG4C 4H6TA 4AFSA 1NM6A 2FMJA 2IPQX 4XD7D 1E0FD 1SFIA 6CHAC 1TRMA 1SI5H 5F8TA 1TNLA 1COWD 1FNIA 1YLDA 3TH4H 2PUQH 2FX6A 1SGTA 1EFRD 5GCHG 3D49H 2Z7FE 4D9RA 4KTSA 1KMHB 2BD5A 4X8VH 6LPRA 2RFKC 3GY6A 5DP7A 1CGIE 1GBFA 2AFQB 3RXTA 1O3IA 4M9FA 1MTSA 1HXFH 2FLBH 2FOEA 5AF9H 2BMGB 1YWUA 2PTNA 3ZZ4A 1WV7H 2VINA 2GCHF 2ZO3H 3A7ZA 1SC8U 4RI0A 1O2WA 2SGFE 4ABBA 2TGDA 1LMWB 2D8WA 3V0XA 1DFPA 4Y8YA 3CS0A 3LGUA 3VPKA 1BJVA 2C8XB 5IDKA 4DURA 1K0HA 1ARBA 3ELAH 3ZZ9A 1LVBA 1QQUA 1PPEE 1EXFA 3HATH 1ZRBA 5SGAE 1BOQA 1NTPA 1P3CA 2BDHA 1GMCF 1EAUA 2HNTE 2JKHA 3GISB 5CDFE 4DT7B 1K1MA 2F9UA 2FO9A 3PO1C 4FUBA 4WF8A 1BRAA 2STAE 1MTNC 2FXRA 1W7GH 4NWKA 1SG8B 3LC5A 1YCPK 1BMAA 4ABGA 3AW0A 2Y82A 4OS1A 1TPOA 2PWXA 1GMDG 4ABHA 4D76A 1ZSLA 3N7DA 1IQMA 3KYGA 3F9EA 1YLNA 3EE7A 5CHBA 4TWWA 3RXBA 5HYOA 1K28D 1LPKB 1LQEA 2GMTB 3I78A 3NZIA 3R3GB 4CHAC 3ATLA 5EJ1A 1O3KA 4I8GA 2GD4B 4OS5A 2KAIB 4WH6A 3OEHD 2HVYB 3T2NA 4YOGA 5DK1A 4RKJB 4U01A 3QLPH 3SV7A 5E0JA 3S69A 3STIA 2K8IA 1C5PA 2OLGA 1OS8A 1UVPA 3TK6A 1LHEH 1F5LA 4LZ4B 3BG4B 1EZQA 1HPGA 4ISLA 1O3MA 1J16A 2BYAX 2PW8H 2CV3A 1MD8A 1SQRA 1IQJA 2BTCE 6CHAB 1OWJA 1C5YB 5EPYA 1E79D 2FI4E 3PWBA 3TJOA 3GOVB 5G4BA 1WQSA 1DXPA 3QZRA 4B73A 5C2ZA 3ZVCA 4CRDA 5C0UA 3MU0A 3EGKH 1FY3A 1MABB 1YKTA 3M5NA 4K1TA 1C2KA 3QO6A 3IITA 1LQDB 1BMLA 1OYQA 2WUBA 2ZU4A 3O8RA 3SGAE 1WSSH 3FFGA 5JBBS 1J17T 1H8DH 1ZSJA 3RMLH 3SU5A 2V3HH 4NA7A 3RXEA 1E36B 2Z3CA 4NWLA 1P04A 1C4Y2 2Z9IA 3EAJA 4AFZA 1SGYE 1YGCH 1BBRK 2AEIH 4GAWA 2QYIA 3M7TA 5FAHA 2BY8X 2J4IA 1TNKA 2WPMS 2G81E 2HLDD 1W8BH 2EI8A 4INLA 5DN6D 2QE7D 1C4V2 1HV7A 5I46H 2XCNA 3PTNA 5CHAC 1TAWA 5EODA 2QA9E 2BD9A 3PO1B 1ZYOA 4ACBA 1HIAB 1MTNB 1Q3XA 3NXPA 3GYMA 4HG6A 1F2SE 3MU5A 3NCLA 4I8KA 3QK1A 4ABEA 3TITA 4TPIZ 1AY6H 3NK8A 3C27B 4RKOB 1T32A 1DUAA 1XUHA 1L4DA 1EOJA 4NFFA 2AS9A 1O3BA 1Y8TA 3DSOA 1GI3A 2P3FH 4WVPE 3F0OA 1TLDA 1P03A 2PSYA 4K60A 1XM1A 1DOJA 2Z94A 1NN6A 4P00A 2C8ZB 4BAMB 4OS4A 1DY9A 5DJ7A 3DA9B 4U30A 2W6ID 4OM9A 3A83A 1BCUH 2NU3E 2ZPQA 5FCRA 1GBEA 2CXVA 3B8JA 1O2RA 1D9IA 1NRSH 1C1WH 2KCYA 2IJD1 2WV5A 4ZROA 1Y5AT 1QA0A 1CE5A 3ZZ5A 3GY7A 4ZAEA 1AO5A 4R8TB 2QGRA 1YY3A 3SYJA 1BHXF 1E37B 1YPKH 1AE5A 2THFB 1BA8B 1T8LA 1ELFA 7GCHF 1O2JA 3F1SB 4OS7A 1YPMH 2IN2A 1HAVB 1ELTA 2PUXB 3SQHE 1GGDC 3GS9A 2NWNA 3BIUH 1KLTA 3A80A 4DOQA 