2F9OA

Crystal structure of the recombinant human alpha i tryptase mutant d216g
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tryptase alpha-1
publication title X-ray Structures of Free and Leupeptin-complexed Human alpha I-Tryptase Mutants: Indication for an alpha to beta-Tryptase Transition
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9oA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9oA01
4JK6A 1KXEA 4X6OA 2HPQH 3LGUA 1ZHRA 1MCTA 3O8DA 3F1SB 1EZXC 1JWTA 3F9EA 2QCYA 4UE7H 4NG9H 2FOMB 2TGTA 3T26A 2BD4A 1GL0E 1ETSH 1O2JA 4K5ZA 1O2YA 2ZQ1A 1ANEA 4UFDH 1PPEE 1NTPA 3FP6E 3GISB 3CS0A 1SQTA 1V2MT 4ISHH 4TY6A 1O3NA 3OYPA 4MPWA 2A2QH 2BD3A 1GVZA 3BN9A 3OX7U 4SGBE 2ZO3H 1FNIA 1N8OC 2GGVB 2GCHF 3TPIZ 4A92A 1UK4A 1HAVB 4Y6DA 4X6NA 1LKBA 1CE5A 2V6NA 1HXEH 1K1IA 2FM2A 1P01A 1AB9B 1MKWH 5A8XA 1TNKA 3SU2A 1GJ8B 1DWDH 1GJ7B 3E0PB 3A87A 1EX3A 3MU5A 1TRYA 2SGAA 1ZHMA 4ABBA 4CREA 1TX8A 1C5QA 2WYJA 4FUJA 3GDUA 4H6SB 2ODPA 1C9TA 3RXLA 3QTOH 2AS9A 5GIBA 4MDSA 1L4ZA 1WCZA 4UDWH 2ODYB 3Q77A 3SJKA 1AGJA 4XBBA 4NSVA 4HFPB 1YLCA 1BBRK 1P09A 2W7SA 1H9HE 1K1NA 4X8UH 2FOBA 1YPEH 2BDYA 3RC5A 1H4WA 2VINA 2KAIB 3KF2A 1GI4A 3SO3A 3VGCC 3RM0H 4DURA 2WV5A 2B7DH 5F6MA 5EODA 3U9AH 1UO6A 1TPSA 1A1RA 1MBMA 1GI2A 1SR5C 3M5MA 1FIZA 1V2VT 4DOQA 2H9HA 1O3GA 4NFFA 6CHAC 1GMCG 3ZZ4A 1Q2WA 2VWNA 4AYVB 1S5SA 5J4QA 2ZPQA 1INCA 2AEIH 2Z9GA 2Y5GA 2R3YA 1NFXA 2ZU5A 4BTUB 2BD9A 7GCHF 3OTJE 5AVDA 1QJ7B 1E36B 2ZIQH 2H9EH 3A8DA 4XFQA 3ATLA 4Y79A 3RU4D 2D26C 1IQFA 2WUCA 5DP3A 4R8TB 2G5NA 1YPKH 1VGCC 2P93A 1QIXB 3M35A 1EOJA 2BDHA 1GBHA 4AB8A 4AN7A 3UUZA 1O3OA 1GMDG 2Z94A 3TJUA 2Z3CA 1MBQA 1LTOA 1QRZA 3MYWA 1ZR0A 1VJAU 5FX6A 3LDXH 1GGDB 1AU8A 1C5SA 1BTUA 1GG6C 1EOLA 3T25A 1W8BH 3VB7A 3DFLA 2VIWA 1JIRA 3R3GB 2Z3DA 1BRBE 1CHOF 3HATH 1CGHA 1LHGH 1HJAB 4NZLA 2EI6A 2XXLA 5C1YA 1GI5A 2I6SA 1MTNC 4WXVA 1QQUA 1O3CA 3ZYDA 3KIDU 2FX4A 3BEFB 1FLEE 3A7XA 1FV9A 3EE0B 3VB3A 4Y7AA 3RXKA 1O5EH 1NC6A 2VWLA 1NROH 4ISLA 3BSQA 1PYTD 4X8VH 5PTPA 2RA0A 3T5FH 2AGEX 1X7AC 1MCVA 4BAOB 2ZCKP 1NFYA 2QXHA 2ZGJA 1GBMA 3RMMH 3RXBA 1O2KA 2VWOA 1TMTH 3HKJB 1TB6H 1L1GA 4TWWA 3BF6H 4Y71A 5F8ZA 1LHEH 3HGNA 1C5UA 1C2LA 2ZTYA 1TOCB 4LZ1H 2BHGA 1O2HA 1O2ZA 1W0YH 2RG3A 2DE8A 5ABWA 5EW2H 6GCHF 1NESE 2ZNKH 3LH1A 3P8FA 1MD8A 3MHWU 5EQQA 2O8LA 1LCYA 1K1JA 1SLXB 2HOBA 1THPB 3E0NB 3JZ2B 5IDKA 2NU1E 3GCTF 1DANH 1YPHE 1BTXA 2GV6A 2XYAA 2OXSA 3F9FA 1Y8TA 1W11U 2WPMS 2XNIA 3F9HA 2VIVA 1T8OA 4ZKRU 1O36A 3LGWA 2BOKA 2AIQA 4YZUA 4BXSA 3SORA 1HJ8A 2W7UA 5FHTA 4DCDA 1A2CH 1RIWB 1RGQA 3M5OA 3SU6A 4DT7B 1VITG 1C5WB 1ZGVA 4CRGA 1P12E 2FI3E 3LH3A 1GHBG 5L30H 1AVXA 2ZC9H 1BQYA 3TITA 4Q7YA 1AHTH 1ZJDA 2BTCE 1GHAF 2BDIA 1QBVH 1XUGA 2GCTB 1HUTH 1ID5H 2HLCA 1O5GH 4KELA 2XC0A 2FO9A 2BQ7B 2AH4X 3UNRA 1O3JA 1O39A 1CT4E 1NT1A 3RXVA 1CBWB 1MKXK 4YLUA 1H1BA 1ZRKA 1L1JA 4WWYA 1E35B 3BTGE 4NA9H 1ANDA 1HAVA 2RDLA 1A5HA 2ZGXH 1E38B 1GVLA 4CR5A 4ZHMU 2FP7B 2AYWA 1ARBA 4WMEA 4B71A 1S6FA 1TX6A 4GVUA 3RXMA 1P10A 1G3CA 1RTKA 4MPXA 9ESTA 3TGKE 2FXRA 1P2IA 2QF3A 4WJG2 1NZQH 1CVWH 3MH7A 2ASUB 2WPJS 1OS8A 1UTKA 3RXHA 3BG4B 2SGPE 1E0FD 1DT2A 1SGEE 4X6PA 4WF8A 3PO1C 1ZPCA 2J92A 2Z9LA 1DVAH 1FY4A 1V2JT 1KXBA 1ACBE 4KGAA 3N7OA 5AF9H 3RXFA 2Y7XA 1C4V2 1H9IE 1SOTA 1TFXA 3MNCA 4MLFB 4CRAA 1SLVB 1HPGA 5GCHF 1YCPH 2A5KA 4D9QA 2J95A 1O3DA 1G2LA 4F49A 2KAIA 2OC7A 1C2GA 1GJAB 5DP5A 2ZTXA 2H6MA 3ZZBA 3EA8A 3UIRA 3M37A 1EP5A 3UR6A 2XC4A 2BDBA 1TMUH 3GY4A 3A80A 5I46H 4GCHG 3SU4A 1TYNA 1DFPA 2GDDA 3VXFH 1HBTH 1A61H 1O2SA 3AASA 1ETTH 1CA8B 1HIAA 3SJ8A 1D9IA 1O31A 3UFAA 3RXRA 4AG2A 3SJOA 3ZVEA 2RA3A 3PLBA 1J16A 1GHYH 1P04A 1U6QA 2BZ6H 3GICB 4ABAA 1DPOA 2FOHA 1IQIA 4WMFA 2GDEH 4BANB 4B73A 2PHBA 1SVPA 3QO6A 2PR3A 7KMEH 1HJ9A 1V2OT 5DP7A 1PQ5A 3SV9A 1IQGA 3SJ9A 3GY7A 1ESAA 4ISOA 3CS7A 2F9UA 2W5EA 3M5NA 4ABHA 2UUYA 3UNQA 1BTPA 3PMJA 1GDNA 1UCYH 2R9PA 1SL3A 2A1DB 3U98H 3EGKH 1C5VA 2Z3EA 2C8WB 1BJUA 5T6DA 1TX7A 1W7XH 1D3PB 4X2WA 4X8TH 3SU0A 3M36A 3E6PH 1N1LA 1BRCE 1O2XA 1B0EA 3ZZCA 5A0CA 4JMYA 2WPLS 3QTVH 5FXLA 1Y3WA 1C2KA 1NFWA 1OXGA 3BTQE 3A7YA 1OYTH 1UTQA 4E7RG 1QFKH 3VB4A 1EATA 1ELEE 2UWOA 1FDPA 1C2HA 5L2YH 1TBQH 3MI4A 5T6GA 4NA7A 2XCFA 1T8MA 3VXEH 2R2WU 1LQEA 4ASHA 4CBNA 1GHWH 3CP7A 4FUHA 3SI3H 1IQMA 1F5LA 4Z6AH 5DP4A 3S7HB 1UK2A 1DWCH 1UCYE 2ZP0H 2F83A 2GV7A 3P95A 1YPLH 3VFEA 4DIHH 3SGBE 5EQRA 5LGOA 3ATMA 3BTDE 4CRFA 4I8LA 1EAXA 1ETRH 1E37B 3KEEA 5JBCS 1QY6A 4YOJA 1D4PB 1SGCA 4Y8XA 4CBOA 4J2YB 1HYLA 1P8VC 1YPJH 3GYLB 3UNSA 4SGAE 2D2DA 1UTMA 5DK1A 4MG3A 1CU1A 2PTNA 3LT3A 4I8JA 1HDTH 1Y3XA 2PGQB 4QT8C 1AD8H 1HGTH 2P16A 5T6FA 1SGRE 4IBLH 4JZIA 4IN2A 2Y6TA 3I78A 3TIUA 5K7RA 4INLA 5HGGA 2BLOA 3NKKA 4TWYA 2THFB 1GBBA 4WXIA 1K1OA 1W12U 1DXWA 3TH2H 2VIQA 3QX5H 3SV7A 1IQEA 1QNJA 3PWCA 1PPFE 3B23B 1NO9H 3FZZA 4ABDA 2CN0H 3EA9A 1EP6A 5FPTA 4IC6A 3EQ0H 8GCHF 1D3QB 5DJ7A 4WY3A 4DIIH 3SV2H 2HRVA 5EXMA 3Q3XA 3B9FH 4JYUH 4JZDH 1GJ5H 4JZFH 1W7GH 1GI6A 3NWUA 3S9BA 2BY8X 2QXJA 2Y82A 1GDUA 3ITIA 1A5IA 1O5DH 3SUGA 1CGJE 2JKHA 3RXJA 3E91A 1KXCA 1PQ8A 1BIOA 2FTLE 1NU7B 