2STAE

Anionic salmon trypsin in complex with squash seed inhibitor (cucurbita maxima trypsin inhibitor i)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
222
structure length
222
Chain Sequence
IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
publication title High-resolution structures of three new trypsin-squash-inhibitor complexes: a detailed comparison with other trypsins and their complexes.
pubmed doi rcsb
total genus 53
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2staE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2staE02
1NFXA 3C27B 1XKAC 3NPSA 3PTBA 4CHAC 1T31A 1C2GA 1KXFA 1BQYA 1BHXF 2FLRH 3VB6A 2B5TB 1DLEA 1QQ4A 4OS7A 1EPTA 1Y5BT 2A32A 1FLEE 2NU0E 3BG8A 3ELAH 1QRWA 2W3IA 1SLUB 3ZZCA 1CGHA 3F9GA 1A5IA 1C5VA 5L2YH 4IC5A 1XM1A 1DVAH 1XXDA 1CGIE 1NZQH 1J15A 1SGQE 2AIQA 1V3XA 2BY9X 2FESH 1E38B 1OWKA 1TX6A 3B23B 1CT4E 4TY7A 1BMNH 2XCFA 1C1NA 3PLPA 2BD4A 1QJ1B 3BEUA 5JBTA 3AW1A 1Y3WA 2OXSA 1TBRH 1C2DA 2ZTYA 5C67A 1BBRK 3EGKH 1UTLM 4K1SA 3RXDA 3S7KB 3GCHC 1FY1A 2F9BH 1MCTA 1O39A 2ZHQH 5LPFA 1H8DH 1ELCA 1D3DB 4MPWA 3ODDA 3HK6B 1VITH 1PFXC 2TGTA 4NIYA 1NESE 3NKKA 5E2OA 2R0KA 1VGCB 4GHTA 1DSTA 1F0TA 2WUCA 1KTTB 2PWXA 1DM4B 3V7TA 4B76A 2Y5GA 5JB9S 3GDUA 2QA9E 5AHGH 5EXLA 1GJCB 3VGCC 2ZECA 1O2ZA 1VCWA 2PUXB 5E0GA 2R2WU 1KXBA 1OKXA 1OYTH 5FX5A 1DXPA 2LPRA 3SNAA 3Q3XA 3S69A 1C5ZB 2P8OC 1TPPA 2SGQE 1SQOA 3P92A 2GDEH 1TRYA 1SGNE 1GVZA 1GMCG 3QGJA 5A2MH 5F8ZA 2OINA 2A2XH 4ZKSU 3ZZ9A 4AGJA 4X2WA 1ZPBA 1YCPK 1MAXA 2F83A 3ATIA 1IQEA 1YLDA 1A2CH 3OYPA 4J1YA 1A0JA 5GPIB 1LKBA 2G81E 3GYMA 2ZU2A 1GHZA 4ABEA 1A0LA 1MH0A 3A8CA 2P94A 1H8IH 1O37A 1V2VT 4TPYA 3RXOA 1LCYA 3PLBA 1AUJA 1BRUP 1FDPA 1C5YB 5AF9H 3GDVA 2A4GA 5HM9A 2D1JA 2XTTB 2PKSB 5LH8A 3MHWU 2QF0A 4UFDH 4VGCB 3F1SB 1GMHF 5FPTA 1W0YH 1O2YA 1WQVH 2TGDA 1MZDA 4ZHMU 1KYNA 2BQ7B 1Y5AT 1GL0E 1Y8TA 4E7RG 1E0FD 2ZTZA 1GG6B 3U9AH 4ISLA 3UWJH 2HRVA 3EA8A 3LGTA 2OBQA 2STBE 1MBQA 1MBMA 3ZV9A 1W12U 2BDGA 1GHAG 1IQJA 2Y7ZA 2P59A 4GPGA 2UUJB 1ANBA 1C5MD 1YPMH 2R9PA 2FOAA 1C4Y2 1FIWA 3BTKE 4Z6AH 1HAOH 1K28D 2AERH 4ISHH 2WPKS 4IS5A 1A7SA 3E1XB 2BVRH 3RXJA 3URDA 1BTYA 1PQAA 3MO6A 1WYKA 2Z9IA 3SO3A 1Z6JH 2BDYA 4X1RU 1V2JT 4Y71A 3LDXH 1LQDB 4ZXXH 1IQFA 1JXPA 1KDQB 2HLCA 4UE7H 2H5CA 4I31A 3VB5A 2WV4A 3SUDA 1ZYOA 1T8LA 1HAGE 1PPBH 1KXEA 4IGDA 1J16A 4INHA 1QJ6B 3SQEE 2ZGJA 2CGAA 3IITA 1Z1IA 1G2MA 2O8WA 1MU8B 3LONA 1D3TB 4TWYA 2ANMH 1NFUA 1IHTH 4ISOA 2Y7XA 3GCHB 3A8AA 2AGIX 1GJ5H 3HKJB 1ESTA 2BD5A 1O3OA 4X6OA 2WV5A 1M9UA 2ANKH 5JDUB 1BMMH 1ETSH 3O8RA 1O2UA 3A81A 2C90B 5G4BA 3GISB 5GIBA 4UFFH 3SHAH 2OP9A 4K5ZA 3VGCB 1GJ8B 1P12E 3UUZA 1O3AA 2ZI2H 2BD9A 2XYAA 2SGAA 3UR6A 1MTSA 4JZFH 2OBOA 2I6QA 1ETTH 1PPHE 4IN1A 1W7XH 2P8OB 4E06H 1KLIH 3M5MA 3TGIE 1O5GH 2V3OH 1GMCF 3H5CB 1GJ6A 3RXVA 4HTCH 4Q7ZA 3MU4A 3L33A 4AFZA 4MNYA 3ZZ4A 4FXGH 4I8HA 3SOSA 2HALA 3RXFA 5AFZH 4JZIA 4WWYA 1XVMA 1S0RA 4JYUH 5DJ7A 4XFQA 1F5KU 1A1RA 7ESTE 1S85A 1ZSJA 3V12A 2ASUB 2G5VA 1VR1H 6LPRA 1O31A 3MO9A 2Z9KA 3M3SA 1SHYA 3CENA 3CS7A 1SMFE 1TNLA 1TNKA 1GI7B 4FUGA 3RXBA 5CE1A 2CHAC 5I46H 4HFPB 1TGCA 1TGBA 2YNBA 3SU5A 3VPKA 2TPIZ 3TH4H 1XUGA 4AFQA 5EG4A 1EASA 3LJOA 1BTUA 1P2MA 1DT2A 1ZPCA 1HAYB 1LHCH 4ZKRU 1GBFA 2EEKA 3O8DA 4X1QU 4XBBA 1YCPM 1HAZB 3LH3A 4XBCA 4F4OC 4INKA 4LXBH 3RMNH 3SU2A 1K1NA 5DP5A 1QB9A 1QFKH 4K1EA 4UFEH 3VB3A 2BDIA 2GVFA 1CA0B 3P8GA 2HVXA 3IG6B 5H4IB 5FAHA 1MD8A 4JK6A 3TJNA 1F0SA 1JOUB 8ESTE 1GHAF 2G4TA 2Y5HA 3Q00A 2GMTB 5HMAA 2GDDA 2FYQA 3V0XA 2ZCLP 1YPJH 1ZGVA 3MU1A 1GHWH 1FZZA 1DX5M 2XNIA 2BB4A 1SB1H 3EYDA 1P04A 4K69A 1SHHB 4OS4A 1T4VH 3EA7A 1ANCA 2LNCA 2J38A 1BMLA 1K22H 1OXGA 3ZVAA 3T2NA 1EOJA 1GBMA 1OWEA 