2V3MA

Structure of the gar1 domain of naf1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
94
Chain Sequence
VPELPEDYEISEKTIITPIGVLKSAFENNIIIHATRVLKEGSIFCLEDRTLIGMLTEVFGPLQNPFYRIKLPDSKKNLFDELKVRLGEKAFIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAF1
publication title The Box H/Aca Rnp Assembly Factor Naf1P Contains a Domain Homologous to Gar1P Mediating its Interaction with Cbf5P.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosomal protein
total genus 17
structure length 94
sequence length 99
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 2v3mA00
3U28C 2EY4C 2V3MA 2EQNA 3MQKC 2RFKC 3UAIC 2HVYB
chains in the Genus database with same CATH superfamily
1Y59T 1C5QA 1S85A 1TE0A 1KTTB 1ZMNA 4AFQA 2Z3CA 4DGJA 5LPRA 2SGPE 5FPTA 1H9HE 3BTHE 5AFZH 2G55A 2VNTA 4WH6A 3V12A 1JBUH 1NRSH 4K1TA 1RFNA 3LU9B 1UVPA 3BTKE 4Y6DA 1ZHRA 3RXTA 3SNCA 3AAVA 1A5IA 1UTOA 1A3BH 1O32A 2BOHB 2ZHFH 2QF4A 5E0JA 1NU7B 4NIYA 4YZUA 5JB9S 2YNAA 2ODPA 4YTAA 1AB9B 2UUFB 3ZVGA 1AVGH 2A2XH 2J98A 3F9HA 2HLDD 4JZEH 4U01A 3RM2H 1MAXA 4Q2KA 3RXPA 4FUCA 3QTVH 3EQ0H 1Y5UT 4M7GA 2G81E 1W13U 1XMNB 2CJIA 2QE7D 5DP7A 4DG4A 4F48B 4BNRA 5C3NA 1NBME 3PRDA 5HMAA 1Q31A 3CS0A 2NU4E 1C1RA 4OS5A 5C0TA 2FPZA 1PQAA 3NRLA 2AIPA 1EZQA 2RDEA 1IQEA 2YMSC 2A7HA 3GYLB 1V2QT 1EP6A 1QA0A 2BZ6H 2TGDA 5DP6A 5A8XA 3N99A 2QF0A 1NFWA 4KELA 4TY7A 1TNKA 3F9GA 1AO5A 2H5DA 3MYWA 3SU1A 4X8VH 2A1DB 1GGDC 4D9RA 5BRRE 1FY3A 1OYTH 3SN8A 1YLCA 3KEEA 1ELVA 1FPCH 1C2FA 1ARBA 1PQ8A 2XNIA 4ZH8A 5C1YA 3DUXH 1SOZA 3RC5A 1LKAA 6ESTA 2FOMB 2ZGJA 1JXPA 2CHAC 1H8IH 1A46H 1KXEA 1TX6A 2BVRH 2C90B 4MPXA 4I31A 3ATLA 4ZHAA 1MH0A 4ABGA 2Y5FA 3BTWE 4TYDA 1GI0A 3TH3H 2ANMH 2IOTA 1ESAA 4Y79A 1BRBE 1GJAB 4TWWA 2QXIA 3OFND 3KNXA 5CE1A 2O8TA 4MG3A 1O2OA 2ANKH 3T28A 1UK4A 2WINI 3QZQA 2Y7ZA 1EB1H 2GT8A 3SV9A 1C1VH 1CGHA 1V2JT 4O03A 5K0HA 1F5RA 2C8WB 1FONA 4NFFA 3HK6B 1E79D 4YT7H 3PB1E 3NCLA 1SGQE 1TLDA 3F2HA 5LH8A 2YMSB 2BDYA 1SOTA 3ESTA 1DUAA 4ABAA 2FOFA 1ZJKA 1LO6A 1ZZZA 2OTVA 3KGPA 4MPUA 2AFQB 1P06A 4HG6A 1CGIE 1RTLA 5DGJA 2G4TA 4BAHB 1SMFE 1GCTB 1GHXH 3QWCH 1GGDB 2PR3A 3TVJB 1NRPH 1HPGA 1XUIA 4GVUA 1HIAB 1Z6EA 4UEHH 1S6LA 2WZQA 1P2OA 2BY9X 3DSGA 3OYPA 3FZZA 4Q7ZA 2P59A 3SJIA 1QB6A 1K1PA 1RTFB 2CHAB 1BMAA 2XBVA 1MCVA 2FEQH 3KHVA 3R3GB 3M37A 4K1SA 4Y71A 1O5BB 2C8YB 3C1KA 2WYJA 3VB7A 3MU8A 2BOKA 2BQ6B 3ZZAA 3MOCA 5A0BA 1FZZA 2AMQA 2RG3A 1QIXB 1O2SA 3SYJA 2I6QA 4K60A 3MNCA 1AUJA 4SGBE 1EX3A 2SGQE 5EXLA 3BTDE 1AU8A 1BB0B 1RIWC 1ZPCA 5L2ZH 4KTSA 3ZVDA 1BBRE 3FP6E 1H8ED 1HV7A 4DVAU 1HAYB 1ELBA 1EPTA 4INKA 3D65E 1QRZA 1AY6H 2BLVA 2TGTA 3KQ5A 2BY5X 2BDBA 5JBBS 3SV7A 3VEQB 3ZYEA 3A8DA 3MH5A 1WTHD 1WU1A 1B0EA 1ZPBA 3P8NA 1A3EH 7GCHG 3RXFA 3GY8A 2V0BA 2WPJS 4GHQA 1C5PA 3QTOH 3M3VA 2GV6A 2H9EH 5A8YA 5AFYH 2G00A 2WV9A 1PPGE 3UTUH 2GP9B 1S83A 1IQIA 2FOEA 1UHBA 4Z6AH 4IS5A 1LKBA 1QZ8A 1Z7KA 3MU5A 1DT2A 1MUEB 2CF9H 2Q6DA 3SGQE 1SR5C 1QFKH 1IOEA 3LH1A 3TU7H 5FBEA 1GHVH 5EG4A 3IITA 3ZV8A 1L1GA 1GJ8B 4A92A 2HALA 2XCNA 3M3TA 3SGAE 1MKXH 1GI8B 1ZYOA 2ZC9H 2WPDD 2G52A 3ZZDA 1OHHD 2EQNA 3RXGA 1O2RA 4X6OA 4B73A 3QK1A 4A5TS 3F6UH 5EIYA 1GMCG 1GBHA 2FOCA 2GCHG 1RIWB 2VIWA 5HIYA 3SBKA 3VB6A 3SU6A 3L6PA 1FLEE 3E6PH 4JCNA 1O5CB 2OBQA 1QTFA 2J5UA 4B2AA 3V7TA 4I8LA 3ZZ3A 1O3JA 1Y5BT 3BIVH 4YESB 5FX6A 5EXNA 5L30H 1CHGA 1AVWA 3RU4D 4NA9H 1T4UH 4F49A 2ZHDA 3T29A 1ZMLA 3TH2H 1XX9A 3PO1C 1ANBA 1QHRB 4X2VA 4UFEH 3UWJH 3MFJA 5IYTA 4FVDA 2GGVB 3SQEE 2IPHA 2W7SA 1C2DA 2GDDA 2VVVA 2JJ1D 1G3DA 2VIQA 1DM4B 3LKWA 1IQHA 1GI5A 1Q3XA 3FFGA 1NROH 1HJAC 1LHFH 1TGNA 1G37A 2P3UB 4GUXA 6GCHF 1D3QB 5C2ZA 3SGBE 2FM2A 1BRCE 3HKIB 1G3EA 1HAZB 1S5SA 1YWUA 1OWHA 1K1MA 2HLCA 4MPVA 1V2UT 3RLWH 1Y3UA 2P95A 5J4SA 1PQ5A 1B7XB 2TIOA 2GT7A 1DOJA 2QIQA 4VGCC 3S7HB 1BIOA 1D9IA 4WXIA 2B7DH 4IMZA 5CHAC 4YLUA 4D9QA 4YM9A 3VB5A 5EODA 3GCHC 4E7RG 1ETRH 3PV4A 1VKYA 1LVMA 3A84A 5DK1A 4BAOB 4CR9A 2BVXH 2PGBB 3PMBB 1BTXA 4OGYA 1MCTA 2HNTF 2PKAA 1W7XH 2O8UA 1KLTA 3KQDA 1AGJA 3F68H 4XSKU 2ZU3A 1QBOA 1ZHPA 2L74A 3PO1B 1ELFA 5EJ1A 1ZRBA 1V2VT 2ZFRH 3H7TA 4A6LA 1O3BA 1S82A 3RXCA 2ZDNA 2G51A 4WMEA 3NZIA 5T6FA 3RXHA 3SJKA 4B71A 1S0QA 3LGTA 3UR9A 4D8NA 1YCPK 2JDID 1ID5H 5DJ7A 1O3LA 1SGRE 3OE7D 1C5RA 1GI1A 1J8AA 1TA2A 1THSH 4DOQA 3A88A 2UUJB 4FUIA 3URDA 1O38A 1O2HA 2ASUB 5CHBA 4P02A 1KXBA 3G01A 2ZFTA 1ELCA 2K0QA 1DFPA 1NY22 4LK4A 4WWYA 3VGCC 4A1XA 4ABIA 4AGKA 1SGTA 1LCYA 2BD3A 1K0HA 2JJ2D 1E35B 3RLYH 2J9NA 4AFZA 1IQKA 2Z9JA 3GISB 4BXWA 1TYNA 2BX3A 2OQ5A 1WYKA 1O2YA 2XBYA 1ZTJA 2OC0A 5T6GA 5A09A 3K2UA 1E38B 2J92A 4VGCB 4INLA 5H4IB 3M7QA 1GG6B 4O3UA 3LJJA 1C5SA 1QRXA 2A31A 3A8BA 1ZJDA 3GCTG 1HAGE 5ESTE 1O2VA 1AFEH 1N8OC 2CGAA 2F9NA 1FUJA 3A7TA 1AWHB 4HI3A 1SBWA 3GY2A 1AE5A 3QN7A 3TIUA 2AEIH 3VXEH 1K1OA 1A0JA 1EJAA 4XOJA 5HGGA 1FNIA 1UO6A 2ZDKA 1P05A 2A7CA 1F5KU 1ZOMA 1RGQA 5FCRA 3VFEA 1O2PA 3SNDA 1O2MA 1Z8IB 1TGSZ 1SGPE 2OXSA 4OS6A 4AG2A 1P9UA 2B0FA 3OTPA 4IBLH 5HXFA 4OS1A 2BD4A 4AFUA 2FMJA 1C5OH 5JBTA 3A81A 3PMHB 4IN1A 1ANCA 2XBXA 2THFB 1V3XA 4CRGA 3RU4T 3VGCB 3FN8A 1GVZA 3WW7A 3Q3XA 2FOGA 1K1LA 1KSNA 3VPKA 1NU9A 1SHHB 3KCGH 1SGNE 1ZSJA 1FI8A 1DXPA 1HAVB 2NU1E 2BHGA 2FI4E 4CRAA 2BQ7B 3BTTE 3AW0A 1DWDH 4U30A 3MHWU 3RXLA 2A2QH 3WWFA 2AERH 2AMDA 5DP3A 3GICB 3DFLA 1N8OB 1SKYE 4MLFB 2AIQA 4NGAH 4Y0YE 1FV9A 3LIWA 1QL7A 2J34A 3K65B 4ZUHA 1PPEE 