2V3MA

Structure of the gar1 domain of naf1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
94
Chain Sequence
VPELPEDYEISEKTIITPIGVLKSAFENNIIIHATRVLKEGSIFCLEDRTLIGMLTEVFGPLQNPFYRIKLPDSKKNLFDELKVRLGEKAFIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosomal protein
molecule keywords NAF1
publication title The Box H/Aca Rnp Assembly Factor Naf1P Contains a Domain Homologous to Gar1P Mediating its Interaction with Cbf5P.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 94
sequence length 99
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 2v3mA00
3MQKC 2HVYB 2EY4C 2RFKC 3UAIC 2EQNA 2V3MA 3U28C
chains in the Genus database with same CATH superfamily
2FOFA 2FI5E 1AZ8A 1E79D 1THSH 2OBOA 2Y80A 3E90B 1CQQA 2CHAB 1MTNB 3ZZ5A 1EFRD 1Y3UA 1YM0A 5ESTE 3HK6B 3RM2H 4U01A 1RRKA 4YOJA 2QA9E 3SV8A 5E2PA 2PV9B 1F5LA 1W0JD 2KCYA 1Y3WA 2XRCA 3FP6E 1EZSC 2ZHEH 3QZQA 1DPOA 2ZCHP 4MPVA 1H8IH 3UTUH 3VFEA 5SGAE 5DP3A 1ZOMA 1SFIA 1LHEH 3GYMA 3K6YA 2ZFTA 1DY9A 2J95A 3ODDA 4O03A 2M5TA 1C2IA 1TMUH 1NPMA 2ZDNA 2G4UA 4YTAA 2R3YA 5A8XA 2BD5A 1LVYA 2ZECA 1GMDF 1RTLA 3SW2B 4FUEA 4ABHA 1PPHE 1EP5A 1BJUA 5L2YH 2OD3B 4K1SA 1SGIB 4HFPB 1H9LB 1OX1A 1S84A 4BANB 1UVOA 2Y7XA 5FBIA 3DSOA 1VITF 2A2QH 1QA7A 1YWUA 3A7TA 4INKA 2ZF0H 2AYWA 1BMAA 1YGCH 1OWJA 2ANWA 1GGDC 1T4UH 4NCYA 3TJVA 4LXBH 3TGIE 2OK5A 1AGJA 1WTGH 1HLTH 2VBCA 4U32A 2FTMA 3M7TA 3BTEE 2AH4X 1KSNA 4FVBA 4D9QA 3V0XA 1LVOA 1RIWB 1WYKA 2VVCA 5JBAS 3NCLA 1NRPH 1DXWA 1AUTC 5E8EH 5T3HA 2DE9A 4K5ZA 1MMJN 4ISIH 2A0QB 1FY1A 1SLUB 1BQYA 3RXTA 3IWMA 5JBBS 1IHSH 2BYAX 2JJ1D 3SU1A 2GDEH 1ELGA 3KHVA 2BY5X 4E7NA 4LK4A 4DIHH 2GV7A 1KTSB 2RA3A 3F2FA 2FPZA 3LGYA 1TE0A 2EI6A 3NZIA 1W8BH 2IJOB 2B7DH 1UK3A 4KGAA 2FI3E 1GDQA 2CF8H 4MNXA 2FESH 3F9EA 4A1XA 2Y5HA 2BOKA 2BDBA 4AG1A 1K1PA 1UVSH 3Q3YA 1MUEB 4TWWA 1LHDH 4WY3A 4K3JA 1P2MA 4DT4A 3T28A 2J2UA 2DUCA 3LPRA 2Y5GA 1QNJA 3M3SA 1O2YA 1ELBA 2GT7A 1N1LA 5JBCS 4Y79A 2TGDA 1GVZA 1O39A 1BRCE 1BTUA 2OQ5A 4ABIA 4NIYA 1NT1A 4IMQA 2ZGXH 1SG8B 4BXWA 3QTVH 4KTCA 3U9AH 4FUGA 4K1EA 5KGOA 4Y8ZA 3STJA 3PV2A 4YLQH 1XUIA 1A61H 4CH8B 1FN6A 2JH0D 3RXBA 1MZDA 1OHHD 1C4U2 2Y81A 1C1VH 2Z94A 1WSSH 1KY9A 1NRQH 3EA8A 4Y71A 4CH2B 3PO1B 8GCHG 1F5RA 1LHFH 3M7QA 1VCWA 2A4QA 1S85A 2QXHA 3P8FA 1XKBC 1PPEE 1LQDB 3KF2A 3SBKA 2ODYB 3RMMH 1O3AA 5HGGA 5EIYA 2ZU3A 1JWTA 1A0HB 1SPJA 2JDID 1FAXA 1G3DA 3OX7U 3PLPA 4Y11E 1O2IA 2O8MA 1SLXB 5LH8A 2OC1A 1G32B 4X1RU 4IN2A 2BXUH 2IPHA 1GBKA 7GCHG 3RLYH 6GCHF 2A31A 4K1TA 3UFAA 2VWOA 4TY6A 1EZUC 1QL9A 3M36A 1KXAA 4TT3D 5FPSA 1KXEA 1KDQA 1O0DH 1HDTH 4AFUA 4AX9H 5JB9S 2V7QD 1PPGE 3AAUA 1MU6B 1ARCA 1C1QA 3LIWA 1GGDB 2GMTB 1O3CA 2G00A 3O8BA 5B6LA 2F9PA 2P59A 4DOQA 1AWHB 1XX9A 2G81E 1WOFA 1MTSA 1GBFA 4BAMB 2BDYA 2BDHA 3GDVA 1LHCH 3PV4A 2KFWA 3MNSA 3U69H 2B0FA 3TK6A 7KMEH 1K21H 4B73A 1GHWH 2A7CA 1O2JA 1GI6A 2XC4A 1J17T 2WINI 5KECA 5I46H 1TPPA 3T2NA 2HLDD 4Q2KA 1EJAA 2Z9GA 2BDIA 3LONA 3ZYEA 5FCKA 1A3EH 1QGFA 1AWFH 1E1QD 1SGFA 1BBRK 3LGIA 5AFYH 4FOUC 5FAHA 1IQMA 2FOEA 3RXJA 2IJD1 3AVZA 5C0UA 4CRFA 2QF4A 2ZTXA 3WW7A 4I7YH 4ZXXH 2D26C 1SB1H 4I32A 2B8OH 1M9UA 1ABJH 3P8NA 1LPKB 4PROA 2CJIA 2OTVA 3LGTA 3LKWA 4P00A 1AN1E 4DGJA 1HYLA 2Y7ZA 3FP8E 1JXPA 4XBCA 5A8YA 1YPKH 1LVBA 1C5XB 3RDZA 3VGCC 2PKSC 3SNCA 1GJAB 2F43B 4JMYA 3HKJB 1UVTH 5GDSH 2VIWA 4OS4A 1O3IA 2ZP0H 4Q7XA 1TRMA 1AE8H 1HAGE 1N6YA 1SC8U 1OKXA 3A88A 3A8BA 1IHTH 1SGCA 4WXVA 3H5CB 1CGHA 1NO9H 3FKSD 3L33A 3VXEH 1UW7A 2BX3A 3SV7A 3S9CA 3AASA 1EASA 3GISB 1P2QA 3QK1A 1ESAA 2CGAA 4MNWA 1LKAA 1IQLA 1C1PA 4GPGA 2V3OH 5DP4A 4ZHMU 1Z7KA 3A84A 1SR5C 1HAPH 1KYNA 1GI2A 2K8IA 2FLBH 1DFPA 2VB0A 1OWKA 2WUBA 3SJKA 3UNQA 1O34A 4UD9H 3MU0A 3M35A 1QJ6B 1UCYE 1CA0B 3MNXA 1EOJA 1KDQB 4ISLA 1TX6A 3SNAA 5HKKD 3SNEA 1ZHPA 1S6LA 4Y6DA 4X6NA 1LPZB 2ZCKP 1MBMA 2G52A 2FZZA 1IQGA 3BIUH 1CHOF 1C5WB 2Q1JA 4MPWA 4IW4E 3HATH 1Z1JA 2ZWLH 2XTTB 2FYQA 2P3FH 2UWPA 5EGMA 2XWAA 2V3MA 4YT6H 3ZV9A 1A1RA 3MI4A 1EPTC 2FOMB 2CF9H 2BQ6B 3RM0H 4Y7BA 3OEHD 4J1YA 1ELTA 5DG6A 5JPMH 4F4OC 3TJOA 1Z1IA 1AUJA 1YPLH 3MH7A 3B8JA 1UMAH 2Z6BD 1ZGIA 1ZJKA 1GI5A 2ILNA 2TGTA 2XBWA 3KGPA 1EZQA 1P3CA 2GDDA 3NXPA 2V35A 1O5DH 3A7ZA 2UWOA 3RUOA 1A5GH 1GJDB 2ZFFH 4R8TB 3A80A 3FP7E 4NIXA 4K8BA 4Y76A 1JRSA 1A7SA 1TNLA 1A46H 1ARBA 1EPTA 2A1DB 4I8LA 1IQEA 3SZNA 2VH6A 3VB6A 3LDXH 4B6EA 4E7RG 1UTKA 1YBWA 9ESTA 3RXFA 1MQ6A 5FPTA 3P8OA 1GDUA 1C1NA 3KQEA 8KME2 3F9HA 4AGKA 2TGAA 3A8DA 1WXRA 3LJOA 2G5NA 3ZVAA 3T29A 4OM9A 4CHAB 3QDZB 2EI7A 3KYFA 2G55A 2FO9A 1TABE 5EJLA 1NM6A 3ZZ6A 1WTHD 2SGQE 1UTJA 3RXLA 2THFB 1HFDA 5EG4A 1BDAA 2H9EH 1TB6H 2HVYB 1OP0A 1RXPA 1Y5UT 1OOKB 3OAAD 1WDIA 1FI8A 1MKWK 1DT2A 1C1OA 2PKSB 3FO8D 2XCNA 5C20A 1WCZA 2ZHFH 3KN2A 1HAOH 1DUAA 1IQKA 2CHAC 1HIAA 1MTNC 1QHRB 1ZMJA 4IGDA 3RMNH 3LC5A 2A32A 1J15A 1FZZA 3SV2H 1QQUA 1Y59T 2PWXA 5GCHG 2C8YB 4MTBA 4YXWD 2EA3A 4B6FA 1MABB 1ESBA 3GY3A 2FS9A 2OUAA 5A0BA 2F91A 4UFGH 1O33A 4JZ1A 1NY22 2GT8A 3F9FA 4TPYA 2GVFA 4XOJA 3MHWU 5FBEA 3A83A 1C5ZB 2NU4E 3E0NB 5DJ7A 1L4ZA 1PFXC 3ZVFA 5DP5A 1D6RA 2BD3A 3VB3A 1O5BB 1ACBE 1W3CA 1VKYA 4A6LA 1DOJA 1QURH 1E34B 1YP9A 1ELCA 1T8OA 5ETXA 3PB1E 1N8OB 4TPIZ 1P2OA 1IOEA 1CBWC 1ANEA 3RLWH 1SGEE 4B75A 3EA9A 2BXTH 4IN1A 1HNEE 4DVAU 2ANMH 3P92A 1QZ8A 1MTVA 1SGYE 5GPIB 3TK5A 5EODA 2BVSH 1RIWC 4GHTA 5FPYA 5EQQA 1ZRBA 4JZIA 1GI8B 1T8NA 4GUXA 1NN6A 3IG6B 