1T8MA 2ZF0H 4UDWH 4ZROA 3A85A 1EAXA 3MNXA 1THSH 3RU4T 1S82A 3R3GB 3EQ0H 4IC6A 3RC6A 9ESTA 2BDBA 1C2HA 1LHGH 3T62A 1VJAU 2F9PA 2A5IA 5LPEA 2BOKA 1F0RA 2PFEA 4D9RA 3A7ZA 3TK6A 1OSSA 1Z8IB 4X1PU 2BLOA 1QL9A 1JRTA 1ID5H 1C9TA 4I7YH 1ACBE 1O5CB 2A7CA 3SNEA 1SPJA 5HXFA 3UOPA 3GICB 5K7RA 5L2ZH 1P05A 3KQCA 3CP7A 3S9AA 1V6DA 2JH5D 2ZPSA 3MH4A 4ZXYH 2OUAA 1QCPA 1QTFA 3E91A 1AU8A 3A86A 3M7UA 2G51A 1O3LA 2H5DA 4IBLH 1EKBB 4QT8C 2FOCA 1QNJA 1UVSH 2P95A 1GBTA 1SLVB 2BD7A 4YTAA 5C3NA 4HZHA 4DY7B 1YBWA 4U30A 1D6WA 1A3EH 2XW9A 3SORA 2P16A 2EI7A 3MU0A 3I29A 4MTBA 1ELTA 2D8WA 4XE4A 3PMBB 1HCGA 4KTCA 3OY5U 3QN7A 1JMOH 2W5EA 3TH3H 1SGEE 1AVGH 2VWLA 4O3UA 1HIAB 1TPOA 1GI5A 1NPMA 1O2QA 1TMTH 1GHXH 2IPHA 1V2RT 4KP0A 4O3TA 3ODFA 2BZAA 4YOJA 4X6PA 1YYY1 2ZQ1A 3E6PH 1Z8RA 5F6MA 4MQAA 1N6YA 1QB6A 4XOJA 4I33A 3ZVFA 2ALPA 1C1SA 4DT7B 4AORA 2DUCA 3SQHE 1VGCC 2AMQA 3M7QA 1C2FA 3GDSA 4UFGH 3UQVA 4DURA 2PR3A 1DY9A 3PTNA 3NWUA 1TRNA 4GSOA 3MO3A 2BYAX 1HB0B 2QYIA 4ZUHA 1C1PA 1G36A 3GYLB 4X8VH 2CF9H 3SGQE 1P9UA 2ZFQH 3LOXA 4AB9A 1SG8B 3PV4A 4NSYA 3DFJA 3SU3A 2PKAB 2Y82A 2EC9H 4GAWA 1AFEH 1KLJH 1LDTT 1GVLA 5HM2A 1ZHPA 1XX9A 1TPAE 2ZHWH 3VFEA 4E05H 1HAVB 1QIXB 1O2IA 3ZVCA 5T3HA 3TGJE 1Y3UA 4CH8B 1YPGH 1TWXB 5DGJA 1DWBH 3M5LA 1O5AB 5AFYH 4U32A 1UTKA 1UHBB 1KY9A 3TPIZ 1HLTH 3SGAE 3MOCA 3ESTA 1J17T 4OGYA 3SNDA 4H4FA 2STAE 4AG2A 1JBUH 1INCA 1H9HE 4JK5A 2B7DH 2SGFE 4CR9A 2BD3A 2OQ5A 4CREA 3I78A 3SNBA 1D6RA 1AD8H 3EA9A 2ZU5A 2A2QH 8KME2 1F7ZA 3SUFA 3WY8A 1O3NA 2PKSC 1BBRH 3PM3A 3EAJA 3SJIA 3HK3B 4VGCC 4WY3A 3ZZAA 1O2TA 1TPSA 2VB0A 2JH0D 3O8BA 3QTVH 1G37A 3H7TA 3S9CA 5C2ZA 3D65E 5LPRA 1GJDB 4Q2KA 2GV6A 1YPHC 2F9UA 1Z71A 2ZKSA 4BANB 2FI3E 2Z3CA 1NFWA 1VZQH 4X1NU 1OWIA 3SV6A 1V2QT 1GG6C 1ZTLA 2SNVA 1O3EA 1FJSA 1CGJE 2ZNKH 4X1SU 2UWLA 3UOUA 4AN7A 4ZHLU 5C1XA 2ZO3H 3ITIA 2NU1E 3QZQA 5CHAB 2BY7X 1A5GH 1TMBH 3TK9A 3SI4H 1EXFA 1F2SE 1YPKH 2FTLE 1C1TA 2Y80A 2G52A 1KXAA 1ANDA 3LU9B 4RKOB 5DP8A 5FXLA 1EJAA 3KHVA 4KTUA 5C1UA 5ESBA 1O3PB 3OX7U 2ZU4A 3TU7H 2VU8E 2FDAA 3SV9A 1YCPH 1LPKB 1TOMH 4OGXA 3VB7A 4YLQH 1GBKA 4NFEA 1WBGB 2BZ6H 1HAHH 4DG4A 3LT3A 4FUEA 3ZZDA 5BPEA 4DIIH 3F68H 3U8TH 1QHRB 4E7NA 3E16B 3EDXB 1HRTH 4LK4A 4J2YB 1WOFA 3RMOH 5EQRA 2AYWA 1AHTH 1RGQA 3A84A 1PQ5A 3A87A 5EQSA 4WXVA 1OWJA 2OC7A 3SBKA 4DW2U 3BEFB 2Y6TA 3HGNA 4O03A 2VVCA 2ZGCA 1UVUH 1O2HA 1RIWB 1UTNA 2A5KA 1GI3A 2UUYA 3T5FH 1CO7E 3FZZA 1O2XA 1EAIA 1FONA 3MI4A 1G3BA 1SFIA 3ZVBA 2FIRH 1BTXA 1C1OA 1AWHB 3FP7E 2NU3E 2XWBI 1ZJDA 1MTVA 4BAMB 1TBQH 2GV7A 3SJKA 4AFSA 3QZRA 1WQSA 1ZZZA 2QGRA 1UO6A 4Q7YA 1U6QA 1S0QA 3LGUA 4MNVA 2BY8X 2R3UA 5EU8A 5C1YA 1SGTA 3Q76A 1UMAH 3QK1A 3RXPA 2H9HA 1PQ8A 1FAXA 1FQ3A 3A8DA 1HXFH 1W0ZU 2AH4X 4H6TA 3B8JA 1E36B 1C2IA 1TQ7B 4A5TS 2THFB 2F9OA 2J94A 2Z9JA 3SV2H 1BRAA 1K1JA 1XVOA 5FBIA 2R0LA 2GZ7A 2QIQA 1SR5C 3SNCA 3TLOA 2IJOB 2XBYA 1MTUA 3Q77A 2BHGA 3BTME 4ABGA 1A61H 2F91A 1YKTA 2PTNA 2O8LA 2F9VA 1GCTB 4NWKA 2FS9A 4FVDA 2UUFB 5EPNA 3DD2H 1EJNA 1DWCH 1ZLRA 1PPGE 1Y59T 4X6MA 1FNIA 1HJ8A 1UVTH 3TJOA 4YLUA 4AX9H 5HYOA 4AG1A 4YT6H 1SL3A 2ZDNA 2HNTE 3M35A 5DG6A 3SUGA 1DS2E 3ZVDA 1SGYE 3RXCA 2VINA 4B74A 3QDZB 1CA8B 4MPUA 3RMLH 2J4IA 1ZSLA 2IN2A 2RDLA 1TNJA 1IQNA 1W3CA 2VIQA 3DHKH 1MTWA 3BTQE 3E0PB 3A80A 1C5UA 3MWIU 1RJXB 2H2ZA 2PGQB 2PLXA 2C3SA 2C8WB 3MFJA 2QC2A 2FOMB 1CA0C 1G32B 2XBVA 1G9IE 3D62A 4Y8XA 1TA6A 1W2KH 1AKSB 1TBZH 1GI6A 3A7VA 2VWMA 2ZDVH 4BNRA 3S7HB 4CBOA 5EXMA 2GMTC 5HGGA 2ZFSA 2AS9A 3FP6E 1RFNA 1P3EA 4FUBA 2FWWA 4B2CA 1CBWB 4DOQA 4FUHA 3LGYA 5E8EH 3LJJA 5A0CA 3UPEA 1ABJH 1QL7A 3S0NA 1C1UH 1K1MA 2W7UA 3M5NA 5GJ4B 2ZHFH 3RLYH 4JYVH 1GBHA 2F9NA 1O0DH 3FAOA 2BDCA 1OPHB 5E2PA 5EODA 3RXQA 2FOBA 2XC5A 3PO1B 