5A8ZA 3VEQB 4OS6A 2GX4A 1F0RA 3FP7E 1VZQH 3LOXA 2A4RA 1EX3A 1EUFA 1HAXB 1LVMA 1CGHA 1UVTH 4PROA 3ZZ6A 2JJ1D 2BDBA 4AZ2B 5FPSA 1SSXA 3A7XA 1XKBC 1IQIA 3MH7A 5TCAA 4XOJA 3M3TA 5CHAB 1OYTH 4K1SA 1ANCA 4MPWA 1CBWC 1LHCH 1BTUA 5LPEA 1NS3A 1FQ3A 5AFYH 2Z6BD 4AG1A 3SW2B 4GCHF 5ESTE 1GHAF 5GXPA 2ZTZA 4GHTA 2VIDA 1ZOMA 2BY7X 1MU8B 4MDSA 2A2QH 1XXFA 1DANH 2V7QD 2ANYA 1PQ7A 2AGGX 1GI7B 1O5BB 1O5DH 3E8LA 1C5XB 1WTHD 1OWIA 4IC5A 2M2AA 2VU8E 3LJOA 4ZKRU 3AVZA 5EXLA 1SGCA 3U1IB 2ZI2H 2NU2E 4ASHA 4DY7B 1FXYA 1V2JT 2G4UA 3OY5U 3RM2H 2Q6FA 2AMQA 3TH2H 1DWBH 2C3SA 2A4OA 1QRXA 4NIWA 5A0CA 4H42U 3RDZA 1V2MT 3JZ2B 2OUAA 3FVFB 2AGEX 1DUEA 3RXUA 3UOPA 1C5TA 1C1QA 3ZYDA 4ZXXH 5FPYA 4DJZB 4UE7H 3LGTA 1O2ZA 3A85A 2YNBA 5FXLA 1PPGE 1XUKA 3BTTE 3ZVAA 3PRDA 3OSYA 1YCPM 2W7SA 2HLCA 3SZEA 1Z6EA 5E2OA 2KFWA 2WHXA 1NO9H 2NU4E 4BTIB 3EE0B 3OEED 2W3IA 3E0NB 5BPEA 3RXVA 1O3GA 3UUZA 1O39A 3VG8A 2CHAC 1O5EH 2G00A 5DP4A 4UD9H 1GGDB 1KY9A 1GJ7B 1TMUH 1TBRH 2IJOB 3RXIA 5FBIA 5E0HA 3UREA 2Y7ZA 3HKJB 1S6LA 1V2LT 2GDDA 1S6FA 1PPFE 1O2IA 3FZZA 4ZHLU 1FY1A 1O32A 2OBOA 4ABJA 1AWFH 2ZNKH 1SFQB 4Q7ZA 1QB1A 1ZGIA 2FS9A 3FP6E 3MNXA 4X2WA 1TNJA 4NA9H 5EPNA 1KTTB 1BTYA 1HJAC 1RJXB 1C5OH 1MKXH 1P2MA 1TOMH 1QR3E 1ABJH 2WPLS 3RXGA 4B6EA 1CBWB 1C1SA 1VITF 3CENA 2W5EA 5DP8A 3MTYA 4D9QA 4J1YA 4DW2U 1GWAA 1HGTH 2QXJA 1G30B 9ESTA 3M37A 1GI2A 4DGJA 2P3UB 4HFPB 1ZLRA 5FBEA 3HK6B 1A1RA 1THRH 3AAUA 1UMAH 1C2IA 2BB4A 3MFJA 1ANDA 1V3XA 2A5AA 3GCNA 1ZGVA 1YF4A 5EXNA 1G9IE 2PGBB 4YLQH 3W94A 1OP0A 3SZNA 2ODQA 1A3EH 4JZEH 1BTZA 3K6ZA 4X8UH 1O2KA 1H8HD 4MQAA 5L2YH 1SMFE 1LPGB 3RC5A 3RC4A 3MYWA 2VNTA 1K1NA 3TGKE 2GCHG 2FLRH 2HNTF 2G8TA 4TYDA 3UOUA 1Y3YA 2CN0H 1D3QB 3UNSA 2P95A 2BQ6B 1GPZA 3KF2A 3TGJE 2FZZA 2P59A 3DSGA 1GCTC 2ZQ1A 3MU1A 3ATKA 1OSSA 3RXOA 2BLWA 4HTCH 1RTFB 4I8HA 3QWCH 1W2KH 5IYTA 1QJ1B 1QTFA 2R3YA 1AUJA 3F9GA 5EXMA 2KZ4A 3KNXA 3TNTA 1GMCG 2H6MA 1C5MD 2J38A 5A8XA 1QURH 3E91A 1CO7E 2R2MB 1UK4A 3BIVH 4KELA 1GHBF 1V2ST 1TGCA 1WAYB 1XMNB 1HFDA 1FDPA 2EQNA 3MNSA 2H9EH 2BDGA 2BVXH 2FM2A 2H2ZA 5PTPA 1TFXA 2FOGA 1FIWA 1EZXC 2QXIA 4J2YB 5F53A 3AAVA 2VB0A 3L3TA 2A45B 4NCYA 1C5WB 3VB7A 1S6HA 2BVSH 1ESTA 2QF3A 2XBWA 3CS7A 3ZIAD 1TMTH 1RGQA 2XC4A 5EGMA 2BD7A 2A5IA 1C2DA 1MQ6A 1MKWH 1QRZA 5C3NA 3ZVGA 1CT2E 2GV7A 1AI8H 2K1QA 1EB1H 3PWCA 5C1XA 