2FDAA 3GYLB 3LJJA 4Y7AA 3KYGA 2ZU4A 1MCVA 1ZZZA 4H4FA 1SOZA 4CBOA 2BDCA 1RS0A 1AIXH 1ZPCA 1NRRH 5GJ4B 1NESE 1H9HE 1E0FD 2OXSA 4UFDH 1FQ3A 4GAWA 1C5SA 1FONA 1V2UT 4X6OA 3TJNA 1VGCB 1TX7A 4AB8A 4JZEH 2XCFA 5IDKA 1A0LA 3SU5A 2I6QA 4CR9A 1F0RA 2CXVA 4MNVA 2J34A 1Y5AT 1SGDE 2Q6DA 4OS2A 1PYTD 5LGOA 1PPCE 1V2OT 3VB5A 4K60A 1VCPA 2AFQB 3RP2A 2ZDMA 2OBQA 3UIRA 3V13A 2VVVA 1JIMA 2RFKC 2EQNA 2FP7B 4SGAE 1HIAB 1WU1A 3LH1A 2XWBI 3I29A 4HG6A 4U2WA 3D49H 2SGPE 1AVWA 1EKBB 2BD2A 1O2OA 2BD7A 3RXAA 4AFZA 1F0UA 1CT0E 1UVPA 1TGSZ 4BTIB 1L2EA 2HRVA 3P17H 4HZHA 1K28D 2A7HA 3PMHB 1LPGB 2A2XH 3TVJB 2AMQA 1GBEA 3SJ9A 2NU0E 2A4RA 3GY5A 1G3BA 1HJAC 3SQEE 2A5KA 4WH6A 1MAYA 2SNVA 4MQAA 1O2TA 3PO1C 1C9TA 1ZHRA 5C2ZA 4JZDH 3TNSA 3F6UH 3P6ZB 3SN8A 1O5FH 2YMSD 8GCHF 3E91A 1KMHB 1J16A 1NBMD 1S0RA 2FX6A 4RKJB 4JCNA 1FNIA 4KTSA 2F9NA 2QF5A 3MO9A 3EE0B 1GBBA 4WJG2 2BDGA 2J38A 3CS0A 3F9GA 3N7OA 1GL0E 3ZZ4A 1FX0B 1V3XA 1AVGH 3E16B 4IMZA 5EOKA 5IK2D 1AI8H 2WPMS 4AGJA 3UOPA 4UONA 1QTFA 2A45B 1T8MA 2FLRH 3IITA 2GCHG 4NSVA 1BCUH 1XXDA 5C94A 1TGTA 1K1JA 2YOLA 2BY8X 2BD9A 1DWEH 1YPEH 4CBNA 4I86A 3OY5U 4D7FA 4UFEH 4XFQA 1ZSLA 1O3OA 1TNKA 1SOTA 1CBWB 1EAUA 4A5TS 5HM9A 4FUHA 2WPDD 5F8TA 1YLNA 2I6SA 3K2UA 1L1NA 1GJ8B 1GMCG 1Z71A 4CREA 4ISOA 2R9PA 2GTBA 3GCOA 4DY7B 4B71A 1FUJA 2GMTC 4Z6AH 1UTOA 3T27A 3PLBA 1E35B 4OS6A 1BTWA 2V3HH 5E2OA 1FXYA 2FOHA 2ZFSA 2PGQB 2V0BA 5AFZH 1TLDA 1GHAG 4UE7H 5CMXH 2J94A 3OSYA 1K9OE 1GBLA 1MQ5A 3F2GA 3PYHA 4XRNA 2OC0A 3Q3KA 2AEIH 4BAKB 3KIDU 1DITH 2OP9A 5EQRA 1YCPK 2GV6A 2B5TB 4UEHH 2FI4E 1OPHB 4YESB 3UY9A 1VZQH 4QT8C 1QBNA 1UO6A 2R2WU 1C5OH 1QL7A 1RTFB 2P94A 2WPHS 2EC9H 3SU2A 3RXDA 5F6MA 1LDTT 2M2AA 1EB1H 2HPPH 5LPRA 5E0HA 4B1TA 3T26A 1GI9B 1FV9A 4OS7A 2XXLA 1O37A 3V12A 1G2MA 2NWNA 2FOCA 1O32A 3SORA 2ZTZA 2BLOA 3ZZAA 4NZQA 3BTGE 2H9TH 2ZTYA 3TITA 2WZQA 2QE7D 1Z8JB 1QRXA 1BMFD 1BTXA 2F4LA 2XW9A 3KQDA 4I8GA 3GY8A 1O2LA 4YT7H 3D65E 3OY6U 4FUCA 3RXGA 5A2MH 1O2RA 2ZO3H 2KAIA 2UUJB 1GMHG 1O3KA 3BG4B 1DWDH 4YOGA 2UUFB 4RN6A 2ASUB 3PTBA 2P3TB 3H09A 2O8LA 5TCCA 5ESBA 2QXJA 1O3DA 4UFFH 3AK5A 1YKTA 4AORA 3LU9B 4FU8A 1HJ9A 2Q6GA 2EI8A 4E06H 1EX3A 3RC4A 3UREA 3FOAA 1L0ZA 2NU1E 1ANDA 2VWLA 2OC8A 2P8OC 1GBDA 3CENA 2F9BH 2BY6X 1PQ5A 2PLXA 1FY3A 1GJ5H 4ASHA 1HJAB 3BTQE 1CGJE 1AKSA 1DWBH 1IAUA 3H7OA 4MPXA 2NU3E 2KCPA 4A7IB 3GCTG 1YPHE 2ZFQH 3EQ0H 1C5PA 1HCGA 3VB7A 3BTTE 1SKYE 5DP8A 2JETB 1BZXE 4WF8A 1GL1A 4BTUB 3MFJA 1AD8H 1RJXB 3E3TA 1CHGA 1CA0C 4GHQA 1Q2WA 3VPKA 3TH3H 4BAQB 4WVPE 2HOBA 3A81A 2FMJA 2QV1A 3BTME 3BIVH 1B5GH 3UR9A 4YLUA 2BLWA 4RSPA 3S69A 1O3HA 1CT2E 2J92A 3MWIU 3ZVDA 2ZZUH 4MNYA 4AG2A 1NU7B 2WSSD 5T6FA 1C1MA 2ZFRH 2BM2A 1O3NA 2BB4A 5C1UA 4YO9A 3L3TA 3KQ5A 2BY9X 4JYUH 4BNRA 4X2YA 2STBE 1ORFA 2JH5D 1ANCA 1CGIE 3FAOA 3ZVGA 2CK3D 1J9CH 1XVOA 5PTPA 2J4IA 2SFAA 1MBQA 1Y3YA 2QIQA 3MH6A 2STAE 1FLEE 4JK5A 5I25A 1TGBA 5E0JA 3V3MA 3DT0H 3BTHE 3U1IB 1UCYH 2Y5FA 1D3QB 1G3EA 2SGDE 3LGWA 4KP0A 1CO7E 3SU4A 3KQBA 2ZDKA 3OFND 4Y8XA 4X0WU 1YLDA 1H8ED 4LOYH 1YPJH 1BBRE 4OGXA 1W7GH 5KEDA 1FJSA 1THPB 1CT4E 5DKMA 1B0FA 4CRDA 1TNGA 5F8ZA 3MTYA 3ZZ9A 3SNBA 1J14A 2H1UA 4RT1A 5DPAA 1C2LA 2PKAA 4HI3A 1T7CA 3LGVA 1TONA 2KAIB 2A4GA 1TALA 4Z1MD 4CHAC 1BJVA 1ZMLA 3T62A 2K0QA 1DS2E 1NTPA 1ZHMA 1YCPM 4ZROA 1QFKH 5TJXA 1BMLA 1VR1H 5ABWA 3GY7A 2TIOA 1QJ1B 2VGCC 1RD3B 3A89A 1DUEA 4WH8A 1EOLA 4O3TA 5FXLA 2ZGJA 2F9UA 5JYIA 4AZ2B 3QWCH 1XKAC 1WQVH 2Z3DA 3SU3A 2IN2A 3LOXA 5F03A 1YLCA 3H7TA 2D8WA 2YMSB 3K9XB 1FN8A 3SJIA 1O35A 1W14U 1AKSB 4XE4A 1DY8A 4Q7ZA 1MKXH 6CHAB 4KTUA 1HRTH 1KXFA 5C1XA 1D4PB 2HLCA 3SO3A 1OWIA 2WPKS 4NWLA 1GJCB 3OE7D 2PTNA 3PRDA 1G9IE 1C5RA 1SQOA 3MO6A 1TPAE 2PTCE 2VWMA 1GBHA 1O2UA 2ZCLP 2AERH 4GCHG 2IOTA 1OWEA 4X8VH 3RXKA 2GKVE 1XUGA 2P8OB 3E8LA 5H4IB 1EJNA 2KM0A 1TPSA 3SJOA 1P10A 3V7TA 5HM2A 3QTOH 2VVUA 3A85A 2QYIA 5AHGH 2A4OA 2H6MA 2BHGA 4TYDA 1P04A 3D62A 1WUNH 1QA0A 3LH3A 1OS8A 4ZKOU 1SHHB 1K1OA 1N8OC 1C2DA 3E6PH 1DM4B 3ZZCA 1JOUB 2GCTB 1RGQA 4LZ4B 2R0LA 2KX4A 1AFQB 4NWKA 1O2XA 3ATKA 1PPBH 1UHBA 5A0AE 3A82A 7ESTE 3KQCA 3LC3A 3MMGA 3PROA 4DCDA 3GDSA 2AMDA 5BRRE 2BTCE 1XM1A 4FUIA 1GBIA 2CN0H 2TPIZ 1CA8B 2PW8H 4R0IA 1BITA 3QGNB 1K1IA 2CV3A 1GPZA 1SI5H 1O2HA 2FIRH 3SV6A 1GHXH 1K1NA 2KCAA 2NU2E 2L6OA 2VH0A 1P06A 1SGPE 4FU7A 4FUFA 2BDAA 3TPIZ 1PJPA 2BQWB 3FZDA 1GCTB 2PKAB 1D3TB 1F0SA 1O5CB 1IQIA 3JZ2B 4X2VA 2F9VA 1ID5H 1UTQA 2ZFPH 4RT0A 3O8CA 4XBBA 2FX4A 3AW1A 1SBWA 2ZU1A 1F2SE 4TSFD 1Y5BT 4B76A 1DVAH 1NU9A 1VGCC 4I31A 1GDNA 3AW0A 3VXFH 1THRH 4X6MA 2FEQH 3PRBA 1BTZA 3U1JB 3QX5H 2O8UA 1CSOE 2C90B 1KLIH 3SUDA 2RDLA 4TY7A 4AFQA 1TBZH 2PP6A 2BD8A 1DLKB 1V2QT 3RXSA 5L30H 4NFFA 5CHAB 1S81A 3M5LA 1E36B 1O3MA 4X2WA 3TH2H 3MQKC 1W0KD 5K7RA 1TFXA 4H6SB 2ZHDA 2LP6A 5C67A 1V2JT 4E05H 2TRMA 1AB9C 1QB6A 3GY2A 2VWNA 5EW2H 1OP2A 1BHXF 5J4SA 2WPIS 4WMFA 5DGJA 1ZJDA 1BRUP 2VGCB 5T6DA 3STIA 4ZHLU 1GBAA 1K22H 1GBTA 1TGNA 1TOCB 1GI0A 4FUBA 3M5NA 4D9RA 4I8HA 3RXIA 4ZXYH 3TNTA 1O2WA 4JZFH 5JBTA 1FY8E 1O3BA 1O2MA 3RXRA 3P70B 2W6ID 4DT7B 4D7GA 1P03A 3OU0A 2ANYA 1O2KA 3A87A 4WMDA 3GCHB 5EW1H 1TMTH 1D9IA 2DE8A 1K2I1 3TLOA 3S9BA 3F2HA 3DA9B 3CNRA 4B2AA 1TQ0B 1C1WH 1NC6A 2WHXA 3I77A 2PSXA 3SI4H 4CR5A 3NUMA 3BTWE 4AOQA 1HAYB 1BHXB 2ESTE 2IPQX 4K69A 2ZPRA 2ANKH 2Z9KA 1V2LT 5A0CA 1UHBB 2VNTA 4ABAA 2R0KA 2EEKA 3HPTB 2XOKD 4NGAH 3QN7A 1DICA 2OQUA 1C4Y2 