3ATWA 2PKSC 1DM4B 3ZZ6A 5G4BA 2A4GA 2CGAA 2A5IA 3DT0H 2Z9IA 4X2YA 1ELFA 4Y8ZA 5FAHA 5BRRE 1T8LA 4ZKNU 1YM0A 2G5VA 5FX5A 1PPZA 4X1NU 3TJNA 1GL1A 4RKJB 3OY6U 2AGIX 2OTVA 3VB6A 5E0JA 5HM2A 1HAZB 1TBRH 4JK5A 1TALA 1P9SA 2STAE 3ZVCA 2O9QA 1G3EA 1ESBA 5TCCA 4IMQA 3RU4E 1DDJA 2ZGCA 1S85A 1SGTA 3RXAA 4BAHB 2BX4A 3W95A 2B8OH 2ZHWH 2G4UA 2G51A 2JH6D 4UFFH 1DLKB 1UVTH 2BD2A 5C3NA 1O37A 2Y80A 2OBOA 1B0FA 2PFEA 1AKSB 1AB9C 3TNSA 4Q80A 1SGNE 2ZF0H 5TCAA 2YNBA 1H9LB 1GBCA 3PMBB 2VGCB 2XBXA 3DHKH 5CMXH 1JXPA 4JYTA 2ZDLA 1JBUH 5GJ4B 1D6WA 3SV6A 2TBSA 5AHGH 4ZUHA 1V2NT 1GBFA 2PWXA 4Y11E 1JRTA 1EPTB 2FYRA 2NU3E 1WTHD 4JYVH 5EW1H 1L1NA 2AGGX 3RXEA 1EJAA 3S0NA 3GYMA 1BOQA 1FAXA 1F0TA 1S83A 1V2WT 4RSPA 1EB2A 5BPEA 2V3HH 3LU9B 5LH8A 4K1SA 1P2QA 4WH6A 3ZVGA 2GZ7A 2A31A 1GI9B 2PSXA 1W0ZU 1BTHH 3TJOA 1SFIA 2FLBH 1GJCB 3H7OA 3ODDA 1Z8IB 3A8CA 3TH4H 4BAMB 3SU5A 2BQWB 3PMHB 1GBKA 1TGBA 1P2MA 1C5LH 4GLYA 1SGFA 1Z8RA 1LVMA 3A7VA 3SV8A 1F92A 2UWLA 1KSNA 1G3BA 1O38A 1BZXE 3PWBA 1WTGH 2K1QA 4JZEH 3MO9A 3V13A 1PPGE 2OUAA 1TMBH 1P3EA 4FXGH 5ESTE 4B74A 1IHSH 1FIWA 1LDTT 4CH2B 3UY9A 2H5CA 2A4RA 2CF9H 3UQVA 3M3SA 3MO6A 4YT7H 4X1RU 1EZQA 1KXDA 3TK9A 2BY5X 1GBAA 2VWMA 1JRSA 3D65E 3C27B 5L2ZH 2XCNA 2C4FH 3STIA 2C8ZB 4KP0A 1K21H 3GDVA 3AW1A 1MKWK 1XX9A 1FXYA 1VITF 2ZPRA 4E7NA 1YPGH 1CO7E 1XUFA 3PROA 4Q2KA 1QBNA 3SW2B 1Z1JA 3RXSA 2P95A 2Z9KA 1GGDC 1TNIA 4MPVA 1AZZA 3BTWE 1S6HA 1DICA 1HIAB 1MZAA 2ZDMA 2ZFQH 3F6UH 2V3OH 4AORA 4I32A 1O3HA 1SGFG 1TGTA 1HJAC 2C90B 5FPSA 8LPRA 1F0RA 1K9OE 3U69H 4AYYB 1XXDA 2B9LA 3A81A 1C2EA 1BJVA 1YYY1 4MTBA 1CGIE 2BLQA 1ZPBA 4DG4A 3U8OH 2ZTZA 1QJ1B 2BDAA 4HTCH 2QXIA 2EI8A 2ODQA 1PJPA 2ZCLP 2HVXA 1O3FA 3ZZ7A 4OS1A 3ESTA 5E2PA 1ELAA 1BB0B 4XBDA 4ABGA 4MNVA 3VGCB 1HXFH 1E34B 2XBWA 2QYIA 4Y7BA 4NIYA 2XTTB 2QAAA 4A5TS 1T4VH 4A1VA 1ZGIA 1TGNA 4YOGA 1LO6A 2WUBA 1NM6A 4CH8B 1Y5UT 2BZAA 4ABIA 2GVFA 2J4IA 1VITH 1K1MA 1C2JA 2PV9B 2GZ9A 4I33A 4UFEH 5E8EH 3BTFE 5GPIB 2HNTE 2TGAA 3A83A 3UWJH 4AB9A 3BV9B 3SGAE 1NRQH 1FPHH 4Y8YA 4X8SH 1W10U 2GCHG 3IWMA 4NA8A 1V2PT 2BVSH 2C8XB 1RIWC 1IOEA 2B5TB 3LIWA 3MU0A 3H5CB 2BD8A 1P2JA 3UR9A 4JCNA 2EI7A 2CJIA 1AO5A 3AVZA 1OOKB 3FVFB 1C5MD 1WOFA 1O3PB 5A8ZA 1WUNH 3BTEE 2C8YB 1FY5A 3M7TA 1AI8H 2ZHDA 1JMOH 2GCTC 4K8YA 1QRXA 2OP9A 5C2ZA 3DFJA 3K6YA 5JDUB 4K69A 4UONA 1MAXA 4UD9H 4KTUA 5JB8S 1QRWA 1TWXB 3TH3H 4A1XA 2BOHB 4D76A 5DG6A 1AMHA 3URCA 1CBWC 1MTNB 1AN1E 1Q3XA 3ZVAA 3RC6A 2ZECA 1LHFH 3SJIA 4NSYA 5EGMA 1PPBH 1O2QA 3S69A 1C5PA 1F5RA 1L2EA 1UVPA 4OS4A 1AKSA 4RKOB 5DP8A 1ELVA 4WH8A 4R0IA 5JBTA 4WVPE 2J34A 2F9NA 2FLRH 2ZDVH 3RXTA 3IG6B 1FAKH 2H5DA 3BG4C 4D9RA 3A89A 4GHTA 3NK8A 4BTIB 1EPTA 1Z6JH 4O3TA 4H42U 1KTTB 2WPKS 2OC0A 1Q31A 2FS9A 3KQEA 2SNVA 3F9GA 4AZ2B 1GWAA 4CRCA 1C1SA 4LOYH 2FOCA 7GCHG 1SGPE 5EXNA 1MQ6A 2NWNA 3S9CA 1O34A 3T62A 1KXAA 1BCUH 3SHCH 2CF8H 2ANWA 3PM3A 1D6RA 1GHZA 1UTNA 1HLTH 2HWLB 1TGSZ 5EPNA 2FPZA 3BTME 2C3SA 4K1TA 2I6QA 1LPKB 3PYHA 4MQAA 2P8OB 3LGYA 1P3CA 1O5FH 4OS5A 4Z0KA 1V2TT 1C1TA 3TGJE 1MZDA 2ZHQH 1UK3A 2G55A 3A88A 1YLDA 1NY22 1SGQE 3LGIA 4UFGH 3UPEA 1UTOA 1OP2A 1GBLA 3NPSA 4MVNA 5HXFA 1A0HB 1PYTC 2PW8H 2ALVA 4WMDA 4I31A 1CHOG 1DS2E 1BTYA 3ATKA 2BLVA 1LVOA 5FBEA 4XDEA 1DUEA 1DXPA 2J94A 1QB9A 3AAUA 2VB0A 3HPTB 5CE1A 3SU1A 4FUEA 1C4U2 4PROA 1P06A 2GT8A 1N6YA 2FOFA 1C1MA 4KKDA 3V0XA 4ZHAA 3ZYEA 3K2UA 1GBJA 4FUDA 1HV7A 1V2ST 4IN1A 1ZTLA 3SNAA 1KLIH 1MUEB 4HI3A 3ZV8A 4YTAA 1TE0A 3QZQA 1G9IE 2A5AA 2M5TA 2ESTE 3ZVBA 1KYNA 1D3TB 1JIMA 3UREA 2OBQA 2IN2A 1ABIH 1P57B 1RS0A 4AGKA 4U32A 1SG8B 2OQ5A 4OGYA 1ZHPA 2Q6DA 5EPYA 1YCPK 4MPUA 2ZHFH 2WINI 4MNYA 6GCHG 1TPAE 1L4DA 3GCHB 4NCYA 1TGCA 4BNRA 4VGCB 2BXUH 1OWJA 1YBWA 4GHQA 2GZ8A 3GCTG 5F8TA 3AAVA 1KY9A 5A2MH 2ZDAH 1P2NA 1L0ZA 4ZKSU 2HALA 3QN7A 3UOUA 2ZA5A 3SU3A 2BB4A 2SFAA 2ZZUH 3LOXA 3SNDA 2JETC 2SNWA 4YT6H 2DE9A 4XE4A 1ZPZA 1ZZZA 1Z8JB 3PB1E 5GDSH 4ZHLU 3ZZAA 3Q76A 4ABJA 1T32A 1GMHF 3A8BA 1RTFB 1MTWA 2FS8A 5C67A 1H8DH 4AOQA 1NN6A 1RJXB 1ELBA 5A0BA 3FAOA 4D8NA 1O35A 4U2WA 1NRPH 2D8WA 4X1PU 2ZQ2A 2OC8A 1GHAG 5JYIA 1GCTC 1C1PA 3D49H 1TABE 3SZNA 3ZVDA 1CT2E 1W2KH 4AFSA 5FCKA 2W3KA 3RXPA 1DITH 2ZDNA 1GJDB 1LHDH 2GTBA 5A09A 3G01A 3B8JA 3KL6A 5E2OA 1QCPA 1WSSH 4HZHA 1CA0B 1HAIH 2BM2A 1UCYK 1OWKA 5CHAC 2FOAA 2FYQA 3VEQB 3C1KA 4XBCA 3P8NA 5L6NH 4B2CA 1DY8A 1QA0A 1NRNH 4J1YA 3MNXA 3BG8A 1WAYB 3QK1A 4UEHH 4Y0YE 3LJOA 2HNTC 2GMTC 1O3IA 2XWBI 1OWDA 2FIRH 1SQAA 7LPRA 4X6MA 4ESTE 2FESH 1ZSKA 1TNGA 1HAXB 1O32A 3GCOA 5J4SA 3MU4A 4F4OC 2AFQB 2BQ6B 1MAYA 2UWPA 1XMNB 5EG4A 4ISIH 1M9UA 1AQ7A 2GX4A 1MD7A 3SI4H 1BTWA 3E1XB 3QLPH 2NU0E 4NFEA 4FUIA 1V6DA 5GCHG 1C5ZB 1OWIA 4I8GA 1C5NH 1C5YB 1AUTC 1FJSA 1YP9A 5HYOA 2CHAB 1AWHB 2FMJA 1RRKA 3RXGA 2FI4E 2FDAA 2ZU2A 1EZSC 1O3LA 3HK6B 4ISNA 1YPHC 1YF4A 4H6TA 2ZU4A 4DY7B 4INHA 5C5NA 5DO4H 1C2IA 2OC1A 2XBYA 1OWEA 3PMAB 1V2RT 5C20A 1O2NA 1QURH 4NGAH 5ETXA 1C9PA 4YESB 3SNEA 1AY6H 1C2FA 1S82A 2ZEBA 3P70B 5HMAA 1G30B 4FVDA 4IMZA 3LPRA 5GXPA 1KDQB 3UQOA 1ZSJA 1CSOE 1SI5H 3BTHE 1ZJKA 2O8MA 1WQSA 1YCPM 3IITA 1MTUA 2HGTH 4AFQA 4K8BA 1YKTA 