1D3PB 2OP9A 4JYUH 4F55A 3KEEA 5EW1H 1C5QA 1TQ0B 1VJ9U 1Z1IA 3BEUA 1C9PA 1P2QA 2O9QA 1LHDH 1UK2A 2M5TA 2ZPRA 1G3DA 4SGBE 2R2WU 3HGPA 1BIOA 3A7YA 3P6ZB 2PKSC 4AGKA 3K9XB 2ZDVH 2L6OA 2KCOA 1RS0A 3Q3XA 4ZKNU 3S7KB 4FUGA 3MH6A 2A5KA 1JIRA 3FAOA 3BTWE 3GCHC 3I29A 1BT7A 4IS5A 2AHME 3RUOA 1WYKA 3SI4H 5HXFA 1GBAA 1S83A 1P2KA 1W0KD 1UVSH 2B0FA 4CRFA 5L30H 2ZIQH 3TLOA 1O30A 1ELDE 3LJJA 2ASUB 2F9BH 4INKA 4O03A 1S84A 3E3TA 2GKVE 5T6FA 5C94A 1T8NA 1UTKA 1IHTH 3F9FA 2Y5FA 4E7NA 1QL7A 1XKAC 2ODPA 5HKKD 3KQCA 3JZ1B 5BRRE 3SV8A 2XBXA 3Q76A 1NROH 1VITH 1GCTB 2F83A 4WMFA 3SUGA 2YMSC 4IN1A 2BDCA 1VGCC 1WDIA 4NGAH 1GVLA 2OBQA 2BD3A 5AFZH 3SUFA 1BITA 3IG6B 3OU0A 1Y3UA 5FX6A 4CRAA 1ZTKA 1TGTA 1ARCA 1C5UA 1OOKB 1H1BA 2GJGA 1IQNA 4JZIA 1QBOA 2ZEBA 1EPTA 1Z8GA 1BBRE 1SLWB 1YPEH 5JDUB 2J2UA 4WXIA 4X8TH 3NRLA 1YPGH 1W0ZU 3C1KA 3LONA 2RDEA 4B2BA 5J4QA 1YC0A 2PR3A 1CHGA 2UWOA 3U9AH 2AMDA 4BTTB 2XNIA 1TX8A 4ZHMU 1V2RT 1C1NA 2TPIZ 3MQKC 5ESBA 4IBLH 4BOHA 5GNDA 5GDSH 2ZHFH 1IQGA 4D7GA 1A3BH 1SLVB 2DE8A 4FUEA 2ZFRH 1O2LA 3BTME 5F6MA 1Y5BT 3GCTF 3PM3A 3SHAH 5JPMH 2B8OH 1GI9B 3FN8A 3FKSD 3VB6A 2PKSB 1RXPA 4ABDA 3OAAD 4ZKSU 2D26C 1B0FA 3P8NA 2FOHA 3ZZCA 3P92A 2XTTB 4A7IB 1CQQA 1MCTA 1HJ8A 4ESTE 1TPSA 1GBJA 4FUIA 2WPDD 2RA3A 1GJ5H 1ANBA 4KP0A 4B76A 4FOUC 3GCHB 3BEIB 2QN5T 2C90B 2TGTA 4CREA 3H09A 3UWJH 1L4ZA 3FANA 4QT8C 8LPRA 1G3CA 4ZKOU 1ABIH 4YOJA 1QBNA 7GCHG 5B6LA 2QF4A 1GMHF 3V3MA 3BTKE 2D1JA 3A8BA 3SV6A 3SJKA 1ELGA 1Q2WA 4FUHA 3U98H 1HYLA 4CR9A 1EPTC 3TNSA 2ZFTA 3EA9A 2PKAB 1SGFG 2A32A 2QXGA 3M3VA 3OX7U 2AGIX 4YLUA 1GI5A 3RXCA 1SGNE 1K21H 1WOFA 2ZHWH 4H6SB 1F92A 3A7VA 2IOTA 1BMMH 5AVDA 1EB2A 4DG4A 5EQRA 5F8XA 3SUDA 1AZ8A 1QQ4A 3KN2A 2F3CE 1VGCB 2UWLA 4UDWH 4NIVA 2J94A 1V2QT 3LIWA 2ZU2A 3H7TA 1KXAA 1NFXA 1GBMA 1G3BA 1O5CB 1SQOA 2ZGHA 5H4IB 1E38B 1H8IH 1ZR0A 4AOQA 2H1UA 1AE8H 2ZFFH 1O3AA 2RDLA 1P02A 5FPTA 3LGIA 1ID5H 2ZHDA 1GHAG 4GCHG 3TJNA 4I7YH 2P94A 1LVYA 4AFUA 4TY6A 1GBBA 2SGQE 1O2TA 1MKWK 1Y3XA 1DLKB 1TYNA 4LZ1H 4NZLA 5DP9A 1N6XA 4MG3A 3NUMA 2G5VA 2Z3EA 4YT6H 3BG8A 1K1LA 4XBCA 3FO8D 1IAUA 1K22H 1LTOA 2CF9H 4WY3A 4Y8ZA 4UFFH 2BZAA 1GI0A 1VCQA 1Z8JB 1TMBH 3U1JB 1GDNA 2RA0A 1DPOA 1O3HA 4YTAA 1L2EA 3E90B 2FYRA 1O31A 3SQEE 5E0GA 1GJ4H 2O8TA 2A4QA 1O3PB 1FIZA 1HDTH 4BAQB 3M3SA 3B23B 1KXBA 1O38A 1G2MA 