1BITA 4X2XA 3ZZ3A 2AIPA 1XKBC 1C1MA 2C8YB 2J2UA 1O5EH 3RM0H 1C1RA 3DFLA 2EI6A 2GT8A 3SW2B 3MNCA 1AQ7A 2BLWA 3RDZA 3NZIA 8LPRA 1PPEE 1GI4A 3TH2H 1NY22 1GDNA 3RM2H 1O38A 1MZAA 1P06A 1O2OA 1ZR0A 4GUXA 1EX3A 2PUQH 3PB1E 3QGNB 3KF2A 1B7XB 4A92A 1O3DA 4OS2A 1HV7A 1HXEH 3UQOA 3MU5A 3ZV8A 1GCDA 1K9OE 1A5HA 1AVXA 1P01A 3LGVA 1OP0A 2XXLA 1TFXA 5SGAE 1BTPA 4BTTB 2ILNA 5ESTE 4BAHB 1PYTD 1UK3A 2J92A 1TGNA 3BG4C 2FI5E 2VNTA 3AAVA 4M7GA 1TONA 1LVOA 3SU1A 1KSNA 4O9VA 3ATWA 1E34B 1TAWA 3N7OA 1F92A 2Q1JA 2ZG0H 1GI8B 2BDHA 3T25A 2Z94A 2ZDMA 5C5NA 2BXTH 4R0IA 1V2NT 2YNAA 1G2LA 1P0SH 3RC4A 1P11E 3TVJB 1AVWA 2BQ6B 2WYJA 5B6OA 3A89A 3ZYEA 4B2BA 4GCHG 2FOEA 3TITA 1JRSA 2GKVE 1GBLA 2ZP0H 2TGPZ 3BN9A 1NROH 3R0FA 5L6NH 2A0QB 1ELBA 1C2JA 2O9QA 1THRH 2Z9GA 4WJG2 2VVVA 1NT1A 1BZXE 1BOQA 1WSSH 5F8XA 1MKXK 1L4ZA 5DK1A 4KKDA 2QCYA 2ZQ2A 1LVBA 3P8NA 1IOEA 1WAYB 1CVWH 2GGVB 1GBEA 3UNQA 1DPOA 3OSYA 2WINI 3U69H 4BTUB 2ZIQH 3ZZ8A 1DWDH 1O3CA 1MKWK 3A7TA 4B2AA 2VGCB 4D8NA 4THNH 1SGFA 1DXWA 4YOGA 3HPTB 1O34A 1QL8A 1YGCH 1O5BB 2A4QA 3LH1A 4OS5A 1O3GA 1TMUH 2FI4E 3E8LA 4IW4E 1O3FA 1DLKB 1VCQA 1UCYE 1MUEB 3SI3H 1QRXA 3M61U 4MVNA 2QY0B 4NCYA 4FUCA 3ZYDA 1O3JA 1QGFA 2H9TH 1V2TT 4H42U 1FXYA 3OU0A 2WPLS 3SHCH 1KLTA 1KTSB 1W10U 2OTVA 3RXAA 3JZ2B 1C1WH 1NTPA 1L1GA 2VIVA 1GDUA 2ULLA 5IYTA 2GTBA 4K2YA 2BQWB 3SU4A 2BTCE 2B8OH 1OP8A 1YF4A 3M3TA 1GMDF 8GCHG 1K1OA 1L0ZA 2BD8A 3FFGA 4LOYH 4WMEA 2F3CE 1TLDA 1LMWB 4JMYA 5DKMA 4YOIA 3QX5H 1SGRE 1T32A 2FOFA 1TIOA 4BOHA 1O2PA 2AEIH 4I32A 1C5LH 5CMXH 2ZHEH 5EW2H 1C5WB 1EB1H 2VH6A 1Z7KA 2BVXH 2ODYB 3QUMP 2V35A 1PQ7A 4UD9H 4YM9A 3KL6A 4Y6DA 5A8XA 2SNWA 3RXMA 1D9IA 1O5DH 4Y11E 4ESTE 3BTWE 4NA9H 4YT7H 4YO9A 4BTIB 2GZ8A 2OD3B 1F5RA 4ZHAA 2FX6A 3F9EA 1H9IE 5AVDA 5FX6A 1NU9A 3W95A 1L1JA 2ZGHA 4K8BA 5EQQA 4MNWA 5CHAC 1EPTC 1C5SA 4CRFA 4ZMAH 3M5OA 3LC3A 2VH0A 2GZ9A 4O97A 1FY4A 4ZKOU 2FODA 3MNBA 3K6ZA 1QA7A 4GHQA 1GBIA 1FI8A 1EOLA 4FUJA 2AGEX 5FPYA 3RXKA 1SC8U 3SU6A 1V2UT 1PPZA 3GY5A 3PWBA 3ATMA 3UIRA 4GVUA 4CBNA 5BRRE 1AI8H 1SGIB 1XXFA 1P03A 1DWEH 1QQUA 2ZDKA 6GCHG 2RG3A 1J9CH 4CRBA 1NU7B 3RC5A 1O3MA 2FTMA 1GL1A 1ELVA 4AB8A 4BAKB 2WPMS 1JIRA 4AGKA 2ZU1A 3BG4B 2RA3A 2FO9A 3V13A 5E0JA 4K8YA 4A1VA 1LTOA 3M7TA 2Z3EA 2I6SA 3MH5A 5TCAA 5FCKA 4FU7A 1VCPA 1SI5H 3U98H 1O5FH 7KMEH 1SGPE 1K1LA 1O36A 1RIWC 1AWFH 1MTNB 1XUJA 1LVMA 4GCHF 2ZFRH 2OC8A 4NIVA 3PYHA 2ESTE 6CHAB 4TYDA 1Q31A 2OCVB 4B75A 1ZMJA 1NFYA 3RXIA 2BX3A 1B0EA 1T8OA 4X8TH 1EJMA 1V2WT 1GWAA 1UTQA 1BTZA 4IN2A 1TA2A 3LC5A 1V2ST 1NRSH 3PWCA 4X8SH 4ISIH 1HYLA 2BVSH 5EGMA 2QXGA 3TJUA 3VXFH 1AZZA 2C4FH 1HIAA 3AW0A 1ZJKA 1WTHD 1OWHA 2WYGA 2JETB 1K1PA 3RXHA 1UTOA 2A1DB 4RN6A 5DO4H 1T4UH 1AFQC 3BIUH 1CHGA 5T6GA 2XCNA 2V3HH 1NRNH 1IQGA 1ORFA 2PSXA 1O2MA 2FZZA 3A7XA 3T27A 1UCYK 4AOQA 1GCTC 1GVKB 2A4RA 1AO5A 1FMGA 7GCHG 1RS0A 1T7CA 3GCTG 2KAIB 5GDSH 3MU8A 1GJBB 1ZGIA 4ZAEA 6ESTA 3NXPA 1ELFA 1HNEE 3SJOA 5A8YA 1EUFA 3E3TA 1SGDE 1P2JA 3RXEA 4WVPE 5J4QA 1FY5A 2PSYA 3ZVEA 1O2NA 2PKAA 2ZFPH 1QBNA 1QBVH 2TGAA 1P09A 5FBEA 1HJ9A 8GCHF 1EZUC 2PHBA 1DICA 3PROA 2FYRA 4UEHH 3RU4E 2J9NA 2ZFTA 2ZCKP 4JZDH 2NU2E 1O33A 4JZEH 2CMYA 2CJIA 1D4PB 1BA8B 2ZZUH 5DP7A 1EATA 1UVPA 1QURH 3KCGH 1BIOA 5JBCS 2B0FA 1Q2WA 4NSVA 3LGWA 1MMJN 1BJVA 3BIVH 1OYQA 1RXPA 1YP9A 1L4DA 1C5NH 3A82A 1C4V2 1S83A 1TGTA 3BEIB 1BMAA 4WH6A 2OLGA 2TBSA 1D3QB 4IMZA 2HNTC 1WUNH 1CQQA 2VIWA 3BTTE 3C1KA 1AB9B 4FVBA 1C1VH 4HGCA 3KQDA 4Q7XA 4INLA 3ZZBA 1EPTB 5JPMH 1ZMNA 2A31A 4LZ4B 5LGOA 3UTUH 1CBWC 4XBDA 2QXHA 1YM0A 1P3CA 2C93B 4D76A 1MU6B 1IQIA 1SOZA 5ABWA 2R3YA 3MNSA 4Y0ZE 3A7YA 1TE0A 1ANEA 1SQAA 3IWMA 5F03A 4Y8YA 5T6DA 2OQUA 1FPCH 1ZRBA 1V2PT 3ZZ6A 3QO6A 1O2LA 2J95A 1S81A 