2F9OA

Crystal structure of the recombinant human alpha i tryptase mutant d216g
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase alpha-1
publication title X-ray Structures of Free and Leupeptin-complexed Human alpha I-Tryptase Mutants: Indication for an alpha to beta-Tryptase Transition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9oA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2f9oA01
3A88A 2Z3DA 3RM2H 4B1TA 3M5MA 2FEQH 1HDTH 4MNWA 1P11E 3GISB 1ZTKA 1NFYA 3EA8A 3AAVA 2ODQA 1BRAA 5EPNA 1J9CH 2BDCA 2G5NA 3SV8A 1D3TB 1Z1JA 6ESTA 2OC8A 1SI5H 2O8TA 4D7GA 4NGAH 5FBEA 1ID5H 4LOYH 5A8YA 4ABFA 1ZJKA 1V2OT 2ZHWH 3L6PA 2PKSC 5HM2A 1GHBG 1NPMA 5EOKA 1UK3A 1Z6EA 1UCYH 2ZPQA 4AZ2B 1GI5A 5EQSA 1RS0A 3RMLH 4CR5A 1QJ1B 4ZAEA 5LH8A 3T5FH 2XBYA 3UY9A 1WAYB 1G37A 4IGDA 1G2LA 1DANH 1OXGA 3SJIA 2ZHEH 1QY6A 1O3KA 1S5SA 4DT7B 1TGCA 2R0LA 1P0SH 1GMCF 5E0JA 1THSH 1TX6A 3BTTE 1JBUH 5DP5A 4KKDA 1OP0A 3SNBA 3M36A 9ESTA 1C2FA 2ZCLP 1QL8A 4BAQB 1C5XB 1GVZA 4NIWA 3T27A 2RCEA 4IS5A 1DOJA 4F49A 5F03A 3T29A 1AUTC 2BX4A 3F9GA 1ETSH 1P9UA 4OS4A 4WJG2 3SJ9A 2J2UA 3KQEA 5DP7A 1HAGE 1P01A 3RXIA 1YPHC 2B7DH 1O3IA 1O2TA 4Y71A 4CH2B 1ZJDA 1OWEA 1NU7B 4X6MA 1TRYA 3HGPA 4XBBA 1C5QA 3F9FA 2SNVA 1KLTA 3SI4H 4DOQA 1DSUA 1O5CB 2BVSH 2A5KA 1KYNA 1TE0A 2Y80A 1FQ3A 1DY9A 1ZLRA 4ABDA 1D3QB 1CE5A 1OWDA 1WV7H 3HK6B 4BNRA 3SNCA 2W7SA 1HJ9A 5J4QA 1L4ZA 3PO1C 2A0QB 3TH4H 1FUJA 4AGKA 1P2MA 2O8WA 1F92A 1YLDA 1IHTH 1BCUH 3ZV8A 2F9NA 3K2UA 2QCYA 2VWLA 4MNYA 1EATA 2GMTC 1O2XA 3NXPA 1NZQH 2TRMA 2BLOA 2M5TA 3SU5A 3UPEA 2WPHS 2Y82A 3DUXH 2IJOB 1UTQA 5C1XA 2BTCE 1ZTLA 1IQNA 2VIPA 1HJAB 2XWBI 3MH5A 2FTMA 1O0DH 3GY4A 2ZU4A 3OY5U 1GHBF 1LCYA 5G4BA 1JIMA 2Z7FE 3ZZAA 2ZWLH 3DD2H 1SGIB 1GHAF 3I29A 1HNEE 1P2JA 1C5ZB 5L2ZH 2A2XH 3K65B 2K1QA 4FU7A 4YZUA 3SNAA 4X0WU 1ELAA 1O38A 1FZZA 2A5IA 3LKWA 1HAPH 1ELFA 2Y7ZA 1V2ST 1TYNA 2F9VA 4NIVA 1FN6A 4OS7A 3SNDA 2ZNKH 5K0HA 1T4VH 2QYIA 3BTWE 1MTUA 2P95A 2ZF0H 3MWIU 1XKAC 2ZFFH 4HGCA 2NU2E 4FUDA 2ALPA 1D9IA 1QQ4A 1GI3A 2BLWA 1DDJA 3A81A 1TA2A 3NWUA 1XKBC 1C5SA 5DKMA 3STIA 4Y8ZA 2VWMA 1HJ8A 3RXKA 2SGDE 2WYGA 1DXPA 5DP9A 2ZCKP 2NWNA 1L1NA 2ZHDA 3P8OA 5C5NA 3O8RA 4GCHF 3TU7H 1ZHRA 4I8HA 3V7TA 1F0SA 2ODPA 4ABGA 2OC0A 1GHXH 3RXEA 2PKSB 1O3GA 1HAXB 4BXWA 3UNRA 5TCCA 7ESTE 3TNSA 5L30H 5C1YA 1GVKB 3AW1A 2QGRA 3E3TA 1QURH 4CR9A 1TALA 1ZSLA 1C2HA 2P59A 5DJ7A 2BXTH 1IQGA 1LQDB 1O5DH 1C1WH 1CA8B 1NESE 4MNXA 2F9OA 3RXJA 1GDUA 2FOGA 2UUJB 2PUXB 2Q6FA 1QHRB 4JYVH 4DGJA 1TNHA 1XXDA 3OSYA 5GPIB 2A4QA 1PPBH 1GCTC 5EODA 2B9LA 1K1MA 1GDNA 2HPPH 4GSOA 9LPRA 2H9TH 2RA0A 1BMAA 3LC3A 2VU8E 3MO6A 2VGCB 2BZ6H 3KF2A 1WQSA 3MFJA 4X1QU 4BTTB 2ZECA 4NZQA 1O5EH 1NRPH 2ZKSA 1AI8H 8GCHG 1A1RA 2QXHA 1AMHA 2IN2A 3T2NA 1MTWA 1XX9A 4H6SB 4LXBH 3DT0H 5EW2H 1XVOA 3CS7A 3QUMP 3P8FA 1P57B 3HATH 1AB9C 1O2QA 3ODDA 1SGTA 3TJVA 1C1UH 2CMYA 2C8ZB 2HLCA 4NA9H 1N6YA 1IOEA 1KXAA 8ESTE 1KXDA 2G81E 1O3LA 3Q3YA 2VJ1A 4RSPA 2GMTB 1AD8H 1O3MA 3S9BA 1GJ8B 1K1JA 2PTNA 4CRDA 4B75A 4IW4E 2YOLA 1V2JT 1BRUP 1GJAB 3PV4A 1GJ5H 3V13A 3RLYH 1HFDA 5F6MA 3HKJB 3MO9A 4FUEA 1GHYH 2XBWA 2EI7A 4FVDA 3ZZ8A 1A5IA 1HRTH 3ZZ4A 2XRCA 4WMEA 1AVGH 3U9AH 4GAWA 1KLIH 1SGDE 3ZVDA 4NFFA 2ZDVH 1ETRH 1NC6A 3TH3H 2TGAA 3S9AA 4X2YA 2BD9A 3A8DA 4ZMAH 3RLWH 1AHTH 1MKXH 4WH8A 1NU9A 1J15A 2ZFPH 4D7FA 3Q00A 1TB6H 1ZHPA 3HK3B 1ESBA 1OP2A 3EQ0H 3M7TA 4DVAU 2UUFB 1VITH 1SGNE 5HGGA 3IITA 4NA8A 2UWOA 3RU4D 2JETB 1AUJA 1YM0A 3U98H 4JK5A 2ZDMA 1C5NH 3LGIA 1OYTH 3URDA 2ESTE 5A2MH 1TPAE 5DPAA 2D2DA 2B5TB 2BMGB 1C2LA 2RDLA 3MTYA 3EYDA 1AZZA 1WTGH 2C8XB 1TRNA 5AFYH 3U1IB 2IPHA 2ZGJA 2P8OB 1OWIA 2BVXH 3AAUA 4D8NA 2B0FA 3TGJE 1ZPCA 2XC5A 4KTUA 3B23B 2GZ9A 2A2QH 1GHWH 1MTNB 1HBTH 3RDZA 4K3JA 2G5VA 1TMUH 1RJXB 5LGOA 1ESTA 4ABHA 1K28D 1ZTJA 1XUKA 2WINI 1SMFE 1F7ZA 1YPHE 2SNWA 5ESBA 3TNTA 1YPGH 3A8AA 1C9TA 1Q2WA 3A8BA 1TIOA 3MH4A 5EXNA 2A32A 4Z6AH 3Q76A 1K1OA 1RTLA 1LHCH 2XBVA 4XOJA 1P3EA 4OS5A 1A3EH 3LGUA 5LPEA 1ZR0A 1S84A 2ZP0H 2GT8A 1AU8A 1FJSA 4YOIA 1O3EA 1TBQH 2AYWA 3RC4A 1GCDA 1THRH 7KMEH 1EZSC 4PROA 2J95A 1VJAU 3M61U 4IMQA 1O2VA 1F0RA 1S6HA 4B2AA 3ZZ3A 4XSKU 1PYTD 2WPJS 1ZYOA 4WMDA 5TJXA 1TQ7B 2ALVA 4Y0YE 2KAIB 3RXSA 1SFIA 1EB2A 1U6QA 2ZQ2A 3E90B 4K8BA 5FX6A 4WH6A 3H5CB 4ZROA 3ZZ7A 1GBMA 2PTCE 4GVUA 1GL0E 2GCHG 2LNCA 1SSXA 2ZZUH 3C27B 1ZSKA 4IC5A 4X8UH 2O9QA 4A5TS 1OWKA 3SO3A 3CS0A 1GJDB 1YBWA 1ZMNA 3RMMH 1KXBA 1UTPA 3UOUA 1A4WH 1G9IE 4BAMB 3ATKA 1HB0B 1D4PB 4UDWH 2G51A 3UTUH 1W13U 2C93B 1C4U2 1TONA 3BIUH 3PWCA 2G00A 1ABIH 1LO6A 2BD3A 4WMFA 1O3HA 5JB8S 2BB4A 1W10U 3RMOH 1C5LH 1GBTA 1ELTA 1NN6A 2BYAX 1YC0A 2THFB 4RKOB 4HZHA 1D3PB 4UFDH 2GCTB 4YTAA 1PQAA 4ISHH 2ZPSA 2VWOA 3E1XB 2BD7A 2NU0E 2Y5FA 2A31A 4AGJA 2ODYB 1RTFB 2PHBA 4Y6DA 3FAOA 1YPJH 1XUGA 1F0UA 2GT7A 2A7CA 2WPKS 3GY7A 1UJ1A 3M7UA 4CRCA 3S0NA 3RP2A 2ZFRH 3SBKA 2FX4A 4I8KA 4U32A 1ANBA 1CBWB 3LONA 1D6RA 2FTLE 1MKXK 3LGTA 1K21H 1SGRE 3UNSA 2YNBA 1FIWA 2RG3A 3TJUA 3E0NB 1N6XA 3FANA 2AMDA 1BTZA 3MOCA 1B0FA 2BX3A 2CF9H 1YPEH 5FXLA 1UK4A 3QTVH 1W8BH 2TIOA 1HJAC 1TLDA 2H9HA 