1DSTA 2AMPA 4YM9A 5L6NH 3GICB 3SU6A 5EU8A 1DWCH 1O2VA 4K2YA 3BG8A 1YC0A 3UPEA 3UAIC 1NS3A 2W3IA 3N7DA 3O8DA 5GXPA 2RA0A 2C93B 3ODFA 4THNH 1V2RT 3M61U 4ZAEA 4MLFB 2HALA 1FPHH 2AS9A 2J97A 3SHAH 2QC2A 4A1TA 1GMCF 1C5VA 2ZPQA 1W2KH 3A7YA 3ITIA 4ZKSU 3S7KB 2ZDLA 3MU8A 1O36A 3PLKA 4NZLA 1L1GA 2ULLA 1P12E 1IQNA 4INHA 2GJGA 3RXHA 1GHAF 1GHBG 1LTOA 1FPCH 4ABJA 1EAWA 1IQJA 1AMHA 2JKHA 2OC7A 2KZ4A 2XBVA 3ZV8A 2GZ9A 2GX4A 1GI1A 2FODA 2BX4A 4ABFA 1O2PA 2ALVA 3VB4A 4XBDA 3ZVBA 1K0HA 3URDA 3MU4A 1L1JA 3OTJE 1XUJA 2F3CE 2JJ2D 1C1SA 4NA9H 4Q80A 1O5EH 1ZLRA 2B9LA 3E0PB 1X7AC 3U98H 1DLEA 2Z3CA 3BTFE 3FVFB 3G01A 4GLYA 3ZZBA 1KLJH 5FCRA 2HWLB 1LHGH 3BN9A 4BAOB 3PTNA 3M5MA 1UTLM 2FOAA 2H9HA 4ISHH 1QB9A 2V6NA 3CP7A 3SGAE 1G2LA 1BTHH 3URCA 1CE5A 2TBSA 3BG4C 1H9IE 3EAJA 1ZSKA 1J8AA 2Z7FE 1BTYA 3UUZA 1AB9B 1DE7H 2SGEE 1VITH 2WPLS 1T32A 1Y3VA 1GMHF 3SV9A 1HJ8A 1BRBE 1S6FA 4ZHAA 4FU9A 2ALPA 1SGRE 3C1KA 3U8OH 9LPRA 1GJ7B 3QLPH 2ZHWH 1OWHA 1A5HA 1O3FA 3N7EA 1C2FA 1B7XB 5FX6A 2QGRA 4OS5A 3T5FH 4Z0KA 1BMNH 2VIOA 2ZGHA 3ENSB 3D23A 2RCEA 2O9QA 2FOBA 2FOGA 2O8TA 1BIOA 5C1YA 4Y0YE 3M3TA 4XD7D 4CRGA 1KXCA 5EXLA 1LKBA 2UWLA 2JETC 2ZHQH 1OYTH 3EGKH 2GZ7A 1SGQE 2QCYA 2CMYA 1P3EA 3ZZ8A 3SQHE 3M5OA 2Y6TA 2ZC9H 4YZUA 8ESTE 4ABDA 1UJ1A 3KCGH 2KCOA 1YPHC 4Y10E 2Z3EA 3VG8A 4X1PU 3SYJA 2F9OA 3MO3A 4B74A 3RXCA 1FY5A 3FZZA 1FY4A 1P2NA 2WYGA 2BMGB 4X6PA 5C3NA 1E1RD 1D6WA 2W26A 3ESTA 3UWJH 4DW2U 2QY0B 3TH4H 3FANA 3EE7A 4F49A 5JB8S 1HPGA 1PQ8A 3C27B 5HIZA 1GVKB 1GI4A 1A2CH 1W11U 7GCHF 1ZRKA 5DSFA 1U6QA 2Q6FA 2JIZD 4AFSA 4I8JA 1DANH 1VJAU 1MU8B 1DSUA 2FM2A 2W5EA 1KXDA 1HAVA 1FMGA 1YF4A 2P16A 1W7XH 3BEIB 2ZA5A 1PYTC 1YPGH 2QAAA 3F3BA 2WV9A 2G5VA 3HK3B 2LELA 1ELEE 2P93A 3TK9A 1KXBA 3S0NA 1TAWA 3M3VA 2WYJA 4ABGA 3TIUA 1AU8A 1T4VH 3FN8A 4XDEA 4MVNA 2W6JD 4Q4LA 1TMBH 3BF6H 1P05A 1F92A 2PSYA 1OXGA 3DSPA 2BOHB 3SGQE 3UR6A 2BVXH 2W7UA 1S6HA 4HTCH 4KKDA 1S0QA 4IC5A 1QBOA 1P9UA 1TBRH 3HGNA 1T31A 2ZEBA 4FUJA 1XMNB 2UUKB 3DFJA 1C2MA 1ZGVA 2VIQA 1INCA 2PFEA 2TGPZ 3MOCA 1EZXC 1OP8A 4F48B 1V2WT 1HAZB 2YMSC 1NFWA 4H42U 3BEFB 3UQVA 5C5OA 5DN6D 4MPUA 1TYNA 4NIVA 6CHAC 1E37B 1BBRH 2XYAA 3RC5A 1V2ST 1W10U 3U28C 1VCQA 2EY4C 1QRWA 4OGYA 1ZPZA 2H5CA 3BTKE 1WQSA 1HGTH 2ZNKH 1QCPA 2FWWA 2ZGCA 5HIYA 6ESTA 1TX8A 4VGCC 2H2ZA 4ZKRU 3S9AA 3ZYDA 3TGJE 2J9NA 1LVMA 2ZI2H 4KELA 4A92A 1SQRA 4GCHF 1ABIH 3MU5A 5GNDA 2BVRH 1C5UA 2P3UB 3WWFA 4GSOA 1DX5M 1AFEH 2ZDAH 3NRLA 2QXIA 3U8TH 3GCNA 5EPNA 3ZVEA 4ACBA 1G30B 3OYPA 3HGPA 4K8YA 4Y0ZE 1SGNE 2Z9LA 1YYY1 2GCTC 3BV9B 1HAXB 1OYQA 3U8RH 1FIZA 1AY6H 2BD4A 1LCYA 2XBYA 5L2ZH 1AFQC 1BUIA 1EJMA 4IBLH 1F0TA 1HAVB 1C4V2 4HGCA 2PR3A 1IQFA 1C2GA 3GY4A 4ESTE 2C3SA 5TCAA 1P9SA 4MG3A 3MH5A 1TRYA 1QIXB 2AIPA 1V2PT 2R3UA 1A5IA 4P02A 4BTTB 1QJ7B 4IS5A 5IYTA 5C0TA 4OS1A 3UWIA 1TNHA 5HYOA 1PQ7A 4BXSA 1SL3A 4X1QU 1TPOA 3GY6A 1GMDG 1UK4A 3GOVB 3UNSA 1GCTC 2XNIA 1WBGB 1O2SA 1EXFA 2PGBB 2D2DA 4ACAA 3F0PA 1AO5A 1V2NT 2VINA 3R0FA 2QF3A 3Q3XA 4ZKNU 3JZ1B 3MYWA 1C2EA 1VITG 1B0EA 3ZIAD 2J98A 3ZVCA 1DDJA 1O30A 1ELFA 5DP6A 2HNTC 2FXRA 3SUEA 2XBXA 4A1VA 2C8ZB 4F55A 3S7HB 4FVDA 1CVWH 1SMFE 3M7UA 4O97A 3CS7A 2PUXB 4RKOB 1Z8RA 1EB2A 1Z6JH 3PWCA 2LNCA 5E0GA 5CHAC 1MCTA 2OCVB 2QN5T 5DK1A 1ZTJA 4AC9A 3N99A 2A7JA 3RU4D 1GJ6A 1N6XA 1CU1A 3PV5A 1BOQA 4ABBA 1QB1A 2VIPA 4INLA 1NBME 3PWBA 5EXNA 4WMEA 1W12U 1AVXA 5T1VA 1TWXB 3ATIA 4AYVB 1A0JA 3SGBE 2BY7X 3GDUA 1S83A 1BT7A 2ZQ1A 4TWYA 1K1LA 2ZDVH 4NG9H 1QR3E 3QUMP 1ZSJA 1WV7H 3DFLA 3EA7A 1SQTA 4YOIA 3B23B 1C5YB 3SU0A 4CRBA 2ZKSA 1P8VC 2R2MB 1ZTKA 5GIBA 4J2YB 4FUDA 2BZAA 3RXEA 4ASUD 1P09A 5FHTA 4DJZB 1TNIA 3NPSA 1LMWB 3GCHC 5B6OA 1TGCA 5EXMA 4AN7A 3OTPA 4ZMAH 4FETA 5BPEA 1QL8A 1P11E 4IC6A 1TA2A 2ODPA 2SGAA 3ZZ7A 3UNRA 4RI0A 1XUHA 5GCHF 2G8TA 3LGUA 2C4FH 4VGCB 2WV5A 4WWYA 1C2KA 1O2QA 4D76A 1ANBA 1GBJA 1P01A 1YY3A 1MKWH 3F0OA 1Q3XA 1GVLA 3UQOA 1BTPA 5CHBA 2ZGBH 2GZ8A 2PUQH 2YNAA 1C5LH 1GCDA 3DSGA 5A09A 2ODQA 4BAHB 1DXPA 3QO6A 1KIGH 1Y8TA 1C9PA 4LZ1H 1C2HA 1GHVH 1P0SH 3ATWA 1D3PB 2XC0A 2J5UA 1NFUA 3A7WA 3PM3A 1HUTH 3BEUA 2ZQ2A 3DCLA 2AGEX 2QF0A 1TIOA 2QXGA 1SVPA 1XUKA 1AQ7A 2A5AA 1EP6A 1Y3XA 1TNJA 3NK8A 3TGKE 1O2NA 4ZUHA 3MNBA 1H1BA 1JMOH 3MNCA 1AHTH 4NSYA 1A3BH 1TBQH 3A7VA 1BMMH 2HNTF 1FIWA 3K65B 1HB0B 3W94A 1QRZA 1EQ9A 1EUFA 4ZCNA 1OWDA 2J98B 1IQHA 1GBCA 3L6PA 1MD7A 1O2GH 2GGVB 1C5QA 4NA8A 3MH4A 3OEED 1SLVB 1HBTH 5F53A 3BTDE 1GHBF 2OINA 1ETRH 5T6GA 1UCYK 2HNTE 2O8WA 5EQSA 1NRSH 2GD4B 3W95A 1SGTA 1Z6EA 3A8CA 5GWZA 3NWUA 6GCHG 4DIIH 5LPEA 3RU4T 1G3CA 1NFYA 2GP9B 3DD2H 3LT3A 1C5NH 4ZH8A 5DP9A 5EPYA 2ZU5A 7LPRA 2K1QA 1C1TA 1ETTH 2FS8A 4GVUA 5C17A 3KL6A 1QY6A 1K1MA 2VIVA 1XVMA 4CRCA 3EDXB 1Z8IB 1SSXA 1S5SA 3SI3H 4BOHA 3UOUA 3F1SB 2D1JA 3I78A 1UTPA 4FXGH 1HXEH 1ZTLA 1O2ZA 2VIDA 1ETSH 2W3KA 3SNDA 4SGBE 1ELDE 3ATLA 1H8HD 3FFGA 1FAKH 1O3JA 3KNXA 5CDFE 2SGFE 1NZQH 2AGGX 1ELAA 1MH0A 2L74A 1V2MT 3K6ZA 5DP7A 3ZZDA 1JRTA 1GJ9B 1EAIA 5AF9H 2UUYA 1Z8GA 2AIQA 3QGJA 3RXMA 4B2BA 2OLGA 4ISNA 5HMAA 3P95A 1MKXK 4I8KA 3T25A 1UVUH 1GG6C 3RC6A 1OSSA 3SJ8A 3B9FH 3QZRA 3W1EA 2F83A 4MDSA 4WXIA 1SQAA 3A86A 2BQ7B 4Q63A 5DO4H 5HXFA 2A5IA 1F5KU 5G4BA 1WAYB 1RFNA 1GWAA 1BRAA 2HPQH 3GS9A 4M9FA 1O3GA 4CRAA 1MZAA 1E38B 1V2KT 2ZPSA 1PPZA 4X8TH 3VGCB 1O5GH 1PPFE 1P02A 2XNDD 3O8RA 1T8LA 4NFEA 3R3GB 1KTTB 2G4TA 1MAXA 4X1NU 1SHYA 1MD8A 1LQEA 2VU8E 1HXFH 