2YNAA 4AB8A 1UCYH 4MNXA 1AKSB 1DT2A 3UWIA 1Z6JH 4GHQA 3EDXB 2FDAA 5K7RA 1PPZA 2J5UA 2BD2A 2XWAA 1NESE 2SGPE 1BMNH 3NKKA 3S9CA 1NZQH 1UTJA 1C9TA 1EPTB 1ZSKA 1SGFA 2Y6TA 2BVRH 1DVAH 1PPBH 2AIQA 1AUTC 3TPIZ 1EAXA 1TNIA 3MH5A 3KQEA 5DP3A 4XDEA 3V7TA 2VH0A 4CHAB 1S81A 2CK3D 1U6QA 1OHHD 2EC9H 5DKMA 1NRPH 1QA7A 3WWBA 4AB9A 3URCA 1GVZA 1EKBB 3M7QA 1UTOA 3P70B 1FV9A 1LHFH 3QDZB 5GCHF 2Y5GA 3OE7D 1TGNA 3RXSA 3K2UA 1H9HE 1QY6A 2A31A 2SGEE 2IPHA 1VITG 3A7TA 4XSKU 4CBNA 2QAAA 1KXFA 2AH4X 1Z71A 2G55A 1GJDB 2R3UA 1UVOA 1WTGH 3W1EA 2Y81A 1O2HA 1FN6A 1K1OA 1MH0A 2YMSD 1QJ7B 4LK4A 1OP8A 2FP7B 3RM0H 1A61H 1AZZA 1NRQH 1BRCE 3LH3A 1DWCH 2VVUA 1NC6A 4IN2A 2TRMA 3PLBA 5FCKA 1JRSA 1BB0B 2FODA 3OFND 1AGJA 4WH8A 1O2MA 1W11U 4K8YA 3T29A 4WXVA 1SGQE 1GBKA 2WUCA 1QCPA 2ZG0H 3CP7A 1QJ6B 1IQHA 3PYHA 3O8CA 1KYNA 2WV4A 5DP5A 5JBTA 3F2GA 2XWBI 3DCLA 3ENSB 1TX7A 4FUCA 1G32B 2AERH 1Y3VA 3MU8A 2QV1A 3RU4T 4K3JA 1OWKA 1E34B 3U8TH 1O3JA 3ZZ3A 1JRTA 2BDYA 4INHA 3EA8A 2UUJB 3UB0A 2F91A 1FLEE 4ZH8A 2EI6A 4UFEH 1K9OE 2ZU5A 1C2MA 2ILNA 2W6JD 4NSVA 1UW7A 1F0TA 3F9HA 2VH6A 4JZDH 2ZGCA 2ZFQH 4ISHH 4UEHH 4ASUD 4ZXYH 3UNRA 1RRKA 1SHHB 1HB0B 1MZDA 4HZHA 9LPRA 3Q77A 5EW2H 2FI3E 1BTPA 4Q7YA 2OTVA 1DSTA 1C5ZB 1KLJH 1OWDA 5B6OA 1GHBG 1KXDA 1O2SA 5C17A 4BAKB 1O3EA 2VIVA 4O3TA 3SNDA 1FUJA 2JETC 3FP8E 1NFWA 3QN7A 1ELCA 3ESTA 1YM0A 1T7CA 1L1JA 4NA8A 3VB3A 1OWEA 2ODYB 4FVDA 3M36A 4TSFD 1AFQC 2OD3B 5EOKA 2NU0E 1UTNA 1VCPA 1J15A 2G4TA 4FUDA 1C1TA 4FU9A 2FOMB 3T5FH 1GBCA 2BOHB 1TNHA 4I8JA 2VIOA 1QRWA 1EJNA 4Y7BA 4KTUA 3N7EA 4A1XA 1P3EA 3FZDA 4Y79A 1TALA 3RXHA 4KGAA 5JB9S 4Y11E 1TABE 1ZJKA 1P9UA 2XCFA 1SGEE 3DFJA 1UVUH 3PV5A 1GHWH 1ZHPA 2GT8A 1TBZH 5K0HA 3W95A 4DIIH 3MU4A 3DD2H 1O2NA 1XVOA 7LPRA 3A81A 3MO3A 2O8MA 1W7XH 2LP6A 4UFGH 1A46H 4MPXA 1D6RA 3VXFH 2OC7A 4MPVA 3TVJB 1A0HB 1FMGA 4Z6AH 1GHZA 5ETXA 2EI7A 1FZZA 3RXLA 1HAPH 2VWOA 1SLUB 2FTMA 2PSXA 3SI3H 1A7SA 1WUNH 3OY6U 1W12U 3RXKA 1C1MA 3LGYA 3PMAB 4A6LA 2BD8A 1QB9A 5A09A 1Y3WA 1C2LA 1UCYK 1ZZZA 1E35B 3MOCA 2I6SA 1BUIA 2R0LA 2V3OH 1C5RA 3UNQA 1ZMNA 1EATA 1O3DA 2V3MA 3LKWA 1TONA 1CA0C 4YT7H 1LCYA 1BTWA 2C4FH 1EP5A 4Y0ZE 3STJA 5J4SA 3QTVH 5T3HA 3D23A 1AMHA 1V2TT 1SLXB 4BTUB 2GT7A 2SNWA 2CMYA 5GIBA 1ETTH 2ZZUH 3PB1E 1DWEH 5DSFA 5T1VA 3GDUA 1C1VH 1TBQH 1CGJE 4WWYA 2BY6X 1HNEE 4NG9H 