1ANEA 2V35A 1V2NT 1GHZA 1EOLA 5FCKA 2HGTH 1H8DH 3MNSA 1TWXB 1UVUH 4THNH 2O8LA 4E06H 1O2ZA 2DUCA 4ZH8A 1AFEH 2C3SA 4GHTA 1Y5AT 1YLCA 2SGFE 2P3UB 3E16B 4F4OC 1NS3A 1P12E 1GJBB 1T31A 2GCHF 3PMJA 4TWWA 1HPGA 4YT6H 1O3BA 2ZPRA 5JBAS 3TVJB 3U1JB 6CHAC 1O3JA 3L33A 1CO7E 3ZVBA 4ISLA 2DE9A 2HOBA 4Q7XA 1A7SA 2C8WB 3ZVGA 4AX9H 1BQYA 2A4RA 2G52A 3SNEA 3GCNA 4DIIH 3K6ZA 4AORA 4U2WA 4NCYA 4JZEH 4MPXA 3SUGA 4AFZA 4OGXA 3TJNA 1W12U 2ZCHP 2BHGA 1XUFA 1QBNA 1K2I1 5ETXA 4VGCB 3R3GB 1LMWB 2ZTZA 4SGBE 5A8XA 1C5UA 2I6QA 4OS1A 2H2ZA 2AGGX 2CHAC 4X8TH 3CENA 3A83A 5HM9A 1KIGH 2WUCA 2ZG0H 1GHAG 2PSXA 4ZKRU 1BRBE 3S7KB 4Y7AA 1JWTA 2F9UA 2BQ7B 5GDSH 2EI6A 4ZUHA 3SV2H 1C2DA 1MZAA 2BDBA 1KTTB 2XCNA 2ANMH 3W94A 2XCFA 1TOMH 3VPKA 3SI3H 2GTBA 2W3KA 3O8BA 1A0HB 1EASA 1P02A 2GX4A 3RXVA 2KAIA 2LPRA 1AWHB 2UWLA 1BHXB 3PYHA 2W26A 2VINA 5EQRA 1ABJH 4JK6A 2FDAA 2O8UA 1DSTA 1Y3WA 3LT3A 3RXRA 3A7WA 2F9PA 3GOVB 5DGJA 2VIWA 5C2ZA 1SG8B 1RXPA 2BM2A 4ISNA 4X1NU 2OP9A 4MPUA 3A7TA 1BTHH 2VGCC 1NRRH 3KEEA 3GY2A 1Z1IA 1P2IA 4DJZB 3A80A 2F83A 1NFUA 2D8WA 3ZV9A 4GCHG 5T6DA 3A85A 1O2YA 2HNTF 1CQQA 4TPYA 1WBGB 1PJPA 1TNIA 2EA3A 2BVRH 1GVLA 1AQ7A 2FOCA 1GI2A 2WUBA 4JZIA 1GDQA 1MTSA 5E8EH 5JDUB 1JOUB 2TPIZ 5T6FA 4CRGA 2H9EH 1C1OA 1NT1A 4YLQH 5AF9H 3S7HB 1BTPA 1XUIA 3F6UH 4X1RU 4ABJA 2VVCA 1BA8B 2SGEE 5A0CA 1DITH 5JPMH 3MO3A 3BG4B 7LPRA 1TBZH 1UK2A 4BXSA 2A4GA 1OPHB 4MG3A 3UR9A 1UVSH 5B6OA 4FUFA 1L1GA 5ABWA 4FXGH 1W14U 5AHGH 5C5OA 1G32B 2Y6TA 1FXYA 1Y8TA 3RU4E 2XC4A 1SBWA 1J8AA 1O34A 1C1VH 1EZQA 1YPLH 1C1QA 1C2EA 3A7YA 1EP6A 1LHFH 1V3XA 3B9FH 1ELCA 5DP8A 5JYIA 3EA7A 1HAYB 3OU0A 3GDVA 2QY0B 4FU8A 2H5DA 2J92A 1NM6A 4FUJA 4GLYA 1MCTA 2RA3A 6CHAB 1INCA 1XMNB 1V6DA 2VVUA 1EJAA 2JETC 1O2PA 3AVZA 2R3YA 1EX3A 1UTKA 2Z3CA 1LPZB 5T6GA 2BY6X 1BBRE 2TGDA 4WY3A 1EB1H 2P8OC 3GY6A 1AKSB 1TX7A 4R0IA 2FS9A 1MTNC 1T7CA 1SOTA 5FX5A 1C5VA 1EPTB 3SU1A 2AIQA 5EU8A 1G3BA 3URCA 2CHAB 1ARCA 2TGTA 4WXIA 3ZZ5A 4X2VA 3PB1E 2XBXA 3SJ8A 2AIPA 2JKHA 2ULLA 4FUBA 2HRVA 1CSOE 1ESAA 1WCZA 2R0KA 4O97A 1KXCA 4ABBA 1A2CH 1UCYK 2GZ7A 4ZHMU 2FOFA 4Q2KA 4CBOA 3M5OA 3P92A 4ASHA 1B5GH 2EEKA 4ISIH 2ZGHA 3U8OH 4HTCH 2FOAA 3ZYEA 5EW1H 2AFQB 3VEQB 4AFUA 3KQCA 2QAAA 3E91A 5JBCS 1HAHH 5EGMA 1DS2E 4AB8A 3QLPH 3RC6A 1S82A 5AVDA 3VXEH 1MCVA 2Z9GA 2HNTC 3GYLB 3H7OA 4B74A 1SLXB 1IQKA 3QGNB 2GGVB 1OYQA 3BTDE 1EKBB 1EOJA 1QIXB 3RXTA 3SU4A 3ZYDA 1SVPA 5FCRA 2C8YB 4LK4A 1P10A 3EA9A 4I32A 1GWAA 1LDTT 3A7XA 3D62A 1KY9A 3IWMA 3SV6A 1H4WA 2NU1E 3TGIE 3OTJE 3SJOA 1ANDA 2A45B 2ZGXH 5CMXH 4NA7A 2ZGCA 3A86A 3E0PB 1OS8A 1HUTH 1A5GH 1C9PA 1IQHA 1O39A 5FPSA 3SUEA 1WYKA 3M3SA 5E2OA 1S0QA 2AEIH 1DWDH 1TX8A 3ATIA 1GI6A 4KP0A 1XUJA 5AFZH 1DLKB 4K8YA 2FYRA 2BD4A 1DUEA 2BDGA 3PMHB 2XNIA 3P8GA 1C2KA 3RXLA 1FONA 1Y3XA 3OY6U 1C1SA 1F5RA 3FVFB 5HMAA 2ZU5A 5JB9S 2Q6GA 3SW2B 1EAXA 1BBRH 2A5AA 1LVBA 1RGQA 1MUEB 1O35A 4A1VA 5C20A 4AFSA 1GBAA 3A7VA 3UQOA 1M9UA 4YO9A 5GJ4B 1ELEE 4Z0KA 1SGEE 1P2KA 1BHXF 1ZMLA 2GCTC 5A09A 1LVYA 3IG6B 2P16A 3GY5A 1ZOMA 4GUXA 3VB7A 1QRZA 4XDEA 2ZHFH 3SUDA 1Z7KA 1ANCA 5E2PA 1UHBB 1GBFA 1QA7A 3M7QA 1BB0B 1O3CA 5DK1A 1LKAA 3F9EA 5IDKA 1LHEH 1D3DB 2XC0A 3ATLA 2SGAA 5GCHG 1HAVB 4HI3A 1QL9A 2GV7A 3Q3XA 3ENSB 1CBWC 1GGDC 1P9SA 4Y8YA 1RIWB 1V2VT 2ZEBA 4CHAC 1MU8B 1VJ9U 1VCWA 3BSQA 3GY8A 3ATMA 3GICB 4X6OA 5I25A 5C1UA 1PQ5A 3MU5A 1TBRH 2WPLS 1C5WB 1YCPM 1O3NA 3QZQA 1SGPE 1AO5A 1GBCA 1O2KA 1O33A 4K1TA 2GP9B 1UVTH 2GVFA 1CU1A 2Z94A 1C1TA 1H8IH 2Z3EA 1P05A 1TA6A 1O2UA 4B73A 1HAOH 5GIBA 3K6YA 4JZ1A 2OBQA 4X6PA 1CT2E 1VITF 4CH8B 2XXLA 3D49H 4QT8C 3GYMA 4D76A 1FY8E 1AVXA 1CVWH 2OTVA 1E38B 3A82A 3EGKH 1BIOA 4FUGA 1QL7A 3M3VA 3RU4T 1SB1H 3EE0B 1SLVB 4I31A 4K69A 1GJ9B 1QNJA 1NROH 1FY3A 2D1JA 2ZU2A 3EAJA 4KTSA 1V2WT 4A1TA 1HXFH 1AKSA 1Q3XA 3RXQA 2PWXA 1F5KU 1MKWH 4OS2A 4ZKOU 5JBTA 4BAOB 4HFPB 4AOQA 4MTBA 1P2QA 2W3IA 3JZ1B 1EPTA 4TY7A 1HIAA 1LVMA 1AFQC 1DX5M 1P2OA 1QJ7B 4TYDA 4WWYA 3ZZCA 3SZNA 1SQOA 2GKVE 2Z9KA 2Q6DA 5EQQA 2UUYA 4X2XA 3I78A 3VGCB 3MH6A 1O3FA 4B71A 4UONA 4VGCC 1T8OA 2TBSA 1TRMA 4E7RG 2BY7X 4DG4A 2PSYA 1W0ZU 3S9CA 2V0BA 4BAHB 3U69H 4AG2A 4B76A 3BTME 1FAKH 3BTKE 1W11U 5L2YH 1K1IA 1T32A 1NRQH 5DP3A 1V2RT 4JYTA 2ZIQH 1H9IE 3LJOA 3D65E 2OQUA 3VB4A 5GCHF 1SQAA 2ZFQH 1GMHF 3PTNA 1G30B 1IAUA 1ZRKA 3NZIA 1K1NA 2W7UA 1XUHA 3TK5A 4AG1A 3ZZ9A 2FODA 1FIZA 3LH1A 1EXFA 2H1UA 1E37B 1SGYE 5SGAE 2HVXA 4X8SH 4YT7H 4MPVA 1L0ZA 3SHCH 3UREA 2PKAB 1PPCE 1Z8GA 1ZZZA 4YESB 4UE7H 4X2WA 2BLVA 3GDUA 1EJNA 4X1SU 3TGKE 2VIDA 1K1LA 4ZKNU 1PYTC 2V6NA 1N8OC 3RXBA 4FUHA 1J16A 2Y5HA 1FY1A 4X6NA 4AYYB 1PPFE 2ASUB 3UOPA 2OBOA 2UWPA 2ZU1A 1WUNH 2J34A 4I33A 1QA0A 2AGEX 1THPB 2D26C 1O3AA 1C1RA 4UFGH 3SQHE 3HPTB 3SGAE 2H5CA 1DVAH 3LGVA 1A0JA 1UTNA 4J1YA 4K5ZA 1N1LA 1Z71A 1GI7B 2Z6BD 1MQ6A 1QB1A 1TPSA 1ZSJA 1QTFA 3BTQE 1V2UT 3HGNA 3RUOA 3PWBA 4CREA 4I8GA 4BAKB 1GGDB 3GCHB 5BRRE 1GI9B 3I77A 2STAE 2BD8A 4CHAB 1BTXA 1UHBA 1BMMH 3RMNH 2R9PA 2QA9E 3BG4C 1BJVA 1NY22 2WV5A 1CHOG 2JH5D 2BOKA 2ZDAH 7GCHF 2AH4X 1W7XH 4I8JA 1B0EA 1TABE 3V3MA 1HAVA 1BRCE 1QQUA 1TPOA 3MU8A 4NFEA 