4O03A 1ABJH 2A7CA 2ZFSA 1O2VA 3MFJA 3BIUH 3SQEE 1AFQB 1QB6A 2A45B 3KHVA 1BDAA 4HGCA 3M5LA 2TGDA 3M7QA 4THNH 3V3MA 1GPZA 3ZZ3A 4D7GA 2PTCE 1BITA 1AE5A 1LPZB 2EA3A 4IS5A 3E90B 4CHAB 5HM9A 3P8GA 3RXQA 1GMCF 1WU1A 1Z6EA 3ENSB 3MU1A 4FUGA 2H1UA 3PTBA 3RM2H 1XUKA 5T3HA 2ZFPH 1EQ9A 1PFXC 3A86A 2ZFTA 1SBWA 6ESTA 4U30A 2A0QB 2VGCC 3MOCA 3D62A 1EUFA 2JH5D 2EEKA 1SB1H 2SGEE 4Q7ZA 1GHXH 4DJZB 4TYDA 5JB9S 1DSUA 3RMOH 3E3TA 5FCRA 2J2UA 1C1QA 1RD3B 4GUXA 2PUXB 4XSKU 3MH6A 3WY8A 2NU4E 1HB0B 1KLJH 3GY6A 1SMFE 2NU2E 2WPHS 1DLEA 3HK3B 2Q6FA 3MWIU 1XUJA 1DX5M 4X2VA 1GMDF 1O3EA 3BTTE 3I29A 3SUDA 1TA6A 1Z8GA 1BUIA 3TU7H 4E06H 3S7KB 4MNWA 2ANMH 2BD5A 1A5GH 1G3DA 3SUEA 4GAWA 1AVGH 2OINA 1QQ4A 1SC8U 3KQCA 1BRUP 2TIOA 4FUBA 2LPRA 1HAGE 4TPIZ 3A84A 2A7JA 5H4IB 4FU7A 3RC4A 5EU8A 1LQDB 3I77A 3U1IB 1GJ9B 2G81E 3FANA 4NIXA 1FN8A 2ALPA 1FI8A 5GWZA 3RLWH 1YC0A 1GCDA 5TJXA 2TGPZ 2TRMA 3DA9B 2SGQE 1GBIA 1RTLA 4I8KA 1BMNH 1S84A 5F03A 1O2MA 3OSYA 1K22H 1MTSA 3ZZ9A 2J38A 3HGPA 2VNTA 2FOGA 1EZUC 1OP0A 3QWCH 1HRTH 1O2LA 2ZKSA 1EAUA 1TNJA 4IGDA 5FBIA 4YO9A 4I8HA 1BBRH 3RDZA 1IHTH 1P02A 2C93B 2P94A 1BHXB 2F91A 1ZRBA 3L6PA 8ESTE 1XVMA 2BY6X 1T7CA 2HNTF 3GY8A 3L33A 1NU9A 1TAWA 3V12A 1SGIB 3ZV9A 1SSXA 3TK5A 1GBDA 4OS7A 4CR9A 1T31A 1UVSH 5LPRA 5E0GA 3DUXH 3KQDA 1O2IA 8GCHG 1UVOA 4ABFA 1S0RA 2FEQH 1UTJA 3QUMP 3RXCA 1TLDA 1D3DB 2ILNA 1O5BB 4D7FA 1OPHB 4BAKB 1T4UH 3RXDA 3F68H 5A8YA 2F3CE 2OCVB 1N8OB 4K1EA 4A7IB 2QGRA 3UWIA 5DP9A 3A82A 2F9VA 4XOJA 3GY3A 4FU9A 3S9AA 2G52A 2R0KA 1QJ6B 1BBRE 1DUAA 4B2BA 1FZZA 3QGNB 1GHBF 2VU8E 1RFNA 1P03A 5DKMA 5EQSA 5A0AE 4A1TA 1MU6B 3GY5A 4Q7XA 2G8TA 4AX9H 2Y5FA 1ANCA 2PKAA 1SLUB 1YPMH 1Z1IA 1SFQB 3V7TA 2P59A 1B5GH 1G36A 3BEIB 2OD3B 2VH6A 1HAOH 2Z9JA 1FY1A 2VVCA 3LGVA 3U8RH 1O2WA 2AERH 2Z7FE 1O3KA 1LPGB 1K28D 1TQ7B 3BTKE 1F5KU 3SNCA 1BT7A 2ZPSA 2Z6BD 1P9UA 2A2XH 4NWLA 1B7XB 3O8RA 2R3UA 2VIOA 3E16B 4CRBA 4FVBA 1IAUA 1XM1A 1EASA 1AIXH 4A6LA 5FPYA 1ZSLA 3T28A 1SPJA 2DUCA 3FP7E 1ELTA 4CRDA 4Y10E 4BTTB 1QA7A 2PGBB 2GT7A 3OU0A 1OX1A 1O2UA 2FZZA 2ANKH 6CHAB 3SBKA 3MNSA 1KDQA 2WYGA 1VR1H 1H8IH 1UHBB 2XBVA 1WQVH 1XUHA 2SGFE 3RMLH 2G00A 3K6ZA 4BXWA 1LVYA 2PUQH 2ZGHA 2ZG0H 3M61U 1C4Y2 2BLWA 1Y3UA 1J15A 4OS2A 1K1PA 1GI0A 4AG1A 2ZHEH 1EKBB 3GOVB 4X2XA 4RN6A 2ZU1A 1ARCA 3DD2H 1S0QA 3CENA 5C1XA 5DPAA 1XKBC 2ZFRH 1THSH 1TNHA 1PQ7A 1VGCB 1OSSA 3UOPA 4TY7A 1AVWA 3A7TA 9LPRA 1FY3A 3AW0A 4GCHF 1UTLM 4LZ4B 1BRAA 2Y81A 1NRSH 2QY0B 1HCGA 1GI7B 2OQUA 2FI5E 1O2TA 1UMAH 1BHXF 1A0LA 1G2MA 3RU4T 4GSOA 3RP2A 4BAQB 1GG6B 1CT0E 1PPHE 3TJVA 3MNBA 3STJA 3BIVH 3P6ZB 2QA9E 2H2ZA 3K65B 3BEUA 1MU8B 1UJ1A 3VB5A 1OP8A 1XUIA 1PQAA 2Q1JA 1O3AA 4OGXA 1O3MA 2FX6A 2BY9X 1MQ5A 1TIOA 1THRH 2W26A 1G32B 4NIVA 2WV4A 2A4OA 1RXPA 2P3FH 3QGJA 3VPKA 2VVVA 4O97A 1MKXH 2CXVA 1O2RA 3MTYA 1GI1A 1N6XA 4M7GA 2PLXA 2W3IA 4ZKOU 3GDSA 3KCGH 1ZMJA 1GDQA 1AUJA 1ESTA 1EXFA 1C1NA 2P8OC 1O30A 3LGTA 1HAPH 1T8NA 1Y3YA 3SHAH 4IC5A 4K3JA 3MH4A 2HPPH 1WBGB 3PLKA 1XKAC 3SUFA 7ESTE 1DOJA 2AIPA 2XWAA 2OLGA 1CHGA 3D23A 3E8LA 4YM9A 4ZMAH 4Y76A 1QR3E 3LC3A 4AGJA 2F9OA 3MMGA 2GP9B 4NWKA 1V2QT 1C2MA 1G37A 1Y3VA 1KTSB 1ZTKA 3QDZB 1AFEH 2FWWA 3TK6A 3K9XB 2BMGB 4I7YH 1SLWB 1ANBA 1DSTA 1TRMA 1WYKA 1O2GH 5C1UA 3SN8A 2O8TA 3M7UA 4X1QU 1FY8E 1FONA 1Y5AT 1QTFA 5F8XA 1NRRH 3RXUA 2CMYA 1Y59T 4MNXA 1QBOA 1ELDE 3KNXA 2BDGA 1IQJA 2ZU3A 3FFGA 1VCPA 1A0JA 3NZIA 1TBZH 1NS3A 1A3EH 3NCLA 2PSYA 3M3VA 2TPIZ 2IPHA 2QF0A 3ZVFA 3O8BA 1UTPA 5DGJA 2R2MB 1GBTA 1BMAA 2VIDA 2UUJB 2VVUA 1QHRB 1LVBA 1ZMNA 1MMJN 6LPRA 1P11E 3T29A 2XRCA 5IYTA 1TA2A 2FTMA 4GPGA 5E0HA 4YOIA 1ZLRA 2BX3A 2VH0A 2R0LA 1V3XA 1W13U 1WV7H 1F0SA 3RXIA 3GCHC 1F7ZA 2QIQA 1F0UA 2V0BA 3EA7A 2O8UA 4VGCC 4ZH8A 3A7WA 1IQLA 4O9VA 1LMWB 4B1TA 5JBAS 2B0FA 4ZXYH 1VJ9U 1IQHA 3RLYH 5JPMH 3PV4A 1KLTA 2ZDKA 4JZ1A 4LK4A 1GVKB 2CV3A 2GD4B 3KN2A 1EAWA 1GHVH 1JOUB 1K1LA 2XC5A 4H4FA 4ZXXH 1ORFA 1YGCH 2RCEA 1VZQH 3PO1B 1A7SA 1SHHB 1C5XB 2A7HA 2XW9A 4KTCA 3GY2A 3URDA 1EJNA 1HFDA 4Y0ZE 2WPIS 3L3TA 1J17T 2BD7A 3O8CA 1SHYA 3EDXB 4O3UA 3TGIE 3ATIA 1A46H 1V2UT 5LPFA 1BTZA 3ZZDA 4KTSA 4TPYA 3H7TA 2ANYA 1OWHA 1HNEE 1Z71A 1K2I1 1CA0C 2Y7ZA 1TOMH 1DE7H 3TVJB 1UHBA 1C5OH 1O5CB 1C1RA 1IQKA 2IJOB 1Y5BT 1OKXA 1FQ3A 4AFUA 4NIWA 1FUJA 2BDCA 4ABEA 1DWBH 1IQNA 1XXFA 4OS6A 4NZQA 2ULLA 1Z7KA 4E05H 1DY9A 1LKAA 4INKA 3Q3KA 4B2AA 3M3TA 5AFYH 3FZDA 1C1UH 1DWEH 1QGFA 4X1SU 5ESBA 2ZGBH 2Q6GA 1W14U 4LXBH 5I25A 2ZCHP 1ZYOA 1J14A 1HAYB 1TPOA 2CHAC 1TRNA 2IOTA 3EAJA 3HKIB 1ZTJA 3TLOA 4B75A 1O5AB 1A4WH 2JETB 2A4QA 5LPEA 2EC9H 3A7ZA 4BOHA 1ELCA 1BA8B 1FPCH 2H9TH 2J9NA 2P3TB 1EB1H 3JZ1B 3PTNA 1BMLA 4U01A 3UTUH 1MH0A 2F9PA 2PKAB 3KGPA 1OYQA 1P0SH 1QL8A 1EAIA 3ZZ5A 1O33A 3RMNH 2D1JA 1GI8B 1AWFH 3PLPA 1TNLA 1C1VH 1TPPA 2QV1A 3KQBA 1J8AA 1A3BH 3MH5A 1C1OA 1ZOMA 1FMGA 3FP8E 3A8AA 1GCTB 1ZMLA 2QXGA 1S81A 1SOZA 3MU8A 2FODA 1KXFA 1AFQC 1PPCE 3TNTA 1C5RA 1J9CH 1TONA 1V2KT 4FUCA 1NPMA 3NUMA 1UVUH 2YOLA 3Q00A 4ZROA 2BVRH 1TQ0B 5CHAB 3OY5U 3P17H 1FN6A 1BMMH 1O2PA 4CHAC 2GKVE 2VIPA 1SQOA 4FUFA 1AZ8A 1LHCH 2BY7X 1KIGH 2BXTH 3RXOA 1EJMA 1NFUA 4IW4E 3NXPA 2GMTB 3SGQE 1GJ4H 4DW2U 2Y5HA 2BYAX 4B76A 2ZFFH 5EXLA 1P2KA 1ELGA 2ZWLH 4ZAEA 3SQHE 1W3CA 1MTVA 1VCWA 2V35A 4X0WU 1P2OA 1C2DA 1VCQA 3EYDA 1V2LT 3LKWA 4FU8A 1SGDE 3GCNA 4YLQH 5C5OA 3T27A 3SNBA 1GBEA 1HAHH 1GJ6A 2AMPA 2F9BH 1GJBB 2G4TA 3LJJA 1O2OA 3ODFA 5B6OA 5AFZH 5JBBS 1QL7A 1AE8H 2VJ1A 3Q3YA 4K2YA 1C5TA 1XVOA 1P05A 3P92A 2SGDE 2QC2A 2LNCA 1GI3A 1QL9A 3P8OA 3U1JB 1CQQA 1QB1A 3LC5A 3U8TH 3QZRA 1GMHG 3ZZ8A 2YNAA 4AFZA 4DVAU 1EPTC 2P3UB 3SOSA 2AMDA 2UUFB 3ELAH 1O3BA 8KME2 2BVXH 3T2NA 1F2SE 2O8WA 2ZI2H 1C1WH 3MO3A 2UUKB 2JH0D 1SGYE 2A32A 2FOEA 2STBE 2AMQA 4K60A 5SGAE 5EOKA 5K0HA 3A85A 3LONA 4DGJA 3R0FA 2PKSB 1O0DH 3W94A 5DP6A 3RUOA 2QN5T