1UTMA 2Z9JA 4X8UH 1QBVH 1RTKA 2WUCA 2GCHF 1C1UH 4JK6A 5FX5A 1V6DA 2BLVA 5F8XA 2C8WB 2ZIQH 1GHZA 4ABEA 1COWD 5FL7D 3PMAB 5C5NA 2AGIX 1GJBB 3DHKH 5A8ZA 3WWBA 1C5MD 1PQAA 4I33A 3RU4E 1GI7B 3NKKA 1H4WA 3Q77A 2ZG0H 2BZ6H 2WPJS 1KLTA 1SGFG 5LPFA 1ZPBA 3EYDA 1GI3A 1C2JA 1HAIH 3TJUA 3WY8A 3RXUA 1BA8B 2G51A 3A7XA 4NIWA 1NRNH 2P95A 2RDEA 2Y82A 5K0HA 1FDPA 1W13U 3MU1A 1LO6A 2YNBA 1HV7A 4X2XA 1CHOG 8LPRA 4X1SU 1XXFA 1C5TA 4DG4A 1O3LA 2W7SA 2KR7A 4XSKU 3SUGA 1JBUH 1TRNA 3RMOH 1ESTA 2JH6D 3RXPA 2FYRA 4NA7A 1P2KA 3AAVA 2HGTH 1ZYOA 3PMBB 1EPTB 3SUFA 3BSQA 1Q31A 1UTNA 2PHBA 2VJ1A 1XUFA 1GHYH 2XC5A 2LPRA 1W0YH 1NFXA 4AYYB 1EAXA 1UK2A 4DURA 1TQ7B 3SHCH 1GBMA 1G36A 1MTUA 4D8NA 1HAHH 4UDWH 4H6TA 1SFQB 3F68H 1G37A 1AZZA 1W0ZU 1YCPH 1H8DH 2FTLE 1O3EA 3P8GA 5J4QA 1YPMH 2BLQA 1O38A 3M37A 3VEQB 2Z9IA 1S82A 2AHME 5CE1A 1D3DB 2RG3A 4X8SH 1TOMH 3Q76A 3SOSA 1L4DA 1O3PB 3RXVA 3PMJA 4B2CA 2C8XB 4Y8YA 3A8AA 3RMLH 3TU7H 1BB0B 3KEEA 4AB9A 4JYVH 1VJ9U 1P57B 3Q00A 1GJ4H 4O3UA 1GG6B 1V2VT 5EJZA 3SZEA 1JIRA 1F7ZA 3HKIB 1SLWB 1P2IA 1TA6A 3UB0A 1EATA 1C1RA 3DUXH 3ZZ3A 1V2TT 2HVXA 1MTWA 6LPRA 3RXQA 1AE5A 1P2JA 4M7GA 5AVDA 3E1XB 2ZU2A 4O9VA 1ZMNA 2H5DA 4JYTA 2SNWA 3ATMA 4Q7YA 1O31A 1QQ4A 1O5AB 1NROH 3GCTF 1A4WH 1ELVA 5EJ1A 2WV4A 3RXOA 1ZR0A 3ELAH 5JDUB 4U30A
chains in the Genus database with same CATH topology
3MQKC 2HVYB 2EY4C 2RFKC 3UAIC 2EQNA 2V3MA 3U28C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQK C;  2HVY B;  2EY4 C;  2RFK C;  3UAI C;  2EQN A;  2V3M A;  3U28 C; 
#chains in the Genus database with same CATH topology
 2FOF A;  2FI5 E;  1AZ8 A;  1E79 D;  1THS H;  2OBO A;  2Y80 A;  3E90 B;  1CQQ A;  2CHA B;  1MTN B;  3ZZ5 A;  1EFR D;  1Y3U A;  1YM0 A;  5EST E;  3HK6 B;  3RM2 H;  4U01 A;  1RRK A;  4YOJ A;  2QA9 E;  3SV8 A;  5E2P A;  2PV9 B;  1F5L A;  1W0J D;  2KCY A;  1Y3W A;  2XRC A;  3FP6 E;  1EZS C;  2ZHE H;  3QZQ A;  1DPO A;  2ZCH P;  4MPV A;  1H8I H;  3UTU H;  3VFE A;  5SGA E;  5DP3 A;  1ZOM A;  1SFI A;  1LHE H;  3GYM A;  3K6Y A;  2ZFT A;  1DY9 A;  2J95 A;  3ODD A;  4O03 A;  2M5T A;  1C2I A;  1TMU H;  1NPM A;  2ZDN A;  2G4U A;  4YTA A;  2R3Y A;  5A8X A;  2BD5 A;  1LVY A;  2ZEC A;  1GMD F;  1RTL A;  3SW2 B;  4FUE A;  4ABH A;  1PPH E;  1EP5 A;  1BJU A;  5L2Y H;  2OD3 B;  4K1S A;  1SGI B;  4HFP B;  1H9L B;  1OX1 A;  1S84 A;  4BAN B;  1UVO A;  2Y7X A;  5FBI A;  3DSO A;  1VIT F;  2A2Q H;  1QA7 A;  1YWU A;  3A7T A;  4INK A;  2ZF0 H;  2AYW A;  1BMA A;  1YGC H;  1OWJ A;  2ANW A;  1GGD C;  1T4U H;  4NCY A;  3TJV A;  4LXB H;  3TGI E;  2OK5 A;  1AGJ A;  1WTG H;  1HLT H;  2VBC A;  4U32 A;  2FTM A;  3M7T A;  3BTE E;  2AH4 X;  1KSN A;  4FVB A;  4D9Q A;  3V0X A;  1LVO A;  1RIW B;  1WYK A;  2VVC A;  5JBA S;  3NCL A;  1NRP H;  1DXW A;  1AUT C;  5E8E H;  5T3H A;  2DE9 A;  4K5Z A;  1MMJ N;  4ISI H;  2A0Q B;  1FY1 A;  1SLU B;  1BQY A;  3RXT A;  3IWM A;  5JBB S;  1IHS H;  2BYA X;  2JJ1 D;  3SU1 A;  2GDE H;  1ELG A;  3KHV A;  2BY5 X;  4E7N A;  4LK4 A;  4DIH H;  2GV7 A;  1KTS B;  2RA3 A;  3F2F A;  2FPZ A;  3LGY A;  1TE0 A;  2EI6 A;  3NZI A;  1W8B H;  2IJO B;  2B7D H;  1UK3 A;  4KGA A;  2FI3 E;  1GDQ A;  2CF8 H;  4MNX A;  2FES H;  3F9E A;  4A1X A;  2Y5H A;  2BOK A;  2BDB A;  4AG1 A;  1K1P A;  1UVS H;  3Q3Y A;  1MUE B;  4TWW A;  1LHD H;  4WY3 A;  4K3J A;  1P2M A;  4DT4 A;  3T28 A;  2J2U A;  2DUC A;  3LPR A;  2Y5G A;  1QNJ A;  3M3S A;  1O2Y A;  1ELB A;  2GT7 A;  1N1L A;  5JBC S;  4Y79 A;  2TGD A;  1GVZ A;  1O39 A;  1BRC E;  1BTU A;  2OQ5 A;  4ABI A;  4NIY A;  1NT1 A;  4IMQ A;  2ZGX H;  1SG8 B;  4BXW A;  3QTV H;  4KTC A;  3U9A H;  4FUG A;  4K1E A;  5KGO A;  4Y8Z A;  3STJ A;  3PV2 A;  4YLQ H;  1XUI A;  1A61 H;  4CH8 B;  1FN6 A;  2JH0 D;  3RXB A;  1MZD A;  1OHH D;  1C4U 2;  2Y81 A;  1C1V H;  2Z94 A;  1WSS H;  1KY9 A;  1NRQ H;  3EA8 A;  4Y71 A;  4CH2 B;  3PO1 B;  8GCH G;  1F5R A;  1LHF H;  3M7Q A;  1VCW A;  2A4Q A;  1S85 A;  2QXH A;  3P8F A;  1XKB C;  1PPE E;  1LQD B;  3KF2 A;  3SBK A;  2ODY B;  3RMM H;  1O3A A;  5HGG A;  5EIY A;  2ZU3 A;  1JWT A;  1A0H B;  1SPJ A;  2JDI D;  1FAX A;  1G3D A;  3OX7 U;  3PLP A;  4Y11 E;  1O2I A;  2O8M A;  1SLX B;  5LH8 A;  2OC1 A;  1G32 B;  4X1R U;  4IN2 A;  2BXU H;  2IPH A;  1GBK A;  7GCH G;  3RLY H;  6GCH F;  2A31 A;  4K1T A;  3UFA A;  2VWO A;  4TY6 A;  1EZU C;  1QL9 A;  3M36 A;  1KXA A;  4TT3 D;  5FPS A;  1KXE A;  1KDQ A;  1O0D H;  1HDT H;  4AFU A;  4AX9 H;  5JB9 S;  2V7Q D;  1PPG E;  3AAU A;  1MU6 B;  1ARC A;  1C1Q A;  3LIW A;  1GGD B;  2GMT B;  1O3C A;  2G00 A;  3O8B A;  5B6L A;  2F9P A;  2P59 A;  4DOQ A;  1AWH B;  1XX9 A;  2G81 E;  1WOF A;  1MTS A;  1GBF A;  4BAM B;  2BDY A;  2BDH A;  3GDV A;  1LHC H;  3PV4 A;  2KFW A;  3MNS A;  3U69 H;  2B0F A;  3TK6 A;  7KME H;  1K21 H;  4B73 A;  1GHW H;  2A7C A;  1O2J A;  1GI6 A;  2XC4 A;  1J17 T;  2WIN I;  5KEC A;  5I46 H;  1TPP A;  3T2N A;  2HLD D;  4Q2K A;  1EJA A;  2Z9G A;  2BDI A;  3LON A;  3ZYE A;  5FCK A;  1A3E H;  1QGF A;  1AWF H;  1E1Q D;  1SGF A;  1BBR K;  3LGI A;  5AFY H;  4FOU C;  5FAH A;  1IQM A;  2FOE A;  3RXJ A;  2IJD 1;  3AVZ A;  5C0U A;  4CRF A;  2QF4 A;  2ZTX A;  3WW7 A;  4I7Y H;  4ZXX H;  2D26 C;  1SB1 H;  4I32 A;  2B8O H;  1M9U A;  1ABJ H;  3P8N A;  1LPK B;  4PRO A;  2CJI A;  2OTV A;  3LGT A;  3LKW A;  4P00 A;  1AN1 E;  4DGJ A;  1HYL A;  