3U8TH 4A1XA 1O2LA 1EUFA 2EI8A 1C5OH 2BQWB 2BD2A 2FM2A 1NFWA 4MVNA 3SQEE 3LPRA 3SGBE 2SGQE 3A87A 1SLUB 2ANWA 1IHSH 3F1SB 3DHKH 1DM4B 2ZDKA 2QIQA 1HV7A 4H42U 5F8ZA 2HNTE 2ZTYA 1BZXE 4I8LA 3SUFA 3BEUA 1L4DA 1QGFA 2J94A 4B2CA 1BT7A 1YCPH 1P06A 3A84A 3GDSA 3RXOA 3GY3A 1FV9A 2CF8H 4ABIA 1K9OE 1LPKB 1QB6A 1C5PA 4A92A 3P8NA 1W2KH 1VZQH 2GDDA 1IQEA 5DG6A 1TQ0B 4XFQA 1C1MA 3FP7E 1EAIA 3W95A 1LTOA 4KELA 1MKWK 1MBMA 1AFQB 3O8DA 1E36B 2FZZA 2XTTB 1O2SA 3GCTF 3WY8A 1GBBA 1MBQA 4ZHAA 2ZGBH 1C1NA 3JZ2B 3N7OA 1BTYA 1JXPA 3BTGE 1GHVH 1TGNA 2UUKB 1EPTC 4JZDH 2Y7XA 5DP6A 2A1DB 2CXVA 3M5LA 1EQ9A 3ZVFA 3LU9B 3QK1A 1T4UH 1WU1A 1KLJH 3T62A 3LGYA 2DE8A 2XYAA 2PV9B 2P94A 1UMAH 3MNCA 1WQVH 1AIXH 4NSVA 1PFXC 1Z8IB 5FPYA 5J4SA 1QBVH 1UTMA 3UQVA 2FWWA 2B8OH 1BTUA 4O03A 5I46H 4X1PU 2Q1JA 1C1PA 1TOCB 1ELVA 1S85A 3VXFH 1C2JA 1EAUA 1AE5A 1C5YB 3MNXA 2ZI2H 3SGQE 2PGBB 1OWHA 4ABEA 4I7YH 3KN2A 5FPTA 1PPHE 1IQFA 1GBLA 1CHOF 4NIXA 4JZFH 4NWLA 1FPHH 5L6NH 1QR3E 2NU4E 5HXFA 3RM0H 1Y59T 3A8CA 1CHGA 1MZDA 4LZ4B 3UFAA 1A61H 3NKKA 4NIYA 3UWJH 1BOQA 1YPMH 2A7HA 2PFEA 2PUQH 3Q3KA 4K60A 4NZLA 1O36A 1OX1A 1ARBA 5FBIA 4KTCA 2Z9IA 1N8OB 1H9HE 4K1EA 3SU0A 4FUIA 4TWYA 4TY6A 2J38A 3TJOA 6GCHG 1TPPA 1G3EA 1GMDF 2PKAA 1H1BA 4YLUA 5FAHA 3TH2H 3FFGA 1QB9A 1MU6B 1LHDH 1C5MD 2HWLB 4ABAA 2PGQB 3KQDA 2FI3E 5K7RA 1K1PA 2VB0A 1SGFG 1CGHA 1DPOA 4IC6A 2R2WU 1G3DA 3LJJA 1HCGA 2ILNA 4JMYA 2F91A 1SPJA 2PR3A 1MD8A 1SFQB 1VGCB 1YYY1 1Z8RA 1E35B 1O3OA 3P17H 3MHWU 2PW8H 5DP4A 5CE1A 3SJKA 4TPIZ 1ZPZA 1AN1E 2BXUH 4NWKA 1Y3YA 1ELGA 1ORFA 2WV4A 5E0GA 3RXUA 3TIUA 3FP8E 1G3CA 2FOBA 1SHHB 3SN8A 4UFFH 3U8RH 1O2GH 4CRAA 5A0AE 2G4UA 1A46H 2EC9H 1BJUA 3ATWA 4DCDA 1DFPA 1CA0B 1QRWA 2PLXA 1IQIA 1E0FD 1OKXA 4INLA 1FI8A 3P6ZB 1IQJA 1FAXA 1P04A 8KME2 1TGTA 1O5BB 1F0TA 3SHAH 4GPGA 1K22H 3A7ZA 1RIWC 3HKIB 4M7GA 1ZHMA 2W5EA 4KGAA 4WF8A 2QN5T 2NU3E 2BDYA 1YCPK 4U01A 5CHAC 2ZA5A 3DFLA 1O31A 4BTUB 4H6TA 1IQMA 4U30A 2FPZA 1SGFA 5FHTA 3SORA 1SLWB 3BN9A 3UIRA 1CGJE 3LGWA 3VFEA 1O2MA 4SGAE 2OCVB 3TITA 2GDEH 3PLPA 2H6MA 4NSYA 3KNXA 5H4IB 1CT4E 4CRFA 3LC5A 1UTLM 3MH7A 3QZRA 2TGPZ 3VB3A 1LPGB 3B8JA 1ACBE 1GJ4H 1HIAB 2R2MB 2AGIX 4YOGA 2G8TA 1V2TT 2ZHQH 1D6WA 6GCHF 4Y76A 1SHYA 4ISOA 1PPEE 4Y8XA 4ESTE 2BD5A 1EP5A 1MD7A 3AASA 3PMBB 2STBE 1ETTH 3BG8A 2I6SA 4Q7ZA 1T8MA 1TNLA 4RKJB 1TMBH 1F2SE 5GWZA 1GG6C 2QF3A 2GD4B 1O2IA 1ZRBA 2CGAA 3PLKA 1O2NA 2ZO3H 2CJIA 2ZC9H 2OC1A 5E0HA 3ODFA 2BLQA 1Z8JB 3RXGA 1FDPA 3VGCC 2BDAA 1BMNH 4INHA 4DIHH 3G01A 1O2WA 4XBDA 1C2MA 2HPQH 1V2LT 2ZQ1A 1FPCH 1P2NA 2FOEA 3P70B 2J4IA 4IN1A 4Y11E 1C4V2 3SU3A 4YM9A 2OLGA 1FNIA 1HAZB 4IMZA 3NK8A 2FOHA 1O30A 1VITG 1X7AC 3E6PH 4GHQA 1TGBA 3K9XB 1GI8B 1WOFA 3NCLA 4D9QA 4NG9H 4BOHA 1XM1A 2Y81A 2P3FH 3SU2A 2VIOA 5HYOA 1ELBA 3BEIB 1PQ7A 1C2IA 2GV6A 4ZKSU 3QDZB 3VB5A 4AYVB 4A6LA 1SC8U 2J9NA 2JH6D 2VVVA 4MQAA 4OGYA 3KL6A 1SGCA 2ZFSA 1W0YH 1DLEA 2FI5E 2ANYA 2Y5GA 1O2HA 1W3CA 1EZUC 2R3UA 1LQEA 3ZVCA 1RD3B 1B7XB 1EJMA 1JRSA 1YPKH 3OYPA 3M35A 2FIRH 1GBIA 1YGCH 4MLFB 2FX6A 4O9VA 3TK9A 3H7TA 1P3CA 1G2MA 1PPZA 4Y7BA 1HAIH 4Y0ZE 5LPFA 1DWBH 4Y10E 5JBBS 3PO1B 4CBNA 1MH0A 2FXRA 1A3BH 4DURA 2HALA 1KDQB 1O5GH 1EZXC 1UTOA 3MU0A 3F9HA 3RXAA 1NRNH 2OINA 3SV7A 4MNVA 3A89A 3NUMA 5GXPA 1CT0E 1EAWA 4IN2A 4YOJA 2A7JA 1BTWA 1CGIE 5DO4H 1IQLA 1KSNA 1C5TA 3SU6A 1MTVA 1QBOA 1S0RA 3V12A 1QFKH 1AY6H 1DXWA 1GMHG 1AWFH 2V3HH 3UUZA 1TNKA 1OSSA 1ZGVA 1KXEA 3GCHC 1YF4A 3GCOA 2FOMB 3RXDA 1Q31A 1V2QT 2OD3B 3MU4A 3FP6E 4UEHH 5CHAB 3SOSA 1TNGA 2FESH 5PTPA 3ELAH 1PQ8A 2A4OA 1KTSB 4ZHLU 2CN0H 1Z6JH 2BQ6B 2VH0A 2AMPA 1DT2A 3UNQA 4DW2U 5A0BA 2P3TB 1AZ8A 2QV1A 1NO9H 4MPWA 1HGTH 3PROA 3RXHA 2V3OH 4R8TB 1O37A 1UO6A 3Q77A 1G36A 1GJCB 5EG4A 3TLOA 2JH0D 1QRXA 3TK6A 2WYJA 2WPIS 3MMGA 1Y3VA 3MI4A 6LPRA 2AMQA 1J14A 1AE8H 1WTHD 3FZDA 3ZZDA 8LPRA 1Y3UA 4O3TA 1QJ6B 4E7NA 1F5LA 1AGJA 1L1JA 1BUIA 2SGPE 3KHVA 8GCHF 1ELDE 2XWAA 1GJ7B 1BMLA 1GG6B 1LKBA 2F3CE 2VIQA 3LOXA 3M37A 1FN8A 3AW0A 1XXFA 1HLTH 1O5AB 5EXMA 1GBJA 1A5HA 1GI1A 4FU9A 3STJA 1GBKA 1TFXA 2VIVA 1JIRA 1ZMJA 1TAWA 1V2MT 3F68H 4DY7B 1P09A 3BV9B 7GCHG 1WSSH 2FLBH 1C4Y2 2OQ5A 4JCNA 4AFQA 1V2KT 3BTFE 2BZAA 2FI4E 1TMTH 1GL1A 1DE7H 3BF6H 5TCAA 4WXVA 2BY5X 3V0XA 2YNAA 4FVBA 2OC7A 2F9BH 3E8LA 3RXFA 3RXPA 1BDAA 1NTPA 1DWCH 3QWCH 2BDHA 1JRTA 3T25A 1W7GH 2FYQA 2FS8A 3L3TA 1C2GA 1HXEH 1GI4A 1MMJN 3NPSA 1L2EA 2QXJA 1SL3A 2OXSA 2BY9X 3S69A 2QC2A 1H9LB 3C1KA 3QX5H 1T8NA 1GCTB 1MAYA 5F8TA 1XVMA 4UD9H 3ITIA 3MYWA 1V2PT 2FP7B 1UVPA 1HYLA 2ANKH 1S83A 1RFNA 1DY8A 1RRKA 2QXGA 2BY8X 1GJ6A 3BEFB 1P03A 1GBEA 2P93A 3KCGH 2QF0A 4IBLH 1QCPA 3LDXH 1BITA 1O32A 1O3DA 1DICA 3CP7A 1Y5UT 5C67A 3DA9B 4UFEH 1NFXA 3EDXB 1TGSZ 2FO9A 3SV9A 1MQ5A 1P8VC 3BTHE 1BBRK 1GBHA 3GCTG 4B2BA 3ZVEA 3ZZBA 1SGQE 2C90B 3RXMA 5C3NA 3KGPA 5EPYA 1GBDA 1DUAA 1Y5BT 5A8ZA 3R0FA 1AB9B 1SQTA 1VR1H 4Y79A 1VCPA 1S81A 3LIWA 2ZU3A 3P95A 2FMJA 3QTOH 2AERH 3RC5A 1LHGH 3RXCA 5LPRA 4K1SA 3PM3A 4J2YB 1O2RA 3QGJA 4O3UA 1E34B 2XW9A 3QO6A 2ZDLA 3QN7A 3FZZA 1A0LA 1S6FA 5BPEA 2G4TA 2OUAA 2ZDNA 3KIDU 1FY5A 1YP9A 3DFJA 4Q7YA 3T28A 1KDQA 3LH3A 3VB6A 4JYUH 5EXLA 2ZTXA 2C4FH 4D9RA 3UR6A 2VWNA 1VGCC 2VNTA 5IYTA 3TPIZ 2Z9JA 1O2JA 1UCYE 2BOHB 3MNBA 2GZ8A 2G55A 2CV3A 4LZ1H 1O3PB 4Q80A 3UWIA 4MDSA 4E05H 1KXFA 3MU1A 1PPGE 3ZZ6A 1OWJA 2O8MA 1T8LA 1DWEH 1UTJA 1O5FH 1J17T 3BIVH 2IOTA 1GMCG 1TNJA 4BTIB 1FY4A 1OOKB 2WPMS 3M5NA 1NRSH 1UVOA 4FUCA 4A7IB 1JMOH 1ZPBA 3PTBA 1SR5C 2QXIA 2BDIA 3BTEE 1CA0C 4XBCA 4CRBA 1FLEE 5T3HA 4ZXYH 4AN7A 4RN6A 1MAXA 2Z9LA 3PLBA 1AVWA 4H4FA 3KQBA 3D23A 1C5RA 1RTKA 4X8VH 1ZGIA 1GI0A 1GMDG 2SFAA 4XE4A 4BANB 1GPZA 2FLRH 1OP8A 4AB9A 3PMAB 5ESTE 4INKA 2AS9A 1VCQA 4K2YA 2ZFTA 4OS6A 4ZXXH 4WVPE 3ZVAA 3ESTA 3M3TA 3OX7U 1FMGA 1O2OA 1LVOA 1SOZA 3T26A 1YKTA 5F8XA 3O8CA 2VH6A