1UVOA 1TQ0B 1K21H 2HNTF 3PO1C 2PTCE 6GCHF 4ABHA 4AYVB 2NU4E 4JYTA 1LPZB 1HJAB 3E90B 3GOVB 1ZPZA 4I8KA 3ZVGA 1PYTC 5K0HA 3NK8A 2CN0H 3D23A 4NG9H 3M3VA 3K6YA 2O8TA 5PTPA 3RU4D 1C2LA 4Y8ZA 2BOHB 3MH6A 4R8TB 1ZTKA 1UJ1A 3SUEA 1B5GH 1TOCB 3BSQA 1BUIA 2Q6FA 1O2VA 1UK2A 3DT0H 1W7GH 2SGEE 4X6NA 1BT7A 2ZCHP 3PMAB 3SV7A 3TJVA 1ZRKA 1T8NA 3ENSB 3NCLA 1W8BH 1IQMA 1SBWA 1L1NA 2OC1A 3UNRA 1N1LA 2H1UA 5L30H 4DCDA 3D49H 1ZHMA 4X0WU 4ABFA 2YOLA 1KXDA 3LKWA 2GT7A 2D2DA 7LPRA 1EAUA 1AMHA 1BDAA 1P10A 3TIUA 3P17H 4Y79A 1OWDA 3VB4A 3OTJE 1AY6H 3SU0A 5I25A 2W3KA 4X2VA 3FP8E 1RTKA 4BAQB 1CHOG 2BLVA 1OOKB 4TPIZ 1XMNB 1AFQB 2P3TB 1G3EA 1EZQA 4D7GA 1BJUA 2ANYA 1YC0A 2VIPA 3STJA 2ZA5A 7GCHF 1AN1E 2A7HA 2G8TA 2BXUH 2R2MB 1C5QA 3AASA 3GCTF 3HATH 4WMFA 1S6FA 4JCNA 3PLKA 3TNTA 1N8OB 3L6PA 1Z1JA 4ABJA 1E35B 1GDQA 3BF6H 4I8LA 2FPZA 1A0HB 1NN6A 2GCTB 1DE7H 1TX7A 2G55A 1G30B 1LKAA 2EA3A 1WTGH 2ZU3A 1UK4A 1VJ9U 1GJ4H 1LPGB 1ELGA 1XUIA 5FCRA 5C20A 1GBDA 2AMDA 1O3BA 1Z8GA 1GBBA 2VGCC 4WH8A 1YPHE 3W94A 2FP7B 3GCNA 2GP9B 1DITH 1O2JA 2FEQH 2DE8A 1GHBG 3QWCH 4ABAA 3MTYA 4F49A 1P02A 2SFAA 5DP9A 2FOGA 1L2EA 4RKJB 4LZ1H 1J14A 1XUFA 2EI8A 1O2GH 3H7OA 1OX1A 1A4WH 2OC0A 5DP6A 1BHXB 3M36A 1IQLA 3GCOA 1NS3A 2ZWLH 1MQ5A 2AGGX 4NWLA 1FAKH 1G3CA 1E37B 1YLCA 3RMMH 1SFQB 1NO9H 3K65B 1GMDG 2XRCA 4CRGA 1AZ8A 1O2RA 4CR5A 2ZPRA 1AGJA 3HKIB 3SJ8A 2VJ1A 2UWOA 1WV7H 1GI2A 3F9FA 3UR9A 5JBBS 3KN2A 2ZGBH 2GX4A 1H4WA 5DP3A 2Y5FA 4ZH8A 3O8CA 4CHAB 1O32A 1O3KA 3RUOA 4ABDA 1AKSA 1P2QA 3UNSA 1C5OH 3QTOH 4I8JA 4D9QA 2RA0A 3GY8A 1MKXH 3LPRA 2ANWA 3M37A 3RP2A 1YPLH 1DANH 4Y7AA 3P8OA 1MD7A 2P3UB 3SN8A 5IDKA 3K9XB 3RXTA 1XUKA 5J4SA 3JZ1B 1C5RA 1Y5UT 3ZZ5A 4KGAA 1TYNA 1ARCA 1LHFH 3ZZ7A 4A6LA 1MKWH 2V0BA 2UUKB 3KIDU 4ZKNU 2C8XB 1GGDC 1S84A 4NIXA 1ABIH 1HGTH 1DDJA 1SSXA 2QAAA 3AAUA 1KDQA 4XDEA 4FUFA 1ARBA 3P6ZB 1SGCA 4MDSA 1O2WA 4MG3A 4WXIA 2WPIS 4CRDA 3B9FH 4NFFA 3KQEA 3KQBA 1SLXB 5EPYA 5TCCA 2A5AA 3BV9B 1AUTC 1DY8A 3KEEA 3RXLA 3U8OH 5A09A 1BTHH 4RSPA 4BXSA 3K2UA 1CU1A 4DVAU 1ELEE 1Y3VA 1NRRH 3U1IB 5GWZA 2C8ZB 3KNXA 2HPPH 3GY6A 4JZ1A 2H9EH 1CHOF 2VWNA 1V2KT 4NZLA 2H6MA 1W14U 1ETRH 1C2MA 4WMDA 1EZXC 1LQEA 1THPB 1MTNC 3TNSA 6CHAC 1O30A 1CT2E 5EW1H 1TNGA 5JYIA 1FUJA 1MAYA 2P3FH 1GBCA 1VITG 2JKHA 5DPAA 1AE5A 3TK5A 4X8UH 1NRPH 2SGPE 2A4OA 1EP5A 2G00A 3V3MA 3L3TA 4CRCA 1EB2A 3BTHE 2QN5T 3BTEE 3P70B 4IMQA 3FANA 2AMPA 4OS1A 3STIA 2BDAA 2XWAA 2JETC 4MLFB 5T6FA 1SVPA 1GBJA 4U2WA 1HFDA 2BD2A 1DUEA 2FMJA 3UWIA 4U01A 2ZC9H 2HOBA 4B1TA 1FY8E 2CF8H 2ZGXH 4KTSA 2ZEBA 5A0BA 3P8FA 1GHBF 5GCHG 2O8UA 1TX8A 2ODQA 1TNHA 4NA8A 1QY6A 3UREA 2HGTH 1UTJA 3FVFB 3MYWA 3LGIA 1AIXH 2ODPA 2WPHS 1F5LA 1EZSC 1Y3YA 3DA9B 4X2YA 3OY6U 2CXVA 1WU1A 1LO6A 1A46H 3A7WA 2Z3DA 4SGBE 1C2EA 2BX4A 1UTPA 4Y76A 1QR3E 3AVZA 3PMHB 2V6NA 1PPFE 2CV3A 2O8MA 5C5OA 4MPVA 1Q3XA 1C4U2 1GPZA 1TGSZ 2HPQH 1BCUH 1OS8A 1KIGH 5F8TA 2BY6X 1IHSH 2G4UA 2DE9A 4H6SB 2TRMA 2UWPA 1P57B 2G5NA 2W7SA 3FZDA 4NGAH 1W13U 3U8RH 1X7AC 5ETXA 1BRCE 4TWWA 2WUBA 1QJ7B 2Z7FE 4Q80A 4WF8A 1V2MT 3SGBE 4UONA 4AYYB 2GCHG 1ELAA 4GLYA 1IQKA 4XSKU 1AB9C 4A1TA 1HBTH 1H1BA 2VWOA 4TY6A 4DGJA 1GJ7B 2HWLB 2ALVA 4DJZB 5FHTA 3QLPH 1TNIA 1TRMA 3HGPA 2J34A 2XC0A 1CT0E 4PROA 4Y10E 4BAOB 2D26C 1GGDB 1FV9A 1ELDE 3GY3A 1GHYH 2FLBH 1CE5A 3A83A 3T26A 1UCYH 3KGPA 5JB8S 1HDTH 5TJXA 3SV8A 2AFQB 4Y7BA 3DUXH 4YZUA 2Y81A 1C5PA 4K3JA 1HJAC 1MQ6A 3BTFE 1A3BH 3T28A 4MPXA 1S5SA 3Q3YA 2XC4A 4NA7A 1BTWA 1ESAA 4YESB 2FS8A 1OP2A 1C1QA 1K2I1 5FPSA 2QF3A 3RXUA 3SZNA 2XBXA 2ZPQA 1H9LB 4FU8A 1QRZA 3T29A 1HAIH 2FM2A 3A8BA 4SGAE 2QXJA 3RLWH 1K1IA 1ZTJA 5EOKA 1F0UA 1HAPH 4ISNA 1BRBE 3CS0A 4KELA 1GI0A 1XUHA 1LHDH 1O2KA 1MCVA 3BTGE 1TALA 3U1JB 