2Y7Z A;  3FP8 E;  1JXP A;  4XBC A;  5A8Y A;  1YPK H;  1LVB A;  1C5X B;  3RDZ A;  3VGC C;  2PKS C;  3SNC A;  1GJA B;  2F43 B;  4JMY A;  3HKJ B;  1UVT H;  5GDS H;  2VIW A;  4OS4 A;  1O3I A;  2ZP0 H;  4Q7X A;  1TRM A;  1AE8 H;  1HAG E;  1N6Y A;  1SC8 U;  1OKX A;  3A88 A;  3A8B A;  1IHT H;  1SGC A;  4WXV A;  3H5C B;  1CGH A;  1NO9 H;  3FKS D;  3L33 A;  3VXE H;  1UW7 A;  2BX3 A;  3SV7 A;  3S9C A;  3AAS A;  1EAS A;  3GIS B;  1P2Q A;  3QK1 A;  1ESA A;  2CGA A;  4MNW A;  1LKA A;  1IQL A;  1C1P A;  4GPG A;  2V3O H;  5DP4 A;  4ZHM U;  1Z7K A;  3A84 A;  1SR5 C;  1HAP H;  1KYN A;  1GI2 A;  2K8I A;  2FLB H;  1DFP A;  2VB0 A;  1OWK A;  2WUB A;  3SJK A;  3UNQ A;  1O34 A;  4UD9 H;  3MU0 A;  3M35 A;  1QJ6 B;  1UCY E;  1CA0 B;  3MNX A;  1EOJ A;  1KDQ B;  4ISL A;  1TX6 A;  3SNA A;  5HKK D;  3SNE A;  1ZHP A;  1S6L A;  4Y6D A;  4X6N A;  1LPZ B;  2ZCK P;  1MBM A;  2G52 A;  2FZZ A;  1IQG A;  3BIU H;  1CHO F;  1C5W B;  2Q1J A;  4MPW A;  4IW4 E;  3HAT H;  1Z1J A;  2ZWL H;  2XTT B;  2FYQ A;  2P3F H;  2UWP A;  5EGM A;  2XWA A;  2V3M A;  4YT6 H;  3ZV9 A;  1A1R A;  3MI4 A;  1EPT C;  2FOM B;  2CF9 H;  2BQ6 B;  3RM0 H;  4Y7B A;  3OEH D;  4J1Y A;  1ELT A;  5DG6 A;  5JPM H;  4F4O C;  3TJO A;  1Z1I A;  1AUJ A;  1YPL H;  3MH7 A;  3B8J A;  1UMA H;  2Z6B D;  1ZGI A;  1ZJK A;  1GI5 A;  2ILN A;  2TGT A;  2XBW A;  3KGP A;  1EZQ A;  1P3C A;  2GDD A;  3NXP A;  2V35 A;  1O5D H;  3A7Z A;  2UWO A;  3RUO A;  1A5G H;  1GJD B;  2ZFF H;  4R8T B;  3A80 A;  3FP7 E;  4NIX A;  4K8B A;  4Y76 A;  1JRS A;  1A7S A;  1TNL A;  1A46 H;  1ARB A;  1EPT A;  2A1D B;  4I8L A;  1IQE A;  3SZN A;  2VH6 A;  3VB6 A;  3LDX H;  4B6E A;  4E7R G;  1UTK A;  1YBW A;  9EST A;  3RXF A;  1MQ6 A;  5FPT A;  3P8O A;  1GDU A;  1C1N A;  3KQE A;  8KME 2;  3F9H A;  4AGK A;  2TGA A;  3A8D A;  1WXR A;  3LJO A;  2G5N A;  3ZVA A;  3T29 A;  4OM9 A;  4CHA B;  3QDZ B;  2EI7 A;  3KYF A;  2G55 A;  2FO9 A;  1TAB E;  5EJL A;  1NM6 A;  3ZZ6 A;  1WTH D;  2SGQ E;  1UTJ A;  3RXL A;  2THF B;  1HFD A;  5EG4 A;  1BDA A;  2H9E H;  1TB6 H;  2HVY B;  1OP0 A;  1RXP A;  1Y5U T;  1OOK B;  3OAA D;  1WDI A;  1FI8 A;  1MKW K;  1DT2 A;  1C1O A;  2PKS B;  3FO8 D;  2XCN A;  5C20 A;  1WCZ A;  2ZHF H;  3KN2 A;  1HAO H;  1DUA A;  1IQK A;  2CHA C;  1HIA A;  1MTN C;  1QHR B;  1ZMJ A;  4IGD A;  3RMN H;  3LC5 A;  2A32 A;  1J15 A;  1FZZ A;  3SV2 H;  1QQU A;  1Y59 T;  2PWX A;  5GCH G;  2C8Y B;  4MTB A;  4YXW D;  2EA3 A;  4B6F A;  1MAB B;  1ESB A;  3GY3 A;  2FS9 A;  2OUA A;  5A0B A;  2F91 A;  4UFG H;  1O33 A;  4JZ1 A;  1NY2 2;  2GT8 A;  3F9F A;  4TPY A;  2GVF A;  4XOJ A;  3MHW U;  5FBE A;  3A83 A;  1C5Z B;  2NU4 E;  3E0N B;  5DJ7 A;  1L4Z A;  1PFX C;  3ZVF A;  5DP5 A;  1D6R A;  2BD3 A;  3VB3 A;  1O5B B;  1ACB E;  1W3C A;  1VKY A;  4A6L A;  1DOJ A;  1QUR H;  1E34 B;  1YP9 A;  1ELC A;  1T8O A;  5ETX A;  3PB1 E;  1N8O B;  4TPI Z;  1P2O A;  1IOE A;  1CBW C;  1ANE A;  3RLW H;  1SGE E;  4B75 A;  3EA9 A;  2BXT H;  4IN1 A;  1HNE E;  4DVA U;  2ANM H;  3P92 A;  1QZ8 A;  1MTV A;  1SGY E;  5GPI B;  3TK5 A;  5EOD A;  2BVS H;  1RIW C;  4GHT A;  5FPY A;  5EQQ A;  1ZRB A;  4JZI A;  1GI8 B;  1T8N A;  4GUX A;  1NN6 A;  3IG6 B;  2FDA A;  3GYL B;  3LJJ A;  4Y7A A;  3KYG A;  2ZU4 A;  1MCV A;  1ZZZ A;  4H4F A;  1SOZ A;  4CBO A;  2BDC A;  1RS0 A;  1AIX H;  1ZPC A;  1NRR H;  5GJ4 B;  1NES E;  1H9H E;  1E0F D;  2OXS A;  4UFD H;  1FQ3 A;  4GAW A;  1C5S A;  1FON A;  1V2U T;  4X6O A;  3TJN A;  1VGC B;  1TX7 A;  4AB8 A;  4JZE H;  2XCF A;  5IDK A;  1A0L A;  3SU5 A;  2I6Q A;  4CR9 A;  1F0R A;  2CXV A;  4MNV A;  2J34 A;  1Y5A T;  1SGD E;  2Q6D A;  4OS2 A;  1PYT D;  5LGO A;  1PPC E;  1V2O T;  3VB5 A;  4K60 A;  1VCP A;  2AFQ B;  3RP2 A;  2ZDM A;  2OBQ A;  3UIR A;  3V13 A;  2VVV A;  1JIM A;  2RFK C;  2EQN A;  2FP7 B;  4SGA E;  1HIA B;  1WU1 A;  3LH1 A;  2XWB I;  3I29 A;  4HG6 A;  4U2W A;  3D49 H;  2SGP E;  1AVW A;  1EKB B;  2BD2 A;  1O2O A;  2BD7 A;  3RXA A;  4AFZ A;  1F0U A;  1CT0 E;  1UVP A;  1TGS Z;  4BTI B;  1L2E A;  2HRV A;  3P17 H;  4HZH A;  1K28 D;  2A7H A;  3PMH B;  1LPG B;  2A2X H;  3TVJ B;  2AMQ A;  1GBE A;  3SJ9 A;  2NU0 E;  2A4R A;  3GY5 A;  1G3B A;  1HJA C;  3SQE E;  2A5K A;  4WH6 A;  1MAY A;  2SNV A;  4MQA A;  1O2T A;  3PO1 C;  1C9T A;  1ZHR A;  5C2Z A;  4JZD H;  3TNS A;  3F6U H;  3P6Z B;  3SN8 A;  1O5F H;  2YMS D;  8GCH F;  3E91 A;  1KMH B;  1J16 A;  1NBM D;  1S0R A;  2FX6 A;  4RKJ B;  4JCN A;  1FNI A;  4KTS A;  2F9N A;  2QF5 A;  3MO9 A;  3EE0 B;  1GBB A;  4WJG 2;  2BDG A;  2J38 A;  3CS0 A;  3F9G A;  3N7O A;  1GL0 E;  3ZZ4 A;  1FX0 B;  1V3X A;  1AVG H;  3E16 B;  4IMZ A;  5EOK A;  5IK2 D;  1AI8 H;  2WPM S;  4AGJ A;  3UOP A;  4UON A;  1QTF A;  2A45 B;  1T8M A;  2FLR H;  3IIT A;  2GCH G;  4NSV A;  1BCU H;  1XXD A;  5C94 A;  1TGT A;  1K1J A;  2YOL A;  2BY8 X;  2BD9 A;  1DWE H;  1YPE H;  4CBN A;  4I86 A;  3OY5 U;  4D7F A;  4UFE H;  4XFQ A;  1ZSL A;  1O3O A;  1TNK A;  1SOT A;  1CBW B;  1EAU A;  4A5T S;  5HM9 A;  4FUH A;  2WPD D;  5F8T A;  1YLN A;  2I6S A;  3K2U A;  1L1N A;  1GJ8 B;  1GMC G;  1Z71 A;  4CRE A;  4ISO A;  2R9P A;  2GTB A;  3GCO A;  4DY7 B;  4B71 A;  1FUJ A;  2GMT C;  4Z6A H;  1UTO A;  3T27 A;  3PLB A;  1E35 B;  4OS6 A;  1BTW A;  2V3H H;  5E2O A;  1FXY A;  2FOH A;  2ZFS A;  2PGQ B;  2V0B A;  5AFZ H;  1TLD A;  1GHA