2Y5HA 3UR9A 2OC1A 1ELEE 3H7OA 2P8OC 4F48B 1EOLA 2VWNA 1DSUA 4MNVA 3RMOH 4UONA 1WXRA 1C1PA 1O2OA 1AIXH 1A5HA 1NFYA 3S7HB 3M35A 2JETB 5E2PA 1V2WT 1C2FA 1D4PB 3A88A 4JYVH 4MVNA 1GL0E 4O97A 1PPHE 3LGVA 1MBMA 4WMEA 1SGDE 2V6NA 3LU9B 2JIZD 1AVXA 4I33A 1OXGA 1AFQB 2Z9GA 4U32A 1P57B 1L1GA 1ACBE 4X6PA 3RMMH 1JXPA 5FHTA 2A7HA 5JBAS 2Z9LA 1PJPA 2W26A 2F43B 1NY22 5A0AE 2VGCC 1MZAA 2I6QA 1O2VA 2R9PA 3KQDA 4Q4LA 1QZ8A 2A7CA 3T28A 4YESB 1YBWA 1GHVH 1UO6A 3MO6A 3M5MA 3SU2A 4ABAA 3RU4E 2HPPH 3SJOA 3RXJA 1WBGB 2C93B 2KCPA 2OQ5A 3CNRA 1SQTA 3ZV9A 1NU9A 2OK5A 1P9SA 4ABIA 1GG6C 3E16B 4FUJA 4Q80A 1C5LH 2BLVA 4CH8B 2WPKS 1ZTLA 1JBUH 1FPHH 2CHAB 2KX4A 1V2UT 1KIGH 3HGNA 3BTHE 1W10U 1C5SA 2QIQA 1OPHB 4XFQA 5C1YA 2Q1JA 1TA6A 3RU4D 1KXEA 3NWUA 1GMHG 4FETA 1OWHA 2A2XH 1B0EA 2OQUA 2AYWA 1C1OA 1AVWA 3GICB 1O33A 4ISIH 3ATIA 3OTPA 1D3TB 2BXTH 2STBE 1BRUP 1CA0B 4XBDA 4FU8A 2WYGA 1BQYA 3F2HA 1PPCE 2BM2A 1VR1H 3EYDA 1O37A 1FJSA 3SU0A 1SGIB 1HJAB 2XC0A 5DO4H 4B1TA 3P17H 5EG4A 2FOCA 2BX3A 8GCHF 2Y7XA 2GDEH 3K6YA 1OP2A 1ZTJA 5DPAA 1LHGH 4Y0YE 1MBQA 1Z7KA 3BTGE 2ZP0H 1ZPBA 2VWMA 3S9AA 5DGJA 1ZMJA 5JB8S 1HCGA 2KAIA 3KQBA 2P8OB 3TK5A 2ZDAH 2FESH 1S5SA 3P8GA 2Z9JA 1P06A 2HWLB 3ZV8A 1GJAB 2KCAA 4X6OA 3T27A 1YYY1 1CVWH 2ZCHP 3OYPA 4O3UA 2Y80A 3V12A 4AC9A 2BD4A 1GJ6A 1O3NA 2V0BA 4Q63A 2GZ7A 2G5NA 4K5ZA 1PYTC 2A4GA 2JH0D
chains in the Genus database with same CATH topology
1V2VT 1W13U 2SGAA 1TGSZ 3A89A 3PLKA 1NU7B 2UUKB 4XBBA 1GBHA 5I25A 3A84A 1SVPA 1EAWA 4E7RG 3M61U 3VGCC 3SGBE 1O3FA 3P95A 1O5GH 1RTKA 1OKXA 2TGPZ 1SQAA 1Z8RA 3AASA 3G01A 1G37A 1SOTA 2O8UA 1D6WA 1B7XB 1ELBA 1O34A 1RD3B 2WPJS 1VCWA 5HMAA 3RXQA 2BHGA 1GG6B 1GI1A 3LDXH 1S0QA 1O2XA 3SJIA 1MCVA 1S0RA 3BTDE 2HALA 2P16A 2ZHEH 3R0FA 5A8YA 5GJ4B 4U2WA 2BX4A 3TH3H 3MMGA 3QX5H 2GVFA 3U69H 1SB1H 1C1RA 2SFAA 1SGRE 4B2AA 1SBWA 2PV9B 1F5KU 3L6PA 3ZZDA 1MKXK 1HIAA 2FWWA 1MQ5A 2UUFB 2F9PA 5C5NA 4IW4E 1GHXH 3EQ0H 3IWMA 4B75A 1C1UH 4A1VA 1ZHMA 2QCYA 1BRBE 1FONA 5EU8A 3M7UA 4YOIA 2VWLA 3A8CA 4IC6A 1ETSH 1TPAE 4X0WU 3RXDA 1IQEA 1FI8A 3AW1A 1MAXA 3RC6A 5HM9A 4GUXA 1TRYA 1TNGA 3VFEA 1N8OC 4CBOA 3VXEH 1C5NH 4AYYB 2GP9B 3ITIA 1FY5A 3SBKA 3UQVA 2P3TB 2BLOA 1UTQA 1FAXA 3MHWU 5L6NH 1O5FH 4MNWA 1P01A 3ZVEA 1CT0E 1QBVH 4R0IA 1SR5C 3UR6A 1V2PT 2C8YB 3ZVBA 3RP2A 3ZVFA 2OXSA 1Z8IB 