chains in the Genus database with same CATH superfamily
3A88A 2Z3DA 3RM2H 4B1TA 3M5MA 2FEQH 1WXRA 1HDTH 4MNWA 1P11E 3GISB 1ZTKA 1NFYA 3EA8A 3AAVA 2ODQA 4B6FA 1BRAA 5EPNA 1J9CH 2BDCA 2G5NA 3SV8A 1D3TB 1Z1JA 6ESTA 2OC8A 1SI5H 2O8TA 4D7GA 5FL7D 4NGAH 5FBEA 1ID5H 2PP6A 4LOYH 5A8YA 4ABFA 1ZJKA 1V2OT 2ZHWH 3L6PA 2PKSC 5HM2A 1GHBG 1NPMA 5EOKA 1UK3A 1Z6EA 1UCYH 2M2AA 2ZPQA 4AZ2B 1GI5A 5EQSA 1RS0A 3RMLH 4CR5A 3NRLA 3OEED 1QJ1B 4ZAEA 5LH8A 3T5FH 2XBYA 3UY9A 1WAYB 3PV5A 1G37A 4IGDA 1G2LA 1DANH 1OXGA 3SJIA 2ZHEH 1QY6A 1O3KA 1S5SA 4DT7B 1TGCA 2R0LA 1P0SH 1GMCF 5E0JA 1THSH 5HIZA 1TX6A 3BTTE 1JBUH 2W6JD 5DP5A 4KKDA 1OP0A 3SNBA 3M36A 9ESTA 1C2FA 5KECA 2ZCLP 1QL8A 2RDEA 4BAQB 4Q63A 1C5XB 1GVZA 4NIWA 3T27A 2RCEA 4IS5A 1DOJA 4F49A 5F03A 3T29A 1AUTC 2BX4A 3F9GA 1ETSH 1P9UA 4OS4A 4WJG2 3SJ9A 2KX4A 2J2UA 3KQEA 5DP7A 1HAGE 1P01A 3RXIA 1YPHC 2B7DH 1O3IA 1O2TA 4Y71A 4CH2B 1ZJDA 1OWEA 1NU7B 3F2HA 4X6MA 1TRYA 3HGPA 4XBBA 1C5QA 3F9FA 2SNVA 1KLTA 3SI4H 4DOQA 1DSUA 1O5CB 2BVSH 2A5KA 1KYNA 1TE0A 2Y80A 1FQ3A 1DY9A 1ZLRA 4ABDA 1D3QB 1CE5A 1OWDA 1WV7H 3HK6B 4BNRA 5EJZA 3SNCA 2W7SA 1HJ9A 5J4QA 1L4ZA 3PO1C 2A0QB 3TH4H 1FUJA 4AGKA 1P2MA 2O8WA 1F92A 1YLDA 1IHTH 1BCUH 3ZV8A 2F9NA 3K2UA 2QCYA 2VWLA 4MNYA 5EIYA 1EATA 2GMTC 1O2XA 3NXPA 1NZQH 2TRMA 2BLOA 2M5TA 3SU5A 3UPEA 2WPHS 2Y82A 3DUXH 2IJOB 1UTQA 5C1XA 2BTCE 1ZTLA 1IQNA 2VIPA 1HJAB 2XWBI 3MH5A 2FTMA 1O0DH 3GY4A 2ZU4A 3OY5U 1GHBF 1LCYA 5G4BA 1JIMA 2Z7FE 3ZZAA 2ZWLH 3DD2H 1SGIB 1GHAF 3I29A 1HNEE 1P2JA 1C5ZB 5L2ZH 2A2XH 3K65B 2K1QA 4FU7A 4YZUA 3SNAA 4B6EA 4X0WU 1ELAA 1O38A 1FZZA 2A5IA 3LKWA 1HAPH 1ELFA 2Y7ZA 1V2ST 1TYNA 2F9VA 4NIVA 1FN6A 4OS7A 3SNDA 2ZNKH 5K0HA 1T4VH 2QYIA 3BTWE 1MTUA 2P95A 5B6LA 2ZF0H 3MWIU 1XKAC 2ZFFH 3DSOA 4HGCA 2NU2E 4FUDA 2ALPA 1D9IA 1QQ4A 1GI3A 2BLWA 1DDJA 3A81A 1TA2A 3NWUA 1NBMD 1XKBC 1C5SA 5DKMA 3STIA 4Y8ZA 2VWMA 1HJ8A 3RXKA 2SGDE 2WYGA 1DXPA 5DP9A 2ZCKP 2NWNA 1L1NA 2ZHDA 3P8OA 5C5NA 4P02A 3O8RA 4GCHF 3TU7H 1ZHRA 4I8HA 3V7TA 1F0SA 2ODPA 4ABGA 2OC0A 1GHXH 3RXEA 2PKSB 1O3GA 1HAXB 3OEHD 4BXWA 3UNRA 5TCCA 7ESTE 3TNSA 5L30H 5C1YA 1GVKB 3AW1A 1VKYA 2QGRA 3E3TA 1QURH 4CR9A 1TALA 1ZSLA 4ACAA 1C2HA 2P59A 5DJ7A 2BXTH 1IQGA 3F0PA 1LQDB 1O5DH 1C1WH 1CA8B 1NESE 4MNXA 2F9OA 3RXJA 5HIYA 1GDUA 2FOGA 2UUJB 2PUXB 2Q6FA 1QHRB 4JYVH 3FKSD 4DGJA 1TNHA 1XXDA 3OSYA 5GPIB 2A4QA 1PPBH 1GCTC 5EODA 2B9LA 1K1MA 1GDNA 2HPPH 4GSOA 9LPRA 2H9TH 2RA0A 1BMAA 1SQRA 3LC3A 2VU8E 3MO6A 2VGCB 2BZ6H 3KF2A 1WQSA 3MFJA 4X1QU 4BTTB 2ZECA 4NZQA 1E1RD 1O5EH 1NRPH 2ZKSA 3WW7A 1AI8H 8GCHG 1A1RA 2QXHA 1AMHA 2IN2A 3T2NA 1MTWA 1XX9A 4H6SB 4LXBH 3PRBA 4P00A 2EY4C 3DT0H 5EW2H 1XVOA 3CS7A 3QUMP 3P8FA 1P57B 3HATH 2WSSD 1AB9C 1O2QA 3ODDA 1SGTA 3TJVA 1C1UH 2CMYA 2C8ZB 2HLCA 4NA9H 1N6YA 1IOEA 1KXAA 8ESTE 1KXDA 2G81E 1O3LA 3Q3YA 2VJ1A 4RSPA 2GMTB 1AD8H 1O3MA 3S9BA 1GJ8B 1E1QD 1K1JA 2PTNA 4CRDA 4B75A 4IW4E 2YOLA 1V2JT 1BRUP 1GJAB 3PV4A 1GJ5H 3V13A 3RLYH 1HFDA 5F6MA 3HKJB 3MO9A 4FUEA 1GHYH 2XBWA 2EI7A 4FVDA 3ZZ8A 1A5IA 1HRTH 3ZZ4A 2XRCA 4WMEA 1AVGH 3U9AH 4GAWA 1KLIH 1SGDE 3ZVDA 4NFFA 2ZDVH 1ETRH 1NC6A 3TH3H 2TGAA 3S9AA 4X2YA 2BD9A 3A8DA 4ZMAH 3RLWH 1AHTH 1MKXH 4WH8A 1NU9A 1J15A 2ZFPH 3FO8D 4D7FA 3Q00A 1TB6H 1ZHPA 3HK3B 1ESBA 1OP2A 3EQ0H 3M7TA 4DVAU 2UUFB 2KCYA 1VITH 2OK5A 1SGNE 5HGGA 3IITA 4NA8A 2UWOA 3RU4D 2JETB 1AUJA 1EFRD 1YM0A 3U98H 4JK5A 2ZDMA 1C5NH 3LGIA 1OYTH 2F4LA 2ESTE 3URDA 5A2MH 1TPAE 5DPAA 2D2DA 4FETA 2B5TB 2BMGB 1C2LA 2RDLA 3MTYA 3EYDA 1AZZA 1WTGH 2C8XB 1TRNA 5AFYH 3U1IB 2IPHA 2ZGJA 2P8OB 1OWIA 2BVXH 3AAUA 4D8NA 2B0FA 3TGJE 1ZPCA 2XC5A 4KTUA 3B23B 2GZ9A 2A2QH 1GHWH 1MTNB 1HBTH 3RDZA 4K3JA 2G5VA 3F3BA 1TMUH 1RJXB 5LGOA 1ESTA 4ABHA 1K28D 1ZTJA 1XUKA 2WINI 1SMFE 1F7ZA 1YPHE 2SNWA 5ESBA 3TNTA 1YPGH 4Q4LA 3A8AA 1C9TA 1Q2WA 3A8BA 1TIOA 3MH4A 5EXNA 2A32A 4Z6AH 3Q76A 4ZCNA 1K1OA 1RTLA 2WHXA 1LHCH 2XBVA 4XOJA 3U28C 1P3EA 4OS5A 1A3EH 3LGUA 5LPEA 1ZR0A 1S84A 2ZP0H 4ASUD 2GT8A 1AU8A 1FJSA 4YOIA 1O3EA 1TBQH 2AYWA 4DT4A 3RC4A 1GCDA 1THRH 7KMEH 1EZSC 4PROA 2J95A 1VJAU 3M61U 4IMQA 1O2VA 1F0RA 1S6HA 4B2AA 3ZZ3A 4XSKU 1PYTD 2WPJS 1ZYOA 5T1VA 4WMDA 5TJXA 1TQ7B 2ALVA 4Y0YE 2KAIB 3RXSA 1SFIA 1EB2A 1U6QA 2ZQ2A 3E90B 4K8BA 5FX6A 4WH6A 3H5CB 4ZROA 3ZZ7A 1GBMA 2PTCE 4GVUA 1GL0E 2GCHG 2LNCA 1SSXA 2ZZUH 3C27B 1ZSKA 4IC5A 4X8UH 2O9QA 4M9FA 4A5TS 1OWKA 3SO3A 3CS0A 3CNRA 1GJDB 1YBWA 1ZMNA 3RMMH 1KXBA 1UTPA 