chains in the Genus database with same CATH superfamily
4JK6A 1KXEA 4X6OA 2HPQH 3LGUA 1ZHRA 1MCTA 3O8DA 3F1SB 1EZXC 1H8HD 1JWTA 3F9EA 2QCYA 4UE7H 2KX4A 4NG9H 2FOMB 2TGTA 3T26A 2BD4A 1GL0E 1ETSH 1O2JA 4K5ZA 1O2YA 2ZQ1A 1ANEA 4UFDH 1PPEE 1NTPA 3FP6E 3GISB 3CS0A 1SQTA 1V2MT 4ISHH 4TY6A 5EJLA 1O3NA 3OYPA 4MPWA 2A2QH 2BD3A 1GVZA 3BN9A 3OX7U 4SGBE 2ZO3H 1FNIA 1N8OC 2GGVB 1SKYE 2GCHF 4F55A 3TPIZ 4Q63A 4A92A 1UK4A 2WZQA 3PV2A 1HAVB 4Y6DA 4X6NA 1LKBA 1CE5A 2V6NA 1HXEH 1K1IA 2FM2A 1P01A 2L74A 2EQNA 1AB9B 1MKWH 5F53A 5A8XA 1TNKA 3SU2A 1GJ8B 1DWDH 1GJ7B 3E0PB 3A87A 1EX3A 3MU5A 1TRYA 2SGAA 1ZHMA 4ABBA 4CREA 1TX8A 1C5QA 2WYJA 4FUJA 3GDUA 4H6SB 2ODPA 1C9TA 3RXLA 3QTOH 2AS9A 5GIBA 4MDSA 2LELA 1L4ZA 1WCZA 4UDWH 2ODYB 3Q77A 3SJKA 2JDID 1AGJA 4XBBA 5EIYA 4NSVA 4HFPB 3VG8A 1YLCA 1BBRK 1P09A 2W7SA 1H9HE 1K1NA 4X8UH 2FOBA 1YPEH 2BDYA 3RC5A 1H4WA 2VINA 2KAIB 3KF2A 1GI4A 3SO3A 3VGCC 3RM0H 4DURA 2WV5A 2B7DH 5F6MA 5EODA 3U9AH 1UO6A 1TPSA 1A1RA 1MBMA 1GI2A 1SR5C 3M5MA 2RFKC 1FIZA 1V2VT 4DOQA 2H9HA 1O3GA 4NFFA 6CHAC 1GMCG 3ZZ4A 1Q2WA 2VWNA 4AYVB 1S5SA 5J4QA 2ZPQA 1INCA 2AEIH 2Z9GA 2Y5GA 2R3YA 1NFXA 2ZU5A 3U28C 4BTUB 1WDIA 2BD9A 7GCHF 3OTJE 5AVDA 1QJ7B 1E36B 2ZIQH 2W6ID 2H9EH 3A8DA 4XFQA 3ATLA 4Y79A 3RU4D 2D26C 1IQFA 2WUCA 5DP3A 4R8TB 2G5NA 1YPKH 1VGCC 2P93A 1QIXB 3M35A 1EOJA 2BDHA 1GBHA 4AB8A 4AN7A 3UUZA 1O3OA 1GMDG 2Z94A 3TJUA 2Z3CA 1MBQA 1LTOA 1QRZA 3MYWA 1ZR0A 1VJAU 5FX6A 3LDXH 1GGDB 1AU8A 1C5SA 1BTUA 1GG6C 1EOLA 3T25A 1W8BH 3VB7A 3DFLA 2VIWA 1JIRA 3R3GB 2Z3DA 1BRBE 1CHOF 3HATH 1CGHA 1LHGH 1HJAB 4NZLA 2EI6A 2XXLA 5C1YA 1GI5A 2I6SA 1MTNC 4WXVA 1QQUA 1O3CA 3ZYDA 3KIDU 2FX4A 3BEFB 1FLEE 3A7XA 1FV9A 3EE0B 3VB3A 4Y7AA 3RXKA 1O5EH 2JJ2D 3PRBA 1NC6A 2VWLA 1NROH 4ISLA 3BSQA 1PYTD 4X8VH 5PTPA 2RA0A 3T5FH 2AGEX 1X7AC 1MCVA 4BAOB 2ZCKP 1NFYA 2QXHA 2ZGJA 1GBMA 3RMMH 3RXBA 1O2KA 2VWOA 1TMTH 3HKJB 1TB6H 1L1GA 4TWWA 3BF6H 4Y71A 5F8ZA 1LHEH 3HGNA 1C5UA 1C2LA 3F0PA 2ZTYA 1TOCB 5T1VA 4LZ1H 2BHGA 4ASUD 1O2HA 1O2ZA 1W0YH 2RG3A 2DE8A 5DN6D 5ABWA 5EW2H 6GCHF 1NESE 2ZNKH 3LH1A 3P8FA 1MD8A 3MHWU 5EQQA 2OK5A 2O8LA 1LCYA 1K1JA 1SLXB 2HOBA 1THPB 3E0NB 3JZ2B 5IDKA 2NU1E 3GCTF 1DANH 1YPHE 1BTXA 2GV6A 2XYAA 4P00A 2OXSA 4AC9A 3F9FA 1Y8TA 2XNDD 1W11U 2WPMS 2XNIA 3F9HA 4TT3D 2VIVA 1T8OA 4ZKRU 1O36A 3LGWA 2BOKA 2AIQA 4YZUA 4BXSA 3SORA 1HJ8A 2W7UA 5FHTA 1YWUA 1A2CH 1KMHB 1RIWB 4DCDA 1RGQA 3M5OA 3SU6A 4DT7B 1VITG 1C5WB 1ZGVA 4CRGA 1P12E 2FI3E 3LH3A 1GHBG 5L30H 1AVXA 2ZC9H 1BQYA 3TITA 4Q7YA 1AHTH 1W0JD 1ZJDA 2BTCE 1GHAF 2BDIA 1QBVH 1XUGA 2GCTB 1HUTH 1ID5H 2HLCA 1O5GH 4KELA 2XC0A 2FO9A 2BQ7B 2AH4X 3UNRA 1O3JA 1O39A 1CT4E 1NT1A 3RXVA 1CBWB 1MKXK 4YLUA 1H1BA 1ZRKA 1L1JA 4WWYA 1E35B 3BTGE 4NA9H 1ANDA 1HAVA 2RDLA 1A5HA 2ZGXH 1E38B 1GVLA 4CR5A 5C17A 4ZHMU 2FP7B 2AYWA 1ARBA 4WMEA 4B71A 1S6FA 3DSGA 1TX6A 4GVUA 3RXMA 1P10A 1G3CA 1RTKA 4MPXA 9ESTA 3W1EA 3TGKE 4B6FA 2FXRA 1P2IA 2QF3A 4WJG2 1NZQH 1CVWH 3MH7A 2ASUB 2WPJS 1OS8A 1UTKA 3RXHA 3BG4B 2SGPE 1E0FD 1DT2A 1SGEE 4X6PA 4WF8A 3PO1C 1ZPCA 2J92A 2Z9LA 1DVAH 1FY4A 1V2JT 1KXBA 1ACBE 4KGAA 3N7OA 5AF9H 3RXFA 2Y7XA 1C4V2 1H9IE 1SOTA 1TFXA 3MNCA 4MLFB 4CRAA 4FOUC 1SLVB 1HPGA 5GCHF 1YCPH 2A5KA 4D9QA 2J95A 1O3DA 1G2LA 4F49A 2KAIA 2OC7A 1C2GA 1GJAB 5DP5A 2ZTXA 2H6MA 3ZZBA 3EA8A 3UIRA 3M37A 1EP5A 3UR6A 4RT0A 2XC4A 2BDBA 1TMUH 3GY4A 3A80A 5I46H 4GCHG 3SU4A 1TYNA 1DFPA 2GDDA 3VXFH 4TSFD 1HBTH 1A61H 1O2SA 3AASA 1ETTH 1CA8B 1HIAA 3SJ8A 1D9IA 1O31A 3UFAA 3RXRA 4AG2A 3SJOA 3ZVEA 2RA3A 3PLBA 1J16A 1GHYH 1P04A 1U6QA 2BZ6H 3GICB 4ABAA 1DPOA 2FOHA 1IQIA 4WMFA 2GDEH 4BANB 2RDEA 4B73A 2PHBA 1SVPA 3QO6A 2PR3A 7KMEH 1HJ9A 1V2OT 5DP7A 1PQ5A 3SV9A 1IQGA 3SJ9A 3GY7A 1ESAA 4ISOA 3CS7A 2F9UA 2W5EA 3M5NA 4ABHA 2UUYA 3UNQA 3EE7A 1BTPA 3PMJA 1GDNA 1UCYH 2R9PA 1SL3A 2A1DB 3U98H 3EGKH 1C5VA 2Z3EA 2C8WB 1BJUA 5T6DA 1TX7A 1W7XH 1D3PB 4X2WA 4X8TH 3SU0A 3M36A 3E6PH 1N1LA 1BRCE 1O2XA 1B0EA 5CDFE 3ZZCA 5A0CA 4JMYA 3SZEA 2WPLS 3QTVH 5FXLA 1Y3WA 1C2KA 1NFWA 1OXGA 3BTQE 3A7YA 1OYTH 1UTQA 4ZCNA 4E7RG 1MABB 1QFKH 3VB4A 1EATA 1ELEE 2UWOA 4HG6A 1FDPA 1C2HA 5L2YH 1TBQH 3MI4A 5T6GA 4NA7A 2XCFA 1T8MA 3VXEH 2R2WU 1LQEA 4ASHA 4CBNA 1GHWH 3CP7A 4FUHA 3SI3H 1IQMA 1F5LA 4Z6AH 5DP4A 3S7HB 1UK2A 4YXWD 1DWCH 1UCYE 2ZP0H 5GNDA 2F83A 2GV7A 3P95A 1YPLH 3VFEA 4DIHH 3SGBE 5EQRA 5LGOA 3ATMA 3BTDE 4CRFA 4I8LA 1EAXA 1ETRH 1E37B 3KEEA 5JBCS 1QY6A 