1MD7A 2JH6D 5L2YH 3LT3A 1EFRD 3DT0H 1RD3B 1IQNA 2PTNA 4KTUA 3TGJE 1IQGA 2C8ZB 4FUFA 1GJ9B 2WPMS 3AVZA 1C5NH 4U2WA 5A0CA 1A1RA 2FOHA 2W6ID 1GL0E 4YOGA 1DLKB 1LPZB 3RMMH 3RXBA 1LHDH 2Z7FE 5FCKA 1BMMH 4X1PU 1D3DB 2UUKB 4NSYA 3M35A 2AGIX 2OQUA 1CHOF 1OP0A 2GMTC 1TMTH 1BTYA 2Q1JA 1C2IA 2QC2A 5A8ZA 1O2NA 1C2GA 1VJ9U 1H8HD 1TRYA 2CMYA 2P8OC 3NK8A 2ZGBH 2F9VA 2XBWA 3OAAD 1FXYA 2PW8H 1VITF 3SZEA 5F8ZA 3UPEA 1O2IA 4GCHF 4ABJA 5JBAS 1Z1IA 2ZF0H 1V2LT 3ZZCA 3SJ9A 2TGAA 1C5VA 1TALA 5AHGH 1SQTA 1EJMA 5KGOA 4OGXA 5PTPA 3ZVEA 4X1NU 1FIWA 1C2MA 1IQLA 1IQMA 1EP5A 4DIIH 4TT3D 2A4OA 3DSPA 5CDFE 4JZDH 2NU0E 1YPHE 1MMJN 1HYLA 1XUHA 1NFXA 1Y3XA 1BITA 1NO9H 6CHAC 3BEUA 3GY6A 2HGTH 2ZFQH 4XBCA 2GZ8A 4DURA 3TNSA 2Y82A 1OWIA 1W8BH 1OKXA 1KDQB 3S69A 1ZMJA 1MTWA 3GYMA 1G36A 1GPZA 3TNTA 4GLYA 1QNJA 2XW9A 1A7SA 2ILNA 1T8MA 4BANB 1MQ5A 1KYNA 1L0ZA 2L6OA 3UUZA 1C1SA 2FXRA 1BJVA 2FZZA 4ISOA 4XRNA 5DPAA 1TRNA 5F8XA 3FP8E 3ZZ5A 1KXAA 2GDEH 2C8XB 2GMTB 1MTNC 9LPRA 5EPYA 2P8OB 3S9BA 4LOYH 2EI7A 2ANYA 2ZECA 2BVSH 1W0YH 3SJOA 1O34A 3ZVCA 1LHCH 4FU9A 1BMFD 1MZAA 5HIZA 1NT1A 1OWDA 3FO8D 1GJ6A 2NWNA 1ANDA 4HZHA 1P09A 1FX0B 4MNWA 2KZ4A 1UCYH 2XRCA 5KECA 3M61U 1QB1A 1SSXA 1D3TB 1JRSA 2AHME 2ZIQH 1ELTA 1GJBB 2A45B 2A5AA 2J4IA 3RXIA 4X2XA 3PM3A 2FLBH 2ZTYA 3TK6A 1CA8B 1NC6A 1HCGA 3H5CB 1BTUA 4K8BA 4J1YA 3FAOA 5TCAA 1TPSA 5HKKD 2R3UA 3T27A 1ACBE 3VB4A 2KCYA 2ZWLH 2PUQH 2BY7X 1LDTT 3F3BA 3I77A 1HLTH 1C2LA 1COWD 1O2WA 3FP7E 1EAIA 1EATA 1QR3E 4IGDA 1OOKB 2QXHA 1TQ7B 3ITIA 1G3CA 3I78A 3BG8A 2ODYB 2CN0H 2O9QA 7KMEH 1CQQA 1HGTH 4CBNA 3A87A 5TJXA 3QGNB 5E2PA 4ZCNA 4DT4A 1MTNB 2ZFFH 1LVBA 2WSSD 3P17H 3SOSA 2VGCC 3AW1A 1V2ST 4Q4LA 1SG8B 4FUHA 2XC4A 2W7UA 4CH8B 2OLGA 3JZ1B 1GJ7B 1OPHB 1YLNA 3PLBA 3F2GA 3TLOA 1YPKH 2BDAA 2Q6GA 3EE0B 3MMGA 1PPBH 3RXDA 3RXVA 4ZXYH 3A8CA 3MU1A 1GJCB 1BMLA 2Y80A 1Z8JB 5GWZA 1CT2E 2P3TB 4DCDA 2D1JA 1EZUC 3BIUH 2R2WU 3ZZ9A 2OC7A 1C4U2 3TJUA 1HFDA 4NSVA 5JB8S 2BX4A 3N7DA 3W94A 4YO9A 5DG6A 1XKAC 4FUBA 1DITH 3M5LA 3MO3A 1GHBG 2K8IA 3BTME 4TPIZ 1VCQA 2VWOA 4THNH 1AWFH 2FDAA 5GDSH 3PROA 2IN2A 3PTNA 2ZCKP 1YM0A 1Z8GA 2TRMA 1T8LA 1YPHC 4D7FA 3M5OA 1W0KD 1C1WH 1W14U 4JK5A 5ESBA 1PPHE 3SUGA 4ABEA 2FP7B 1Z71A 2JH0D 2ZHQH 2JH5D 5EGMA 4FUJA 1GMHF 4D7GA 3QDZB 2CV3A 3ZVFA 1NZQH 3RM0H 2AYWA 2D8WA 1F0SA 1O5GH 1P57B 2VGCB 3BG4C 3MI4A 1G2LA 2YNBA 1QA7A 2VVCA 2A5IA 4NFEA 1IQFA 2ZU2A 2KCPA 2QF3A 3VXFH 1P2JA 3S9CA 2ZGXH 3EYDA 2J2UA 1GDQA 3D49H 2FTMA 5GXPA 1NTPA 3P8FA 1OX1A 3SU0A 3URCA 4B6EA 1O3OA 3N7EA 1MTUA 1Y3YA 1HAVA 2FX4A 1HNEE 3STJA 4ZMAH 3GDUA 2NU3E 3NWUA 4BTIB 2O8LA 2ZPRA 2V3MA 4YLQH 2Z9LA 3ODFA 1HB0B 2Z94A 1JWTA 1T8NA 1ELDE 1XM1A 5F8TA 1PYTD 3KQBA 1P10A 1T4VH 3GY4A 3S0NA 2H9TH 1SQOA 2VJ1A 1W0ZU 4GCHG 4H42U 5HM9A 4K3JA 3VG8A 3UQVA 1OXGA 1GMDG 1E0FD 2ODQA 2VB0A 3S9AA 5GIBA 3RXUA 1LMWB 1WV7H 1MBMA 1K22H 3U9AH 4K69A 1CT0E 1WSSH 4UFGH 5T6DA 2KR7A 4OS2A 2HPQH 1PQ7A 4GAWA 4YOJA 1TQ0B 3BEIB 1O3HA 1W0JD 3VB3A 1AFQC 3CS7A 1TFXA 1L4DA 4ASHA 2NU2E 3SQHE 3BG4B 4RI0A 2AGGX 3EA8A 1C1MA 2O8MA 5EJLA 4F4OC 1BBRK 4DIHH 4I8HA 1W7GH 3GS9A 4TPYA 2YMSD 4WXVA 1TGTA 2FESH 1VGCC 4AOQA 1MTVA 1G3BA 3M7UA 5E2OA 5A0AE 1O2TA 4AG1A 2HRVA 1FAXA 1KTSB 1TOMH 1PPZA 1FN8A 4WF8A 1YF4A 3HGPA 4ZAEA 5FBIA 2PV9B 1SPJA 1A61H 4Y11E 2ZPSA 4CHAC 1AZZA 2PHBA 1TA6A 4NA8A 3B9FH 2XXLA 4Y76A 1P3EA 1F92A 1TX7A 2PTCE 3PV5A 4AB9A 3UNRA 1BHXB 4ZXXH 1GBBA 1F0RA 1EZXC 3GY3A 2ZDLA 1N6YA 1ANEA 3UNQA 5FHTA 3SV2H 1DSUA 4ESTE 3RMLH 1YC0A 2W26A 1X7AC 2GVFA 2HWLB 1P3CA 1YPLH 2KAIA 1QJ1B 8GCHF 1DANH 1O5AB 3V3MA 2D26C 3ODDA 1V6DA 1DXWA 1H9IE 3KYFA 2WV5A 3CNRA 4RSPA 1V2NT 1F0UA 3ZZ7A 1AFQB 4Q80A 4JYTA 1EXFA 4UONA 4LZ1H 2DE9A 3BV9B 4NZLA 3H7OA 1TNJA 1UVUH 3ZZ8A 1P04A 2TGPZ 1S6FA 1O0DH 1OP2A 1VGCB 2JETC 3WY8A 2PWXA 2UWPA 1GJ4H 3TGKE 5HYOA 3NXPA 3ATKA 1DUEA 1HBTH 1TBQH 2OD3B 1TBZH 4IN2A 5DP8A 1GHAF 1MQ6A 2XOKD 1GBAA 1O39A 3A7WA 3LJOA 1ABJH 1A5HA 3D62A 2Z6BD 3QUMP 4WH8A 2AGEX 4X6NA 3MH6A 4YOIA 2AMPA 1TAWA 4CHAB 1LQEA 1VJAU 2SGFE 2WPKS 4RN6A 1O30A 1D6RA 1SQAA 1AE8H 4YT6H 4MTBA 5IDKA 1K2I1 3FVFB 4TSFD 5C67A 3EAJA 2Y81A 1JIRA 4H6SB 2XNDD 2LP6A 2ZFSA 1L1NA 4ASUD 3K9XB 3BTEE 3MNXA 3MQKC 5B6LA 4D76A 2QA9E 2R2MB 3TPIZ 2WUCA 1MU8B 2R0LA 1JOUB 2F9UA 2DUCA 3LGYA 4WMDA 5T3HA 1N6XA 4Y0ZE 3SUFA 3E91A 3D23A 2WHXA 1SI5H 3F0PA 1EQ9A 1H8DH 1KY9A 2J98B 5LPEA 1RS0A 1O3AA 4B6FA 2P93A 5SGAE 1P2MA 3BTGE 4NG9H 4E05H 1QBVH 1GHWH 5ABWA 3ZZ6A 2KFWA 2JETB 1MAYA 1HJAB 1T32A 4ZKOU 3UQOA 1Y3VA 1FY8E 2H5CA 3C27B 1AIXH 2FWWA 2WPHS 4K1EA 5FPSA 1FPHH 1GMHG 2SGEE 3N7OA 4CH2B 1D3PB 2P94A 1XXDA 3T26A 3SU3A 2HVXA 1SFIA 5E0GA 4AX9H 1TRMA 4Y8XA 3ENSB 2BMGB 4DJZB 5HM2A 1MZDA 4Z1MD 4X0WU 5CHAB 4JZFH 3GCHB 2O8WA 1P12E 1E1RD 2PSXA 2GJGA 1EOLA 1BMNH 3PWBA 1FQ3A 1WTGH 1YKTA 1P9SA 1O33A 2W3IA 1SLUB 1ESTA 4CRBA 4B74A 4ABBA 2QCYA 4A1VA 3LPRA 3RXSA 1TPAE 3SV6A 4R0IA 4ISIH 2ZA5A 1ZLRA 1C1PA 5EQSA 3DD2H 3U28C 3SU4A 4Q7XA 2KCAA 3BTQE 5EQQA 3SW2B 1CGJE 3SHCH 2OC8A 2BZAA 2ZNKH 1HIAA 1Y3WA 1EAXA 1UTPA 5J4QA 1OSSA 1EOJA 1BUIA 1EPTC 1GVLA 1DWBH 8KME2 1GWAA 1ZGIA 2ZU5A 2VBCA 1O2ZA 1VITH 3W95A 2GX4A 3LOXA 4WVPE 1DWCH 1MTSA 4UDWH 1C2EA 3T25A 1MABB 4GPGA 2ZTXA 4INHA 1O3NA 2H1UA 2WUBA 1KXCA 1MU6B 1C9PA 3HATH 3F0OA 4FVBA 4IMQA 2VVUA 5EW2H 2ZDAH 1QL8A 3A7XA 3SV8A 4DT7B 1NFUA 1ZHMA 4MNVA 1TNHA 2A5KA 3GY7A 3GCOA 1UTKA 3RXRA 4HGCA 1MKWH 1LVYA 1LTOA 2W3KA 