4CH2B 1IOEA 3B9FH 3OTJE 3I77A 5L2ZH 3BTQE 3SNCA 1EZUC 1P2JA 2XC5A 2WPIS 3A7WA 1HRTH 1AB9C 3MO9A 4OGXA 4BANB 3GY3A 4NIXA 1ZMLA 2TIOA 5EQQA 1K2I1 3VGCB 1K1JA 1HAVA 1L1NA 4THNH 2BZ6H 3QZQA 1DDJA 1HBTH 1C2GA 5C1UA 2ESTE 2BDAA 3P8FA 1MTUA 2BQWB 1H9LB 2J34A 2QXHA 1NPMA 3TIUA 1GHYH 4ISNA 1UTPA 1YP9A 3MNCA 2FS8A 4Z0KA 3DT0H 1NRRH 2ALVA 3SV9A 4JCNA 1TOCB 2GCTC 3E0PB 1TA2A 5ABWA 1GDQA 2ANMH 2AIPA 1H4WA 1WU1A 1UJ1A 3PMJA 5JYIA 4AYVB 4Y6DA 3E1XB 4YO9A 1G2LA 4O9VA 2XBVA 3M5LA 4X2XA 3U8OH 3ZVDA 2AMPA 4BAHB 2JH6D 2ZECA 1XUJA 2LNCA 1RIWC 1O2PA 4SGAE 3GCOA 3KIDU 1FAKH 4H4FA 1O2GH 4K69A 4AFQA 2FOBA 4DCDA 2BY9X 5C20A 1EP6A 3Q00A 1F0UA 4D8NA 3Q3KA 3L33A 2GZ8A 1F7ZA 3LH1A 4X1SU 4AORA 1N8OB 1JMOH 2ZGJA 2ZPSA 4UFDH 4FVBA 1YPJH 1Z1JA 4GSOA 1QHRB 3UIRA 1LDTT 2BDIA 1H9IE 6GCHF 3KL6A 1O2UA 1GJCB 3D62A 1AD8H 1AN1E 3D65E 4FXGH 4DIHH 1LVOA 1V2KT 1T31A 4F49A 1P2IA 2O8LA 3SUEA 2WINI 3TK9A 2VVCA 3E6PH 3TU7H 5LGOA 1CHOF 1AQ7A 3SU6A 1GBIA 2ZU3A 2Z3DA 1NRNH 2ANKH 1ELVA 4X2YA 4AN7A 3PV4A 3WY8A 3KHVA 4B74A 1F5RA 2OINA 3KGPA 1HXEH 5C67A 2WPHS 1QIXB 1AB9B 1DITH 4Y7AA 5GPIB 4YZUA 1QGFA 1PYTD 3UPEA 3O8DA 2J92A 1DXWA 5CE1A 4NIYA 2ZGBH 5A2MH 4A92A 1O3CA 3NPSA 2PTCE 2FX4A 1SL3A 4F4OC 1P05A 1HAYB 1PQAA 1XUGA 3BEFB 1N1LA 1P2OA 2FEQH 1L0ZA 3HKIB 1O2QA 2F9OA 5E8EH 2GTBA 2GCTB 2UUYA 2B9LA 2Z9KA 1J14A 3LC3A 1QFKH 4RN6A 1UCYE 4E06H 2H5DA 2ZCKP 3PTBA 2PFEA 1WQVH 4K2YA 2ZFPH 1ELAA 5F8ZA 1YPHC 4I8LA 1HUTH 2Q6GA 2Q6DA 1AU8A 1D3DB 1GJBB 2ZTYA 1UHBA 1W3CA 4JZFH 2BY5X 2FI5E 1KDQA 1FY8E 2FTLE 1EASA 1DLEA 4JMYA 3A87A 1RIWB 1MAYA 5A0BA 7KMEH 4K8BA 1P0SH 5LPFA 2FOFA 2F9VA 1HAOH 1UTMA 2OCVB 1FY4A 4GPGA 1QL8A 1KXCA 2W3KA 2GGVB 1BTHH 4NZQA 2R0KA 2GZ9A 1DY8A 3QGJA 1EZSC 3SU1A 3ODFA 2A0QB 2ZQ2A 2VIQA 4DVAU 1BTXA 1ESBA 1GMDF 2TGAA 1QB6A 4IGDA 3M5OA 1V2OT 1C5VA 2QC2A 2ZDKA 1GL1A 4ZHAA 2LPRA 4OGYA 1DICA 3SN8A 4CRCA 1M9UA 2ZGXH 1ZPCA 2ZFSA 5TCCA 1T8OA 3MNBA 1BJUA 4E05H 1O35A 3TJUA 3BN9A 1MTVA 3BTEE 2EA3A 1CA8B 1KLIH 1GI8B 1GI4A 2A7JA 1BZXE 3K65B 1TWXB 1XUFA 4X8SH 1GBTA 4FUFA 1TGBA 3DFLA 1DM4B 3RXRA 3SV2H 2TBSA 3H5CB 4JYTA 1FPCH 3UQOA 1A0JA 1P12E 4Q2KA 1LO6A 3SU4A 1HAIH 3BSQA 2ALPA 4Q7XA 1ESAA 5T6DA 3UTUH 1A4WH 4I32A 1ZHRA 5JBCS 2A1DB 1PQ5A 1DE7H 2H9TH 4AGJA 3SNEA 8GCHG 2D2DA 4RSPA 1PQ8A 4ZUHA 1O3OA 1C2EA 4A1TA 4MPUA 2FIRH 2XW9A 3LPRA 