G;  4UE7 H;  5CMX H;  2J94 A;  3OSY A;  1K9O E;  1GBL A;  1MQ5 A;  3F2G A;  3PYH A;  4XRN A;  2OC0 A;  3Q3K A;  2AEI H;  4BAK B;  3KID U;  1DIT H;  2OP9 A;  5EQR A;  1YCP K;  2GV6 A;  2B5T B;  4UEH H;  2FI4 E;  1OPH B;  4YES B;  3UY9 A;  1VZQ H;  4QT8 C;  1QBN A;  1UO6 A;  2R2W U;  1C5O H;  1QL7 A;  1RTF B;  2P94 A;  2WPH S;  2EC9 H;  3SU2 A;  3RXD A;  5F6M A;  1LDT T;  2M2A A;  1EB1 H;  2HPP H;  5LPR A;  5E0H A;  4B1T A;  3T26 A;  1GI9 B;  1FV9 A;  4OS7 A;  2XXL A;  1O37 A;  3V12 A;  1G2M A;  2NWN A;  2FOC A;  1O32 A;  3SOR A;  2ZTZ A;  2BLO A;  3ZZA A;  4NZQ A;  3BTG E;  2H9T H;  2ZTY A;  3TIT A;  2WZQ A;  2QE7 D;  1Z8J B;  1QRX A;  1BMF D;  1BTX A;  2F4L A;  2XW9 A;  3KQD A;  4I8G A;  3GY8 A;  1O2L A;  4YT7 H;  3D65 E;  3OY6 U;  4FUC A;  3RXG A;  5A2M H;  1O2R A;  2ZO3 H;  2KAI A;  2UUJ B;  1GMH G;  1O3K A;  3BG4 B;  1DWD H;  4YOG A;  2UUF B;  4RN6 A;  2ASU B;  3PTB A;  2P3T B;  3H09 A;  2O8L A;  5TCC A;  5ESB A;  2QXJ A;  1O3D A;  4UFF H;  3AK5 A;  1YKT A;  4AOR A;  3LU9 B;  4FU8 A;  1HJ9 A;  2Q6G A;  2EI8 A;  4E06 H;  1EX3 A;  3RC4 A;  3URE A;  3FOA A;  1L0Z A;  2NU1 E;  1AND A;  2VWL A;  2OC8 A;  2P8O C;  1GBD A;  3CEN A;  2F9B H;  2BY6 X;  1PQ5 A;  2PLX A;  1FY3 A;  1GJ5 H;  4ASH A;  1HJA B;  3BTQ E;  1CGJ E;  1AKS A;  1DWB H;  1IAU A;  3H7O A;  4MPX A;  2NU3 E;  2KCP A;  4A7I B;  3GCT G;  1YPH E;  2ZFQ H;  3EQ0 H;  1C5P A;  1HCG A;  3VB7 A;  3BTT E;  1SKY E;  5DP8 A;  2JET B;  1BZX E;  4WF8 A;  1GL1 A;  4BTU B;  3MFJ A;  1AD8 H;  1RJX B;  3E3T A;  1CHG A;  1CA0 C;  4GHQ A;  1Q2W A;  3VPK A;  3TH3 H;  4BAQ B;  4WVP E;  2HOB A;  3A81 A;  2FMJ A;  2QV1 A;  3BTM E;  3BIV H;  1B5G H;  3UR9 A;  4YLU A;  2BLW A;  4RSP A;  3S69 A;  1O3H A;  1CT2 E;  2J92 A;  3MWI U;  3ZVD A;  2ZZU H;  4MNY A;  4AG2 A;  1NU7 B;  2WSS D;  5T6F A;  1C1M A;  2ZFR H;  2BM2 A;  1O3N A;  2BB4 A;  5C1U A;  4YO9 A;  3L3T A;  3KQ5 A;  2BY9 X;  4JYU H;  4BNR A;  4X2Y A;  2STB E;  1ORF A;  2JH5 D;  1ANC A;  1CGI E;  3FAO A;  3ZVG A;  2CK3 D;  1J9C H;  1XVO A;  5PTP A;  2J4I A;  2SFA A;  1MBQ A;  1Y3Y A;  2QIQ A;  3MH6 A;  2STA E;  1FLE E;  4JK5 A;  5I25 A;  1TGB A;  5E0J A;  3V3M A;  3DT0 H;  3BTH E;  3U1I B;  1UCY H;  2Y5F A;  1D3Q B;  1G3E A;  2SGD E;  3LGW A;  4KP0 A;  1CO7 E;  3SU4 A;  3KQB A;  2ZDK A;  3OFN D;  4Y8X A;  4X0W U;  1YLD A;  1H8E D;  4LOY H;  1YPJ H;  1BBR E;  4OGX A;  1W7G H;  5KED A;  1FJS A;  1THP B;  1CT4 E;  5DKM A;  1B0F A;  4CRD A;  1TNG A;  5F8Z A;  3MTY A;  3ZZ9 A;  3SNB A;  1J14 A;  2H1U A;  4RT1 A;  5DPA A;  1C2L A;  2PKA A;  4HI3 A;  1T7C A;  3LGV A;  1TON A;  2KAI B;  2A4G A;  1TAL A;  4Z1M D;  4CHA C;  1BJV A;  1ZML A;  3T62 A;  2K0Q A;  1DS2 E;  1NTP A;  1ZHM A;  1YCP M;  4ZRO A;  1QFK H;  5TJX A;  1BML A;  1VR1 H;  5ABW A;  3GY7 A;  2TIO A;  1QJ1 B;  2VGC C;  1RD3 B;  3A89 A;  1DUE A;  4WH8 A;  1EOL A;  4O3T A;  5FXL A;  2ZGJ A;  2F9U A;  5JYI A;  4AZ2 B;  3QWC H;  1XKA C;  1WQV H;  2Z3D A;  3SU3 A;  2IN2 A;  3LOX A;  5F03 A;  1YLC A;  3H7T A;  2D8W A;  2YMS B;  3K9X B;  1FN8 A;  3SJI A;  1O35 A;  1W14 U;  1AKS B;  4XE4 A;  1DY8 A;  4Q7Z A;  1MKX H;  6CHA B;  4KTU A;  1HRT H;  1KXF A;  5C1X A;  1D4P B;  2HLC A;  3SO3 A;  1OWI A;  2WPK S;  4NWL A;  1GJC B;  3OE7 D;  2PTN A;  3PRD A;  1G9I E;  1C5R A;  1SQO A;  3MO6 A;  1TPA E;  2PTC E;  2VWM A;  1GBH A;  1O2U A;  2ZCL P;  2AER H;  4GCH G;  2IOT A;  1OWE A;  4X8V H;  3RXK A;  2GKV E;  1XUG A;  2P8O B;  3E8L A;  5H4I B;  1EJN A;  2KM0 A;  1TPS A;  3SJO A;  1P10 A;  3V7T A;  5HM2 A;  3QTO H;  2VVU A;  3A85 A;  2QYI A;  5AHG H;  2A4O A;  2H6M A;  2BHG A;  4TYD A;  1P04 A;  3D62 A;  1WUN H;  1QA0 A;  3LH3 A;  1OS8 A;  4ZKO U;  1SHH B;  1K1O A;  1N8O C;  1C2D A;  3E6P H;  1DM4 B;  3ZZC A;  1JOU B;  2GCT B;  1RGQ A;  4LZ4 B;  2R0L A;  2KX4 A;  1AFQ B;  4NWK A;  1O2X A;  3ATK A;  1PPB H;  1UHB A;  5A0A E;  3A82 A;  7EST E;  3KQC A;  3LC3 A;  3MMG A;  3PRO A;  4DCD A;  3GDS A;  2AMD A;  5BRR E;  2BTC E;  1XM1 A;  4FUI A;  1GBI A;  2CN0 H;  2TPI Z;  1CA8 B;  2PW8 H;  4R0I A;  1BIT A;  3QGN B;  1K1I A;  2CV3 A;  1GPZ A;  1SI5 H;  1O2H A;  2FIR H;  3SV6 A;  1GHX H;  1K1N A;  2KCA A;  2NU2 E;  2L6O A;  2VH0 A;  1P06 A;  1SGP E;  4FU7 A;  4FUF A;  2BDA A;  3TPI Z;  1PJP A;  2BQW B;  3FZD A;  1GCT B;  2PKA B;  1D3T B;  1F0S A;  1O5C B;  1IQI A;  3JZ2 B;  4X2V A;  2F9V A;  1ID5 H;  1UTQ A;  2ZFP H;  4RT0 A;  3O8C A;  4XBB A;  2FX4 A;  3AW1 A;  1SBW A;  2ZU1 A;  1F2S E;  4TSF D;  1Y5B T;  4B76 A;  1DVA H;  1NU9 A;  1VGC C;  4I31 A;  1GDN A;  3AW0 A;  3VXF H;  1THR H;  4X6M A;  2FEQ H;  3PRB A;  1BTZ A;  3U1J B;  3QX5 H;  2O8U A;  1CSO E;  2C90 B;  1KLI H;  3SUD A;  2RDL A;  4TY7 A;  4AFQ A;  1TBZ H;  2PP6 A;  2BD8 A;  1DLK B;  1V2Q T;  3RXS A;  5L30 H;  4NFF A;  5CHA B;  1S81 A;  3M5L A;  1E36 B;  1O3M A;  4X2W A;  3TH2 H;  3MQK C;  1W0K D;  5K7R A;  1TFX A;  4H6S B;  2ZHD A;  2LP6 A;  5C67 A;  1V2J T;  4E05 H;  2TRM A;  1AB9 C;  1QB6 A;  3GY2 A;  2VWN A;  5EW2 H;  1OP2 A;  1BHX F;  5J4S A;  2WPI S;  4WMF A;  5DGJ A;  1ZJD A;  1BRU P;  2VGC B;  5T6D A;  3STI A;  4ZHL U;  1GBA A;  1K22 H;  1GBT A;  1TGN A;  1TOC B;  1GI0 A;  4FUB A;  3M5N A;  4D9R A;  4I8H A;  3RXI A;  4ZXY H;  3TNT A;  1O2W A;  4JZF H;  5JBT A;  1FY8 E;  1O3B A;  1O2M A;  