4I7YH 1ZSKA 1GCDA 1UTLM 3ZVBA 4O97A 3RC4A 4LZ4B 3RUOA 3DSOA 1GBEA 4MDSA 2Y5GA 4K2YA 3TK5A 1F5LA 1P2KA 4AYYB 2V35A 3IG6B 3PLPA 1ARCA 4ZKRU 1NRRH 4H4FA 1GI4A 2BY8X 1SLVB 3E0NB 2Z9GA 3IWMA 3L33A 1YCPM 2BD2A 4X1RU 1ZTKA 8LPRA 3QGJA 1HRTH 1GBKA 1LPGB 1FJSA 1O3IA 2GKVE 2W5EA 2Z9IA 1SLWB 3LONA 1O35A 2BY6X 4HTCH 3TJNA 1S0RA 2XC5A 4MNXA 1EPTB 5JBCS 1S84A 3U8TH 4X8UH 1K21H 1XVOA 2BDIA 1TIOA 1GBTA 3RXMA 5C94A 2IPQX 1UCYE 2VIPA 5A2MH 3V0XA 2B9LA 3AASA 2RA0A 3MO9A 1YPMH 1GBMA 3Q76A 6GCHG 4U32A 1GVKB 4ZKSU 2ZGCA 3EDXB 1YPEH 3M5NA 2WPIS 1SVPA 2EA3A 1AKSB 3KF2A 1TNIA 2ZZUH 2ZU1A 1EKBB 1A5GH 2SNWA 1UHBB 1P02A 2GZ7A 2ZCHP 3QLPH 3UIRA 1H4WA 2F4LA 4RKJB 1LHEH 4JMYA 4R8TB 1GBFA 1V2TT 2ZU4A 3LGIA 1CU1A 2A4QA 3RXAA 1UTQA 1UCYK 3SNAA 1HDTH 3E8LA 3SUDA 4BTTB 4JZIA 4RT1A 2ULLA 4MPWA 2ZPQA 1KLJH 3A89A 3LH3A 3RU4E 3RP2A 3OX7U 1BTPA 1TOCB 1FIZA 1LQDB 3BF6H 1LVOA 3Q00A 1HJ8A 4NWLA 2SGDE 3T5FH 2FX6A 4TWYA 1UTNA 1T7CA 3T62A 1A2CH 4NIWA 4WY3A 1NRQH 1SGCA 4NA7A 1AD8H 4B76A 1J15A 2FYRA 3ELAH 4ISLA 1KXFA 1NESE 1K1JA 4JZ1A 1QURH 1XKBC 2VH0A 3KQCA 2KX4A 1H9LB 2QY0B 3CENA 2PGQB 2CXVA 3UOUA 3PV2A 4I8KA 3B23B 2PKSC 1C5MD 4MQAA 1DX5M 3ZVAA 3V13A 1P03A 2RFKC 3F2FA 3M7TA 1DE7H 2P16A 2BLQA 2WPLS 1E36B 2A32A 3ATMA 4FETA 4GHTA 2FIRH 2V3HH 1Z6JH 1V2OT 2FI5E 5GJ4B 2LPRA 2HVYB 1PJPA 2BDHA 3OEED 1OWKA 5GCHF 3JZ2B 1O2UA 1GMCF 4B2BA 1B0FA 1D6WA 1ETSH 1XUGA 1BQYA 2BLWA 2ZFPH 2GCHF 4Y7AA 6CHAB 2QV1A 1PYTC 1SLXB 1G9IE 1JRTA 1BDAA 1O3MA 1Q2WA 1SGIB 1CSOE 3FZDA 2GD4B 2ALVA 5JDUB 3RXQA 5C0UA 2IJD1 1GBIA 4ISHH 1T31A 2V3OH 1GBLA 1NRNH 2VWNA 2PUXB 4CREA 1DY8A 1TMBH 1W12U 1BT7A 2FLRH 2R0KA 1ZTLA 5ETXA 1WOFA 1GBCA 3W1EA 2PP6A 5LGOA 2XCFA 5E8EH 1CE5A 1GI2A 3S7KB 1TWXB 1QBNA 3GOVB 2PLXA 2PKAB 1QJ6B 1EASA 1TPOA 1YPGH 2PKSB 3A85A 5DP5A 7ESTE 2FI3E 5K7RA 4Y8ZA 1DY9A 2V6NA 5IK2D 5C5NA 4ABFA 4M9FA 4KP0A 1V2PT 1SGDE 2QGRA 1DLEA 4XFQA 1O3DA 3O8CA 5C20A 5GNDA 2STBE 2OP9A 1C1QA 4Q7YA 1F2SE 1C1TA 1TX8A 1C4V2 2SGAA 2BD9A 1GI7B 1GCTC 4QT8C 5DSFA 2BDGA 6LPRA 4OS4A 4ZROA 5KEDA 4NCYA 4E7NA 5L6NH 3PMJA 2H9HA 3HKJB 1AUTC 2CF8H 4I86A 2OINA 4CRCA 1OP8A 1RTKA 4A7IB 1ELGA 2F83A 2WV4A 1GI3A 2EC9H 5TCCA 2B8OH 1VR1H 2XWAA 1BA8B 1BTZA 8ESTE 1SL3A 1G30B 5B6OA 3F9EA 3BEFB 2IJOB 2SNVA 2BD8A 2FODA 2GTBA 1P11E 2RDLA 1TGBA 3O8BA 1BTWA 4IW4E 2KCOA 2Z9KA 3MH4A 2F9OA 3BTFE 1BRAA 1A4WH 1UVTH 1GJDB 2VINA 3OTJE 4AC9A 2A0QB 2ZQ1A 2GCTC 1L1JA 1K28D 4Q63A 4ABDA 3AAUA 3NKKA 4Z0KA 3M3SA 2RA3A 1O2QA 1O5DH 2XTTB 3A7ZA 4NIXA 5DP9A 2G5NA 3MNSA 1CBWC 4FU8A 3A83A 1XUKA 3ATIA 3NPSA 1UW7A 4I33A 3P70B 4JK6A 2A4RA 3GY5A 2QXGA 2HPPH 1TONA 2JIZD 1D4PB 1BOQA 3E0PB 4JYVH 1CHOG 2V7QD 1XUJA 1CA0C 2B5TB 4BOHA 1QQ4A 3SNEA 3SU5A 2HNTE 1C2KA 1SGEE 4KTCA 1ZSLA 5DP4A 1O3PB 2I6SA 1HAOH 2ANWA 1RRKA 1VITG 5EU8A 2OUAA 5C17A 5DO4H 2ZKSA 1WDIA 3GCTF 3GDVA 1MKXK 3OY5U 1C5UA 4BXSA 3M36A 1UTJA 4FUEA 4JYUH 4A1TA 1J14A 1NPMA 4UD9H 1ETTH 2Y6TA 1YY3A 3A82A 3BN9A 5EOKA 4BAKB 1HXEH 3DHKH 1IHTH 1NM6A 3SU2A 2J97A 1Y5AT 3RMNH 3MU4A 2J94A 2ZHWH 1IQJA 1QCPA 4H6TA 1BHXF 1K1NA 2GCTB 1SC8U 4X2WA 1KIGH 2ZEBA 2BYAX 4XBDA 1Z1JA 5EPNA 5FX5A 1AI8H 3E3TA 3EE7A 2FOBA 4PROA 2F43B 1J17T 2ZTZA 2UUYA 1CBWB 1MD8A 3MTYA 2OK5A 4Y7BA 3QZRA 4BTUB 3MWIU 1HAPH 1B5GH 2J95A 3QX5H 1PPFE 1G2MA 4UFDH 2R9PA 1GI6A 4J2YB 1NS3A 1S6HA 3DA9B 1NFYA 2OCVB 4AGJA 1UJ1A 1SFQB 1P2IA 1EB2A 5EJZA 1CA0B 2ESTE 4ZKNU 3F9FA 2BTCE 1AQ7A 4X8TH 1AKSA 3TJOA 2BQWB 1ZRKA 2G8TA 4WJG2 4MNYA 1YLDA 3UR6A 1GI9B 5E0HA 1EUFA 3MO6A 1DWEH 3U69H 5G4BA 2AH4X 3MH7A 2C4FH 1GDNA 4TY6A 3PMAB 1UVSH 3SJ8A 1KDQA 1P2QA 1V2MT 4BAMB 1S81A 2GV7A 3K6YA 3M5MA 2CK3D 3HGNA 3ZZBA 2STAE 1QY6A 2UWLA 1GBJA 5GCHG 1W2KH 3A80A 4AB8A 2G5VA 2LELA 5EW1H 5T1VA 4ACBA 5JPMH 2QXJA 1CT4E 3SO3A 3UWIA 2KM0A 1FMGA 3E1XB 1DPOA 1VZQH 2C3SA 2VIOA 3UOPA 4CBOA 2A4GA 3PWCA 3TGIE 3LGVA 2QAAA 2VWMA 3GCNA 1TB6H 3LDXH 3FOAA 1BBRH 1GBDA 4AN7A 1OYQA 2TBSA 4X1SU 3PTBA 1QGFA 3RXOA 3Q3KA 5F6MA 1C1NA 3A8AA 3UREA 3LC5A 1E1QD 5I46H 2ZQ2A 2ALPA 2QF5A 3MNBA 1ZPZA 2PFEA 4KGAA 4Y10E 4OS7A 3AK5A 4X1QU 1J9CH 1SB1H 2BXUH 2WYGA 1O2JA 5I25A 1THPB 1ORFA 1U6QA 1T8OA 2EI8A 1WQVH 3DFJA 3LGWA 1O3FA 2HNTC 1C1OA 2Y7XA 3KQEA 2Z3DA 2M5TA 3EA9A 4X6PA 3UAIC 1GL1A 1O31A 1A0HB 1EAWA 3T2NA 1EZSC 1GG6C 1C5XB 4BAQB 4KKDA 3P95A 3SHAH 5C1UA 1F7ZA 1C5ZB 5FAHA 1V2RT 5DKMA 2Q6FA 1AVXA 3RDZA 1V2WT 3U98H 1ZGVA 3SUEA 1KXDA 1ABIH 1TGCA 2FS8A 2BB4A 2PSYA 1FY4A 3SI3H 1SHYA 4FUDA 1IAUA 4IC6A 5C1XA 2W6JD 1C2HA 3ZYDA 1SQRA 3I29A 1NBMD 4ISNA 1YGCH 1ELEE 3U8OH 3P92A 4FU7A 3RC6A 2FOAA 1HAXB 4I8GA 1MBQA 1C5TA 3PYHA 1O3CA 2ZDMA 4X6MA 2VU8E 2F3CE 4P00A 1WXRA 2Y5HA 3TJVA 1WQSA 3P6ZB 2G4UA 1GDUA 4NZQA 3KL6A 1LHGH 3SORA 1UK3A 1BJUA 1C5LH 1L4ZA 2ZDVH 1Y8TA 1UTMA 1O5EH 1YBWA 1F0TA 2BLOA 5CMXH 3LGUA 4GSOA 4LXBH 1O36A 1O2KA 1TNGA 3K6ZA 2RCEA 1INCA 3RXEA 4UFFH 1O5FH 1SGFG 1XXFA 1C5WB 1LPKB 1TBRH 4O9VA 1O2XA 4NWKA 2ZP0H 2VIVA 1UMAH 1M9UA 3SZNA 1C4Y2 2J38A 1BRUP 5EXMA 2DE8A 3EGKH 3NUMA 1O37A 5JYIA 1MKWK 1FDPA 4XBBA 3TH4H 3TITA 2OBOA 3O8DA 3LC3A 4XDEA 1JIMA 4FOUC 3L3TA 3H09A 2ZO3H 4FXGH 2HOBA 3P8GA 1EAUA 5F53A 2XYAA 1YP9A 4AORA 1OS8A 3TK9A 1HUTH 1GHYH 3ATWA 4B1TA 1YCPH 3SNBA 1E34B 1FY1A 4B2CA 4DY7B 1CO7E 5F03A 2OC1A 3UB0A 1C9TA 4IC5A 2FYQA 1HJ9A 4DW2U 1OWJA 2Z3EA 1GJ5H 1QB9A 1DICA 2D2DA 1HAIH 1TNLA 3QO6A 3EA7A 3Q77A 1IHSH 4ZHMU 1UVOA 1EJNA 4UE7H 2QN5T 1J16A 4X8SH 3PLKA 2P3FH 1WAYB 4RKOB 1K1IA 