3N7DA 2V7QD 3UOUA 1A4WH 1G9IE 4BAMB 3ATKA 1HB0B 1D4PB 4UDWH 2G51A 3UTUH 1W13U 2C93B 1C4U2 1TONA 3BIUH 3PWCA 2G00A 1ABIH 1LO6A 2BD3A 4WMFA 1H8HD 1O3HA 5JB8S 2BB4A 1W10U 3RMOH 1C5LH 1GBTA 1ELTA 1NN6A 2BYAX 1YC0A 2THFB 4RKOB 1COWD 4HZHA 1D3PB 4UFDH 2GCTB 4YTAA 1PQAA 4ISHH 2ZPSA 2VWOA 3E1XB 2BD7A 2NU0E 2Y5FA 2A31A 4AGJA 2ODYB 1RTFB 2PHBA 4Y6DA 3FAOA 1YPJH 1XUGA 1F0UA 2GT7A 5C17A 2A7CA 2WPKS 3FN8A 3GY7A 1UJ1A 3M7UA 4CRCA 3S0NA 3RP2A 2ZFRH 3SBKA 2FX4A 4I8KA 4U32A 1ANBA 1CBWB 3LONA 1D6RA 2FTLE 1MKXK 3LGTA 1K21H 1SGRE 3UNSA 2YNBA 1FIWA 2RG3A 3TJUA 3E0NB 1N6XA 3FANA 2AMDA 1BTZA 2J97A 3MOCA 1B0FA 2BX3A 2CF9H 1YPEH 5FXLA 1UK4A 3QTVH 1W8BH 2TIOA 1HJAC 1TLDA 2H9HA 1ANEA 2V35A 1V2NT 1GHZA 1EOLA 5FCKA 2HGTH 1H8DH 3MNSA 1TWXB 1UVUH 2VBCA 4THNH 2O8LA 4E06H 1O2ZA 2DUCA 4ZH8A 4RI0A 1AFEH 2C3SA 4GHTA 1Y5AT 1YLCA 2SGFE 2IPQX 2P3UB 3E16B 4F4OC 1NS3A 1P12E 1GJBB 1T31A 2GCHF 3PMJA 4TWWA 1HPGA 4YT6H 5EJ1A 1O3BA 2ZPRA 5JBAS 3TVJB 3U1JB 5IK2D 2GJGA 6CHAC 1O3JA 3L33A 1CO7E 3ZVBA 4ISLA 2DE9A 2HOBA 4Q7XA 1A7SA 2C8WB 3ZVGA 4AX9H 1BQYA 2A4RA 2G52A 3SNEA 3GCNA 4DIIH 2JJ2D 4Z1MD 3K6ZA 4AORA 1OHHD 4U2WA 4NCYA 5C0TA 4JZEH 4MPXA 3SUGA 4AFZA 4OGXA 3TJNA 1W12U 3DSGA 2ZCHP 3F2FA 2BHGA 1XUFA 1QBNA 3EE7A 1K2I1 1KMHB 4VGCB 3R3GB 5ETXA 1LMWB 2ZTZA 4SGBE 5A8XA 1C5UA 2I6QA 4OS1A 2H2ZA 2AGGX 2CHAC 4X8TH 3CENA 3A83A 5HM9A 1KIGH 2WUCA 2ZG0H 3GS9A 1GHAG 2PSXA 4ZKRU 1BRBE 3S7KB 4Y7AA 1JWTA 2F9UA 2BQ7B 5GDSH 2EI6A 4ZUHA 3SV2H 1C2DA 1MZAA 2BDBA 1KTTB 2XCNA 2ANMH 2QF5A 3W94A 3UB0A 2XCFA 1TOMH 3VPKA 3SI3H 2GTBA 2W3KA 3O8BA 1A0HB 1EASA 1P02A 2GX4A 3RXVA 2KAIA 2LPRA 1AWHB 2UWLA 1BHXB 3PYHA 2W26A 2VINA 5EQRA 1ABJH 4JK6A 2FDAA 2O8UA 1DSTA 1Y3WA 3LT3A 3RXRA 3A7WA 2F9PA 3GOVB 5DGJA 2VIWA 5C2ZA 2QF4A 1SG8B 1H8ED 1S6LA 1RXPA 2BM2A 4ISNA 4X1NU 2OP9A 2QE7D 4MPUA 3A7TA 1BTHH 2VGCC 1NRRH 3KEEA 3GY2A 1Z1IA 1P2IA 4DJZB 3A80A 2F83A 1NFUA 2D8WA 3ZV9A 4GCHG 5T6DA 3A85A 1O2YA 2HNTF 1CQQA 4TPYA 1WBGB 1PJPA 1TNIA 2EA3A 2BVRH 1GVLA 1AQ7A 2FOCA 1GI2A 2WUBA 4JZIA 1GDQA 1MTSA 3N99A 5E8EH 5JDUB 1JOUB 1FX0B 2TPIZ 5T6FA 4CRGA 2H9EH 1C1OA 1NT1A 4YLQH 5AF9H 3S7HB 1BTPA 1XUIA 3F6UH 4X1RU 4ABJA 2VVCA 1BA8B 2SGEE 4AC9A 5A0CA 1DITH 5JPMH 3MO3A 3BG4B 7LPRA 1TBZH 1UK2A 4BXSA 2A4GA 1OPHB 4MG3A 3UR9A 1UVSH 4I86A 5B6OA 4FUFA 1L1GA 5ABWA 4FXGH 1W14U 5AHGH 5C5OA 1G32B 2Y6TA 1FXYA 1Y8TA 3RU4E 2XC4A 1SBWA 1J8AA 1O34A 1C1VH 1EZQA 1YPLH 1C1QA 1C2EA 3A7YA 1EP6A 1LHFH 1V3XA 3B9FH 1ELCA 5DP8A 5JYIA 3EA7A 1HAYB 3OU0A 3GDVA 2QY0B 4FU8A 2H5DA 2J92A 1NM6A 4FUJA 4GLYA 1MCTA 2RA3A 6CHAB 1INCA 1XMNB 3PRDA 1V6DA 3DCLA 2VVUA 1EJAA 2JETC 1O2PA 3AVZA 2R3YA 1EX3A 1UTKA 2Z3CA 1LPZB 5T6GA 2BY6X 1BBRE 2TGDA 4WY3A 1EB1H 2P8OC 3GY6A 1AKSB 1TX7A 4R0IA 2HLDD 2FS9A 1MTNC 1T7CA 4F55A 1SOTA 5FX5A 1C5VA 1EPTB 3SU1A 2AIQA 5EU8A 2KCAA 1G3BA 5KGOA 3URCA 2CHAB 3MQKC 1ARCA 2TGTA 4WXIA 3ZZ5A 4X2VA 3PB1E 2XBXA 3SJ8A 2AIPA 2JKHA 2ULLA 4FUBA 2HRVA 1CSOE 1ESAA 1WCZA 2R0KA 4O97A 1KXCA 3KYFA 4ABBA 1A2CH 1UCYK 2GZ7A 3W1EA 4ZHMU 2FOFA 4Q2KA 4CBOA 3M5OA 3P92A 4ASHA 1B5GH 2EEKA 3OE7D 4ISIH 2ZGHA 3U8OH 4HTCH 2FOAA 3ZYEA 5EW1H 2AFQB 3VEQB 4AFUA 3KQCA 2QAAA 3E91A 5JBCS 1HAHH 5EGMA 1DS2E 4AB8A 3QLPH 3RC6A 1S82A 5AVDA 3VXEH 1MCVA 2Z9GA 2HNTC 3GYLB 3H7OA 4B74A 1SLXB 1IQKA 3QGNB 2GGVB 1OYQA 2YMSD 3BTDE 1EKBB 1EOJA 1QIXB 3RXTA 3SU4A 3ZYDA 1SVPA 5FCRA 2C8YB 4LK4A 1P10A 3EA9A 4I32A 1GWAA 1LDTT 3A7XA 3D62A 1KY9A 3IWMA 3SV6A 1H4WA 2NU1E 3TGIE 3OTJE 3SJOA 1ANDA 2A45B 2ZGXH 5CMXH 4NA7A 2ZGCA 3A86A 3E0PB 1OS8A 1HUTH 1A5GH 1C9PA 1IQHA 1O39A 5FPSA 3SUEA 1WYKA 3M3SA 5E2OA 1S0QA 2AEIH 1DWDH 2KM0A 1TX8A 3ATIA 1GI6A 4KP0A 1XUJA 5AFZH 1DLKB 4K8YA 2FYRA 2BD4A 1DUEA 2BDGA 3PMHB 2XNIA 3P8GA 1C2KA 3RXLA 1FONA 1Y3XA 3OY6U 1C1SA 1F5RA 3FVFB 5HMAA 2ZU5A 5JB9S 2Q6GA 3SW2B 1WDIA 1EAXA 1BBRH 2A5AA 1LVBA 1RGQA 5C94A 1MUEB 1O35A 4A1VA 5C20A 4AFSA 1GBAA 3A7VA 3AK5A 2K0QA 3UQOA 1M9UA 4YO9A 5GJ4B 1ELEE 4Z0KA 5GNDA 1SGEE 1P2KA 1BHXF 1ZMLA 2GCTC 5A09A 1LVYA 1K0HA 3IG6B 2P16A 3GY5A 1ZOMA 4GUXA 3VB7A 1QRZA 4XDEA 2ZHFH 3SUDA 1Z7KA 1ANCA 5E2PA 1UHBB 1GBFA 1QA7A 3M7QA 1BB0B 1O3CA 5DK1A 1LKAA 3F9EA 5IDKA 5CDFE 1LHEH 1D3DB 2XC0A 3ATLA 2SGAA 5GCHG 1HAVB 4HI3A 1QL9A 2GV7A 3Q3XA 3ENSB 1CBWC 1GGDC 1P9SA 4Y8YA 2L6OA 1RIWB 1V2VT 2ZEBA 4CHAC 1MU8B 1VJ9U 1VCWA 3BSQA 3GY8A 3ATMA 3GICB 2L74A 4X6OA 5I25A 5C1UA 5EJLA 1YY3A 1PQ5A 3MU5A 2JIZD 1TBRH 2WPLS 1C5WB 1YCPM 4F48B 1O3NA 3QZQA 1SGPE 1AO5A 1GBCA 1O2KA 1O33A 4K1TA 2GP9B 1UVTH 2GVFA 1CU1A 2Z94A 1C1TA 1H8IH 2Z3EA 1P05A 1TA6A 1O2UA 4B73A 1HAOH 5GIBA 3K6YA 4JZ1A 2OBQA 4X6PA 1CT2E 1VITF 4CH8B 2XXLA 3D49H 4QT8C 3GYMA 4D76A 2J98B 1FY8E 1AVXA 1CVWH 2OTVA 1E38B 3A82A 3EGKH 1BIOA 4FUGA 1QL7A 3M3VA 3RU4T 1SB1H 3EE0B 1SLVB 4I31A 4K69A 1GJ9B 1QNJA 1NROH 1FY3A 2D1JA 2ZU2A 3EAJA 4KTSA 1V2WT 4A1TA 1HXFH 1AKSA 1Q3XA 3RXQA 2PWXA 1F5KU 1MKWH 4OS2A 4ZKOU 5JBTA 4BAOB 4HFPB 4AOQA 4MTBA 1P2QA 2W3IA 3JZ1B 1EPTA 3OFND 4TY7A 1HIAA 1LVMA 1AFQC 1DX5M 1P2OA 1QJ7B 4TYDA 4WWYA 3ZZCA 3SZNA 1SQOA 2GKVE 2Z9KA 2Q6DA 5EQQA 2UUYA 4X2XA 3I78A 3VGCB 3MH6A 1O3FA 4B71A 4UONA 2EQNA 4VGCC 1T8OA 