4Z0KA 5JBAS 1RTFB 1VITF 1GHVH 1ZHRA 1BBRE 2W26A 2FXRA 1GI9B 3E0NB 2Q6GA 4OS6A 2BM2A 1IAUA 1IQHA 4K60A 4DIHH 1EP6A 2ZDLA 4HI3A 1BB0B 1NM6A 1PPCE 2BLQA 2FOHA 1NC6A 1SOTA 1C5TA 1WCZA 1FN6A 1FY3A 3S9BA 1O35A 2TIOA 4ABIA 1C5XB 3RXSA 3RXRA 1JIMA 4A1XA 1J8AA 1AE8H 2SGDE 3ATLA 1KXCA 3GY2A 2VVUA 3VXEH 2QV1A 1QB1A 5A0AE 9LPRA 1ZOMA 2Z9LA 5GCHF 5DP4A 2BMGB 1LVYA 2CHAB 2JH6D 1TABE 3Q3KA 4CRAA 2PV9B 2A45B 3ATKA 1W11U 5A8ZA 4ABBA 1N8OC 3G01A 1V2LT 3SJ9A 4FU9A 1HAXB 1P2KA 1ESBA 1O3HA 1DSUA 1P8VC 3EE0B 3F6UH 1GBAA 2BY5X 2IOTA 2WPJS 1GJAB 4MNXA 1FPHH 1O3IA 4Y0YE 3UFAA 2FX4A 2ZFFH 1C2KA 2GCTC 1RD3B 1B0FA 4FUIA 1Z8JB 2RCEA 4ASHA 2VIDA 3UY9A 1QA0A 4K1TA 2ZHDA 1Z6EA 1SQTA 1HAVA 4D7FA 1G3DA 3VEQB 3BTDE 2P93A 1Y3XA 2VIOA 2QXIA 1DOJA 1NRQH 2Q6DA 5E0HA 2Z6BD 4BXWA 3I77A 1UHBA 1EQ9A 2PW8H 3GY7A 2PGBB 3A88A 4B71A 1RRKA 2KAIA 1D3PB 1P2NA 2ZDAH 1C9PA 2ZTXA 1GI1A 2GCHF 4NZQA 2M5TA 1SLWB 1O2SA 1DFPA 4I8GA 1N6XA 5EXNA 1SGFG 1QBOA 1P9SA 3F9HA 2NWNA 4AZ2B 1GMHG 1S6HA 5GXPA 1FN8A 1ZSKA 1DUAA 3MMGA 1CSOE 1RTLA 2B9LA 1LHEH 1HPGA 2K1QA 1GJ9B 3RXGA 4CH2B 4A7IB 3PMJA 4AFUA 1EAWA 1P2IA 1UTMA 3MH7A 1ZMLA 1HUTH 3LIWA 1JWTA 3NUMA 2GD4B 1TB6H 2XBWA 3URCA 2A7JA 4B73A 1P2OA 3GY4A 4NIWA 3TGKE 1FIZA 1YPEH 1V2OT 3P95A 4FUDA 1PJPA
chains in the Genus database with same CATH superfamily
1NFXA 3C27B 1XKAC 3NPSA 3PTBA 4CHAC 1T31A 1C2GA 1KXFA 3KQ5A 1BQYA 1BHXF 2FLRH 3VB6A 2B5TB 1DLEA 1QQ4A 4OS7A 1EPTA 1Y5BT 2A32A 1FLEE 2NU0E 3BG8A 3ELAH 1QRWA 2W3IA 1SLUB 3ZZCA 1CGHA 3F9GA 1A5IA 1C5VA 5L2YH 4IC5A 1XM1A 1DVAH 1XXDA 1CGIE 1NZQH 1J15A 1SGQE 2AIQA 1V3XA 2BY9X 2FESH 1E38B 1OWKA 1TX6A 3B23B 1CT4E 4TY7A 1BMNH 2XCFA 1C1NA 3WWFA 3PLPA 2BD4A 1QJ1B 3BEUA 5JBTA 3AW1A 1Y3WA 2OXSA 1QZ8A 1TBRH 1C2DA 2ZTYA 5C67A 1BBRK 3EGKH 1UTLM 4K1SA 3RXDA 3S7KB 3GCHC 1FY1A 2K8IA 2F9BH 1MCTA 1O39A 2ZHQH 5LPFA 1H8DH 1ELCA 1D3DB 4MPWA 3ODDA 3HK6B 1VITH 1PFXC 2TGTA 4NIYA 1NESE 3NKKA 5E2OA 2R0KA 1VGCB 4GHTA 1DSTA 1F0TA 2WUCA 1KTTB 2PWXA 1DM4B 3V7TA 4B76A 2Y5GA 5JB9S 3GDUA 2QA9E 5AHGH 5EXLA 1GJCB 3VGCC 2ZECA 3DCLA 1O2ZA 1VCWA 2PUXB 5E0GA 2R2WU 1KXBA 1OKXA 1OYTH 3DSGA 5FX5A 1DXPA 2LPRA 3SNAA 3Q3XA 3S69A 1C5ZB 2P8OC 1TPPA 2SGQE 1SQOA 3P92A 2GDEH 1TRYA 1SGNE 1GVZA 1GMCG 3QGJA 5A2MH 5F8ZA 2OINA 2A2XH 4ZKSU 3ZZ9A 4AGJA 4X2WA 1K0HA 1ZPBA 1YCPK 1MAXA 2F83A 3ATIA 4I86A 1IQEA 1YLDA 1A2CH 3OYPA 4J1YA 1A0JA 5GPIB 1LKBA 2G81E 3GYMA 2ZU2A 1GHZA 4ABEA 1A0LA 1MH0A 3A8CA 3F2GA 2P94A 1H8IH 1O37A 1V2VT 4TPYA 3RXOA 1LCYA 3PLBA 1AUJA 1BRUP 1FDPA 1C5YB 5AF9H 3GDVA 2A4GA 5HM9A 2D1JA 2XTTB 2PKSB 5LH8A 3MHWU 2QF0A 4UFDH 4VGCB 3F1SB 1GMHF 5FPTA 1W0YH 1O2YA 1WQVH 2TGDA 1MZDA 4ZHMU 1KYNA 2BQ7B 1Y5AT 1GL0E 1Y8TA 4E7RG 1E0FD 3PV5A 2ZTZA 1GG6B 3U9AH 4ISLA 3UWJH 2HRVA 3EA8A 3LGTA 2OBQA 2STBE 1MBQA 5HIYA 1MBMA 3ZV9A 1W12U 4M9FA 2BDGA 1GHAG 1IQJA 2Y7ZA 2P59A 4GPGA 2UUJB 1ANBA 1C5MD 1YPMH 2R9PA 2FOAA 1C4Y2 1FIWA 3BTKE 4Z6AH 1HAOH 1K28D 2AERH 4ISHH 2WPKS 4IS5A 1A7SA 3E1XB 2BVRH 3RXJA 3URDA 1BTYA 1PQAA 5C94A 3MO6A 1WYKA 2Z9IA 3SO3A 1Z6JH 2BDYA 4X1RU 1V2JT 4Y71A 3LDXH 1LQDB 4ZXXH 1IQFA 4P00A 1JXPA 1KDQB 2HLCA 4UE7H 2H5CA 2L6OA 4I31A 3VB5A 2WV4A 3SUDA 4YXWD 4XRNA 1ZYOA 1T8LA 1HAGE 1PPBH 1KXEA 4IGDA 1J16A 4INHA 1NBME 1QJ6B 3SQEE 2ZGJA 2CGAA 3IITA 1Z1IA 1G2MA 2O8WA 1MU8B 3LONA 1D3TB 4TWYA 2ANMH 1NFUA 1IHTH 4ISOA 2Y7XA 3GCHB 3A8AA 2AGIX 1GJ5H 3HKJB 1ESTA 2BD5A 1O3OA 4X6OA 2WV5A 1M9UA 2ANKH 5JDUB 1BMMH 1ETSH 3O8RA 1O2UA 3A81A 3PRBA 2C90B 5G4BA 3GISB 5GIBA 4UFFH 3SHAH 2OP9A 4K5ZA 3VGCB 1GJ8B 1P12E 3UUZA 1O3AA 5HIZA 2ZI2H 2BD9A 2XYAA 2SGAA 3UR6A 1MTSA 4JZFH 2OBOA 2I6QA 1ETTH 1PPHE 4IN1A 1W7XH 2P8OB 4E06H 1KLIH 3M5MA 3TGIE 1O5GH 2V3OH 1GMCF 3H5CB 1GJ6A 3RXVA 4HTCH 4Q7ZA 3MU4A 