1VCPA 2FTLE 1SGYE 5FL7D 2SFAA 3KN2A 5BPEA 1W11U 1P01A 1DSTA 1UK2A 4X2YA 4XD7D 1ESBA 1O2LA 3A7YA 1C1UH 4AFSA 1AHTH 1P8VC 3CP7A 1W3CA 2UWOA 1GHBF 2EEKA 1W10U 1CVWH 3U1JB 2QYIA 2F91A 3ZV9A 2BDCA 3HK3B 2A7JA 4NIVA 3RXJA 5GPIB 5AVDA 2FO9A 1AN1E 1Z8RA 2ZGHA 1SGFA 3OU0A 2F9PA 1RXPA 3P8OA 3A7VA 1HAHH 1AZ8A 1O2GH 1P0SH 1AMHA 4HFPB 3F1SB 1KLIH 1HXFH 4YXWD 4RT0A 3MU0A 3UNSA 3OEHD 1QJ7B 1WUNH 1C2JA 5DN6D 1ZR0A 8GCHG 1FY5A 2VIDA 2GZ9A 5EQRA 4CRDA 1H1BA 1QQUA 4Y8YA 1KMHB 4MVNA 5LPFA 3O8RA 1XUFA 1YPJH 1C5YB 3RMOH 4AYVB 4I32A 2H2ZA 1THRH 2H6MA 1N1LA 2C93B 1G32B 1L2EA 1DDJA 2YOLA 2BD7A 4ACAA 2AS9A 4XE4A 1QL9A 4FUGA 1GHZA 4B75A 4ABHA 1DVAH 1E37B 2XWBI 1JMOH 1A0LA 1YYY1 3E90B 3GDSA 3R0FA 4WMFA 3FANA 2K1QA 1DS2E 1TABE 2ZHEH 1BZXE 3U1IB 3ZIAD 7LPRA 2ZI2H 2JKHA 5C5OA 3RXKA 3KIDU 4OM9A 2R3YA 5FPYA 1GHAG 4E06H 1RJXB 5FXLA 5AF9H 1VCWA 2BD5A 2M2AA 1FAKH 3OY6U 3SI4H 1ELAA 1TMUH 2EI6A 2FS9A 1GMDF 2XC0A 3UY9A 2VH6A 1PPCE 1FN6A 1AB9C 4CR5A 1BTHH 3BSQA 3STIA 1TPPA 3U8RH 3A86A 2BM2A 2VWLA 3ZZ4A 3OSYA 4AZ2B 3HPTB 3PRBA 4K8YA 3KYGA 2ZG0H 1NN6A 7GCHF 1O3GA 2BXTH 4F55A 1V2KT 1QRWA 1XVMA 3FKSD 1WBGB 4I8JA 9ESTA 4SGAE 3DCLA 4CRFA 2ZCLP 3UFAA 3B8JA 1P2NA 2F9BH 1K9OE 4O3TA 2KAIB 4K5ZA 2TPIZ 1PFXC 3Q3YA 1O3EA 2EY4C 1O3KA 1BCUH 1OWEA 4ZHLU 2LNCA 3WWBA 1WCZA 3E16B
chains in the Genus database with same CATH topology
3U28C 2EY4C 2V3MA 2EQNA 3MQKC 2RFKC 3UAIC 2HVYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U28 C;  2EY4 C;  2V3M A;  2EQN A;  3MQK C;  2RFK C;  3UAI C;  2HVY B; 
#chains in the Genus database with same CATH topology
 1Y59 T;  1C5Q A;  1S85 A;  1TE0 A;  1KTT B;  1ZMN A;  4AFQ A;  2Z3C A;  4DGJ A;  5LPR A;  2SGP E;  5FPT A;  1H9H E;  3BTH E;  5AFZ H;  2G55 A;  2VNT A;  4WH6 A;  3V12 A;  1JBU H;  1NRS H;  4K1T A;  1RFN A;  3LU9 B;  1UVP A;  3BTK E;  4Y6D A;  1ZHR A;  3RXT A;  3SNC A;  3AAV A;  1A5I A;  1UTO A;  1A3B H;  1O32 A;  2BOH B;  2ZHF H;  2QF4 A;  5E0J A;  1NU7 B;  4NIY A;  4YZU A;  5JB9 S;  2YNA A;  2ODP A;  4YTA A;  1AB9 B;  2UUF B;  3ZVG A;  1AVG H;  2A2X H;  2J98 A;  3F9H A;  2HLD D;  4JZE H;  4U01 A;  3RM2 H;  1MAX A;  4Q2K A;  3RXP A;  4FUC A;  3QTV H;  3EQ0 H;  1Y5U T;  4M7G A;  2G81 E;  1W13 U;  1XMN B;  2CJI A;  2QE7 D;  5DP7 A;  4DG4 A;  4F48 B;  4BNR A;  5C3N A;  1NBM E;  3PRD A;  5HMA A;  1Q31 A;  3CS0 A;  2NU4 E;  1C1R A;  4OS5 A;  5C0T A;  2FPZ A;  1PQA A;  3NRL A;  2AIP A;  1EZQ A;  2RDE A;  1IQE A;  2YMS C;  2A7H A;  3GYL B;  1V2Q T;  1EP6 A;  1QA0 A;  2BZ6 H;  2TGD A;  5DP6 A;  5A8X A;  3N99 A;  2QF0 A;  1NFW A;  4KEL A;  4TY7 A;  1TNK A;  3F9G A;  1AO5 A;  2H5D A;  3MYW A;  3SU1 A;  4X8V H;  2A1D B;  1GGD C;  4D9R A;  5BRR E;  1FY3 A;  1OYT H;  3SN8 A;  1YLC A;  3KEE A;  1ELV A;  1FPC H;  1C2F A;  1ARB A;  1PQ8 A;  2XNI A;  4ZH8 A;  5C1Y A;  3DUX H;  1SOZ A;  3RC5 A;  1LKA A;  6EST A;  2FOM B;  2ZGJ A;  1JXP A;  2CHA C;  1H8I H;  1A46 H;  1KXE A;  1TX6 A;  2BVR H;  2C90 B;  4MPX A;  4I31 A;  3ATL A;  4ZHA A;  1MH0 A;  4ABG A;  2Y5F A;  3BTW E;  4TYD A;  1GI0 A;  3TH3 H;  2ANM H;  2IOT A;  1ESA A;  4Y79 A;  1BRB E;  1GJA B;  4TWW A;  2QXI A;  3OFN D;  3KNX A;  5CE1 A;  2O8T A;  4MG3 A;  1O2O A;  2ANK H;  3T28 A;  1UK4 A;  2WIN I;  3QZQ A;  2Y7Z A;  1EB1 H;  2GT8 A;  3SV9 A;  1C1V H;  1CGH A;  1V2J T;  4O03 A;  5K0H A;  1F5R A;  2C8W B;  1FON A;  4NFF A;  3HK6 B;  1E79 D;  4YT7 H;  3PB1 E;  3NCL A;  1SGQ E;  1TLD A;  3F2H A;  5LH8 A;  2YMS B;  2BDY A;  1SOT A;  3EST A;  1DUA A;  4ABA A;  2FOF A;  1ZJK A;  1LO6 A;  1ZZZ A;  2OTV A;  3KGP A;  4MPU A;  2AFQ B;  1P06 A;  4HG6 A;  1CGI E;  1RTL A;  5DGJ A;  2G4T A;  4BAH B;  1SMF E;  1GCT B;  1GHX H;  3QWC H;  1GGD B;  2PR3 A;  3TVJ B;  1NRP H;  1HPG A;  1XUI A;  4GVU A;  1HIA B;  1Z6E A;  4UEH H;  1S6L A;  2WZQ A;  1P2O A;  2BY9 X;  3DSG A;  3OYP A;  3FZZ A;  4Q7Z A;  2P59 A;  3SJI A;  1QB6 A;  1K1P A;  1RTF B;  2CHA B;  1BMA A;  2XBV A;  1MCV A;  2FEQ H;  3KHV A;  3R3G B;  3M37 A;  4K1S A;  4Y71 A;  1O5B B;  2C8Y B;  3C1K A;  2WYJ A;  3VB7 A;  3MU8 A;  2BOK A;  2BQ6 B;  3ZZA A;  3MOC A;  5A0B A;  1FZZ A;  2AMQ A;  2RG3 A;  1QIX B;  1O2S A;  3SYJ A;  2I6Q A;  4K60 A;  3MNC A;  1AUJ A;  4SGB E;  1EX3 A;  2SGQ E;  5EXL A;  3BTD E;  1AU8 A;  1BB0 B;  1RIW C;  1ZPC A;  5L2Z H;  4KTS A;  3ZVD A;  1BBR E;  3FP6 E;  1H8E D;  1HV7 A;  4DVA U;  1HAY B;  1ELB A;  1EPT A;  4INK A;  3D65 E;  1QRZ A;  1AY6 H;  2BLV A;  2TGT A;  3KQ5 A;  2BY5 X;  2BDB A;  5JBB S;  3SV7 A;  3VEQ B;  3ZYE A;  3A8D A;  3MH5 A;  1WTH D;  1WU1 A;  1B0E A;  1ZPB A;  3P8N A;  1A3E H;  7GCH G;  3RXF A;  3GY8 A;  2V0B A;  2WPJ S;  4GHQ A;  1C5P A;  3QTO H;  3M3V A;  2GV6 A;  2H9E H;  5A8Y A;  5AFY H;  2G00 A;  2WV9 A;  1PPG E;  3UTU H;  2GP9 B;  1S83 A;  1IQI A;  2FOE A;  1UHB A;  4Z6A H;  4IS5 A;  1LKB A;  1QZ8 A;  1Z7K A;  3MU5 A;  1DT2 A;  1MUE B;  2CF9 H;  2Q6D A;  3SGQ E;  1SR5 C;  1QFK H;  1IOE A;  3LH1 A;  3TU7 H;  5FBE A;  1GHV H;  5EG4 A;  3IIT A;  3ZV8 A;  1L1G A;  1GJ8 B;  4A92 A;  2HAL A;  2XCN A;  3M3T A;  3SGA E;  1MKX H;  1GI8 B;  1ZYO A;  2ZC9 H;  2WPD D;  2G52 A;  3ZZD A;  1OHH D;  2EQN A;  3RXG A;  1O2R A;  4X6O A;  4B73 A;  3QK1 A;  4A5T S;  3F6U H;  5EIY A;  1GMC G;  1GBH A;  2FOC A;  2GCH G;  1RIW B;  2VIW A;  5HIY A;  3SBK A;  3VB6 A;  3SU6 A;  3L6P