3RXR A;  3P70 B;  2W6I D;  4DT7 B;  4D7G A;  1P03 A;  3OU0 A;  2ANY A;  1O2K A;  3A87 A;  4WMD A;  3GCH B;  5EW1 H;  1TMT H;  1D9I A;  2DE8 A;  1K2I 1;  3TLO A;  3S9B A;  3F2H A;  3DA9 B;  3CNR A;  4B2A A;  1TQ0 B;  1C1W H;  1NC6 A;  2WHX A;  3I77 A;  2PSX A;  3SI4 H;  4CR5 A;  3NUM A;  3BTW E;  4AOQ A;  1HAY B;  1BHX B;  2EST E;  2IPQ X;  4K69 A;  2ZPR A;  2ANK H;  2Z9K A;  1V2L T;  5A0C A;  1UHB B;  2VNT A;  4ABA A;  2R0K A;  2EEK A;  3HPT B;  2XOK D;  4NGA H;  3QN7 A;  1DIC A;  2OQU A;  1C4Y 2;  1DST A;  2AMP A;  4YM9 A;  5L6N H;  3GIC B;  3SU6 A;  5EU8 A;  1DWC H;  1O2V A;  4K2Y A;  3BG8 A;  1YC0 A;  3UPE A;  3UAI C;  1NS3 A;  2W3I A;  3N7D A;  3O8D A;  5GXP A;  2RA0 A;  2C93 B;  3ODF A;  4THN H;  1V2R T;  3M61 U;  4ZAE A;  4MLF B;  2HAL A;  1FPH H;  2AS9 A;  2J97 A;  3SHA H;  2QC2 A;  4A1T A;  1GMC F;  1C5V A;  2ZPQ A;  1W2K H;  3A7Y A;  3ITI A;  4ZKS U;  3S7K B;  2ZDL A;  3MU8 A;  1O36 A;  3PLK A;  4NZL A;  1L1G A;  2ULL A;  1P12 E;  1IQN A;  4INH A;  2GJG A;  3RXH A;  1GHA F;  1GHB G;  1LTO A;  1FPC H;  4ABJ A;  1EAW A;  1IQJ A;  1AMH A;  2JKH A;  2OC7 A;  2KZ4 A;  2XBV A;  3ZV8 A;  2GZ9 A;  2GX4 A;  1GI1 A;  2FOD A;  2BX4 A;  4ABF A;  1O2P A;  2ALV A;  3VB4 A;  4XBD A;  3ZVB A;  1K0H A;  3URD A;  3MU4 A;  1L1J A;  3OTJ E;  1XUJ A;  2F3C E;  2JJ2 D;  1C1S A;  4NA9 H;  4Q80 A;  1O5E H;  1ZLR A;  2B9L A;  3E0P B;  1X7A C;  3U98 H;  1DLE A;  2Z3C A;  3BTF E;  3FVF B;  3G01 A;  4GLY A;  3ZZB A;  1KLJ H;  5FCR A;  2HWL B;  1LHG H;  3BN9 A;  4BAO B;  3PTN A;  3M5M A;  1UTL M;  2FOA A;  2H9H A;  4ISH H;  1QB9 A;  2V6N A;  3CP7 A;  3SGA E;  1G2L A;  1BTH H;  3URC A;  1CE5 A;  2TBS A;  3BG4 C;  1H9I E;  3EAJ A;  1ZSK A;  1J8A A;  2Z7F E;  1BTY A;  3UUZ A;  1AB9 B;  1DE7 H;  2SGE E;  1VIT H;  2WPL S;  1T32 A;  1Y3V A;  1GMH F;  3SV9 A;  1HJ8 A;  1BRB E;  1S6F A;  4ZHA A;  4FU9 A;  2ALP A;  1SGR E;  3C1K A;  3U8O H;  9LPR A;  1GJ7 B;  3QLP H;  2ZHW H;  1OWH A;  1A5H A;  1O3F A;  3N7E A;  1C2F A;  1B7X B;  5FX6 A;  2QGR A;  4OS5 A;  3T5F H;  4Z0K A;  1BMN H;  2VIO A;  2ZGH A;  3ENS B;  3D23 A;  2RCE A;  2O9Q A;  2FOB A;  2FOG A;  2O8T A;  1BIO A;  5C1Y A;  4Y0Y E;  3M3T A;  4XD7 D;  4CRG A;  1KXC A;  5EXL A;  1LKB A;  2UWL A;  2JET C;  2ZHQ H;  1OYT H;  3EGK H;  2GZ7 A;  1SGQ E;  2QCY A;  2CMY A;  1P3E A;  3ZZ8 A;  3SQH E;  3M5O A;  2Y6T A;  2ZC9 H;  4YZU A;  8EST E;  4ABD A;  1UJ1 A;  3KCG H;  2KCO A;  1YPH C;  4Y10 E;  2Z3E A;  3VG8 A;  4X1P U;  3SYJ A;  2F9O A;  3MO3 A;  4B74 A;  3RXC A;  1FY5 A;  3FZZ A;  1FY4 A;  1P2N A;  2WYG A;  2BMG B;  4X6P A;  5C3N A;  1E1R D;  1D6W A;  2W26 A;  3EST A;  3UWJ H;  4DW2 U;  2QY0 B;  3TH4 H;  3FAN A;  3EE7 A;  4F49 A;  5JB8 S;  1HPG A;  1PQ8 A;  3C27 B;  5HIZ A;  1GVK B;  1GI4 A;  1A2C H;  1W11 U;  7GCH F;  1ZRK A;  5DSF A;  1U6Q A;  2Q6F A;  2JIZ D;  4AFS A;  4I8J A;  1DAN H;  1VJA U;  1MU8 B;  1DSU A;  2FM2 A;  2W5E A;  1KXD A;  1HAV A;  1FMG A;  1YF4 A;  2P16 A;  1W7X H;  3BEI B;  2ZA5 A;  1PYT C;  1YPG H;  2QAA A;  3F3B A;  2WV9 A;  2G5V A;  3HK3 B;  2LEL A;  1ELE E;  2P93 A;  3TK9 A;  1KXB A;  3S0N A;  1TAW A;  3M3V A;  2WYJ A;  4ABG A;  3TIU A;  1AU8 A;  1T4V H;  3FN8 A;  4XDE A;  4MVN A;  2W6J D;  4Q4L A;  1TMB H;  3BF6 H;  1P05 A;  1F92 A;  2PSY A;  1OXG A;  3DSP A;  2BOH B;  3SGQ E;  3UR6 A;  2BVX H;  2W7U A;  1S6H A;  4HTC H;  4KKD A;  1S0Q A;  4IC5 A;  1QBO A;  1P9U A;  1TBR H;  3HGN A;  1T31 A;  2ZEB A;  4FUJ A;  1XMN B;  2UUK B;  3DFJ A;  1C2M A;  1ZGV A;  2VIQ A;  1INC A;  2PFE A;  2TGP Z;  3MOC A;  1EZX C;  1OP8 A;  4F48 B;  1V2W T;  1HAZ B;  2YMS C;  1NFW A;  4H42 U;  3BEF B;  3UQV A;  5C5O A;  5DN6 D;  4MPU A;  1TYN A;  4NIV A;  6CHA C;  1E37 B;  1BBR H;  2XYA A;  3RC5 A;  1V2S T;  1W10 U;  3U28 C;  1VCQ A;  2EY4 C;  1QRW A;  4OGY A;  1ZPZ A;  2H5C A;  3BTK E;  1WQS A;  1HGT H;  2ZNK H;  1QCP A;  2FWW A;  2ZGC A;  5HIY A;  6EST A;  1TX8 A;  4VGC C;  2H2Z A;  4ZKR U;  3S9A A;  3ZYD A;  3TGJ E;  2J9N A;  1LVM A;  2ZI2 H;  4KEL A;  4A92 A;  1SQR A;  4GCH F;  1ABI H;  3MU5 A;  5GND A;  2BVR H;  1C5U A;  2P3U B;  3WWF A;  4GSO A;  1DX5 M;  1AFE H;  2ZDA H;  3NRL A;  2QXI A;  3U8T H;  3GCN A;  5EPN A;  3ZVE A;  4ACB A;  1G30 B;  3OYP A;  3HGP A;  4K8Y A;  4Y0Z E;  1SGN E;  2Z9L A;  1YYY 1;  2GCT C;  3BV9 B;  1HAX B;  1OYQ A;  3U8R H;  1FIZ A;  1AY6 H;  2BD4 A;  1LCY A;  2XBY A;  5L2Z H;  1AFQ C;  1BUI A;  1EJM A;  4IBL H;  1F0T A;  1HAV B;  1C4V 2;  4HGC A;  2PR3 A;  1IQF A;  1C2G A;  3GY4 A;  4EST E;  2C3S A;  5TCA A;  1P9S A;  4MG3 A;  3MH5 A;  1TRY A;  1QIX B;  2AIP A;  1V2P T;  2R3U A;  1A5I A;  4P02 A;  4BTT B;  1QJ7 B;  4IS5 A;  5IYT A;  5C0T A;  4OS1 A;  3UWI A;  1TNH A;  5HYO A;  1PQ7 A;  4BXS A;  1SL3 A;  4X1Q U;  1TPO A;  3GY6 A;  1GMD G;  1UK4 A;  3GOV B;  3UNS A;  1GCT C;  2XNI A;  1WBG B;  1O2S A;  1EXF A;  2PGB B;  2D2D A;  4ACA A;  3F0P A;  1AO5 A;  1V2N T;  2VIN A;  3R0F A;  2QF3 A;  3Q3X A;  4ZKN U;  3JZ1 B;  3MYW A;  1C2E A;  1VIT G;  1B0E A;  3ZIA D;  2J98 A;  3ZVC A;  1DDJ A;  1O30 A;  1ELF A;  5DP6 A;  2HNT C;  2FXR A;  3SUE A;  2XBX A;  4A1V A;  2C8Z B;  4F55 A;  3S7H B;  4FVD A;  1CVW H;  1SMF E;  3M7U A;  4O97 A;  3CS7 A;  2PUX B;  4RKO B;  1Z8R A;  1EB2 A;  1Z6J H;  3PWC A;  2LNC A;  5E0G A;  5CHA C;  1MCT