3L33A 4AFZA 4MNYA 3ZZ4A 4FXGH 4I8HA 2OK5A 3SOSA 2HALA 3RXFA 5AFZH 4JZIA 4WWYA 1XVMA 1S0RA 2WHXA 4JYUH 5DJ7A 4XFQA 1F5KU 1A1RA 7ESTE 1S85A 1ZSJA 3V12A 2ASUB 2G5VA 1VR1H 6LPRA 1O31A 3MO9A 1NBMD 2Z9KA 3M3SA 1SHYA 3CENA 3CS7A 1SMFE 1TNLA 1TNKA 1GI7B 4FUGA 1W0JD 3RXBA 2CHAC 5CE1A 4HFPB 5I46H 1TGCA 1TGBA 2YNBA 3SU5A 3VPKA 2TPIZ 3TH4H 1XUGA 4AFQA 5EG4A 1EASA 5C17A 3LJOA 1BTUA 1P2MA 1DT2A 1ZPCA 1HAYB 2KCAA 1LHCH 4ZKRU 1GBFA 2EEKA 3O8DA 2LP6A 4X1QU 4XBBA 1YCPM 1HAZB 3LH3A 4XBCA 4F4OC 4INKA 4LXBH 3RMNH 3SU2A 1K1NA 5DP5A 1QB9A 1QFKH 4K1EA 4UFEH 3VB3A 2BDIA 5C0TA 2GVFA 1CA0B 3P8GA 2HVXA 3IG6B 5H4IB 5FAHA 1MD8A 4JK6A 3TJNA 1F0SA 1JOUB 8ESTE 1GHAF 2G4TA 2Y5HA 3Q00A 2GMTB 5HMAA 2GDDA 2FYQA 3V0XA 2ZCLP 1YPJH 1ZGVA 3MU1A 1GHWH 1FZZA 1DX5M 2XNIA 2BB4A 1SB1H 3EYDA 5IK2D 1P04A 4K69A 1SHHB 4OS4A 1T4VH 3EA7A 1ANCA 1OXGA 2J38A 1BMLA 1K22H 2LNCA 3ZVAA 2KR7A 3T2NA 1EOJA 1GBMA 1OWEA 1T8MA 2ZF0H 4UDWH 4ZROA 3A85A 1EAXA 3MNXA 1THSH 3RU4T 1S82A 3R3GB 1WXRA 3EQ0H 4IC6A 3RC6A 9ESTA 2BDBA 1C2HA 1LHGH 3T62A 1VJAU 2F9PA 2A5IA 1S6LA 5LPEA 2BOKA 1F0RA 2AHME 2PFEA 4D9RA 3A7ZA 3TK6A 1OSSA 1Z8IB 4X1PU 2BLOA 1QL9A 1JRTA 1ID5H 1C9TA 4I7YH 1ACBE 1O5CB 2A7CA 3SNEA 1SPJA 5HXFA 3UOPA 3GICB 5K7RA 5L2ZH 1P05A 3KQCA 3CP7A 3S9AA 1V6DA 2JH5D 2ZPSA 3MH4A 4ZXYH 2OUAA 1QCPA 1QTFA 3E91A 1AU8A 3A86A 3M7UA 2G51A 3F2FA 1O3LA 2H5DA 4IBLH 1EKBB 4QT8C 2FOCA 1QNJA 1UVSH 2P95A 1GBTA 1SLVB 2BD7A 4YTAA 5C3NA 4HZHA 4DY7B 1YBWA 4U30A 1D6WA 1A3EH 2XW9A 3SORA 2P16A 2EI7A 3MU0A 3I29A 4MTBA 1ELTA 2D8WA 4XE4A 3PMBB 1HCGA 4KTCA 3OY5U 3QN7A 1JMOH 2W5EA 3TH3H 1E1RD 1SGEE 1AVGH 2VWLA 4O3UA 1HIAB 1TPOA 1GI5A 1NPMA 1O2QA 1TMTH 1GHXH 2IPHA 1V2RT 3MQKC 4KP0A 4O3TA 3ODFA 2BZAA 4YOJA 4X6PA 1YYY1 2ZQ1A 3E6PH 1Z8RA 5F6MA 4MQAA 1N6YA 1QB6A 4XOJA 4I33A 3ZVFA 2ALPA 1C1SA 4DT7B 4AORA 3KYFA 2DUCA 2KM0A 3SQHE 1VGCC 2AMQA 3M7QA 1C2FA 3GDSA 4UFGH 3UQVA 4DURA 2PR3A 1DY9A 3PTNA 3NWUA 3U28C 1TRNA 4GSOA 3MO3A 3DSPA 2BYAX 1HB0B 2QYIA 4ZUHA 1C1PA 1G36A 3GYLB 4X8VH 2CF9H 3SGQE 4ZCNA 1P9UA 2ZFQH 3LOXA 4AB9A 1SG8B 3PV4A 4NSYA 3DFJA 3SU3A 2PKAB 2Y82A 2EC9H 4GAWA 1AFEH 1KLJH 1LDTT 1GVLA 5HM2A 1ZHPA 1XX9A 1TPAE 2ZHWH 3VFEA 4E05H 1HAVB 1QIXB 1O2IA 3ZVCA 5T3HA 3TGJE 1Y3UA 4CH8B 1YPGH 1TWXB 5DGJA 1DWBH 3M5LA 1O5AB 5AFYH 4U32A 1UTKA 1UHBB 4TSFD 1KY9A 3TPIZ 1HLTH 3SGAE 3MOCA 3ESTA 1J17T 4OGYA 3SNDA 4H4FA 2STAE 4AG2A 1JBUH 1INCA 1H9HE 4JK5A 2B7DH 2SGFE 4CR9A 2BD3A 2OQ5A 4CREA 3I78A 3SNBA 1D6RA 1AD8H 3EA9A 2ZU5A 2A2QH 8KME2 1F7ZA 3SUFA 3WY8A 1O3NA 2PKSC 1BBRH 3UAIC 3PM3A 3EAJA 3SJIA 3HK3B 4VGCC 4WY3A 3ZZAA 1O2TA 1TPSA 2VB0A 2JH0D 3O8BA 2JIZD 3QTVH 1G37A 3H7TA 3S9CA 5C2ZA 3D65E 5LPRA 1GJDB 4Q2KA 2GV6A 1YPHC 2F9UA 1Z71A 2ZKSA 4BANB 2FI3E 2Z3CA 1NFWA 1VZQH 4X1NU 1OWIA 3SV6A 1V2QT 1GG6C 1ZTLA 2SNVA 1O3EA 1FJSA 3PRDA 1CGJE 2ZNKH 4X1SU 2UWLA 2J98B 3UOUA 4AN7A 4ZHLU 5C1XA 2ZO3H 3ITIA 2NU1E 3QZQA 1YY3A 5CHAB 2BY7X 1A5GH 1TMBH 3TK9A 3SI4H 1EXFA 1F2SE 1YPKH 2FTLE 1C1TA 2Y80A 2G52A 1KXAA 1ANDA 3LU9B 4RKOB 5DP8A 5FXLA 1EJAA 3GS9A 3KHVA 4KTUA 5C1UA 5ESBA 5KECA 1O3PB 3OX7U 2ZU4A 3TU7H 2VU8E 2FDAA 3SV9A 1YCPH 1LPKB 1TOMH 4OGXA 3VB7A 4YLQH 1GBKA 4NFEA 1WBGB 2BZ6H 1HAHH 4DG4A 3LT3A 4FUEA 3ZZDA 4F55A 5BPEA 4DIIH 3F68H 3U8TH 1QHRB 4E7NA 3E16B 3EDXB 1HRTH 4LK4A 4J2YB 1WOFA 3RMOH 5EQRA 2AYWA 1AHTH 1RGQA 3A84A 1PQ5A 3A87A 5EQSA 4WXVA 1OWJA 2OC7A 3SBKA 4DW2U 3BEFB 2Y6TA 3HGNA 4O03A 2VVCA 2ZGCA 1SKYE 1UVUH 2A5KA 1O2HA 1RIWB 1UTNA 1GI3A 2UUYA 3T5FH 1CO7E 3FZZA 1O2XA 1EAIA 1FONA 4HG6A 3MI4A 1G3BA 1SFIA 3ZVBA 2FIRH 1BTXA 1C1OA 1AWHB 3FP7E 2NU3E 2KCYA 2XWBI 1ZJDA 5C0UA 1MTVA 4BAMB 1TBQH 2GV7A 5EJZA 3SJKA 4AFSA 3QZRA 1WQSA 1ZZZA 2QGRA 1UO6A 4Q7YA 1U6QA 1S0QA 3LGUA 4MNVA 2BY8X 