A;  1FLE E;  3E6P H;  4JCN A;  1O5C B;  2OBQ A;  1QTF A;  2J5U A;  4B2A A;  3V7T A;  4I8L A;  3ZZ3 A;  1O3J A;  1Y5B T;  3BIV H;  4YES B;  5FX6 A;  5EXN A;  5L30 H;  1CHG A;  1AVW A;  3RU4 D;  4NA9 H;  1T4U H;  4F49 A;  2ZHD A;  3T29 A;  1ZML A;  3TH2 H;  1XX9 A;  3PO1 C;  1ANB A;  1QHR B;  4X2V A;  4UFE H;  3UWJ H;  3MFJ A;  5IYT A;  4FVD A;  2GGV B;  3SQE E;  2IPH A;  2W7S A;  1C2D A;  2GDD A;  2VVV A;  2JJ1 D;  1G3D A;  2VIQ A;  1DM4 B;  3LKW A;  1IQH A;  1GI5 A;  1Q3X A;  3FFG A;  1NRO H;  1HJA C;  1LHF H;  1TGN A;  1G37 A;  2P3U B;  4GUX A;  6GCH F;  1D3Q B;  5C2Z A;  3SGB E;  2FM2 A;  1BRC E;  3HKI B;  1G3E A;  1HAZ B;  1S5S A;  1YWU A;  1OWH A;  1K1M A;  2HLC A;  4MPV A;  1V2U T;  3RLW H;  1Y3U A;  2P95 A;  5J4S A;  1PQ5 A;  1B7X B;  2TIO A;  2GT7 A;  1DOJ A;  2QIQ A;  4VGC C;  3S7H B;  1BIO A;  1D9I A;  4WXI A;  2B7D H;  4IMZ A;  5CHA C;  4YLU A;  4D9Q A;  4YM9 A;  3VB5 A;  5EOD A;  3GCH C;  4E7R G;  1ETR H;  3PV4 A;  1VKY A;  1LVM A;  3A84 A;  5DK1 A;  4BAO B;  4CR9 A;  2BVX H;  2PGB B;  3PMB B;  1BTX A;  4OGY A;  1MCT A;  2HNT F;  2PKA A;  1W7X H;  2O8U A;  1KLT A;  3KQD A;  1AGJ A;  3F68 H;  4XSK U;  2ZU3 A;  1QBO A;  1ZHP A;  2L74 A;  3PO1 B;  1ELF A;  5EJ1 A;  1ZRB A;  1V2V T;  2ZFR H;  3H7T A;  4A6L A;  1O3B A;  1S82 A;  3RXC A;  2ZDN A;  2G51 A;  4WME A;  3NZI A;  5T6F A;  3RXH A;  3SJK A;  4B71 A;  1S0Q A;  3LGT A;  3UR9 A;  4D8N A;  1YCP K;  2JDI D;  1ID5 H;  5DJ7 A;  1O3L A;  1SGR E;  3OE7 D;  1C5R A;  1GI1 A;  1J8A A;  1TA2 A;  1THS H;  4DOQ A;  3A88 A;  2UUJ B;  4FUI A;  3URD A;  1O38 A;  1O2H A;  2ASU B;  5CHB A;  4P02 A;  1KXB A;  3G01 A;  2ZFT A;  1ELC A;  2K0Q A;  1DFP A;  1NY2 2;  4LK4 A;  4WWY A;  3VGC C;  4A1X A;  4ABI A;  4AGK A;  1SGT A;  1LCY A;  2BD3 A;  1K0H A;  2JJ2 D;  1E35 B;  3RLY H;  2J9N A;  4AFZ A;  1IQK A;  2Z9J A;  3GIS B;  4BXW A;  1TYN A;  2BX3 A;  2OQ5 A;  1WYK A;  1O2Y A;  2XBY A;  1ZTJ A;  2OC0 A;  5T6G A;  5A09 A;  3K2U A;  1E38 B;  2J92 A;  4VGC B;  4INL A;  5H4I B;  3M7Q A;  1GG6 B;  4O3U A;  3LJJ A;  1C5S A;  1QRX A;  2A31 A;  3A8B A;  1ZJD A;  3GCT G;  1HAG E;  5EST E;  1O2V A;  1AFE H;  1N8O C;  2CGA A;  2F9N A;  1FUJ A;  3A7T A;  1AWH B;  4HI3 A;  1SBW A;  3GY2 A;  1AE5 A;  3QN7 A;  3TIU A;  2AEI H;  3VXE H;  1K1O A;  1A0J A;  1EJA A;  4XOJ A;  5HGG A;  1FNI A;  1UO6 A;  2ZDK A;  1P05 A;  2A7C A;  1F5K U;  1ZOM A;  1RGQ A;  5FCR A;  3VFE A;  1O2P A;  3SND A;  1O2M A;  1Z8I B;  1TGS Z;  1SGP E;  2OXS A;  4OS6 A;  4AG2 A;  1P9U A;  2B0F A;  3OTP A;  4IBL H;  5HXF A;  4OS1 A;  2BD4 A;  4AFU A;  2FMJ A;  1C5O H;  5JBT A;  3A81 A;  3PMH B;  4IN1 A;  1ANC A;  2XBX A;  2THF B;  1V3X A;  4CRG A;  3RU4 T;  3VGC B;  3FN8 A;  1GVZ A;  3WW7 A;  3Q3X A;  2FOG A;  1K1L A;  1KSN A;  3VPK A;  1NU9 A;  1SHH B;  3KCG H;  1SGN E;  1ZSJ A;  1FI8 A;  1DXP A;  1HAV B;  2NU1 E;  2BHG A;  2FI4 E;  4CRA A;  2BQ7 B;  3BTT E;  3AW0 A;  1DWD H;  4U30 A;  3MHW U;  3RXL A;  2A2Q H;  3WWF A;  2AER H;  2AMD A;  5DP3 A;  3GIC B;  3DFL A;  1N8O B;  1SKY E;  4MLF B;  2AIQ A;  4NGA H;  4Y0Y E;  1FV9 A;  3LIW A;  1QL7 A;  2J34 A;  3K65 B;  4ZUH A;  1PPE E;  1MD7 A;  2JH6 D;  5L2Y H;  3LT3 A;  1EFR D;  3DT0 H;  1RD3 B;  1IQN A;  2PTN A;  4KTU A;  3TGJ E;  1IQG A;  2C8Z B;  4FUF A;  1GJ9 B;  2WPM S;  3AVZ A;  1C5N H;  4U2W A;  5A0C A;  1A1R A;  2FOH A;  2W6I D;  1GL0 E;  4YOG A;  1DLK B;  1LPZ B;  3RMM H;  3RXB A;  1LHD H;  2Z7F E;  5FCK A;  1BMM H;  4X1P U;  1D3D B;  2UUK B;  4NSY A;  3M35 A;  2AGI X;  2OQU A;  1CHO F;  1OP0 A;  2GMT C;  1TMT H;  1BTY A;  2Q1J A;  1C2I A;  2QC2 A;  5A8Z A;  1O2N A;  1C2G A;  1VJ9 U;  1H8H D;  1TRY A;  2CMY A;  2P8O C;  3NK8 A;  2ZGB H;  2F9V A;  2XBW A;  3OAA D;  1FXY A;  2PW8 H;  1VIT F;  3SZE A;  5F8Z A;  3UPE A;  1O2I A;  4GCH F;  4ABJ A;  5JBA S;  1Z1I A;  2ZF0 H;  1V2L T;  3ZZC A;  3SJ9 A;  2TGA A;  1C5V A;  1TAL A;  5AHG H;  1SQT A;  1EJM A;  5KGO A;  4OGX A;  5PTP A;  3ZVE A;  4X1N U;  1FIW A;  1C2M A;  1IQL A;  1IQM A;  1EP5 A;  4DII H;  4TT3 D;  2A4O A;  3DSP A;  5CDF E;  4JZD H;  2NU0 E;  1YPH E;  1MMJ N;  1HYL A;  1XUH A;  1NFX A;  1Y3X A;  1BIT A;  1NO9 H;  6CHA C;  3BEU A;  3GY6 A;  2HGT H;  2ZFQ H;  4XBC A;  2GZ8 A;  4DUR A;  3TNS A;  2Y82 A;  1OWI A;  1W8B H;  1OKX A;  1KDQ B;  3S69 A;  1ZMJ A;  1MTW A;  3GYM A;  1G36 A;  1GPZ A;  3TNT A;  4GLY A;  1QNJ A;  2XW9 A;  1A7S A;  2ILN A;  1T8M A;  4BAN B;  1MQ5 A;  1KYN A;  1L0Z A;  2L6O A;  3UUZ A;  1C1S A;  2FXR A;  1BJV A;  2FZZ A;  4ISO A;  4XRN A;  5DPA A;  1TRN A;  5F8X A;  3FP8 E;  3ZZ5 A;  1KXA A;  2GDE H;  2C8X B;  2GMT B;  1MTN C;  9LPR A;  5EPY A;  2P8O B;  3S9B A;  4LOY H;  2EI7 A;  2ANY A;  2ZEC A;  2BVS H;  1W0Y H;  3SJO A;  1O34 A;  3ZVC A;  1LHC H;  4FU9 A;  1BMF D;  1MZA A;  5HIZ A;  1NT1 A;  1OWD A;  3FO8 D;  1GJ6 A;  2NWN A;  1AND A;  4HZH A;  1P09 A;  1FX0 B;  4MNW A;  2KZ4 A;  1UCY H;  2XRC A;  5KEC A;  3M61 U;  1QB1 A;  1SSX A;  1D3T B;  1JRS A;  2AHM E;  2ZIQ H;  1ELT A;  1GJB B;  2A45 B;  2A5A A;  2J4I A;  3RXI A;  4X2X A;  3PM3 A;  2FLB H;  2ZTY A;  3TK6 A;  1CA8 B;  1NC6 A;  1HCG A;  3H5C B;  1BTU A;  4K8B A;  4J1Y A;  3FAO A;  5TCA A;  1TPS A;  5HKK D;  2R3U A;  3T27 A;  1ACB E;  3VB4 A;  2KCY A;  2ZWL H;  2PUQ H;  2BY7 X;  1LDT T;  3F3B A;  