4YOJA 1D4PB 1SGCA 4Y8XA 4CBOA 4J2YB 1HYLA 1P8VC 1YPJH 3GYLB 3UNSA 4SGAE 2D2DA 1UTMA 5DK1A 4MG3A 1CU1A 5C94A 2PTNA 3LT3A 4I8JA 1HDTH 1Y3XA 2PGQB 3F2HA 4QT8C 1AD8H 1HGTH 2P16A 2JJ1D 5T6FA 1SGRE 4IBLH 4JZIA 2J5UA 4IN2A 2Y6TA 3I78A 3TIUA 5K7RA 4INLA 5HGGA 2BLOA 3NKKA 4TWYA 2THFB 1GBBA 4WXIA 1K1OA 1W12U 1DXWA 3TH2H 2VIQA 3QX5H 3SV7A 1IQEA 1QNJA 3PWCA 1PPFE 3B23B 1NO9H 3FZZA 4ABDA 2CN0H 3EA9A 1EP6A 2IPQX 5FPTA 4IC6A 3EQ0H 8GCHF 1D3QB 5DJ7A 4WY3A 4DIIH 3SV2H 2HRVA 5EXMA 3Q3XA 3B9FH 4JYUH 4JZDH 1GJ5H 4JZFH 1W7GH 1GI6A 3NWUA 3UAIC 3S9BA 2BY8X 2QXJA 2Y82A 3WWBA 1GDUA 3ITIA 1A5IA 1O5DH 3SUGA 1CGJE 2JKHA 3RXJA 3E91A 1KXCA 1PQ8A 1BIOA 2FTLE 1NU7B 3ATWA 2PKSC 4RT1A 1FX0B 1DM4B 4ACAA 1NBME 3ZZ6A 5G4BA 2A4GA 2CGAA 2A5IA 3OEHD 3DT0H 2Z9IA 4X2YA 1ELFA 4Y8ZA 5FAHA 5BRRE 2V7QD 1T8LA 4ZKNU 1YM0A 2G5VA 5FX5A 1PPZA 4X1NU 3TJNA 1GL1A 4RKJB 3OY6U 2AGIX 2OTVA 3VB6A 5E0JA 5HM2A 1HAZB 1TBRH 4JK5A 1TALA 1P9SA 2STAE 3ZVCA 2O9QA 1G3EA 1ESBA 3N7EA 5TCCA 4IMQA 3RU4E 1DDJA 2ZGCA 1S85A 1SGTA 3RXAA 4BAHB 2BX4A 3W95A 2B8OH 2ZHWH 2G4UA 2G51A 2IJD1 2JH6D 4UFFH 1DLKB 1UVTH 2BD2A 5C3NA 1O37A 2Y80A 3UB0A 2OBOA 1B0FA 2PFEA 1AKSB 1AB9C 3TNSA 4Q80A 1SGNE 2ZF0H 2AHME 2YNBA 1H9LB 5TCAA 1GBCA 3PMBB 2VGCB 2XBXA 3DHKH 5CMXH 1JXPA 4JYTA 2ZDLA 1JBUH 5GJ4B 1D6WA 3SV6A 2TBSA 5AHGH 4ZUHA 1V2NT 1GBFA 2PWXA 4Y11E 1JRTA 1EPTB 2FYRA 2NU3E 1WTHD 4JYVH 5EW1H 1L1NA 2AGGX 3RXEA 1EJAA 3S0NA 3GYMA 1BOQA 1FAXA 1F0TA 1S83A 1V2WT 4RSPA 1EB2A 5BPEA 2V3HH 3LU9B 5LH8A 4K1SA 1P2QA 4WH6A 1COWD 3ZVGA 2GZ7A 2A31A 1GI9B 2PSXA 1W0ZU 1BTHH 3TJOA 1SFIA 2FLBH 1GJCB 3H7OA 3ODDA 1Z8IB 3A8CA 3TH4H 4BAMB 3SU5A 2BQWB 3PMHB 1GBKA 1TGBA 1P2MA 1C5LH 4GLYA 1SGFA 1Z8RA 1LVMA 3A7VA 3SV8A 1F92A 2UWLA 2W6JD 1KSNA 1G3BA 1O38A 1BZXE 3PWBA 1WTGH 2K1QA 4JZEH 3MO9A 3V13A 1PPGE 2OUAA 1TMBH 1P3EA 4FXGH 5ESTE 4B74A 1IHSH 1FIWA 1LDTT 4CH2B 3UY9A 2H5CA 2A4RA 2CF9H 3UQVA 3M3SA 3MO6A 4YT7H 4X1RU 1EZQA 1KXDA 3TK9A 2BY5X 1NBMD 1GBAA 2VWMA 1JRSA 3D65E 3C27B 5L2ZH 2XCNA 2C4FH 3STIA 2C8ZB 4KP0A 1K21H 3GDVA 3AW1A 1MKWK 1XX9A 2F4LA 1FXYA 1VITF 2ZPRA 4E7NA 1YPGH 1CO7E 1XUFA 3PROA 4Q2KA 1QBNA 3SW2B 1Z1JA 3RXSA 2P95A 2Z9KA 1GGDC 1TNIA 4MPVA 1AZZA 3BTWE 1S6HA 1DICA 1HIAB 1MZAA 2ZDMA 2ZFQH 3F6UH 4M9FA 2V3OH 2YMSC 4AORA 4I32A 1O3HA 1SGFG 1SQRA 1TGTA 1HJAC 2C90B 5FPSA 8LPRA 1F0RA 1K9OE 3U69H 4AYYB 1XXDA 2B9LA 3A81A 1C2EA 1BJVA 1YYY1 4MTBA 1CGIE 2BLQA 1ZPBA 4DG4A 3U8OH 2ZTZA 1QJ1B 2BDAA 4HTCH 2QXIA 2EI8A 1PJPA 2ODQA 5CHBA 2ZCLP 2HVXA 1O3FA 3ZZ7A 4OS1A 3ESTA 5E2PA 1ELAA 1BB0B 4XBDA 4ABGA 4MNVA 3KQ5A 3VGCB 1HXFH 1E34B 2XBWA 2QYIA 4Y7BA 4NIYA 1YLNA 2XTTB 2QAAA 4A5TS 1T4VH 3FN8A 4A1VA 1ZGIA 1TGNA 4YOGA 1LO6A 2WUBA 1NM6A 4CH8B 1Y5UT 2BZAA 4ABIA 2GVFA 2J4IA 1VITH 1K1MA 2M2AA 1C2JA 2PV9B 2GZ9A 4I33A 4UFEH 5E8EH 3BTFE 5GPIB 2HNTE 2TGAA 3A83A 3UWJH 4AB9A 3BV9B 3SGAE 1NRQH 1FPHH 4Y8YA 4X8SH 1W10U 2GCHG 3IWMA 4NA8A 1V2PT 2BVSH 4P02A 1E1QD 1EFRD 2C8XB 1RIWC 2VBCA 1IOEA 2B5TB 2KFWA 3LIWA 3MU0A 5KEDA 3H5CB 2BD8A 1P2JA 3UR9A 4JCNA 2EI7A 2CJIA 1AO5A 3AVZA 1OOKB 3FVFB 1C5MD 1WOFA 4FETA 1O3PB 5A8ZA 1WUNH 3BTEE 2C8YB 1FY5A 3M7TA 1AI8H 2ZHDA 1JMOH 2GCTC 4K8YA 1QRXA 2OP9A 5C2ZA 3DFJA 3K6YA 5JDUB 4K69A 4UONA 1MAXA 4UD9H 4KTUA 5JB8S 1QRWA 1TWXB 3TH3H 4A1XA 2BOHB 4D76A 5DG6A 1AMHA 3URCA 1CBWC 1MTNB 5C0TA 1AN1E 1Q3XA 3ZVAA 3RC6A 2ZECA 1LHFH 3SJIA 1VKYA 4NSYA 2J97A 5EGMA 1PPBH 1E79D 1O2QA 3S69A 1C5PA 1F5RA 1L2EA 1UVPA 4OS4A 1AKSA 4RKOB 5DP8A 1ELVA 1QZ8A 4WH8A 4R0IA 5JBTA 4WVPE 2J34A 2F9NA 2FLRH 2ZDVH 3RXTA 3IG6B 1FAKH 2H5DA 3BG4C 4D9RA 3A89A 2XOKD 4GHTA 3NK8A 4BTIB 3OFND 1EPTA 1Z6JH 4O3TA 4H42U 1KTTB 2WPKS 4I86A 1Q31A 2FS9A 2OC0A 3KQEA 2SNVA 3F9GA 4AZ2B 1GWAA 4CRCA 1C1SA 4LOYH 2FOCA 7GCHG 1SGPE 5EXNA 1MQ6A 2NWNA 3S9CA 1O34A 3T62A 1KXAA 1BCUH 3SHCH 2CF8H 2ANWA 3PM3A 1D6RA 1GHZA 1UTNA 1HLTH 2HWLB 1TGSZ 5EPNA 2FPZA 3BTME 2C3SA 4K1TA 2I6QA 1LPKB 3PYHA 4MQAA 2P8OB 3LGYA 1P3CA 1O5FH 2L6OA 4OS5A 4Z0KA 1V2TT 1C1TA 3TGJE 3WWFA 1MZDA 2ZHQH 4Z1MD 1UK3A 2G55A 3A88A 1YLDA 1NY22 1SGQE 3LGIA 4UFGH 3UPEA 1UTOA 1OP2A 1GBLA 3NPSA 4MVNA 5HXFA 1A0HB 1PYTC 2PW8H 2ALVA 4WMDA 4I31A 1CHOG 1DS2E 1BTYA 3ATKA 2BLVA 1LVOA 5FBEA 4XDEA 1DUEA 2KZ4A 1DXPA 2J94A 1QB9A 3AAUA 2K8IA 2VB0A 3HPTB 5CE1A 3SU1A 4FUEA 1C4U2 4PROA 1P06A 2GT8A 1N6YA 2FOFA 1C1MA 4KKDA 3V0XA 4ZHAA 3ZYEA 3K2UA 1GBJA 4FUDA 1HV7A 1V2ST 3KYFA 4IN1A 1ZTLA 3SNAA 1KLIH 1MUEB 4HI3A 3ZV8A 4YTAA 1TE0A 3QZQA 1G9IE 1E1RD 2A5AA 2M5TA 2ESTE 3DSOA 3ZVBA 1KYNA 2HVYB 1D3TB 1JIMA 1H8ED 3UREA 2OBQA 2IN2A 1ABIH 1P57B 1RS0A 4AGKA 4U32A 1SG8B 2OQ5A 4OGYA 1ZHPA 2Q6DA 5EPYA 1YCPK 4MPUA 2ZHFH 2WINI 4MNYA 6GCHG 1TPAE 1L4DA 3GCHB 4NCYA 1TGCA 4BNRA 4VGCB 5IK2D 2BXUH 1OWJA 1YBWA 4GHQA 2GZ8A 2V3MA 3GCTG 5F8TA 4Q4LA 3AAVA 1KY9A 5A2MH 2ZDAH 1P2NA 3NRLA 1L0ZA 4ZKSU 2HALA 3QN7A 3UOUA 2ZA5A 3SU3A 2BB4A 1K0HA 2SFAA 2ZZUH 3LOXA 3SNDA 2JETC 2SNWA 4YT6H 2DE9A 4XE4A 2KCOA 1ZPZA 1ZZZA 1Z8JB 2KCAA 3PB1E 5GDSH 4ZHLU 3ZZAA 3Q76A 2J98B 4ABJA 1T32A 1GMHF 3A8BA 1RTFB 1MTWA 2FS8A 5C67A 1H8DH 4AOQA 1NN6A 1RJXB 1ELBA 5A0BA 3FAOA 4D8NA 1O35A 4U2WA 5HIYA 1NRPH 2D8WA 4X1PU 