3RXPA 1GI6A 2BLQA 1XX9A 3VB4A 4ABFA 4HGCA 4ZMAH 1F0SA 1VJAU 3A82A 3A86A 4AX9H 4HI3A 1IQKA 1SGPE 3PMBB 4LOYH 2XRCA 1ORFA 4B71A 1K1PA 1MU6B 2ZCLP 1GBDA 1BHXB 2P93A 1N6YA 3A8AA 3T25A 2B5TB 2ZDNA 1GJ8B 1Q31A 1T4UH 1ETRH 4KKDA 4OS2A 1O2YA 2G52A 2FOAA 3U8RH 1GCDA 1TX6A 2G51A 4I31A 4JK6A 2C8WB 2B7DH 2ZKSA 3DUXH 3QTOH 1JWTA 3BTFE 1XVMA 1Y5UT 1T4VH 3SOSA 1UK3A 4WMDA 3O8BA 1HJ9A 3UY9A 4IMQA 1XUIA 3SORA 1DX5M 2HRVA 4B2CA 2CGAA 1P11E 1OX1A 2QY0B 1LPZB 3GDVA 5GWZA 3N7OA 4NSYA 1ZJDA 3RLYH 2JH5D 4X1PU 5EQSA 2OC0A 2YOLA 2CF8H 1O0DH 2ZU1A 1RTLA 2ZDMA 5HM2A 3Q3YA 1T8MA 2VJ1A 2HVXA 1GDUA 1INCA 1NT1A 1FN8A 1TE0A 1S85A 1QL9A 1V6DA 1IHSH 1UHBB 1TB6H 5CMXH 1W0YH 1IQLA 1AVGH 1KDQB 7ESTE 4IMZA 2UWPA 1SPJA 4XE4A 1P10A 2VIPA 5HGGA 3QGNB 4X6NA 4Y71A 2O8WA 4YM9A 4GLYA 3PMHB 1J8AA 1RFNA 8KME2 1CSOE 1YPHE 1K1IA 3BV9B 4TPYA 2V35A 3ATMA 3SNAA 4D7FA 1G36A 1S82A 1UTLM 3GCTG 4LXBH 5TJXA 1A5IA 1MMJN 2HNTC 5LH8A 2ZWLH 1IQFA 4GVUA 4TWYA 2W7UA 4CRBA 1KSNA 3ZZ8A 4K1EA 4AG2A 2ZA5A 4Y8XA 2HGTH 1SHYA 3SJ8A 2XYAA 1TIOA 2F9NA 1YCPH 2PLXA 1SOZA 1EJAA 2ANWA 3KCGH 3ZZ7A 4ISOA 4JK5A 1P2NA 1AWHB 2ULLA 3GYLB 4WJG2 3SGQE 5FX5A 3ZZBA 5AHGH 3SHCH 1A0LA 1O3LA 1TQ7B 4FU7A 2BXUH 3S0NA 3RMNH 2RG3A 3QUMP 5LPRA 1DS2E 1DWDH 2ZDLA 1MUEB 1JIMA 1HAHH 2NU1E 4VGCC 1THSH 5DG6A 1EQ9A 3T26A 3SJ9A 3DHKH 3MI4A 1GVKB 4BAOB 1AHTH 1C2JA 1G3EA 1MD7A 2PKAA 1LKBA 2ZHQH 1LKAA 5DP6A 3RXAA 2H5CA 1HLTH 1NFUA 3PLPA 3SNBA 3V13A 4BXWA 4BXSA 3UFAA 3URDA 2XBYA 3S9BA 1B5GH 2ZC9H 2OC8A 1A2CH 1XXDA 4M7GA 3GY8A 5T6GA 1QNJA 2BOKA 1PFXC 1X7AC 1GJ9B 2DUCA 3SU3A 1C2HA 4MLFB 3SO3A 3GY2A 4MNYA 4A5TS 1O36A 1P09A 3BF6H 2RCEA 1GBLA 1HAGE 1O5AB 2WYJA 3T62A 1JOUB 2FYQA 2J9NA 4BNRA 2VIWA 4X1QU 2PHBA 2VVVA 2HOBA 1THPB 4KTCA 1V2NT 3PROA 2H9HA 1ANEA 6ESTA 3ATWA 3GDSA 2VGCB 4X6MA 4Y76A 3F68H 2ZTXA 3VB5A 4CR5A 1BBRH 2DE9A 4TY7A 1MTWA 2BQ7B 3RLWH 3TJVA 3RXFA 3ZZAA 1A5GH 1KTSB 3LGWA 2QF0A 1J9CH 2CJIA 3TGIE 4X1NU 3F6UH 1EAIA 1P8VC 2PGQB 2XXLA 3EA7A 3HK3B 1AFEH 5F03A 3P8OA 6GCHG 4NFEA 3LT3A 3MWIU 4JZ1A 1BDAA 2ZF0H 3A8DA 1Y59T 3GY4A 2GV6A 1WCZA 1TPPA 2GMTC 1CHOG 1CU1A 1AKSA 1C4U2 1YLCA 3ZYEA 1EJMA 4Y10E 1CT4E 5C5OA 1W14U 3HPTB 1HAZB 3MH4A 2J95A 4CRGA 1TRNA 3RXMA 2FPZA 1YPLH 2SNVA 3ODDA 8ESTE 2EEKA 1ZPZA 4MTBA 3GY5A 4X2VA 2HPQH 2SGDE 4VGCB 1ZRKA 4X1RU 3BG4C 4H6TA 4AFSA 1NM6A 2FMJA 