3I77 A;  1HLT H;  1C2L A;  1COW D;  1O2W A;  3FP7 E;  1EAI A;  1EAT A;  1QR3 E;  4IGD A;  1OOK B;  2QXH A;  1TQ7 B;  3ITI A;  1G3C A;  3I78 A;  3BG8 A;  2ODY B;  2CN0 H;  2O9Q A;  7KME H;  1CQQ A;  1HGT H;  4CBN A;  3A87 A;  5TJX A;  3QGN B;  5E2P A;  4ZCN A;  4DT4 A;  1MTN B;  2ZFF H;  1LVB A;  2WSS D;  3P17 H;  3SOS A;  2VGC C;  3AW1 A;  1V2S T;  4Q4L A;  1SG8 B;  4FUH A;  2XC4 A;  2W7U A;  4CH8 B;  2OLG A;  3JZ1 B;  1GJ7 B;  1OPH B;  1YLN A;  3PLB A;  3F2G A;  3TLO A;  1YPK H;  2BDA A;  2Q6G A;  3EE0 B;  3MMG A;  1PPB H;  3RXD A;  3RXV A;  4ZXY H;  3A8C A;  3MU1 A;  1GJC B;  1BML A;  2Y80 A;  1Z8J B;  5GWZ A;  1CT2 E;  2P3T B;  4DCD A;  2D1J A;  1EZU C;  3BIU H;  2R2W U;  3ZZ9 A;  2OC7 A;  1C4U 2;  3TJU A;  1HFD A;  4NSV A;  5JB8 S;  2BX4 A;  3N7D A;  3W94 A;  4YO9 A;  5DG6 A;  1XKA C;  4FUB A;  1DIT H;  3M5L A;  3MO3 A;  1GHB G;  2K8I A;  3BTM E;  4TPI Z;  1VCQ A;  2VWO A;  4THN H;  1AWF H;  2FDA A;  5GDS H;  3PRO A;  2IN2 A;  3PTN A;  2ZCK P;  1YM0 A;  1Z8G A;  2TRM A;  1T8L A;  1YPH C;  4D7F A;  3M5O A;  1W0K D;  1C1W H;  1W14 U;  4JK5 A;  5ESB A;  1PPH E;  3SUG A;  4ABE A;  2FP7 B;  1Z71 A;  2JH0 D;  2ZHQ H;  2JH5 D;  5EGM A;  4FUJ A;  1GMH F;  4D7G A;  3QDZ B;  2CV3 A;  3ZVF A;  1NZQ H;  3RM0 H;  2AYW A;  2D8W A;  1F0S A;  1O5G H;  1P57 B;  2VGC B;  3BG4 C;  3MI4 A;  1G2L A;  2YNB A;  1QA7 A;  2VVC A;  2A5I A;  4NFE A;  1IQF A;  2ZU2 A;  2KCP A;  2QF3 A;  3VXF H;  1P2J A;  3S9C A;  2ZGX H;  3EYD A;  2J2U A;  1GDQ A;  3D49 H;  2FTM A;  5GXP A;  1NTP A;  3P8F A;  1OX1 A;  3SU0 A;  3URC A;  4B6E A;  1O3O A;  3N7E A;  1MTU A;  1Y3Y A;  1HAV A;  2FX4 A;  1HNE E;  3STJ A;  4ZMA H;  3GDU A;  2NU3 E;  3NWU A;  4BTI B;  2O8L A;  2ZPR A;  2V3M A;  4YLQ H;  2Z9L A;  3ODF A;  1HB0 B;  2Z94 A;  1JWT A;  1T8N A;  1ELD E;  1XM1 A;  5F8T A;  1PYT D;  3KQB A;  1P10 A;  1T4V H;  3GY4 A;  3S0N A;  2H9T H;  1SQO A;  2VJ1 A;  1W0Z U;  4GCH G;  4H42 U;  5HM9 A;  4K3J A;  3VG8 A;  3UQV A;  1OXG A;  1GMD G;  1E0F D;  2ODQ A;  2VB0 A;  3S9A A;  5GIB A;  3RXU A;  1LMW B;  1WV7 H;  1MBM A;  1K22 H;  3U9A H;  4K69 A;  1CT0 E;  1WSS H;  4UFG H;  5T6D A;  2KR7 A;  4OS2 A;  2HPQ H;  1PQ7 A;  4GAW A;  4YOJ A;  1TQ0 B;  3BEI B;  1O3H A;  1W0J D;  3VB3 A;  1AFQ C;  3CS7 A;  1TFX A;  1L4D A;  4ASH A;  2NU2 E;  3SQH E;  3BG4 B;  4RI0 A;  2AGG X;  3EA8 A;  1C1M A;  2O8M A;  5EJL A;  4F4O C;  1BBR K;  4DIH H;  4I8H A;  1W7G H;  3GS9 A;  4TPY A;  2YMS D;  4WXV A;  1TGT A;  2FES H;  1VGC C;  4AOQ A;  1MTV A;  1G3B A;  3M7U A;  5E2O A;  5A0A E;  1O2T A;  4AG1 A;  2HRV A;  1FAX A;  1KTS B;  1TOM H;  1PPZ A;  1FN8 A;  4WF8 A;  1YF4 A;  3HGP A;  4ZAE A;  5FBI A;  2PV9 B;  1SPJ A;  1A61 H;  4Y11 E;  2ZPS A;  4CHA C;  1AZZ A;  2PHB A;  1TA6 A;  4NA8 A;  3B9F H;  2XXL A;  4Y76 A;  1P3E A;  1F92 A;  1TX7 A;  2PTC E;  3PV5 A;  4AB9 A;  3UNR A;  1BHX B;  4ZXX H;  1GBB A;  1F0R A;  1EZX C;  3GY3 A;  2ZDL A;  1N6Y A;  1ANE A;  3UNQ A;  5FHT A;  3SV2 H;  1DSU A;  4EST E;  3RML H;  1YC0 A;  2W26 A;  1X7A C;  2GVF A;  2HWL B;  1P3C A;  1YPL H;  2KAI A;  1QJ1 B;  8GCH F;  1DAN H;  1O5A B;  3V3M A;  2D26 C;  3ODD A;  1V6D A;  1DXW A;  1H9I E;  3KYF A;  2WV5 A;  3CNR A;  4RSP A;  1V2N T;  1F0U A;  3ZZ7 A;  1AFQ B;  4Q80 A;  4JYT A;  1EXF A;  4UON A;  4LZ1 H;  2DE9 A;  3BV9 B;  4NZL A;  3H7O A;  1TNJ A;  1UVU H;  3ZZ8 A;  1P04 A;  2TGP Z;  1S6F A;  1O0D H;  1OP2 A;  1VGC B;  2JET C;  3WY8 A;  2PWX A;  2UWP A;  1GJ4 H;  3TGK E;  5HYO A;  3NXP A;  3ATK A;  1DUE A;  1HBT H;  1TBQ H;  2OD3 B;  1TBZ H;  4IN2 A;  5DP8 A;  1GHA F;  1MQ6 A;  2XOK D;  1GBA A;  1O39 A;  3A7W A;  3LJO A;  1ABJ H;  1A5H A;  3D62 A;  2Z6B D;  3QUM P;  4WH8 A;  2AGE X;  4X6N A;  3MH6 A;  4YOI A;  2AMP A;  1TAW A;  4CHA B;  1LQE A;  1VJA U;  2SGF E;  2WPK S;  4RN6 A;  1O30 A;  1D6R A;  1SQA A;  1AE8 H;  4YT6 H;  4MTB A;  5IDK A;  1K2I 1;  3FVF B;  4TSF D;  5C67 A;  3EAJ A;  2Y81 A;  1JIR A;  4H6S B;  2XND D;  2LP6 A;  2ZFS A;  1L1N A;  4ASU D;  3K9X B;  3BTE E;  3MNX A;  3MQK C;  5B6L A;  4D76 A;  2QA9 E;  2R2M B;  3TPI Z;  2WUC A;  1MU8 B;  2R0L A;  1JOU B;  2F9U A;  2DUC A;  3LGY A;  4WMD A;  5T3H A;  1N6X A;  4Y0Z E;  3SUF A;  3E91 A;  3D23 A;  2WHX A;  1SI5 H;  3F0P A;  1EQ9 A;  1H8D H;  1KY9 A;  2J98 B;  5LPE A;  1RS0 A;  1O3A A;  4B6F A;  2P93 A;  5SGA E;  1P2M A;  3BTG E;  4NG9 H;  4E05 H;  1QBV H;  1GHW H;  5ABW A;  3ZZ6 A;  2KFW A;  2JET B;  1MAY A;  1HJA B;  1T32 A;  4ZKO U;  3UQO A;  1Y3V A;  1FY8 E;  2H5C A;  3C27 B;  1AIX H;  2FWW A;  2WPH S;  4K1E A;  5FPS A;  1FPH H;  1GMH G;  2SGE E;  3N7O A;  4CH2 B;  1D3P B;  2P94 A;  1XXD A;  3T26 A;  3SU3 A;  2HVX A;  1SFI A;  5E0G A;  4AX9 H;  1TRM A;  4Y8X A;  3ENS B;  2BMG B;  4DJZ B;  5HM2 A;  1MZD A;  4Z1M D;  4X0W U;  5CHA B;  4JZF H;  3GCH B;  2O8W A;  1P12 E;  1E1R D;  2PSX A;  2GJG A;  1EOL A;  1BMN H;  3PWB A;  1FQ3 A;  1WTG H;  1YKT A;  1P9S A;  1O33 A;  2W3I A;  1SLU B;  1EST A;  4CRB A;  4B74 A;  4ABB A;  2QCY A;  4A1V A;  3LPR A;  3RXS A;  1TPA E;  3SV6 A;  4R0I A;  4ISI H;  2ZA5 A;  1ZLR A;  1C1P A;  5EQS A;  3DD2 H;  3U28 C;  3SU4 A;  4Q7X A;  2KCA A;  3BTQ E;  5EQQ A;  3SW2 B;  1CGJ E;  3SHC H;  2OC8 A;  2BZA A;  2ZNK H;  1HIA A;  1Y3W A;  1EAX A;  1UTP A;  5J4Q A;  1OSS A;  1EOJ A;  1BUI