2ZQ2A 2OC8A 1WXRA 1GHAG 5JYIA 1GCTC 1C1PA 5HIZA 3D49H 1TABE 3SZNA 3ZVDA 1CT2E 1W2KH 4AFSA 5FCKA 2W3KA 3RXPA 1DITH 2ZDNA 1GJDB 1LHDH 2KCPA 2GTBA 5A09A 3G01A 3B8JA 3KL6A 5E2OA 1QCPA 1WSSH 4HZHA 1CA0B 1HAIH 2BM2A 1UCYK 1OWKA 5CHAC 2FOAA 2FYQA 3F2GA 3FOAA 3VEQB 3C1KA 4XBCA 2F43B 3P8NA 5L6NH 4B2CA 1DY8A 1QA0A 1NRNH 4J1YA 3MNXA 3BG8A 1WAYB 3QK1A 4UEHH 4Y0YE 3LJOA 2HNTC 2GMTC 1O3IA 2XWBI 1OWDA 2FIRH 1SQAA 7LPRA 4X6MA 4ESTE 2FESH 1ZSKA 1TNGA 1HAXB 1O32A 3GCOA 5J4SA 3MU4A 4F4OC 2AFQB 2BQ6B 1MAYA 2UWPA 1XMNB 5EG4A 4ISIH 1M9UA 4XD7D 1AQ7A 2GX4A 1MD7A 3SI4H 1BTWA 3E1XB 3QLPH 2NU0E 4NFEA 2WPDD 4FUIA 1V6DA 5GCHG 1C5ZB 1OWIA 4I8GA 1C5NH 1C5YB 1AUTC 1FJSA 1YP9A 5HYOA 2CHAB 1AWHB 2FMJA 1RRKA 3RXGA 2FI4E 2FDAA 2ZU2A 1EZSC 1O3LA 3HK6B 4ISNA 1YPHC 1YF4A 4H6TA 2ZU4A 4DY7B 4INHA 5C5NA 5DO4H 1C2IA 2OC1A 2XBYA 1OWEA 3PMAB 1V2RT 5C20A 1O2NA 1QURH 4NGAH 5ETXA 1C9PA 4YESB 3SNEA 1AY6H 1C2FA 1S82A 2ZEBA 3P70B 5HMAA 1G30B 4FVDA 4IMZA 3LPRA 5GXPA 1KDQB 3UQOA 1ZSJA 1CSOE 1SI5H 3BTHE 1ZJKA 2O8MA 1WQSA 1YCPM 3IITA 1MTUA 2HGTH 4AFQA 4K8BA 1YKTA 4O03A 1ABJH 2A7CA 2ZFSA 1O2VA 3MFJA 3BIUH 3PV5A 3SQEE 1AFQB 1QB6A 2A45B 3KHVA 1BDAA 4HGCA 3M5LA 2TGDA 3M7QA 4THNH 3V3MA 1GPZA 3ZZ3A 4D7GA 2PTCE 1BITA 3N99A 1AE5A 1LPZB 2EA3A 4IS5A 3E90B 4CHAB 5HM9A 3P8GA 3RXQA 1GMCF 1WU1A 1Z6EA 2WHXA 3ENSB 3MU1A 4FUGA 5EJZA 2H1UA 3PTBA 3RM2H 1XUKA 5T3HA 2ZFPH 1EQ9A 1PFXC 3A86A 2ZFTA 1SBWA 6ESTA 4U30A 2A0QB 2VGCC 3MOCA 3D62A 1EUFA 2JH5D 2EEKA 1SB1H 2SGEE 4Q7ZA 1GHXH 4DJZB 4TYDA 5JB9S 1DSUA 3RMOH 3E3TA 5FCRA 2J2UA 1C1QA 1RD3B 3H09A 4GUXA 2PUXB 4XSKU 3MH6A 3WY8A 2NU4E 1HB0B 1KLJH 3GY6A 1SMFE 2NU2E 2WPHS 1DLEA 3HK3B 2Q6FA 3MWIU 1XUJA 1DX5M 4X2VA 1GMDF 3DSPA 1O3EA 3BTTE 3I29A 3SUDA 1TA6A 1Z8GA 1BUIA 3TU7H 4OM9A 4E06H 2YMSD 3S7KB 4MNWA 2ANMH 2BD5A 1A5GH 1G3DA 3SUEA 4GAWA 1AVGH 2OINA 1QQ4A 1SC8U 3KQCA 1BRUP 2TIOA 4FUBA 2LPRA 1HAGE 4TPIZ 3A84A 2A7JA 5H4IB 3MQKC 4FU7A 3RC4A 5EU8A 1LQDB 3I77A 3U1IB 1GJ9B 2G81E 3FANA 4NIXA 1FN8A 2ALPA 1FI8A 5GWZA 3RLWH 1YC0A 1GCDA 5TJXA 2TGPZ 2TRMA 3DA9B 2SGQE 1GBIA 1RTLA 4I8KA 1BMNH 1S84A 5F03A 1O2MA 3OSYA 1K22H 1MTSA 3ZZ9A 2J38A 3HGPA 2VNTA 2FOGA 1EZUC 1OP0A 3QWCH 1HRTH 1BMFD 1O2LA 2ZKSA 1EAUA 1TNJA 2J98A 4IGDA 4YO9A 4I8HA 5FBIA 1BBRH 3RDZA 1IHTH 1P02A 2C93B 2P94A 1BHXB 2F91A 1ZRBA 3L6PA 8ESTE 1XVMA 2KR7A 2BY6X 3SYJA 1T7CA 2HNTF 3GY8A 3L33A 1NU9A 1TAWA 3V12A 1SGIB 3ZV9A 1SSXA 3TK5A 1GBDA 4OS7A 4F48B 2QE7D 4CR9A 1T31A 1UVSH 5LPRA 3DCLA 5E0GA 3DUXH 3KQDA 1O2IA 8GCHG 1UVOA 4ABFA 1S0RA 2FEQH 1UTJA 3N7DA 3CNRA 3QUMP 3RXCA 1TLDA 1D3DB 2ILNA 1O5BB 4D7FA 1OPHB 4BAKB 1T4UH 3RXDA 3F68H 5A8YA 5KGOA 2F3CE 1UW7A 2OCVB 1N8OB 4K1EA 4A7IB 2QGRA 3UWIA 3WW7A 5DP9A 3A82A 2F9VA 4XOJA 3GY3A 4FU9A 3S9AA 2G52A 2R0KA 1QJ6B 1BBRE 1DUAA 1OHHD 4B2BA 1FZZA 3QGNB 1GHBF 2VU8E 1RFNA 1P03A 5DKMA 5EQSA 5A0AE 4A1TA 1MU6B 3GY5A 4Q7XA 2G8TA 4AX9H 2Y5FA 1ANCA 2PKAA 1SLUB 1YPMH 1Z1IA 1SFQB 3V7TA 2P59A 1B5GH 1G36A 3BEIB 2OD3B 2VH6A 1HAOH 2Z9JA 1FY1A 2VVCA 3LGVA 3U8RH 1O2WA 2AERH 2Z7FE 1O3KA 1LPGB 1K28D 1TQ7B 3BTKE 1F5KU 3SNCA 1BT7A 2ZPSA 2Z6BD 1P9UA 2A2XH 4NWLA 1B7XB 3O8RA 2R3UA 2VIOA 3E16B 4CRBA 4FVBA 1IAUA 1XM1A 1EASA 1AIXH 4A6LA 5FPYA 1ZSLA 3T28A 1SPJA 2DUCA 3FP7E 1ELTA 4CRDA 4Y10E 4BTTB 1QA7A 2QF5A 2PGBB 2GT7A 3OU0A 1OX1A 1O2UA 2FZZA 2ANKH 6CHAB 3SBKA 3MNSA 1KDQA 2KCYA 2WYGA 1VR1H 1H8IH 1UHBB 2XBVA 1WQVH 1XUHA 2SGFE 3RMLH 2G00A 3K6ZA 4BXWA 1LVYA 2PUQH 2ZGHA 2ZG0H 4B6EA 3M61U 1C4Y2 2BLWA 1Y3UA 1J15A 4OS2A 1K1PA 1GI0A 2YMSB 2ZHEH 4AG1A 1EKBB 3GOVB 4X2XA 4RN6A 2ZU1A 1ARCA 3DD2H 1S0QA 3CENA 5C1XA 5DPAA 1XKBC 2ZFRH 3OAAD 1THSH 1TNHA 1PQ7A 1VGCB 1OSSA 3UOPA 4TY7A 1AVWA 3A7TA 9LPRA 1FY3A 3AW0A 4GCHF 1UTLM 4LZ4B 1BRAA 2Y81A 1NRSH 2QY0B 1HCGA 1GI7B 2OQUA 2FI5E 3FO8D 1O2TA 1UMAH 1BHXF 1A0LA 1G2MA 3RU4T 4GSOA 3RP2A 4BAQB 1GG6B 1CT0E 1PPHE 3TJVA 3MNBA 3STJA 3BIVH 3P6ZB 2QA9E 2H2ZA 3K65B 3BEUA 1MU8B 1UJ1A 3VB5A 1OP8A 1XUIA 1PQAA 2Q1JA 1O3AA 4OGXA 1O3MA 2FX6A 2BY9X 1MQ5A 1TIOA 1THRH 2W26A 4RI0A 1G32B 4NIVA 2WV4A 2A4OA 1RXPA 2PP6A 2P3FH 3QGJA 3VPKA 2VVVA 4O97A 1MKXH 2CXVA 3F2FA 1O2RA 3MTYA 1GI1A 1N6XA 4M7GA 2EY4C 2PLXA 2W3IA 4ZKOU 3GDSA 3KCGH 1ZMJA 1GDQA 1AUJA 1ESTA 1EXFA 1W0KD 1C1NA 2P8OC 1O30A 3LGTA 1HAPH 1T8NA 1Y3YA 3SHAH 4XRNA 4IC5A 4K3JA 3MH4A 2HPPH 1WBGB 3PLKA 1XKAC 3SUFA 7ESTE 1DOJA 2AIPA 2XWAA 2JIZD 2OLGA 1CHGA 2HLDD 3D23A 3E8LA 4YM9A 4ZMAH 4Y76A 1QR3E 3LC3A 4AGJA 2F9OA 3MMGA 2GP9B 4NWKA 1V2QT 1C2MA 1G37A 1Y3VA 1KTSB 1ZTKA 3QDZB 1AFEH 2FWWA 3TK6A 3K9XB 2BMGB 4I7YH 1SLWB 1ANBA 1DSTA 1TRMA 1WYKA 1O2GH 5C1UA 3SN8A 2O8TA 3M7UA 4X1QU 1FY8E 1FONA 1Y5AT 1QTFA 5F8XA 1NRRH 3RXUA 2CMYA 1Y59T 4MNXA 1QBOA 1ELDE 4DT4A 3KNXA 2BDGA 1IQJA 2ZU3A 3FFGA 1VCPA 1A0JA 3NZIA 1TBZH 1NS3A 1A3EH 3NCLA 2PSYA 3M3VA 2TPIZ 2IPHA 2QF0A 3ZVFA 3O8BA 1UTPA 5DGJA 3OE7D 2R2MB 1GBTA 1BMAA 2VIDA 2UUJB 2VVUA 1QHRB 1LVBA 1ZMNA 1YY3A 1MMJN 4ACBA 6LPRA 1P11E 3T29A 2XRCA 5IYTA 1TA2A 2FTMA 4GPGA 5E0HA 4YOIA 1ZLRA 2BX3A 2VH0A 2R0LA 1V3XA 1W13U 1WV7H 1F0SA 3RXIA 3GCHC 1F7ZA 2QIQA 2WV9A 1F0UA 2V0BA 3EA7A 2O8UA 4VGCC 4ZH8A 3A7WA 1IQLA 4O9VA 