2TBSA 1TRMA 4E7RG 2BY7X 2LP6A 4DG4A 2PSYA 1W0ZU 3S9CA 2V0BA 4BAHB 3U69H 4AG2A 4B76A 3BTME 1FAKH 3BTKE 1W11U 5L2YH 1K1IA 2J5UA 1T32A 1NRQH 5DP3A 1V2RT 4JYTA 2ZIQH 1H9IE 3LJOA 3D65E 2OQUA 5DSFA 3VB4A 5GCHF 1SQAA 2ZFQH 1GMHF 3PTNA 5C0UA 1G30B 1IAUA 1ZRKA 3NZIA 1K1NA 2W7UA 1XUHA 3TK5A 4AG1A 3ZZ9A 2FODA 1FIZA 3LH1A 1EXFA 2H1UA 1E37B 1SGYE 5SGAE 2HVXA 5DN6D 4X8SH 4YT7H 4MPVA 1L0ZA 3SHCH 3UREA 2PKAB 1PPCE 1Z8GA 1ZZZA 4YESB 4UE7H 4X2WA 2KCPA 2BLVA 3GDUA 1EJNA 4RT0A 4X1SU 3TGKE 2VIDA 1K1LA 4ZKNU 1PYTC 2V6NA 1N8OC 2YMSB 3RXBA 4FUHA 1J16A 2Y5HA 1FY1A 4X6NA 4AYYB 1PPFE 2ASUB 3UOPA 2OBOA 2UWPA 2ZU1A 1WUNH 2J34A 4I33A 1QA0A 2AGEX 1THPB 2D26C 1O3AA 1C1RA 4UFGH 3SQHE 4XD7D 3HPTB 3SGAE 2H5CA 1DVAH 3LGVA 1A0JA 1UTNA 4J1YA 4K5ZA 1N1LA 1Z71A 1GI7B 2Z6BD 1MQ6A 1QB1A 1TPSA 1ZSJA 1QTFA 3BTQE 1V2UT 3WWBA 3HGNA 3RUOA 3PWBA 4CREA 4I8GA 4BAKB 1GGDB 3GCHB 5BRRE 1GI9B 3I77A 2STAE 2BD8A 4CHAB 1BTXA 1UHBA 1BMMH 3RMNH 2R9PA 2QA9E 3BG4C 1BJVA 1NY22 2WV5A 1CHOG 2JH5D 2BOKA 2ZDAH 7GCHF 2AH4X 1W7XH 4I8JA 1B0EA 5KEDA 1TABE 3V3MA 1HAVA 1BRCE 1QQUA 1TPOA 3MU8A 4NFEA 3U8TH 4A1XA 1O2LA 1EUFA 2EI8A 1C5OH 2BQWB 2BD2A 2FM2A 1NFWA 2KR7A 4MVNA 3SQEE 3LPRA 3SGBE 2SGQE 3A87A 1SLUB 2ANWA 1IHSH 3F1SB 3DHKH 1DM4B 2ZDKA 2QIQA 1HV7A 3WWFA 4H42U 5F8ZA 2HNTE 2ZTYA 1BZXE 1NBME 4I8LA 3SUFA 3BEUA 1L4DA 1QGFA 2J94A 4B2CA 1BT7A 1YCPH 1P06A 3A84A 3GDSA 3RXOA 3GY3A 1FV9A 2CF8H 4ABIA 2RFKC 1K9OE 1LPKB 1QB6A 1C5PA 4A92A 3P8NA 1W2KH 3KQ5A 1VZQH 2GDDA 1IQEA 5DG6A 1TQ0B 4XFQA 1C1MA 3FP7E 1EAIA 2J98A 3W95A 1LTOA 4KELA 1MKWK 1MBMA 1AFQB 3O8DA 1E36B 2FZZA 2XTTB 3N7EA 1O2SA 3GCTF 3WY8A 1GBBA 1MBQA 4ZHAA 2ZGBH 1C1NA 3JZ2B 3F2GA 3N7OA 1BTYA 1JXPA 3BTGE 1GHVH 1TGNA 2UUKB 1EPTC 4JZDH 2Y7XA 4TSFD 5DP6A 2A1DB 2CXVA 3M5LA 1EQ9A 3ZVFA 3LU9B 3QK1A 1T4UH 1WU1A 1KLJH 3T62A 3LGYA 2DE8A 2XYAA 4TT3D 2PV9B 2P94A 1UMAH 3MNCA 1WQVH 1AIXH 4NSVA 1PFXC 1Z8IB 5FPYA 5J4SA 1QBVH 1UTMA 3UQVA 2FWWA 2B8OH 1BTUA 4O03A 5I46H 4X1PU 2Q1JA 1C1PA 1TOCB 1ELVA 1S85A 3VXFH 1C2JA 1EAUA 1AE5A 1C5YB 3MNXA 2ZI2H 3SGQE 2F43B 2PGBB 1OWHA 4ABEA 4I7YH 3KN2A 5FPTA 1PPHE 1IQFA 1GBLA 1CHOF 4NIXA 4JZFH 4NWLA 1FPHH 5L6NH 1QR3E 2NU4E 5HXFA 3RM0H 1Y59T 3A8CA 1CHGA 1MZDA 4LZ4B 3UFAA 1A61H 3NKKA 4NIYA 3UWJH 1BOQA 1YPMH 2A7HA 2PFEA 2PUQH 3Q3KA 4K60A 4NZLA 1O36A 1OX1A 1ARBA 5FBIA 4KTCA 2Z9IA 1N8OB 1H9HE 4K1EA 2KFWA 3SU0A 4FUIA 4TWYA 5CHBA 4TY6A 2J38A 3TJOA 6GCHG 1TPPA 1G3EA 1GMDF 2PKAA 1H1BA 4YLUA 5FAHA 3TH2H 3FFGA 1QB9A 1MU6B 1LHDH 1QZ8A 1C5MD 2HWLB 2WV9A 4RT1A 4ABAA 2PGQB 3KQDA 3DSPA 2FI3E 5K7RA 1K1PA 2VB0A 1SGFG 1CGHA 1DPOA 4IC6A 2R2WU 1G3DA 3LJJA 1HCGA 2ILNA 4JMYA 2F91A 1SPJA 2PR3A 1MD8A 1SFQB 1VGCB 1YYY1 1Z8RA 1E35B 1O3OA 3P17H 3MHWU 2PW8H 5DP4A 5CE1A 3SJKA 4TPIZ 1ZPZA 1AN1E 2BXUH 4NWKA 1Y3YA 1ELGA 1ORFA 2WV4A 5E0GA 3RXUA 3TIUA 3FP8E 1G3CA 2FOBA 1SHHB 3SN8A 4UFFH 3U8RH 1O2GH 4CRAA 5A0AE 2G4UA 1A46H 2EC9H 1BJUA 3ATWA 4DCDA 1DFPA 1CA0B 1QRWA 3OAAD 2PLXA 1IQIA 1E0FD 1OKXA 4INLA 1FI8A 3P6ZB 1IQJA 1FAXA 1P04A 8KME2 1TGTA 1O5BB 1F0TA 3SHAH 4GPGA 1K22H 3A7ZA 1RIWC 1E79D 2K8IA 3HKIB 4M7GA 1ZHMA 2W5EA 4KGAA 4WF8A 2QN5T 2NU3E 2BDYA 1YCPK 3FOAA 4U01A 5CHAC 2ZA5A 3DFLA 1O31A 4BTUB 2WZQA 4H6TA 1IQMA 4U30A 2FPZA 1SGFA 5FHTA 3SORA 1SLWB 3BN9A 3UIRA 1CGJE 3LGWA 3VFEA 1O2MA 4SGAE 2OCVB 3TITA 2GDEH 3PLPA 2H6MA 4NSYA 3KNXA 5H4IB 1CT4E 4CRFA 3LC5A 1UTLM 3MH7A 3QZRA 2TGPZ 3VB3A 1LPGB 3B8JA 3SYJA 1ACBE 1GJ4H 1HIAB 2R2MB 2AGIX 4YOGA 2G8TA 1V2TT 2ZHQH 1D6WA 6GCHF 4Y76A 1SHYA 4ISOA 1PPEE 4Y8XA 4ESTE 3F0OA 2BD5A 1EP5A 1MD7A 3AASA 3PMBB 3ZIAD 2STBE 1ETTH 3BG8A 2I6SA 4Q7ZA 1T8MA 1TNLA 4RKJB 1TMBH 1F2SE 5GWZA 1GG6C 2QF3A 2GD4B 1O2IA 1ZRBA 2CGAA 3OTPA 2KZ4A 3PLKA 1O2NA 2ZO3H 2CJIA 2ZC9H 2OC1A 5E0HA 3ODFA 2BLQA 1Z8JB 3RXGA 1FDPA 3VGCC 2BDAA 1BMNH 4INHA 4DIHH 3G01A 1O2WA 4XBDA 1C2MA 2HPQH 2V3MA 1V2LT 2ZQ1A 1YLNA 1FPCH 1BMFD 1P2NA 2FOEA 3P70B 2J4IA 4IN1A 4Y11E 1C4V2 3SU3A 4YM9A 2OLGA 1FNIA 1HAZB 4IMZA 3NK8A 2FOHA 1O30A 1VITG 1X7AC 3E6PH 4GHQA 1TGBA 3K9XB 1GI8B 1WOFA 3NCLA 4D9QA 4NG9H 4BOHA 1XM1A 2Y81A 2P3FH 3SU2A 2VIOA 5HYOA 1ELBA 3BEIB 1PQ7A 1C2IA 2GV6A 4ZKSU 2IJD1 3QDZB 3VB5A 4AYVB 4A6LA 1SC8U 2KCOA 2J9NA 2JH6D 2VVVA 4MQAA 4OGYA 3KL6A 1SGCA 2ZFSA 1W0YH 1DLEA 2FI5E 2ANYA 2Y5GA 1O2HA 1W3CA 1EZUC 2R3UA 1LQEA 3ZVCA 1RD3B 1B7XB 1EJMA 1JRSA 1YPKH 3OYPA 3M35A 2FIRH 1GBIA 1YGCH 4MLFB 2FX6A 4O9VA 3TK9A 3H7TA 1P3CA 1G2MA 1PPZA 4Y7BA 1HAIH 4Y0ZE 5LPFA 1DWBH 4Y10E 2YMSC 5JBBS 3PO1B 4CBNA 1MH0A 2FXRA 1A3BH 4DURA 2HALA 1KDQB 1O5GH 1EZXC 1UTOA 3MU0A 3F9HA 3RXAA 1NRNH 2OINA 3SV7A 4MNVA 3A89A 3NUMA 2JJ1D 1CT0E 5GXPA 1EAWA 4IN2A 4YOJA 2A7JA 1BTWA 1CGIE 5DO4H 2XOKD 1IQLA 1KSNA 1C5TA 3SU6A 1MTVA 1QBOA 1S0RA 3V12A 1QFKH 1AY6H 1DXWA 2CK3D 1GMHG 1AWFH 2V3HH 3UUZA 1W0KD 1TNKA 1OSSA 1ZGVA 1KXEA 3GCHC 1YF4A 3GCOA 2FOMB 3RXDA 1Q31A 1V2QT 2OD3B 3MU4A 3FP6E 4OM9A 4UEHH 5CHAB 3SOSA 1TNGA 2FESH 5PTPA 3ELAH 1PQ8A 2A4OA 1KTSB 4ZHLU 2CN0H 1Z6JH 2BQ6B 2VH0A 2AMPA 1DT2A 3UNQA 4DW2U 1SKYE 5A0BA 2P3TB 1AZ8A 2QV1A 1NO9H 4MPWA 1HGTH 1UW7A 3PROA 2XNDD 3RXHA 2V3OH 4R8TB 1YWUA 1O37A 1UO6A 3Q77A 1G36A 1GJCB 