A;  1EPT C;  1GVL A;  1DWB H;  8KME 2;  1GWA A;  1ZGI A;  2ZU5 A;  2VBC A;  1O2Z A;  1VIT H;  3W95 A;  2GX4 A;  3LOX A;  4WVP E;  1DWC H;  1MTS A;  4UDW H;  1C2E A;  3T25 A;  1MAB B;  4GPG A;  2ZTX A;  4INH A;  1O3N A;  2H1U A;  2WUB A;  1KXC A;  1MU6 B;  1C9P A;  3HAT H;  3F0O A;  4FVB A;  4IMQ A;  2VVU A;  5EW2 H;  2ZDA H;  1QL8 A;  3A7X A;  3SV8 A;  4DT7 B;  1NFU A;  1ZHM A;  4MNV A;  1TNH A;  2A5K A;  3GY7 A;  3GCO A;  1UTK A;  3RXR A;  4HGC A;  1MKW H;  1LVY A;  1LTO A;  2W3K A;  4I7Y H;  1ZSK A;  1GCD A;  1UTL M;  3ZVB A;  4O97 A;  3RC4 A;  4LZ4 B;  3RUO A;  3DSO A;  1GBE A;  4MDS A;  2Y5G A;  4K2Y A;  3TK5 A;  1F5L A;  1P2K A;  4AYY B;  2V35 A;  3IG6 B;  3PLP A;  1ARC A;  4ZKR U;  1NRR H;  4H4F A;  1GI4 A;  2BY8 X;  1SLV B;  3E0N B;  2Z9G A;  3IWM A;  3L33 A;  1YCP M;  2BD2 A;  4X1R U;  1ZTK A;  8LPR A;  3QGJ A;  1HRT H;  1GBK A;  1LPG B;  1FJS A;  1O3I A;  2GKV E;  2W5E A;  2Z9I A;  1SLW B;  3LON A;  1O35 A;  2BY6 X;  4HTC H;  3TJN A;  1S0R A;  2XC5 A;  4MNX A;  1EPT B;  5JBC S;  1S84 A;  3U8T H;  4X8U H;  1K21 H;  1XVO A;  2BDI A;  1TIO A;  1GBT A;  3RXM A;  5C94 A;  2IPQ X;  1UCY E;  2VIP A;  5A2M H;  3V0X A;  2B9L A;  3AAS A;  2RA0 A;  3MO9 A;  1YPM H;  1GBM A;  3Q76 A;  6GCH G;  4U32 A;  1GVK B;  4ZKS U;  2ZGC A;  3EDX B;  1YPE H;  3M5N A;  2WPI S;  1SVP A;  2EA3 A;  1AKS B;  3KF2 A;  1TNI A;  2ZZU H;  2ZU1 A;  1EKB B;  1A5G H;  2SNW A;  1UHB B;  1P02 A;  2GZ7 A;  2ZCH P;  3QLP H;  3UIR A;  1H4W A;  2F4L A;  4RKJ B;  1LHE H;  4JMY A;  4R8T B;  1GBF A;  1V2T T;  2ZU4 A;  3LGI A;  1CU1 A;  2A4Q A;  3RXA A;  1UTQ A;  1UCY K;  3SNA A;  1HDT H;  3E8L A;  3SUD A;  4BTT B;  4JZI A;  4RT1 A;  2ULL A;  4MPW A;  2ZPQ A;  1KLJ H;  3A89 A;  3LH3 A;  3RU4 E;  3RP2 A;  3OX7 U;  1BTP A;  1TOC B;  1FIZ A;  1LQD B;  3BF6 H;  1LVO A;  3Q00 A;  1HJ8 A;  4NWL A;  2SGD E;  3T5F H;  2FX6 A;  4TWY A;  1UTN A;  1T7C A;  3T62 A;  1A2C H;  4NIW A;  4WY3 A;  1NRQ H;  1SGC A;  4NA7 A;  1AD8 H;  4B76 A;  1J15 A;  2FYR A;  3ELA H;  4ISL A;  1KXF A;  1NES E;  1K1J A;  4JZ1 A;  1QUR H;  1XKB C;  2VH0 A;  3KQC A;  2KX4 A;  1H9L B;  2QY0 B;  3CEN A;  2PGQ B;  2CXV A;  3UOU A;  3PV2 A;  4I8K A;  3B23 B;  2PKS C;  1C5M D;  4MQA A;  1DX5 M;  3ZVA A;  3V13 A;  1P03 A;  2RFK C;  3F2F A;  3M7T A;  1DE7 H;  2P16 A;  2BLQ A;  2WPL S;  1E36 B;  2A32 A;  3ATM A;  4FET A;  4GHT A;  2FIR H;  2V3H H;  1Z6J H;  1V2O T;  2FI5 E;  5GJ4 B;  2LPR A;  2HVY B;  1PJP A;  2BDH A;  3OEE D;  1OWK A;  5GCH F;  3JZ2 B;  1O2U A;  1GMC F;  4B2B A;  1B0F A;  1D6W A;  1ETS H;  1XUG A;  1BQY A;  2BLW A;  2ZFP H;  2GCH F;  4Y7A A;  6CHA B;  2QV1 A;  1PYT C;  1SLX B;  1G9I E;  1JRT A;  1BDA A;  1O3M A;  1Q2W A;  1SGI B;  1CSO E;  3FZD A;  2GD4 B;  2ALV A;  5JDU B;  3RXQ A;  5C0U A;  2IJD 1;  1GBI A;  4ISH H;  1T31 A;  2V3O H;  1GBL A;  1NRN H;  2VWN A;  2PUX B;  4CRE A;  1DY8 A;  1TMB H;  1W12 U;  1BT7 A;  2FLR H;  2R0K A;  1ZTL A;  5ETX A;  1WOF A;  1GBC A;  3W1E A;  2PP6 A;  5LGO A;  2XCF A;  5E8E H;  1CE5 A;  1GI2 A;  3S7K B;  1TWX B;  1QBN A;  3GOV B;  2PLX A;  2PKA B;  1QJ6 B;  1EAS A;  1TPO A;  1YPG H;  2PKS B;  3A85 A;  5DP5 A;  7EST E;  2FI3 E;  5K7R A;  4Y8Z A;  1DY9 A;  2V6N A;  5IK2 D;  5C5N A;  4ABF A;  4M9F A;  4KP0 A;  1V2P T;  1SGD E;  2QGR A;  1DLE A;  4XFQ A;  1O3D A;  3O8C A;  5C20 A;  5GND A;  2STB E;  2OP9 A;  1C1Q A;  4Q7Y A;  1F2S E;  1C1T A;  1TX8 A;  1C4V 2;  2SGA A;  2BD9 A;  1GI7 B;  1GCT C;  4QT8 C;  5DSF A;  2BDG A;  6LPR A;  4OS4 A;  4ZRO A;  5KED A;  4NCY A;  4E7N A;  5L6N H;  3PMJ A;  2H9H A;  3HKJ B;  1AUT C;  2CF8 H;  4I86 A;  2OIN A;  4CRC A;  1OP8 A;  1RTK A;  4A7I B;  1ELG A;  2F83 A;  2WV4 A;  1GI3 A;  2EC9 H;  5TCC A;  2B8O H;  1VR1 H;  2XWA A;  1BA8 B;  1BTZ A;  8EST E;  1SL3 A;  1G30 B;  5B6O A;  3F9E A;  3BEF B;  2IJO B;  2SNV A;  2BD8 A;  2FOD A;  2GTB A;  1P11 E;  2RDL A;  1TGB A;  3O8B A;  1BTW A;  4IW4 E;  2KCO A;  2Z9K A;  3MH4 A;  2F9O A;  3BTF E;  1BRA A;  1A4W H;  1UVT H;  1GJD B;  2VIN A;  3OTJ E;  4AC9 A;  2A0Q B;  2ZQ1 A;  2GCT C;  1L1J A;  1K28 D;  4Q63 A;  4ABD A;  3AAU A;  3NKK A;  4Z0K A;  3M3S A;  2RA3 A;  1O2Q A;  1O5D H;  2XTT B;  3A7Z A;  4NIX A;  5DP9 A;  2G5N A;  3MNS A;  1CBW C;  4FU8 A;  3A83 A;  1XUK A;  3ATI A;  3NPS A;  1UW7 A;  4I33 A;  3P70 B;  4JK6 A;  2A4R A;  3GY5 A;  2QXG A;  2HPP H;  1TON A;  2JIZ D;  1D4P B;  1BOQ A;  3E0P B;  4JYV H;  1CHO G;  2V7Q D;  1XUJ A;  1CA0 C;  2B5T B;  4BOH A;  1QQ4 A;  3SNE A;  3SU5 A;  2HNT E;  1C2K A;  1SGE E;  4KTC A;  1ZSL A;  5DP4 A;  1O3P B;  2I6S A;  1HAO H;  2ANW A;  1RRK A;  1VIT G;  5EU8 A;  2OUA A;  5C17 A;  5DO4 H;  2ZKS A;  1WDI A;  3GCT F;  3GDV A;  1MKX K;  3OY5 U;  1C5U A;  4BXS A;  3M36 A;  1UTJ A;  4FUE A;  4JYU H;  4A1T A;  1J14 A;  1NPM A;  4UD9 H;  1ETT H;  2Y6T A;  1YY3 A;  3A82 A;  3BN9 A;  5EOK A;  4BAK B;  1HXE H;  3DHK H;  1IHT H;  1NM6 A;  3SU2 A;  2J97 A;  1Y5A T;  3RMN H;  3MU4 A;  2J94 A;  2ZHW H;  1IQJ A;  1QCP A;  4H6T A;  1BHX F;  1K1N A;  2GCT B;  1SC8 U;  4X2W A;  1KIG H;  2ZEB A;  2BYA X;  4XBD A;  1Z1J A;  5EPN A;  5FX5 A;  1AI8 H;  3E3T A;  3EE7 A;  2FOB A;  4PRO A;  2F43 B;  1J17 T;  2ZTZ A;  2UUY A;  1CBW B;  1MD8 A;  3MTY A;  2OK5 A;  4Y7B A;  3QZR A;  4BTU B;  3MWI U;  1HAP H;  1B5G H;  