1LMWB 4B1TA 5JBAS 2B0FA 4ZXYH 1S6LA 1VJ9U 1IQHA 3RLYH 5JPMH 2CK3D 3PV4A 1KLTA 2ZDKA 4JZ1A 4LK4A 1GVKB 2CV3A 2GD4B 3KN2A 1EAWA 1GHVH 1JOUB 1K1LA 2XC5A 4H4FA 4ZXXH 1ORFA 1YGCH 2RCEA 1VZQH 3PO1B 1A7SA 1SHHB 1C5XB 2A7HA 2XW9A 4KTCA 3GY2A 3URDA 1EJNA 1HFDA 4Y0ZE 3FKSD 2WPIS 3L3TA 1J17T 2BD7A 3O8CA 1SHYA 3EDXB 4O3UA 3TGIE 3ATIA 1A46H 1V2UT 5LPFA 1BTZA 3ZZDA 4KTSA 4TPYA 2WSSD 5KECA 3H7TA 2ANYA 1OWHA 1HNEE 1Z71A 1K2I1 1CA0C 2Y7ZA 1TOMH 1DE7H 3TVJB 1UHBA 1C5OH 5HKKD 1O5CB 1C1RA 1IQKA 2IJOB 1Y5BT 1OKXA 1FQ3A 4AFUA 3AK5A 4NIWA 1FUJA 2BDCA 4ABEA 1DWBH 1IQNA 1XXFA 4OS6A 4NZQA 2ULLA 1Z7KA 4E05H 1DY9A 1LKAA 3GS9A 4INKA 3Q3KA 4B2AA 2K0QA 3M3TA 5AFYH 3FZDA 1C1UH 1DWEH 3KYGA 1QGFA 4X1SU 5ESBA 2ZGBH 2Q6GA 1W14U 4LXBH 2KM0A 5I25A 2ZCHP 1ZYOA 1J14A 1HAYB 1TPOA 2CHAC 1TRNA 2IOTA 3EAJA 3HKIB 1ZTJA 3TLOA 2GJGA 4B75A 1O5AB 1A4WH 2JETB 2A4QA 5LPEA 2EC9H 3A7ZA 4BOHA 1ELCA 1BA8B 1FPCH 2H9TH 2J9NA 2P3TB 1EB1H 3JZ1B 3PTNA 1BMLA 4U01A 3UTUH 1MH0A 2F9PA 2PKAB 5FL7D 3KGPA 1OYQA 1P0SH 1QL8A 1EAIA 3ZZ5A 1O33A 3RMNH 2D1JA 1GI8B 1AWFH 3PLPA 1TNLA 1C1VH 1TPPA 2QV1A 3KQBA 3ZIAD 1J8AA 1A3BH 3MH5A 1C1OA 1ZOMA 1FMGA 3FP8E 3A8AA 1GCTB 1ZMLA 2QXGA 1S81A 1SOZA 3MU8A 2FODA 1KXFA 1AFQC 1PPCE 3TNTA 1C5RA 1J9CH 1TONA 1V2KT 5C0UA 4FUCA 1NPMA 3NUMA 1UVUH 2YOLA 3Q00A 4ZROA 2BVRH 1TQ0B 5CHAB 3OY5U 3P17H 1FN6A 1BMMH 1O2PA 4CHAC 2GKVE 2VIPA 1SQOA 4FUFA 1AZ8A 1LHCH 2BY7X 1KIGH 2BXTH 3RXOA 1EJMA 1NFUA 4IW4E 3NXPA 3F3BA 2GMTB 3SGQE 1GJ4H 4DW2U 2Y5HA 2BYAX 4B76A 2ZFFH 3OEED 5EXLA 1P2KA 1ELGA 2ZWLH 4ZAEA 3SQHE 1W3CA 1MTVA 1VCWA 2V35A 4X0WU 1P2OA 1C2DA 1VCQA 3EYDA 1V2LT 3LKWA 4FU8A 1SGDE 3GCNA 4YLQH 5C5OA 3T27A 3PRDA 3SNBA 1GBEA 1HAHH 1GJ6A 5EJ1A 2AMPA 2F9BH 1GJBB 2G4TA 3LJJA 1O2OA 3ODFA 5B6OA 3F0OA 5AFZH 5JBBS 1QL7A 1AE8H 2VJ1A 3OTPA 3Q3YA 4K2YA 1C5TA 1XVOA 1P05A 3P92A 5DSFA 2SGDE 2QC2A 2LNCA 1GI3A 1QL9A 3P8OA 3U1JB 1CQQA 1QB1A 3LC5A 3U8TH 3QZRA 1GMHG 3ZZ8A 2YNAA 4AFZA 4DVAU 1EPTC 2P3UB 3SOSA 2AMDA 2UUFB 3ELAH 1O3BA 8KME2 2BVXH 3T2NA 1F2SE 2O8WA 2ZI2H 1C1WH 2QF4A 3MO3A 2UUKB 2JH0D 1SGYE 2A32A 2FOEA 2STBE 2AMQA 4K60A 5B6LA 5SGAE 5EOKA 5K0HA 3A85A 3LONA 4DGJA 3R0FA 2LP6A 2PKSB 1O0DH 3W94A 5DP6A 3RUOA 2QN5T
chains in the Genus database with same CATH topology
4JK6A 1KXEA 4X6OA 2HPQH 3LGUA 1ZHRA 1MCTA 3O8DA 3F1SB 1EZXC 1JWTA 3F9EA 2QCYA 4UE7H 4NG9H 2FOMB 2TGTA 3T26A 2BD4A 1GL0E 1ETSH 1O2JA 4K5ZA 1O2YA 2ZQ1A 1ANEA 4UFDH 1PPEE 1NTPA 3FP6E 3GISB 3CS0A 1SQTA 1V2MT 4ISHH 4TY6A 1O3NA 3OYPA 4MPWA 2A2QH 2BD3A 1GVZA 3BN9A 3OX7U 4SGBE 2ZO3H 1FNIA 1N8OC 2GGVB 2GCHF 3TPIZ 4A92A 1UK4A 1HAVB 4Y6DA 4X6NA 1LKBA 1CE5A 2V6NA 1HXEH 1K1IA 2FM2A 1P01A 1AB9B 1MKWH 5A8XA 1TNKA 3SU2A 1GJ8B 1DWDH 1GJ7B 3E0PB 3A87A 1EX3A 3MU5A 1TRYA 2SGAA 1ZHMA 4ABBA 4CREA 1TX8A 1C5QA 2WYJA 4FUJA 3GDUA 4H6SB 2ODPA 1C9TA 3RXLA 3QTOH 2AS9A 5GIBA 4MDSA 1L4ZA 1WCZA 4UDWH 2ODYB 3Q77A 3SJKA 1AGJA 4XBBA 4NSVA 4HFPB 1YLCA 1BBRK 1P09A 2W7SA 1H9HE 1K1NA 4X8UH 2FOBA 1YPEH 2BDYA 3RC5A 1H4WA 2VINA 2KAIB 3KF2A 1GI4A 3SO3A 3VGCC 3RM0H 4DURA 2WV5A 2B7DH 5F6MA 5EODA 3U9AH 1UO6A 1TPSA 1A1RA 1MBMA 1GI2A 1SR5C 3M5MA 1FIZA 1V2VT 4DOQA 2H9HA 1O3GA 4NFFA 6CHAC 1GMCG 3ZZ4A 1Q2WA 2VWNA 4AYVB 1S5SA 5J4QA 2ZPQA 1INCA 2AEIH 2Z9GA 2Y5GA 2R3YA 1NFXA 2ZU5A 4BTUB 2BD9A 7GCHF 3OTJE 5AVDA 1QJ7B 1E36B 2ZIQH 2H9EH 3A8DA 4XFQA 3ATLA 4Y79A 3RU4D 2D26C 1IQFA 2WUCA 5DP3A 4R8TB 2G5NA 1YPKH 1VGCC 2P93A 1QIXB 3M35A 1EOJA 2BDHA 1GBHA 4AB8A 4AN7A 3UUZA 1O3OA 1GMDG 2Z94A 3TJUA 2Z3CA 1MBQA 1LTOA 1QRZA 3MYWA 1ZR0A 1VJAU 5FX6A 3LDXH 1GGDB 1AU8A 1C5SA 1BTUA 1GG6C 1EOLA 3T25A 1W8BH 3VB7A 3DFLA 2VIWA 1JIRA 3R3GB 2Z3DA 1BRBE 1CHOF 3HATH 1CGHA 1LHGH 1HJAB 4NZLA 2EI6A 2XXLA 5C1YA 1GI5A 2I6SA 1MTNC 4WXVA 1QQUA 1O3CA 3ZYDA 3KIDU 2FX4A 3BEFB 1FLEE 3A7XA 1FV9A 3EE0B 3VB3A 4Y7AA 3RXKA 1O5EH 1NC6A 2VWLA 1NROH 4ISLA 3BSQA 1PYTD 4X8VH 5PTPA 2RA0A 3T5FH 2AGEX 1X7AC 1MCVA 4BAOB 2ZCKP 1NFYA 2QXHA 2ZGJA 1GBMA 3RMMH 3RXBA 1O2KA 2VWOA 1TMTH 3HKJB 1TB6H 1L1GA 4TWWA 3BF6H 4Y71A 5F8ZA 1LHEH 3HGNA 1C5UA 1C2LA 2ZTYA 1TOCB 4LZ1H 2BHGA 1O2HA 1O2ZA 1W0YH 2RG3A 2DE8A 5ABWA 5EW2H 6GCHF 1NESE 2ZNKH 3LH1A 3P8FA 1MD8A 3MHWU 5EQQA 2O8LA 1LCYA 1K1JA 1SLXB 2HOBA 1THPB 3E0NB 3JZ2B 5IDKA 2NU1E 3GCTF 1DANH 1YPHE 1BTXA 2GV6A 2XYAA 2OXSA 3F9FA 1Y8TA 1W11U 2WPMS 2XNIA 3F9HA 2VIVA 1T8OA 4ZKRU 1O36A 3LGWA 2BOKA 2AIQA 4YZUA 4BXSA 3SORA 1HJ8A 2W7UA 5FHTA 4DCDA 1A2CH 1RIWB 1RGQA 3M5OA 3SU6A 4DT7B 1VITG 1C5WB 1ZGVA 4CRGA 1P12E 2FI3E 3LH3A 1GHBG 5L30H 1AVXA 2ZC9H 1BQYA 3TITA 4Q7YA 1AHTH 1ZJDA 2BTCE 1GHAF 2BDIA 1QBVH 1XUGA 2GCTB 1HUTH 1ID5H 2HLCA 1O5GH 4KELA 2XC0A 2FO9A 2BQ7B 2AH4X 3UNRA 1O3JA 1O39A 1CT4E 1NT1A 3RXVA 1CBWB 1MKXK 4YLUA 1H1BA 1ZRKA 1L1JA 4WWYA 1E35B 3BTGE 4NA9H 1ANDA 1HAVA 2RDLA 1A5HA 2ZGXH 1E38B 1GVLA 4CR5A 4ZHMU 2FP7B 2AYWA 1ARBA 4WMEA 4B71A 1S6FA 1TX6A 4GVUA 3RXMA 1P10A 1G3CA 1RTKA 4MPXA 9ESTA 3TGKE 2FXRA 1P2IA 2QF3A 4WJG2 1NZQH 1CVWH 3MH7A 2ASUB 2WPJS 1OS8A 1UTKA 3RXHA 3BG4B 2SGPE 1E0FD 1DT2A 1SGEE 4X6PA 4WF8A 3PO1C 1ZPCA 2J92A 2Z9LA 1DVAH 1FY4A 1V2JT 1KXBA 1ACBE 4KGAA 3N7OA 5AF9H 3RXFA 2Y7XA 