5EG4A 3TLOA 2JH0D 1QRXA 3TK6A 2WYJA 2WPIS 3MMGA 1Y3VA 3MI4A 6LPRA 2AMQA 1J14A 1AE8H 1WTHD 3FZDA 3ZZDA 8LPRA 1Y3UA 4O3TA 1QJ6B 4E7NA 1F5LA 1AGJA 1L1JA 1BUIA 2SGPE 4ACBA 3KHVA 8GCHF 1ELDE 2XWAA 1GJ7B 1BMLA 1GG6B 1LKBA 2F3CE 2VIQA 3LOXA 3M37A 4FOUC 4YXWD 1FN8A 3AW0A 1XXFA 1HLTH 1O5AB 5EXMA 1GBJA 1A5HA 1GI1A 4FU9A 3STJA 1GBKA 1TFXA 2VIVA 1JIRA 1ZMJA 1TAWA 1V2MT 3F68H 4DY7B 1P09A 3BV9B 7GCHG 1WSSH 2FLBH 1C4Y2 2OQ5A 2WPDD 4JCNA 4AFQA 1V2KT 3BTFE 2BZAA 2FI4E 1TMTH 1GL1A 1DE7H 3BF6H 5TCAA 4WXVA 2BY5X 3V0XA 2YNAA 4FVBA 2OC7A 2F9BH 3E8LA 3RXFA 3RXPA 1BDAA 1NTPA 1DWCH 3QWCH 2BDHA 1JRTA 3T25A 1W7GH 2FYQA 2FS8A 3L3TA 4XRNA 1C2GA 1HXEH 1GI4A 1MMJN 3NPSA 1L2EA 2QXJA 1SL3A 2OXSA 2BY9X 3S69A 2QC2A 1H9LB 3C1KA 3QX5H 1T8NA 1GCTB 1MAYA 5F8TA 1XVMA 4UD9H 3ITIA 3MYWA 1V2PT 2FP7B 1UVPA 1HYLA 2ANKH 1S83A 1RFNA 1DY8A 1RRKA 2QXGA 2BY8X 1GJ6A 3BEFB 1P03A 1GBEA 5F53A 2P93A 3KCGH 2QF0A 4IBLH 1QCPA 3LDXH 1BITA 1O32A 3H09A 1O3DA 1DICA 3CP7A 1Y5UT 5C67A 3DA9B 4UFEH 1NFXA 3EDXB 1TGSZ 2FO9A 3SV9A 1MQ5A 1P8VC 3BTHE 1BBRK 1GBHA 3GCTG 4B2BA 3ZVEA 3ZZBA 1SGQE 2C90B 3RXMA 5C3NA 3KGPA 5EPYA 1GBDA 1DUAA 2HVYB 1Y5BT 5A8ZA 3R0FA 1AB9B 1SQTA 1VR1H 4Y79A 1VCPA 1S81A 3LIWA 2ZU3A 3P95A 2FMJA 3QTOH 2AERH 3RC5A 1LHGH 2AHME 3RXCA 4K1SA 5LPRA 3PM3A 4J2YB 1O2RA 3QGJA 4O3UA 1E34B 2XW9A 3QO6A 2ZDLA 3QN7A 3FZZA 1A0LA 1S6FA 5BPEA 2G4TA 2OUAA 2ZDNA 3KIDU 1FY5A 1YP9A 3DFJA 4Q7YA 3T28A 3KYGA 1KDQA 3LH3A 3VB6A 3VG8A 4HG6A 4JYUH 5EXLA 2ZTXA 2C4FH 4D9RA 3UR6A 2VWNA 1VGCC 2JDID 2VNTA 5IYTA 3TPIZ 2Z9JA 1O2JA 1UCYE 2BOHB 3MNBA 3SZEA 2GZ8A 2G55A 2CV3A 4LZ1H 1O3PB 4Q80A 3UWIA 4MDSA 4E05H 1W0JD 1KXFA 3MU1A 3PV2A 1PPGE 3ZZ6A 1OWJA 2O8MA 1T8LA 1DWEH 1UTJA 1O5FH 1J17T 3BIVH 2IOTA 1GMCG 1TNJA 4BTIB 1FY4A 1OOKB 2WPMS 3M5NA 1NRSH 1UVOA 4FUCA 4A7IB 1JMOH 1ZPBA 3PTBA 1SR5C 2QXIA 2BDIA 3BTEE 1CA0C 4XBCA 4CRBA 1FLEE 5T3HA 4ZXYH 4AN7A 2W6ID 4RN6A 1MAXA 2Z9LA 3PLBA 1AVWA 1MABB 4H4FA 3KQBA 3D23A 2LELA 1C5RA 1RTKA 4X8VH 1ZGIA 1GI0A 1GMDG 2SFAA 4XE4A 3UAIC 4BANB 1GPZA 2FLRH 1OP8A 4AB9A 3PMAB 5ESTE 5HKKD 4INKA 2AS9A 1VCQA 4K2YA 2ZFTA 4OS6A 4ZXXH 4WVPE 3ZVAA 3ESTA 3M3TA 3OX7U 1FMGA 1O2OA 1LVOA 1SOZA 3T26A 1YKTA 5F8XA 3O8CA 2VH6A
chains in the Genus database with same CATH topology
3A88A 2Z3DA 3RM2H 4B1TA 3M5MA 2FEQH 1HDTH 4MNWA 1P11E 3GISB 1ZTKA 1NFYA 3EA8A 3AAVA 2ODQA 1BRAA 5EPNA 1J9CH 2BDCA 2G5NA 3SV8A 1D3TB 1Z1JA 6ESTA 2OC8A 1SI5H 2O8TA 4D7GA 4NGAH 5FBEA 1ID5H 4LOYH 5A8YA 4ABFA 1ZJKA 1V2OT 2ZHWH 3L6PA 2PKSC 5HM2A 1GHBG 1NPMA 5EOKA 1UK3A 1Z6EA 1UCYH 2ZPQA 4AZ2B 1GI5A 5EQSA 1RS0A 3RMLH 4CR5A 1QJ1B 4ZAEA 5LH8A 3T5FH 2XBYA 3UY9A 1WAYB 1G37A 4IGDA 1G2LA 1DANH 1OXGA 3SJIA 2ZHEH 1QY6A 1O3KA 1S5SA 4DT7B 1TGCA 2R0LA 1P0SH 1GMCF 5E0JA 1THSH 1TX6A 3BTTE 1JBUH 5DP5A 4KKDA 1OP0A 3SNBA 3M36A 9ESTA 1C2FA 2ZCLP 1QL8A 4BAQB 1C5XB 1GVZA 4NIWA 3T27A 2RCEA 4IS5A 1DOJA 4F49A 5F03A 3T29A 1AUTC 2BX4A 3F9GA 1ETSH 1P9UA 4OS4A 4WJG2 3SJ9A 2J2UA 3KQEA 5DP7A 1HAGE 1P01A 3RXIA 1YPHC 2B7DH 1O3IA 1O2TA 4Y71A 4CH2B 1ZJDA 1OWEA 1NU7B 4X6MA 1TRYA 3HGPA 4XBBA 1C5QA 3F9FA 2SNVA 1KLTA 3SI4H 4DOQA 1DSUA 1O5CB 2BVSH 2A5KA 1KYNA 1TE0A 2Y80A 1FQ3A 1DY9A 1ZLRA 4ABDA 1D3QB 1CE5A 1OWDA 1WV7H 3HK6B 4BNRA 3SNCA 2W7SA 1HJ9A 5J4QA 1L4ZA 3PO1C 2A0QB 3TH4H 1FUJA 4AGKA 1P2MA 2O8WA 1F92A 1YLDA 1IHTH 1BCUH 3ZV8A 2F9NA 3K2UA 2QCYA 2VWLA 4MNYA 1EATA 2GMTC 1O2XA 3NXPA 1NZQH 2TRMA 2BLOA 2M5TA 3SU5A 3UPEA 2WPHS 2Y82A 3DUXH 2IJOB 1UTQA 5C1XA 2BTCE 1ZTLA 1IQNA 2VIPA 1HJAB 2XWBI 3MH5A 2FTMA 1O0DH 3GY4A 2ZU4A 3OY5U 1GHBF 1LCYA 5G4BA 1JIMA 2Z7FE 3ZZAA 2ZWLH 3DD2H 1SGIB 1GHAF 3I29A 1HNEE 1P2JA 1C5ZB 5L2ZH 2A2XH 3K65B 2K1QA 4FU7A 4YZUA 3SNAA 4X0WU 1ELAA 1O38A 1FZZA 2A5IA 3LKWA 1HAPH 1ELFA 2Y7ZA 1V2ST 1TYNA 2F9VA 4NIVA 1FN6A 4OS7A 3SNDA 2ZNKH 5K0HA 1T4VH 2QYIA 3BTWE 1MTUA 2P95A 2ZF0H 3MWIU 1XKAC 2ZFFH 4HGCA 2NU2E 4FUDA 2ALPA 1D9IA 1QQ4A 1GI3A 2BLWA 1DDJA 3A81A 1TA2A 3NWUA 1XKBC 1C5SA 5DKMA 3STIA 4Y8ZA 2VWMA 1HJ8A 3RXKA 2SGDE 2WYGA 1DXPA 5DP9A 2ZCKP 2NWNA 1L1NA 2ZHDA 3P8OA 5C5NA 3O8RA 4GCHF 3TU7H 1ZHRA 4I8HA 3V7TA 1F0SA 2ODPA 4ABGA 2OC0A 1GHXH 3RXEA 2PKSB 1O3GA 1HAXB 4BXWA 3UNRA 5TCCA 7ESTE 3TNSA 5L30H 5C1YA 1GVKB 3AW1A 2QGRA 3E3TA 1QURH 4CR9A 1TALA 1ZSLA 1C2HA 2P59A 5DJ7A 2BXTH 1IQGA 1LQDB 1O5DH 1C1WH 1CA8B 1NESE 4MNXA 2F9OA 3RXJA 1GDUA 2FOGA 2UUJB 2PUXB 2Q6FA 1QHRB 4JYVH 4DGJA 1TNHA 1XXDA 3OSYA 5GPIB 2A4QA 1PPBH 1GCTC 5EODA 2B9LA 1K1MA 1GDNA 2HPPH 4GSOA 9LPRA 2H9TH 2RA0A 1BMAA 3LC3A 2VU8E 3MO6A 2VGCB 2BZ6H 3KF2A 1WQSA 3MFJA 4X1QU 4BTTB 2ZECA 4NZQA 1O5EH 1NRPH 2ZKSA 1AI8H 8GCHG 1A1RA 2QXHA 1AMHA 2IN2A 3T2NA 1MTWA 1XX9A 4H6SB 4LXBH 3DT0H 5EW2H 1XVOA 3CS7A 3QUMP 3P8FA 1P57B 3HATH 1AB9C 1O2QA 3ODDA 1SGTA 3TJVA 1C1UH 2CMYA 2C8ZB 2HLCA 4NA9H 1N6YA 1IOEA 1KXAA 8ESTE 1KXDA 2G81E 1O3LA 3Q3YA 2VJ1A 4RSPA 2GMTB 1AD8H 1O3MA 3S9BA 1GJ8B 1K1JA 2PTNA 4CRDA 4B75A 4IW4E 2YOLA 1V2JT 1BRUP 1GJAB 3PV4A 1GJ5H 3V13A 3RLYH 1HFDA 5F6MA 3HKJB 3MO9A 4FUEA 1GHYH 2XBWA 2EI7A 4FVDA 3ZZ8A 1A5IA 1HRTH 3ZZ4A 2XRCA 4WMEA 1AVGH 3U9AH 4GAWA 1KLIH 1SGDE 3ZVDA 4NFFA 2ZDVH 1ETRH 1NC6A 3TH3H 