2J95 A;  3QX5 H;  1PPF E;  1G2M A;  4UFD H;  2R9P A;  1GI6 A;  4J2Y B;  1NS3 A;  1S6H A;  3DA9 B;  1NFY A;  2OCV B;  4AGJ A;  1UJ1 A;  1SFQ B;  1P2I A;  1EB2 A;  5EJZ A;  1CA0 B;  2EST E;  4ZKN U;  3F9F A;  2BTC E;  1AQ7 A;  4X8T H;  1AKS A;  3TJO A;  2BQW B;  1ZRK A;  2G8T A;  4WJG 2;  4MNY A;  1YLD A;  3UR6 A;  1GI9 B;  5E0H A;  1EUF A;  3MO6 A;  1DWE H;  3U69 H;  5G4B A;  2AH4 X;  3MH7 A;  2C4F H;  1GDN A;  4TY6 A;  3PMA B;  1UVS H;  3SJ8 A;  1KDQ A;  1P2Q A;  1V2M T;  4BAM B;  1S81 A;  2GV7 A;  3K6Y A;  3M5M A;  2CK3 D;  3HGN A;  3ZZB A;  2STA E;  1QY6 A;  2UWL A;  1GBJ A;  5GCH G;  1W2K H;  3A80 A;  4AB8 A;  2G5V A;  2LEL A;  5EW1 H;  5T1V A;  4ACB A;  5JPM H;  2QXJ A;  1CT4 E;  3SO3 A;  3UWI A;  2KM0 A;  1FMG A;  3E1X B;  1DPO A;  1VZQ H;  2C3S A;  2VIO A;  3UOP A;  4CBO A;  2A4G A;  3PWC A;  3TGI E;  3LGV A;  2QAA A;  2VWM A;  3GCN A;  1TB6 H;  3LDX H;  3FOA A;  1BBR H;  1GBD A;  4AN7 A;  1OYQ A;  2TBS A;  4X1S U;  3PTB A;  1QGF A;  3RXO A;  3Q3K A;  5F6M A;  1C1N A;  3A8A A;  3URE A;  3LC5 A;  1E1Q D;  5I46 H;  2ZQ2 A;  2ALP A;  2QF5 A;  3MNB A;  1ZPZ A;  2PFE A;  4KGA A;  4Y10 E;  4OS7 A;  3AK5 A;  4X1Q U;  1J9C H;  1SB1 H;  2BXU H;  2WYG A;  1O2J A;  5I25 A;  1THP B;  1ORF A;  1U6Q A;  1T8O A;  2EI8 A;  1WQV H;  3DFJ A;  3LGW A;  1O3F A;  2HNT C;  1C1O A;  2Y7X A;  3KQE A;  2Z3D A;  2M5T A;  3EA9 A;  4X6P A;  3UAI C;  1GL1 A;  1O31 A;  1A0H B;  1EAW A;  3T2N A;  1EZS C;  1GG6 C;  1C5X B;  4BAQ B;  4KKD A;  3P95 A;  3SHA H;  5C1U A;  1F7Z A;  1C5Z B;  5FAH A;  1V2R T;  5DKM A;  2Q6F A;  1AVX A;  3RDZ A;  1V2W T;  3U98 H;  1ZGV A;  3SUE A;  1KXD A;  1ABI H;  1TGC A;  2FS8 A;  2BB4 A;  2PSY A;  1FY4 A;  3SI3 H;  1SHY A;  4FUD A;  1IAU A;  4IC6 A;  5C1X A;  2W6J D;  1C2H A;  3ZYD A;  1SQR A;  3I29 A;  1NBM D;  4ISN A;  1YGC H;  1ELE E;  3U8O H;  3P92 A;  4FU7 A;  3RC6 A;  2FOA A;  1HAX B;  4I8G A;  1MBQ A;  1C5T A;  3PYH A;  1O3C A;  2ZDM A;  4X6M A;  2VU8 E;  2F3C E;  4P00 A;  1WXR A;  2Y5H A;  3TJV A;  1WQS A;  3P6Z B;  2G4U A;  1GDU A;  4NZQ A;  3KL6 A;  1LHG H;  3SOR A;  1UK3 A;  1BJU A;  1C5L H;  1L4Z A;  2ZDV H;  1Y8T A;  1UTM A;  1O5E H;  1YBW A;  1F0T A;  2BLO A;  5CMX H;  3LGU A;  4GSO A;  4LXB H;  1O36 A;  1O2K A;  1TNG A;  3K6Z A;  2RCE A;  1INC A;  3RXE A;  4UFF H;  1O5F H;  1SGF G;  1XXF A;  1C5W B;  1LPK B;  1TBR H;  4O9V A;  1O2X A;  4NWK A;  2ZP0 H;  2VIV A;  1UMA H;  1M9U A;  3SZN A;  1C4Y 2;  2J38 A;  1BRU P;  5EXM A;  2DE8 A;  3EGK H;  3NUM A;  1O37 A;  5JYI A;  1MKW K;  1FDP A;  4XBB A;  3TH4 H;  3TIT A;  2OBO A;  3O8D A;  3LC3 A;  4XDE A;  1JIM A;  4FOU C;  3L3T A;  3H09 A;  2ZO3 H;  4FXG H;  2HOB A;  3P8G A;  1EAU A;  5F53 A;  2XYA A;  1YP9 A;  4AOR A;  1OS8 A;  3TK9 A;  1HUT H;  1GHY H;  3ATW A;  4B1T A;  1YCP H;  3SNB A;  1E34 B;  1FY1 A;  4B2C A;  4DY7 B;  1CO7 E;  5F03 A;  2OC1 A;  3UB0 A;  1C9T A;  4IC5 A;  2FYQ A;  1HJ9 A;  4DW2 U;  1OWJ A;  2Z3E A;  1GJ5 H;  1QB9 A;  1DIC A;  2D2D A;  1HAI H;  1TNL A;  3QO6 A;  3EA7 A;  3Q77 A;  1IHS H;  4ZHM U;  1UVO A;  1EJN A;  4UE7 H;  2QN5 T;  1J16 A;  4X8S H;  3PLK A;  2P3F H;  1WAY B;  4RKO B;  1K1I A;  1VCP A;  2FTL E;  1SGY E;  5FL7 D;  2SFA A;  3KN2 A;  5BPE A;  1W11 U;  1P01 A;  1DST A;  1UK2 A;  4X2Y A;  4XD7 D;  1ESB A;  1O2L A;  3A7Y A;  1C1U H;  4AFS A;  1AHT H;  1P8V C;  3CP7 A;  1W3C A;  2UWO A;  1GHB F;  2EEK A;  1W10 U;  1CVW H;  3U1J B;  2QYI A;  2F91 A;  3ZV9 A;  2BDC A;  3HK3 B;  2A7J A;  4NIV A;  3RXJ A;  5GPI B;  5AVD A;  2FO9 A;  1AN1 E;  1Z8R A;  2ZGH A;  1SGF A;  3OU0 A;  2F9P A;  1RXP A;  3P8O A;  3A7V A;  1HAH H;  1AZ8 A;  1O2G H;  1P0S H;  1AMH A;  4HFP B;  3F1S B;  1KLI H;  1HXF H;  4YXW D;  4RT0 A;  3MU0 A;  3UNS A;  3OEH D;  1QJ7 B;  1WUN H;  1C2J A;  5DN6 D;  1ZR0 A;  8GCH G;  1FY5 A;  2VID A;  2GZ9 A;  5EQR A;  4CRD A;  1H1B A;  1QQU A;  4Y8Y A;  1KMH B;  4MVN A;  5LPF A;  3O8R A;  1XUF A;  1YPJ H;  1C5Y B;  3RMO H;  4AYV B;  4I32 A;  2H2Z A;  1THR H;  2H6M A;  1N1L A;  2C93 B;  1G32 B;  1L2E A;  1DDJ A;  2YOL A;  2BD7 A;  4ACA A;  2AS9 A;  4XE4 A;  1QL9 A;  4FUG A;  1GHZ A;  4B75 A;  4ABH A;  1DVA H;  1E37 B;  2XWB I;  1JMO H;  1A0L A;  1YYY 1;  3E90 B;  3GDS A;  3R0F A;  4WMF A;  3FAN A;  2K1Q A;  1DS2 E;  1TAB E;  2ZHE H;  1BZX E;  3U1I B;  3ZIA D;  7LPR A;  2ZI2 H;  2JKH A;  5C5O A;  3RXK A;  3KID U;  4OM9 A;  2R3Y A;  5FPY A;  1GHA G;  4E06 H;  1RJX B;  5FXL A;  5AF9 H;  1VCW A;  2BD5 A;  2M2A A;  1FAK H;  3OY6 U;  3SI4 H;  1ELA A;  1TMU H;  2EI6 A;  2FS9 A;  1GMD F;  2XC0 A;  3UY9 A;  2VH6 A;  1PPC E;  1FN6 A;  1AB9 C;  4CR5 A;  1BTH H;  3BSQ A;  3STI A;  1TPP A;  3U8R H;  3A86 A;  2BM2 A;  2VWL A;  3ZZ4 A;  3OSY A;  4AZ2 B;  3HPT B;  3PRB A;  4K8Y A;  3KYG A;  2ZG0 H;  1NN6 A;  7GCH F;  1O3G A;  2BXT H;  4F55 A;  1V2K T;  1QRW A;  1XVM A;  3FKS D;  1WBG B;  4I8J A;  9EST A;  4SGA E;  3DCL A;  4CRF A;  2ZCL P;  3UFA A;  3B8J A;  1P2N A;  2F9B H;  1K9O E;  4O3T A;  2KAI B;  4K5Z A;  2TPI Z;  1PFX C;  3Q3Y A;  1O3E A;  2EY4 C;  1O3K A;  1BCU H;  1OWE A;  4ZHL U;  2LNC A;  3WWB A;  1WCZ A;  3E16 B; 
#chains in the Genus database with same CATH homology
 3U28 C;  2EY4 C;  2V3M A;  2EQN A;  3MQK C;  2RFK C;  3UAI C;  2HVY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...