1E0FD 1SFIA 6CHAC 1TRMA 1SI5H 5F8TA 1TNLA 1FNIA 1YLDA 3TH4H 2PUQH 2FX6A 1SGTA 5GCHG 3D49H 2Z7FE 4D9RA 4KTSA 2BD5A 4X8VH 6LPRA 3GY6A 5DP7A 1CGIE 1GBFA 2AFQB 3RXTA 1O3IA 1MTSA 1HXFH 2FLBH 2FOEA 5AF9H 2BMGB 2PTNA 3ZZ4A 1WV7H 2VINA 2GCHF 2ZO3H 3A7ZA 1SC8U 1O2WA 2SGFE 4ABBA 2TGDA 1LMWB 2D8WA 3V0XA 1DFPA 4Y8YA 3CS0A 3LGUA 3VPKA 1BJVA 2C8XB 5IDKA 4DURA 1ARBA 3ELAH 3ZZ9A 1LVBA 1QQUA 1PPEE 1EXFA 3HATH 1ZRBA 5SGAE 1BOQA 1NTPA 1P3CA 2BDHA 1GMCF 1EAUA 2HNTE 2JKHA 3GISB 4DT7B 1K1MA 2F9UA 2FO9A 3PO1C 4FUBA 4WF8A 1BRAA 2STAE 1MTNC 2FXRA 1W7GH 4NWKA 1SG8B 3LC5A 1YCPK 1BMAA 4ABGA 3AW0A 2Y82A 4OS1A 1TPOA 2PWXA 1GMDG 4ABHA 4D76A 1ZSLA 1IQMA 3F9EA 4TWWA 3RXBA 5HYOA 1K28D 1LPKB 1LQEA 2GMTB 3I78A 3NZIA 3R3GB 4CHAC 3ATLA 1O3KA 4I8GA 2GD4B 4OS5A 2KAIB 4WH6A 3T2NA 4YOGA 5DK1A 4RKJB 4U01A 3QLPH 3SV7A 5E0JA 3S69A 3STIA 1C5PA 2OLGA 1OS8A 1UVPA 3TK6A 1LHEH 1F5LA 4LZ4B 3BG4B 1EZQA 1HPGA 4ISLA 1O3MA 1J16A 2BYAX 2PW8H 2CV3A 1MD8A 1IQJA 2BTCE 6CHAB 1OWJA 1C5YB 5EPYA 2FI4E 3PWBA 3TJOA 3GOVB 5G4BA 1WQSA 1DXPA 3QZRA 4B73A 5C2ZA 3ZVCA 4CRDA 3MU0A 3EGKH 1FY3A 1YKTA 3M5NA 4K1TA 1C2KA 3QO6A 3IITA 1LQDB 1BMLA 1OYQA 2WUBA 2ZU4A 3O8RA 3SGAE 1WSSH 3FFGA 5JBBS 1J17T 1H8DH 1ZSJA 3RMLH 3SU5A 2V3HH 4NA7A 3RXEA 1E36B 2Z3CA 4NWLA 1P04A 1C4Y2 2Z9IA 3EAJA 4AFZA 1SGYE 1YGCH 1BBRK 2AEIH 4GAWA 2QYIA 3M7TA 5FAHA 2BY8X 2J4IA 1TNKA 2WPMS 2G81E 1W8BH 2EI8A 4INLA 1C4V2 1HV7A 5I46H 2XCNA 3PTNA 5CHAC 1TAWA 5EODA 2QA9E 2BD9A 3PO1B 1ZYOA 1HIAB 1MTNB 1Q3XA 3NXPA 3GYMA 1F2SE 3MU5A 3NCLA 4I8KA 3QK1A 4ABEA 3TITA 4TPIZ 1AY6H 3NK8A 3C27B 4RKOB 1T32A 1DUAA 1XUHA 1L4DA 1EOJA 4NFFA 2AS9A 1O3BA 1Y8TA 1GI3A 2P3FH 4WVPE 1TLDA 1P03A 2PSYA 4K60A 1XM1A 1DOJA 2Z94A 1NN6A 2C8ZB 4BAMB 4OS4A 1DY9A 5DJ7A 3DA9B 4U30A 3A83A 1BCUH 2NU3E 2ZPQA 5FCRA 1GBEA 2CXVA 3B8JA 1O2RA 1D9IA 1NRSH 1C1WH 2WV5A 4ZROA 1Y5AT 1QA0A 1CE5A 3ZZ5A 3GY7A 4ZAEA 1AO5A 4R8TB 2QGRA 1BHXF 1E37B 1YPKH 1AE5A 2THFB 1BA8B 1T8LA 1ELFA 7GCHF 1O2JA 3F1SB 4OS7A 1YPMH 2IN2A 1HAVB 1ELTA 2PUXB 3SQHE 1GGDC 2NWNA 3BIUH 1KLTA 3A80A 4DOQA 5A8ZA 3VEQB 4OS6A 2GX4A 1F0RA 3FP7E 1VZQH 3LOXA 2A4RA 1EX3A 1EUFA 1HAXB 1LVMA 1CGHA 1UVTH 4PROA 3ZZ6A 2BDBA 4AZ2B 5FPSA 1SSXA 3A7XA 1XKBC 1IQIA 3MH7A 5TCAA 4XOJA 3M3TA 5CHAB 1OYTH 4K1SA 1ANCA 4MPWA 1CBWC 1LHCH 1BTUA 5LPEA 1NS3A 1FQ3A 5AFYH 2Z6BD 4AG1A 3SW2B 4GCHF