2TGAA 3S9AA 4X2YA 2BD9A 3A8DA 4ZMAH 3RLWH 1AHTH 1MKXH 4WH8A 1NU9A 1J15A 2ZFPH 4D7FA 3Q00A 1TB6H 1ZHPA 3HK3B 1ESBA 1OP2A 3EQ0H 3M7TA 4DVAU 2UUFB 1VITH 1SGNE 5HGGA 3IITA 4NA8A 2UWOA 3RU4D 2JETB 1AUJA 1YM0A 3U98H 4JK5A 2ZDMA 1C5NH 3LGIA 1OYTH 3URDA 2ESTE 5A2MH 1TPAE 5DPAA 2D2DA 2B5TB 2BMGB 1C2LA 2RDLA 3MTYA 3EYDA 1AZZA 1WTGH 2C8XB 1TRNA 5AFYH 3U1IB 2IPHA 2ZGJA 2P8OB 1OWIA 2BVXH 3AAUA 4D8NA 2B0FA 3TGJE 1ZPCA 2XC5A 4KTUA 3B23B 2GZ9A 2A2QH 1GHWH 1MTNB 1HBTH 3RDZA 4K3JA 2G5VA 1TMUH 1RJXB 5LGOA 1ESTA 4ABHA 1K28D 1ZTJA 1XUKA 2WINI 1SMFE 1F7ZA 1YPHE 2SNWA 5ESBA 3TNTA 1YPGH 3A8AA 1C9TA 1Q2WA 3A8BA 1TIOA 3MH4A 5EXNA 2A32A 4Z6AH 3Q76A 1K1OA 1RTLA 1LHCH 2XBVA 4XOJA 1P3EA 4OS5A 1A3EH 3LGUA 5LPEA 1ZR0A 1S84A 2ZP0H 2GT8A 1AU8A 1FJSA 4YOIA 1O3EA 1TBQH 2AYWA 3RC4A 1GCDA 1THRH 7KMEH 1EZSC 4PROA 2J95A 1VJAU 3M61U 4IMQA 1O2VA 1F0RA 1S6HA 4B2AA 3ZZ3A 4XSKU 1PYTD 2WPJS 1ZYOA 4WMDA 5TJXA 1TQ7B 2ALVA 4Y0YE 2KAIB 3RXSA 1SFIA 1EB2A 1U6QA 2ZQ2A 3E90B 4K8BA 5FX6A 4WH6A 3H5CB 4ZROA 3ZZ7A 1GBMA 2PTCE 4GVUA 1GL0E 2GCHG 2LNCA 1SSXA 2ZZUH 3C27B 1ZSKA 4IC5A 4X8UH 2O9QA 4A5TS 1OWKA 3SO3A 3CS0A 1GJDB 1YBWA 1ZMNA 3RMMH 1KXBA 1UTPA 3UOUA 1A4WH 1G9IE 4BAMB 3ATKA 1HB0B 1D4PB 4UDWH 2G51A 3UTUH 1W13U 2C93B 1C4U2 1TONA 3BIUH 3PWCA 2G00A 1ABIH 1LO6A 2BD3A 4WMFA 1O3HA 5JB8S 2BB4A 1W10U 3RMOH 1C5LH 1GBTA 1ELTA 1NN6A 2BYAX 1YC0A 2THFB 4RKOB 4HZHA 1D3PB 4UFDH 2GCTB 4YTAA 1PQAA 4ISHH 2ZPSA 2VWOA 3E1XB 2BD7A 2NU0E 2Y5FA 2A31A 4AGJA 2ODYB 1RTFB 2PHBA 4Y6DA 3FAOA 1YPJH 1XUGA 1F0UA 2GT7A 2A7CA 2WPKS 3GY7A 1UJ1A 3M7UA 4CRCA 3S0NA 3RP2A 2ZFRH 3SBKA 2FX4A 4I8KA 4U32A 1ANBA 1CBWB 3LONA 1D6RA 2FTLE 1MKXK 3LGTA 1K21H 1SGRE 3UNSA 2YNBA 1FIWA 2RG3A 3TJUA 3E0NB 1N6XA 3FANA 2AMDA 1BTZA 3MOCA 1B0FA 2BX3A 2CF9H 1YPEH 5FXLA 1UK4A 3QTVH 1W8BH 2TIOA 1HJAC 1TLDA 2H9HA 1ANEA 2V35A 1V2NT 1GHZA 1EOLA 5FCKA 2HGTH 1H8DH 3MNSA 1TWXB 1UVUH 4THNH 2O8LA 4E06H 1O2ZA 2DUCA 4ZH8A 1AFEH 2C3SA 4GHTA 1Y5AT 1YLCA 2SGFE 2P3UB 3E16B 4F4OC 1NS3A 1P12E 1GJBB 1T31A 2GCHF 3PMJA 4TWWA 1HPGA 4YT6H 1O3BA 2ZPRA 5JBAS 3TVJB 3U1JB 6CHAC 1O3JA 3L33A 1CO7E 3ZVBA 4ISLA 2DE9A 2HOBA 4Q7XA 1A7SA 2C8WB 3ZVGA 4AX9H 1BQYA 2A4RA 2G52A 3SNEA 3GCNA 4DIIH 3K6ZA 4AORA 4U2WA 4NCYA 4JZEH 4MPXA 3SUGA 4AFZA 4OGXA 3TJNA 1W12U 2ZCHP 2BHGA 1XUFA 1QBNA 1K2I1 5ETXA 4VGCB 3R3GB 1LMWB 2ZTZA 4SGBE 5A8XA 1C5UA 2I6QA 4OS1A 2H2ZA 2AGGX 2CHAC 4X8TH 3CENA 3A83A 5HM9A 1KIGH 2WUCA 2ZG0H 1GHAG 2PSXA 4ZKRU 1BRBE 3S7KB 4Y7AA 1JWTA 2F9UA 2BQ7B 5GDSH 2EI6A 4ZUHA 3SV2H 1C2DA 1MZAA 2BDBA 1KTTB 2XCNA 2ANMH 3W94A 2XCFA 1TOMH 3VPKA 3SI3H 2GTBA 2W3KA 3O8BA 1A0HB 1EASA 1P02A 2GX4A 3RXVA 2KAIA 2LPRA 1AWHB 2UWLA 1BHXB 3PYHA 2W26A 2VINA 5EQRA 1ABJH 4JK6A 2FDAA 2O8UA 1DSTA 1Y3WA 3LT3A 3RXRA 3A7WA 2F9PA 3GOVB 5DGJA 2VIWA 5C2ZA 1SG8B 1RXPA 2BM2A 4ISNA 4X1NU 2OP9A 4MPUA 3A7TA 1BTHH 2VGCC 1NRRH 3KEEA 3GY2A 1Z1IA 1P2IA 4DJZB 3A80A 2F83A 1NFUA 2D8WA 3ZV9A 4GCHG 5T6DA 3A85A 1O2YA 2HNTF 1CQQA 4TPYA 1WBGB 1PJPA 1TNIA 2EA3A 2BVRH 1GVLA 1AQ7A 2FOCA 1GI2A 2WUBA 4JZIA 1GDQA 1MTSA 5E8EH 5JDUB 1JOUB 2TPIZ 5T6FA 4CRGA 2H9EH 1C1OA 1NT1A 4YLQH 5AF9H 3S7HB 1BTPA 1XUIA 3F6UH 4X1RU 4ABJA 2VVCA 1BA8B 2SGEE 5A0CA 1DITH 5JPMH 3MO3A 3BG4B 7LPRA 1TBZH 1UK2A 4BXSA 2A4GA 1OPHB 4MG3A 3UR9A 1UVSH 5B6OA 4FUFA 1L1GA 5ABWA 4FXGH 1W14U 5AHGH 5C5OA 1G32B 2Y6TA 1FXYA 1Y8TA 3RU4E 2XC4A 1SBWA 1J8AA 1O34A 1C1VH 1EZQA 1YPLH 1C1QA 1C2EA 3A7YA 1EP6A 1LHFH 1V3XA 3B9FH 1ELCA 5DP8A 5JYIA 3EA7A 1HAYB 3OU0A 3GDVA 2QY0B 4FU8A 2H5DA 2J92A 1NM6A 4FUJA 4GLYA 1MCTA 2RA3A 6CHAB 1INCA 1XMNB 1V6DA 2VVUA 1EJAA 2JETC 1O2PA 3AVZA 2R3YA 1EX3A 1UTKA 2Z3CA 1LPZB 5T6GA 2BY6X 1BBRE 2TGDA 4WY3A 1EB1H 2P8OC 3GY6A 1AKSB 1TX7A 4R0IA 2FS9A 1MTNC 1T7CA 1SOTA 5FX5A 1C5VA 1EPTB 3SU1A 2AIQA 5EU8A 1G3BA 3URCA 2CHAB 1ARCA 2TGTA 4WXIA 3ZZ5A 4X2VA 3PB1E 2XBXA 3SJ8A 2AIPA 2JKHA 2ULLA 4FUBA 2HRVA 1CSOE 1ESAA 1WCZA 2R0KA 4O97A 1KXCA 4ABBA 1A2CH 1UCYK 2GZ7A 4ZHMU 2FOFA 4Q2KA 4CBOA 3M5OA 3P92A 4ASHA 1B5GH 2EEKA 4ISIH 2ZGHA 3U8OH 4HTCH 2FOAA 3ZYEA 5EW1H 2AFQB 3VEQB 4AFUA 3KQCA 2QAAA 3E91A 5JBCS 1HAHH 5EGMA 1DS2E 4AB8A 3QLPH 3RC6A 1S82A 5AVDA 3VXEH 1MCVA 2Z9GA 2HNTC 3GYLB 3H7OA 4B74A 1SLXB 1IQKA 3QGNB 2GGVB 1OYQA 3BTDE 1EKBB 1EOJA 1QIXB 3RXTA 3SU4A 3ZYDA 1SVPA 5FCRA 2C8YB 4LK4A 1P10A 3EA9A 4I32A 1GWAA 1LDTT 3A7XA 3D62A 1KY9A 3IWMA 3SV6A 1H4WA 2NU1E 3TGIE 3OTJE 3SJOA 1ANDA 2A45B 2ZGXH 5CMXH 4NA7A 2ZGCA 3A86A 3E0PB 1OS8A 1HUTH 1A5GH 1C9PA 1IQHA 1O39A 5FPSA 3SUEA 1WYKA 3M3SA 5E2OA 1S0QA 2AEIH 1DWDH 1TX8A 3ATIA 1GI6A 4KP0A 1XUJA 5AFZH 1DLKB 4K8YA 2FYRA 2BD4A 1DUEA 2BDGA 3PMHB 2XNIA 3P8GA 1C2KA 3RXLA 1FONA 1Y3XA 3OY6U 1C1SA 1F5RA 3FVFB 5HMAA 2ZU5A 5JB9S 2Q6GA 3SW2B 1EAXA 1BBRH 2A5AA 1LVBA 1RGQA 1MUEB 1O35A 4A1VA 5C20A 4AFSA 1GBAA 3A7VA 3UQOA 1M9UA 4YO9A 5GJ4B 1ELEE 4Z0KA 1SGEE 1P2KA 1BHXF 1ZMLA 2GCTC 5A09A 1LVYA 3IG6B 2P16A 3GY5A 1ZOMA 4GUXA 3VB7A 1QRZA 4XDEA 2ZHFH 3SUDA 1Z7KA 1ANCA 5E2PA 1UHBB 1GBFA 1QA7A 3M7QA 1BB0B 1O3CA 5DK1A 1LKAA 3F9EA 5IDKA 1LHEH 1D3DB 2XC0A 3ATLA 2SGAA 5GCHG 1HAVB 4HI3A 1QL9A 2GV7A 3Q3XA 3ENSB 1CBWC 1GGDC 1P9SA 4Y8YA 1RIWB