1C4V2 1H9IE 1SOTA 1TFXA 3MNCA 4MLFB 4CRAA 1SLVB 1HPGA 5GCHF 1YCPH 2A5KA 4D9QA 2J95A 1O3DA 1G2LA 4F49A 2KAIA 2OC7A 1C2GA 1GJAB 5DP5A 2ZTXA 2H6MA 3ZZBA 3EA8A 3UIRA 3M37A 1EP5A 3UR6A 2XC4A 2BDBA 1TMUH 3GY4A 3A80A 5I46H 4GCHG 3SU4A 1TYNA 1DFPA 2GDDA 3VXFH 1HBTH 1A61H 1O2SA 3AASA 1ETTH 1CA8B 1HIAA 3SJ8A 1D9IA 1O31A 3UFAA 3RXRA 4AG2A 3SJOA 3ZVEA 2RA3A 3PLBA 1J16A 1GHYH 1P04A 1U6QA 2BZ6H 3GICB 4ABAA 1DPOA 2FOHA 1IQIA 4WMFA 2GDEH 4BANB 4B73A 2PHBA 1SVPA 3QO6A 2PR3A 7KMEH 1HJ9A 1V2OT 5DP7A 1PQ5A 3SV9A 1IQGA 3SJ9A 3GY7A 1ESAA 4ISOA 3CS7A 2F9UA 2W5EA 3M5NA 4ABHA 2UUYA 3UNQA 1BTPA 3PMJA 1GDNA 1UCYH 2R9PA 1SL3A 2A1DB 3U98H 3EGKH 1C5VA 2Z3EA 2C8WB 1BJUA 5T6DA 1TX7A 1W7XH 1D3PB 4X2WA 4X8TH 3SU0A 3M36A 3E6PH 1N1LA 1BRCE 1O2XA 1B0EA 3ZZCA 5A0CA 4JMYA 2WPLS 3QTVH 5FXLA 1Y3WA 1C2KA 1NFWA 1OXGA 3BTQE 3A7YA 1OYTH 1UTQA 4E7RG 1QFKH 3VB4A 1EATA 1ELEE 2UWOA 1FDPA 1C2HA 5L2YH 1TBQH 3MI4A 5T6GA 4NA7A 2XCFA 1T8MA 3VXEH 2R2WU 1LQEA 4ASHA 4CBNA 1GHWH 3CP7A 4FUHA 3SI3H 1IQMA 1F5LA 4Z6AH 5DP4A 3S7HB 1UK2A 1DWCH 1UCYE 2ZP0H 2F83A 2GV7A 3P95A 1YPLH 3VFEA 4DIHH 3SGBE 5EQRA 5LGOA 3ATMA 3BTDE 4CRFA 4I8LA 1EAXA 1ETRH 1E37B 3KEEA 5JBCS 1QY6A 4YOJA 1D4PB 1SGCA 4Y8XA 4CBOA 4J2YB 1HYLA 1P8VC 1YPJH 3GYLB 3UNSA 4SGAE 2D2DA 1UTMA 5DK1A 4MG3A 1CU1A 2PTNA 3LT3A 4I8JA 1HDTH 1Y3XA 2PGQB 4QT8C 1AD8H 1HGTH 2P16A 5T6FA 1SGRE 4IBLH 4JZIA 4IN2A 2Y6TA 3I78A 3TIUA 5K7RA 4INLA 5HGGA 2BLOA 3NKKA 4TWYA 2THFB 1GBBA 4WXIA 1K1OA 1W12U 1DXWA 3TH2H 2VIQA 3QX5H 3SV7A 1IQEA 1QNJA 3PWCA 1PPFE 3B23B 1NO9H 3FZZA 4ABDA 2CN0H 3EA9A 1EP6A 5FPTA 4IC6A 3EQ0H 8GCHF 1D3QB 5DJ7A 4WY3A 4DIIH 3SV2H 2HRVA 5EXMA 3Q3XA 3B9FH 4JYUH 4JZDH 1GJ5H 4JZFH 1W7GH 1GI6A 3NWUA 3S9BA 2BY8X 2QXJA 2Y82A 1GDUA 3ITIA 1A5IA 1O5DH 3SUGA 1CGJE 2JKHA 3RXJA 3E91A 1KXCA 1PQ8A 1BIOA 2FTLE 1NU7B 3ATWA 2PKSC 1DM4B 3ZZ6A 5G4BA 2A4GA 2CGAA 2A5IA 3DT0H 2Z9IA 4X2YA 1ELFA 4Y8ZA 5FAHA 5BRRE 1T8LA 4ZKNU 1YM0A 2G5VA 5FX5A 1PPZA 4X1NU 3TJNA 1GL1A 4RKJB 3OY6U 2AGIX 2OTVA 3VB6A 5E0JA 5HM2A 1HAZB 1TBRH 4JK5A 1TALA 1P9SA 2STAE 3ZVCA 2O9QA 1G3EA 1ESBA 5TCCA 4IMQA 3RU4E 1DDJA 2ZGCA 1S85A 1SGTA 3RXAA 4BAHB 2BX4A 3W95A 2B8OH 2ZHWH 2G4UA 2G51A 2JH6D 4UFFH 1DLKB 1UVTH 2BD2A 5C3NA 1O37A 2Y80A 2OBOA 1B0FA 2PFEA 1AKSB 1AB9C 3TNSA 4Q80A 1SGNE 2ZF0H 5TCAA 2YNBA 1H9LB 1GBCA 3PMBB 2VGCB 2XBXA 3DHKH 5CMXH 1JXPA 4JYTA 2ZDLA 1JBUH 5GJ4B 1D6WA 3SV6A 2TBSA 5AHGH 4ZUHA 1V2NT 1GBFA 2PWXA 4Y11E 1JRTA 1EPTB 2FYRA 2NU3E 1WTHD 4JYVH 5EW1H 1L1NA 2AGGX 3RXEA 1EJAA 3S0NA 3GYMA 1BOQA 1FAXA 1F0TA 1S83A 1V2WT 4RSPA 1EB2A 5BPEA 2V3HH 3LU9B 5LH8A 4K1SA 1P2QA 4WH6A 3ZVGA 2GZ7A 2A31A 1GI9B 2PSXA 1W0ZU 1BTHH 3TJOA 1SFIA 2FLBH 1GJCB 3H7OA 3ODDA 1Z8IB 3A8CA 3TH4H 4BAMB 3SU5A 2BQWB 3PMHB 1GBKA 1TGBA 1P2MA 1C5LH 4GLYA 1SGFA 1Z8RA 1LVMA 3A7VA 3SV8A 1F92A 2UWLA 1KSNA 1G3BA 1O38A 1BZXE 3PWBA 1WTGH 2K1QA 4JZEH 3MO9A 3V13A 1PPGE 2OUAA 1TMBH 1P3EA 4FXGH 5ESTE 4B74A 1IHSH 1FIWA 1LDTT 4CH2B 3UY9A 2H5CA 2A4RA 2CF9H 3UQVA 3M3SA 3MO6A 4YT7H 4X1RU 1EZQA 1KXDA 3TK9A 2BY5X 1GBAA 2VWMA 1JRSA 3D65E 3C27B 5L2ZH 2XCNA 2C4FH 3STIA 2C8ZB 4KP0A 1K21H 3GDVA 3AW1A 1MKWK 1XX9A 1FXYA 1VITF 2ZPRA 4E7NA 1YPGH 1CO7E 1XUFA 3PROA 4Q2KA 1QBNA 3SW2B 1Z1JA 3RXSA 2P95A 2Z9KA 1GGDC 1TNIA 4MPVA 1AZZA 3BTWE 1S6HA 1DICA 1HIAB 1MZAA 2ZDMA 2ZFQH 3F6UH 2V3OH 4AORA 4I32A 1O3HA 1SGFG 1TGTA 1HJAC 2C90B 5FPSA 8LPRA 1F0RA 1K9OE 3U69H 4AYYB 1XXDA 2B9LA 3A81A 1C2EA 1BJVA 1YYY1 4MTBA 1CGIE 2BLQA 1ZPBA 4DG4A 3U8OH 2ZTZA 1QJ1B 2BDAA 4HTCH 2QXIA 2EI8A 2ODQA 1PJPA 2ZCLP 2HVXA 1O3FA 3ZZ7A 4OS1A 3ESTA 5E2PA 1ELAA 1BB0B 4XBDA 4ABGA 4MNVA 3VGCB 1HXFH 1E34B 2XBWA 2QYIA 4Y7BA 4NIYA 2XTTB 2QAAA 4A5TS 1T4VH 4A1VA 1ZGIA 1TGNA 4YOGA 1LO6A 2WUBA 1NM6A 4CH8B 1Y5UT 2BZAA 4ABIA 2GVFA 2J4IA 1VITH 1K1MA 1C2JA 2PV9B 2GZ9A 4I33A 4UFEH 5E8EH 3BTFE 5GPIB 2HNTE 2TGAA 3A83A 3UWJH 4AB9A 3BV9B 3SGAE 1NRQH 1FPHH 4Y8YA 4X8SH 1W10U 2GCHG 3IWMA 4NA8A 1V2PT 2BVSH 2C8XB 1RIWC 1IOEA 2B5TB 3LIWA 3MU0A 3H5CB 2BD8A 1P2JA 3UR9A 4JCNA 2EI7A 2CJIA 1AO5A 3AVZA 1OOKB 3FVFB 1C5MD 1WOFA 1O3PB 5A8ZA 1WUNH 3BTEE 2C8YB 1FY5A 3M7TA 1AI8H 2ZHDA 1JMOH 2GCTC 4K8YA 1QRXA 2OP9A 5C2ZA 3DFJA 3K6YA 5JDUB 4K69A 4UONA 1MAXA 4UD9H 4KTUA 5JB8S 1QRWA 1TWXB 3TH3H 4A1XA 2BOHB 4D76A 5DG6A 1AMHA 3URCA 1CBWC 1MTNB 1AN1E 1Q3XA 3ZVAA 3RC6A 2ZECA 1LHFH 3SJIA 4NSYA 5EGMA 1PPBH 1O2QA 3S69A 1C5PA 1F5RA 1L2EA 1UVPA 4OS4A 1AKSA 4RKOB 5DP8A 1ELVA 4WH8A 4R0IA 5JBTA 4WVPE 2J34A 2F9NA 2FLRH 2ZDVH 3RXTA 3IG6B 1FAKH 2H5DA 3BG4C 4D9RA 3A89A 4GHTA 3NK8A 4BTIB 1EPTA 1Z6JH 4O3TA 4H42U 1KTTB 2WPKS 2OC0A 1Q31A 2FS9A 3KQEA 2SNVA 3F9GA 4AZ2B 1GWAA 4CRCA 1C1SA 4LOYH 2FOCA 7GCHG 1SGPE 5EXNA 1MQ6A 2NWNA 3S9CA 1O34A 3T62A 1KXAA 1BCUH 3SHCH 2CF8H 2ANWA 3PM3A 1D6RA 1GHZA 1UTNA 1HLTH 2HWLB 1TGSZ 5EPNA 2FPZA 3BTME 2C3SA 4K1TA 2I6QA 1LPKB 3PYHA 4MQAA 2P8OB 3LGYA 1P3CA 1O5FH 4OS5A 4Z0KA 1V2TT 1C1TA 3TGJE 1MZDA 2ZHQH 1UK3A 2G55A 3A88A 1YLDA 1NY22 1SGQE 3LGIA 4UFGH 3UPEA 1UTOA 1OP2A 1GBLA 3NPSA 4MVNA 5HXFA 1A0HB 1PYTC 2PW8H 2ALVA 4WMDA 4I31A 1CHOG 1DS2E 1BTYA 3ATKA 2BLVA 1LVOA 5FBEA 4XDEA 1DUEA 1DXPA 2J94A 1QB9A 3AAUA