2R3UA 5EU8A 5C1YA 1SGTA 3Q76A 1UMAH 3QK1A 3RXPA 2H9HA 1PQ8A 1FAXA 1FQ3A 3A8DA 1HXFH 1W0ZU 2AH4X 4H6TA 3B8JA 1E36B 1C2IA 1TQ7B 4A5TS 2THFB 2F9OA 1COWD 2J94A 2Z9JA 3SV2H 1BRAA 1WDIA 1K1JA 1XVOA 5FBIA 2R0LA 2GZ7A 2QIQA 1SR5C 3SNCA 3TLOA 2IJOB 2XBYA 1MTUA 3Q77A 2BHGA 3BTME 4ABGA 1A61H 2F91A 1YKTA 2PTNA 4ACAA 2O8LA 2F9VA 1GCTB 4NWKA 1OHHD 2FS9A 4FVDA 2UUFB 5EPNA 3DD2H 1EJNA 1DWCH 1ZLRA 1PPGE 3FO8D 1Y59T 3PV2A 4X6MA 2WPDD 1FNIA 1HJ8A 1UVTH 3TJOA 4YLUA 4AX9H 5HYOA 4AG1A 4YT6H 1SL3A 2XOKD 2HNTE 2ZDNA 3M35A 5DG6A 3SUGA 1DS2E 3ZVDA 1SGYE 3RXCA 2VINA 4B74A 3QDZB 1CA8B 4MPUA 3RMLH 2J4IA 3W1EA 1ZSLA 2IN2A 2RDLA 1TNJA 1IQNA 1W3CA 2VIQA 3DHKH 1MTWA 3BTQE 4XD7D 3E0PB 3A80A 1C5UA 3MWIU 1RJXB 2H2ZA 2PGQB 2PLXA 2C3SA 2C8WB 3MFJA 2QC2A 2FOMB 1CA0C 1G32B 2XBVA 1G9IE 3D62A 4Y8XA 2K0QA 1TA6A 1W2KH 1AKSB 1TBZH 1GI6A 3A7VA 2VWMA 2ZDVH 4BNRA 3S7HB 2F43B 4CBOA 5EXMA 2GMTC 2L74A 3OE7D 5HGGA 2ZFSA 2AS9A 3OAAD 3FP6E 1RFNA 1P3EA 4FUBA 1VKYA 2FWWA 4B2CA 1CBWB 4DOQA 4FUHA 3LGYA 5E8EH 3LJJA 5A0CA 3UPEA 4B6EA 1ABJH 2VBCA 1QL7A 3S0NA 1C1UH 1K1MA 2W7UA 3M5NA 5GJ4B 2ZHFH 3RLYH 4JYVH 2J5UA 1GBHA 2F9NA 1O0DH 3H09A 3FAOA 2BDCA 1OPHB 5E2PA 2V3MA 5EODA 3RXQA 2FOBA 2XC5A 3PO1B 1BITA 4X2XA 3ZZ3A 2AIPA 1XKBC 4Z1MD 1C1MA 2C8YB 2J2UA 1O5EH 3RM0H 1C1RA 3DFLA 2EI6A 2GT8A 3SW2B 3MNCA 1AQ7A 2BLWA 3RDZA 3NZIA 8LPRA 1PPEE 1GI4A 5KGOA 2IPQX 3TH2H 1NY22 1GDNA 3RM2H 1O38A 1MZAA 1P06A 1O2OA 1ZR0A 4GUXA 1EX3A 2PUQH 3PB1E 3QGNB 3KYGA 3F2HA 3KF2A 1B7XB 1BMFD 4A92A 2KZ4A 1O3DA 4OS2A 1HV7A 1HXEH 3UQOA 3MU5A 1KMHB 3ZV8A 1GCDA 1K9OE 1A5HA 1AVXA 1P01A 3LGVA 1OP0A 2XXLA 1TFXA 5SGAE 1BTPA 4BTTB 2ILNA 5ESTE 4BAHB 1PYTD 1UK3A 2J92A 3SYJA 1TGNA 3BG4C 2FI5E 2VNTA 3AAVA 4M7GA 1TONA 1LVOA 3SU1A 5DSFA 1KSNA 4O9VA 3ATWA 1E34B 1TAWA 3N7OA 1F92A 2Q1JA 2ZG0H 1GI8B 3OEED 2BDHA 3T25A 2Z94A 2ZDMA 5C5NA 2BXTH 4R0IA 1V2NT 2YNAA 1G2LA 1P0SH 3RC4A 1P11E 3TVJB 1AVWA 2BQ6B 2WYJA 5B6OA 3A89A 3ZYEA 4B2BA 4GCHG 2FOEA 3TITA 1JRSA 2GKVE 1GBLA 2ZP0H 2F4LA 2TGPZ 3BN9A 1NROH 3R0FA 5L6NH 2A0QB 1ELBA 1H8HD 1C2JA 2W6ID 2O9QA 1THRH 2Z9GA 4WJG2 2VVVA 1NT1A 1BZXE 1BOQA 1WSSH 5F8XA 1MKXK 1L4ZA 5DK1A 4KKDA 5HKKD 2QCYA 2ZQ2A 1LVBA 3P8NA 1IOEA 1WAYB 1CVWH 2GGVB 2JJ1D 1GBEA 3UNQA 1DPOA 3OSYA 2WINI 3U69H 4BTUB 2ZIQH 3ZZ8A 1DWDH 1O3CA 1MKWK 3A7TA 4B2AA 2VGCB 4D8NA 4THNH 1SGFA 1DXWA 4YOGA 3HPTB 1O34A 1QL8A 1YGCH 1O5BB 2A4QA 3LH1A 4OS5A 1O3GA 1TMUH 2FI4E 3E8LA 4IW4E 1O3FA 1DLKB 1VCQA 1UCYE 1MUEB 3SI3H 1QRXA 3M61U 4MVNA 2QY0B 4NCYA 4FUCA 3ZYDA 1O3JA 1QGFA 2H9TH 1V2TT 4H42U 1FXYA 3OU0A 2IJD1 2WPLS 3SHCH 1KLTA 1KTSB 1W10U 2OTVA 3RXAA 3JZ2B 1C1WH 1NTPA 1L1GA 2VIVA 1GDUA 2ULLA 5IYTA 2GTBA 3OTPA 4K2YA 2BQWB 3SU4A 2BTCE 2B8OH 1OP8A 1YF4A 3M3TA 1GMDF 8GCHG 1K1OA 1L0ZA 2BD8A 3FFGA 4LOYH 4WMEA 2F3CE 1TLDA 1LMWB 4JMYA 5DKMA 4YOIA 3QX5H 1SGRE 1T32A 2FOFA 1TIOA 4BOHA 1O2PA 2AEIH 2WSSD 4I32A 1C5LH 5CMXH 2ZHEH 5EW2H 1C5WB 1EB1H 2VH6A 2KCPA 1Z7KA 2BVXH 2ODYB 3QUMP 2V35A 1PQ7A 4UD9H 4YM9A 3KL6A 4Y6DA 5A8XA 2SNWA 2HVYB 3RXMA 1D9IA 1O5DH 4Y11E 4ESTE 3BTWE 4NA9H 4YT7H 4YO9A 2XNDD 2GZ8A 4BTIB 2OD3B 1F5RA 4ZHAA 2FX6A 3F9EA 1H9IE 5AVDA 5FX6A 1NU9A 3W95A 1L1JA 2ZGHA 4K8BA 5EQQA 4MNWA 5CHAC 1EPTC 1C5SA 4CRFA 4ZMAH 3M5OA 3LC3A 2VH0A 2GZ9A 4O97A 1FY4A 4ZKOU 2FODA 3MNBA 3K6ZA 1QA7A 4GHQA 1GBIA 1FI8A 1EOLA 4FUJA 2AGEX 5FPYA 3RXKA 1SC8U 3SU6A 1V2UT 1PPZA 3GY5A 3PWBA 3ATMA 3UIRA 4GVUA 4CBNA 5BRRE 1AI8H 1SGIB 1XXFA 1P03A 3N7DA 1DWEH 1QQUA 2ZDKA 6GCHG 2RG3A 1J9CH 4CRBA 1NU7B 3RC5A 1O3MA 2FTMA 1GL1A 1ELVA 4AB8A 4BAKB 2WPMS 1JIRA 3WW7A 4AGKA 2ZU1A 3BG4B 2RA3A 2FO9A 3V13A 5E0JA 4K8YA 4A1VA 1LTOA 3M7TA 5KEDA 4AC9A 2Z3EA 2I6SA 3MH5A 5TCAA 5FCKA 4FU7A 1VCPA 1SI5H 3U98H 1O5FH 7KMEH 1SGPE 