A;  2OCV B;  2QN5 T;  5DK1 A;  1ZTJ A;  4AC9 A;  3N99 A;  2A7J A;  3RU4 D;  1GJ6 A;  1N6X A;  1CU1 A;  3PV5 A;  1BOQ A;  4ABB A;  1QB1 A;  2VIP A;  4INL A;  1NBM E;  3PWB A;  5EXN A;  4WME A;  1W12 U;  1AVX A;  5T1V A;  1TWX B;  3ATI A;  4AYV B;  1A0J A;  3SGB E;  2BY7 X;  3GDU A;  1S83 A;  1BT7 A;  2ZQ1 A;  4TWY A;  1K1L A;  2ZDV H;  4NG9 H;  1QR3 E;  3QUM P;  1ZSJ A;  1WV7 H;  3DFL A;  3EA7 A;  1SQT A;  4YOI A;  3B23 B;  1C5Y B;  3SU0 A;  4CRB A;  2ZKS A;  1P8V C;  2R2M B;  1ZTK A;  5GIB A;  4J2Y B;  4FUD A;  2BZA A;  3RXE A;  4ASU D;  1P09 A;  5FHT A;  4DJZ B;  1TNI A;  3NPS A;  1LMW B;  3GCH C;  5B6O A;  1TGC A;  5EXM A;  4AN7 A;  3OTP A;  4ZMA H;  4FET A;  5BPE A;  1QL8 A;  1P11 E;  4IC6 A;  1TA2 A;  2ODP A;  2SGA A;  3ZZ7 A;  3UNR A;  4RI0 A;  1XUH A;  5GCH F;  2G8T A;  3LGU A;  2C4F H;  4VGC B;  2WV5 A;  4WWY A;  1C2K A;  1O2Q A;  4D76 A;  1ANB A;  1GBJ A;  1P01 A;  1YY3 A;  1MKW H;  3F0O A;  1Q3X A;  1GVL A;  3UQO A;  1BTP A;  5CHB A;  2ZGB H;  2GZ8 A;  2PUQ H;  2YNA A;  1C5L H;  1GCD A;  3DSG A;  5A09 A;  2ODQ A;  4BAH B;  1DXP A;  3QO6 A;  1KIG H;  1Y8T A;  1C9P A;  4LZ1 H;  1C2H A;  1GHV H;  1P0S H;  3ATW A;  1D3P B;  2XC0 A;  2J5U A;  1NFU A;  3A7W A;  3PM3 A;  1HUT H;  3BEU A;  2ZQ2 A;  3DCL A;  2AGE X;  2QF0 A;  1TIO A;  2QXG A;  1SVP A;  1XUK A;  1AQ7 A;  2A5A A;  1EP6 A;  1Y3X A;  1TNJ A;  3NK8 A;  3TGK E;  1O2N A;  4ZUH A;  3MNB A;  1H1B A;  1JMO H;  3MNC A;  1AHT H;  4NSY A;  1A3B H;  1TBQ H;  3A7V A;  1BMM H;  2HNT F;  1FIW A;  3K65 B;  1HB0 B;  3W94 A;  1QRZ A;  1EQ9 A;  1EUF A;  4ZCN A;  1OWD A;  2J98 B;  1IQH A;  1GBC A;  3L6P A;  1MD7 A;  1O2G H;  2GGV B;  1C5Q A;  4NA8 A;  3MH4 A;  3OEE D;  1SLV B;  1HBT H;  5F53 A;  3BTD E;  1GHB F;  2OIN A;  1ETR H;  5T6G A;  1UCY K;  2HNT E;  2O8W A;  5EQS A;  1NRS H;  2GD4 B;  3W95 A;  1SGT A;  1Z6E A;  3A8C A;  5GWZ A;  3NWU A;  6GCH G;  4DII H;  5LPE A;  3RU4 T;  1G3C A;  1NFY A;  2GP9 B;  3DD2 H;  3LT3 A;  1C5N H;  4ZH8 A;  5DP9 A;  5EPY A;  2ZU5 A;  7LPR A;  2K1Q A;  1C1T A;  1ETT H;  2FS8 A;  4GVU A;  5C17 A;  3KL6 A;  1QY6 A;  1K1M A;  2VIV A;  1XVM A;  4CRC A;  3EDX B;  1Z8I B;  1SSX A;  1S5S A;  3SI3 H;  4BOH A;  3UOU A;  3F1S B;  2D1J A;  3I78 A;  1UTP A;  4FXG H;  1HXE H;  1ZTL A;  1O2Z A;  2VID A;  1ETS H;  2W3K A;  3SND A;  4SGB E;  1ELD E;  3ATL A;  1H8H D;  3FFG A;  1FAK H;  1O3J A;  3KNX A;  5CDF E;  2SGF E;  1NZQ H;  2AGG X;  1ELA A;  1MH0 A;  2L74 A;  1V2M T;  3K6Z A;  5DP7 A;  3ZZD A;  1JRT A;  1GJ9 B;  1EAI A;  5AF9 H;  2UUY A;  1Z8G A;  2AIQ A;  3QGJ A;  3RXM A;  4B2B A;  2OLG A;  4ISN A;  5HMA A;  3P95 A;  1MKX K;  4I8K A;  3T25 A;  1UVU H;  1GG6 C;  3RC6 A;  1OSS A;  3SJ8 A;  3B9F H;  3QZR A;  3W1E A;  2F83 A;  4MDS A;  4WXI A;  1SQA A;  3A86 A;  2BQ7 B;  4Q63 A;  5DO4 H;  5HXF A;  2A5I A;  1F5K U;  5G4B A;  1WAY B;  1RFN A;  1GWA A;  1BRA A;  2HPQ H;  3GS9 A;  4M9F A;  1O3G A;  4CRA A;  1MZA A;  1E38 B;  1V2K T;  2ZPS A;  1PPZ A;  4X8T H;  3VGC B;  1O5G H;  1PPF E;  1P02 A;  2XND D;  3O8R A;  1T8L A;  4NFE A;  3R3G B;  1KTT B;  2G4T A;  1MAX A;  4X1N U;  1SHY A;  1MD8 A;  1LQE A;  2VU8 E;  1HXF H;  1UTM A;  2Z9J A;  4X8U H;  1QBV H;  1RTK A;  2WUC A;  2GCH F;  1C1U H;  4JK6 A;  5FX5 A;  1V6D A;  2BLV A;  5F8X A;  2C8W B;  2ZIQ H;  1GHZ A;  4ABE A;  1COW D;  5FL7 D;  3PMA B;  5C5N A;  2AGI X;  1GJB B;  3DHK H;  5A8Z A;  3WWB A;  1C5M D;  1PQA A;  4I33 A;  3RU4 E;  1GI7 B;  3NKK A;  1H4W A;  3Q77 A;  2ZG0 H;  2BZ6 H;  2WPJ S;  1KLT A;  1SGF G;  5LPF A;  1ZPB A;  3EYD A;  1GI3 A;  1C2J A;  1HAI H;  3TJU A;  3WY8 A;  3RXU A;  1BA8 B;  2G51 A;  3A7X A;  4NIW A;  1NRN H;  2P95 A;  2RDE A;  2Y82 A;  5K0H A;  1FDP A;  1W13 U;  3MU1 A;  1LO6 A;  2YNB A;  1HV7 A;  4X2X A;  1CHO G;  8LPR A;  4X1S U;  1XXF A;  1C5T A;  4DG4 A;  1O3L A;  2W7S A;  2KR7 A;  4XSK U;  3SUG A;  1JBU H;  1TRN A;  3RMO H;  1EST A;  2JH6 D;  3RXP A;  2FYR A;  4NA7 A;  1P2K A;  3AAV A;  2HGT H;  1ZYO A;  3PMB B;  1EPT B;  3SUF A;  3BSQ A;  1Q31 A;  1UTN A;  2PHB A;  2VJ1 A;  1XUF A;  1GHY H;  2XC5 A;  2LPR A;  1W0Y H;  1NFX A;  4AYY B;  1EAX A;  1UK2 A;  4DUR A;  1TQ7 B;  3SHC H;  1GBM A;  1G36 A;  1MTU A;  4D8N A;  1HAH H;  4UDW H;  4H6T A;  1SFQ B;  3F68 H;  1G37 A;  1AZZ A;  1W0Z U;  1YCP H;  1H8D H;  2FTL E;  1O3E A;  3P8G A;  5J4Q A;  1YPM H;  2BLQ A;  1O38 A;  3M37 A;  3VEQ B;  2Z9I A;  1S82 A;  2AHM E;  5CE1 A;  1D3D B;  2RG3 A;  4X8S H;  1TOM H;  3Q76 A;  3SOS A;  1L4D A;  1O3P B;  3RXV A;  3PMJ A;  4B2C A;  2C8X B;  4Y8Y A;  3A8A A;  3RML H;  3TU7 H;  1BB0 B;  3KEE A;  4AB9 A;  4JYV H;  1VJ9 U;  1P57 B;  3Q00 A;  1GJ4 H;  4O3U A;  1GG6 B;  1V2V T;  5EJZ A;  3SZE A;  1JIR A;  1F7Z A;  3HKI B;  1SLW B;  1P2I A;  1TA6 A;  3UB0 A;  1EAT A;  1C1R A;  3DUX H;  3ZZ3 A;  1V2T T;  2HVX A;  1MTW A;  6LPR A;  3RXQ A;  1AE5 A;  1P2J A;  4M7G A;  5AVD A;  3E1X B;  2ZU2 A;  4O9V A;  1ZMN A;  2H5D A;  4JYT A;  2SNW A;  3ATM A;  4Q7Y A;  1O31 A;  1QQ4 A;  1O5A B;  1NRO H;  3GCT F;  1A4W H;  1ELV A;  5EJ1 A;  2WV4 A;  3RXO A;  1ZR0 A;  3ELA H;  5JDU B;  4U30 A; 
#chains in the Genus database with same CATH homology
 3MQK C;  2HVY B;  2EY4 C;  2RFK C;  3UAI C;  2EQN A;  2V3M A;  3U28 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...