1K1LA 1O36A 1RIWC 1AWFH 4Q63A 1MTNB 1XUJA 1LVMA 4GCHF 2ZFRH 2OC8A 4NIVA 3PYHA 2ESTE 6CHAB 4OM9A 3EE7A 4TYDA 1Q31A 2OCVB 4B75A 1ZMJA 2QF5A 1NFYA 3RXIA 2BX3A 1B0EA 1T8OA 4X8TH 1EJMA 1V2WT 1GWAA 1UTQA 1BTZA 4IN2A 1TA2A 3LC5A 1V2ST 1NRSH 3PWCA 4X8SH 4ISIH 1HYLA 2BVSH 5EGMA 2QXGA 4FOUC 3TJUA 3VXFH 1AZZA 2C4FH 1HIAA 3AW0A 1ZJKA 1WTHD 1OWHA 2WYGA 2JETB 2PP6A 1K1PA 3RXHA 1UTOA 1YLNA 2A1DB 4RN6A 5DO4H 1T4UH 1AFQC 3BIUH 1CHGA 5T6GA 2XCNA 2V3HH 1NRNH 1IQGA 1ORFA 2PSXA 1O2MA 2FZZA 3A7XA 2KX4A 3T27A 1UCYK 4AOQA 1GCTC 1GVKB 2A4RA 1AO5A 1FMGA 7GCHG 1RS0A 1T7CA 3GCTG 2KAIB 5GDSH 3MU8A 1GJBB 1ZGIA 4ZAEA 6ESTA 3NXPA 1ELFA 1HNEE 3SJOA 5A8YA 1EUFA 3E3TA 1SGDE 1P2JA 3RXEA 4WVPE 5J4QA 1FY5A 2PSYA 3ZVEA 1O2NA 2PKAA 2ZFPH 1QBNA 1QBVH 2TGAA 1P09A 5FBEA 1HJ9A 8GCHF 1EZUC 2PHBA 1DICA 3PROA 2FYRA 4UEHH 3RU4E 2J9NA 2ZFTA 2ZCKP 4JZDH 2NU2E 1O33A 4JZEH 2CMYA 2CJIA 1D4PB 1BA8B 2ZZUH 5DP7A 1EATA 1UVPA 1FX0B 1QURH 3KCGH 1BIOA 5JBCS 2B0FA 1Q2WA 4NSVA 3LGWA 1MMJN 1BJVA 3BIVH 1OYQA 1RXPA 1YP9A 1L4DA 1C5NH 3A82A 1C4V2 1S83A 1TGTA 3BEIB 1BMAA 4WH6A 2LELA 2OLGA 2KCOA 2TBSA 1D3QB 4IMZA 2HNTC 1WUNH 3ZIAD 1CQQA 2VIWA 3BTTE 3C1KA 1AB9B 4FVBA 2YMSB 1C1VH 4HGCA 3KQDA 4Q7XA 4INLA 3ZZBA 1EPTB 5JPMH 1ZMNA 2A31A 4LZ4B 5LGOA 3UTUH 1CBWC 4XBDA 5EJLA 2QXHA 1YM0A 1P3CA 2C93B 4D76A 1MU6B 1IQIA 1SOZA 5ABWA 2R3YA 3MNSA 4Y0ZE 3A7YA 1TE0A 1ANEA 1SQAA 3IWMA 2KFWA 5F03A 4Y8YA 5T6DA 2OQUA 1FPCH 1ZRBA 3AK5A 1V2PT 3ZZ6A 3QO6A 1O2LA 2J95A 3N99A 1S81A 1UVOA 1TQ0B 1K21H 2HNTF 3PO1C 2PTCE 1MABB 6GCHF 3OEHD 4ABHA 4AYVB 2NU4E 4JYTA 1LPZB 1HJAB 3E90B 3GOVB 1ZPZA 3OFND 2J98A 4I8KA 3ZVGA 1PYTC 2RDEA 4TT3D 5K0HA 3NK8A 2CN0H 3D23A 4NG9H 3M3VA 3K6YA 2O8TA 2YMSD 5GNDA 5PTPA 3RU4D 1C2LA 4Y8ZA 2BOHB 3MH6A 4R8TB 1ZTKA 1UJ1A 3SUEA 1B5GH 1TOCB 3BSQA 1BUIA 2Q6FA 1O2VA 1UK2A 3DT0H 1W7GH 2SGEE 4X6NA 2EQNA 1BT7A 2ZCHP 3PMAB 3SV7A 3TJVA 1ZRKA 2QF4A 1T8NA 3ENSB 3NCLA 1W8BH 1IQMA 1SBWA 1L1NA 2OC1A 3UNRA 1N1LA 2RFKC 2H1UA 5L30H 4DCDA 3D49H 3FN8A 5CHBA 1ZHMA 4X0WU 4ABFA 2YOLA 1KXDA 3LKWA 2GT7A 2D2DA 7LPRA 1EAUA 1AMHA 1BDAA 1P10A 4B6FA 3DSOA 3TIUA 3P17H 4Y79A 1OWDA 3VB4A 3OTJE 1AY6H 2WV9A 3SU0A 5I25A 2W3KA 4X2VA 3FP8E 1RTKA 4BAQB 1CHOG 2BLVA 1OOKB 4TPIZ 1XMNB 1AFQB 2P3TB 1G3EA 1EZQA 4D7GA 1BJUA 2ANYA 1YC0A 2VIPA 3STJA 2ZA5A 7GCHF 1AN1E 2A7HA 2G8TA 2BXUH 2R2MB 1C5QA 3AASA 3GCTF 3HATH 4WMFA 1S6FA 4JCNA 3PLKA 3TNTA 1N8OB 3L6PA 1Z1JA 3FOAA 4ABJA 1E35B 1GDQA 3BF6H 4I8LA 2FPZA 1A0HB 1NN6A 2GCTB 1DE7H 1TX7A 2G55A 1G30B 1LKAA 2EA3A 1WTGH 2ZU3A 1UK4A 1VJ9U 1GJ4H 1LPGB 1ELGA 1XUIA 5FCRA 5C20A 1GBDA 2AMDA 1O3BA 1Z8GA 1GBBA 2VGCC 4WH8A 1YPHE 3W94A 2FP7B 3GCNA 2GP9B 1DITH 1O2JA 2FEQH 2DE8A 1GHBG 3QWCH 4ABAA 3MTYA 4F49A 5T1VA 1P02A 2SFAA 5DP9A 2FOGA 1L2EA 4RKJB 4LZ1H 1J14A 1SQRA 1XUFA 2EI8A 4F48B 1O2GH 3NRLA 3H7OA 1OX1A 1A4WH 2OC0A 5DP6A 1BHXB 3M36A 1IQLA 3GCOA 1NS3A 2ZWLH 1MQ5A 2AGGX 4NWLA 1FAKH 4ACBA 1G3CA 1E37B 1YLCA 3RMMH 1SFQB 1NO9H 3K65B 1GMDG 2JJ2D 2XRCA 4CRGA 1AZ8A 1O2RA 4CR5A 2ZPRA 1AGJA 3HKIB 3SJ8A 2VJ1A 2UWOA 1WV7H 1GI2A 3F9FA 3UR9A 5JBBS 3KN2A 2ZGBH 2GX4A 1H4WA 5DP3A 2Y5FA 4RI0A 2EY4C 4ZH8A 3O8CA 4CHAB 1O32A 1O3KA 3RUOA 4ABDA 5CDFE 1AKSA 1P2QA 3UNSA 1C5OH 3QTOH 4I8JA 4D9QA 2RA0A 3GY8A 1MKXH 3LPRA 2ANWA 3M37A 3RP2A 1YPLH 1DANH 4Y7AA 3P8OA 1MD7A 2P3UB 3SN8A 5IDKA 3K9XB 3RXTA 1XUKA 5J4SA 3JZ1B 1C5RA 1Y5UT 3ZZ5A 4KGAA 1TYNA 1ARCA 1LHFH 3ZZ7A 4A6LA 1MKWH 2V0BA 2UUKB 3KIDU 4ZKNU 2C8XB 1GGDC 1S84A 4NIXA 1ABIH 3UB0A 1HGTH 4Q4LA 1DDJA 1SSXA 2QAAA 3AAUA 1KDQA 4XDEA 4FUFA 1ARBA 3P6ZB 1SGCA 4MDSA 5EJ1A 1O2WA 4MG3A 4WXIA 2WPIS 4CRDA 3B9FH 4NFFA 3KQEA 3KQBA 1SLXB 5EPYA 5TCCA 2A5AA 3BV9B 1AUTC 1DY8A 3KEEA 3RXLA 3U8OH 5A09A 1BTHH 4RSPA 4BXSA 3K2UA 1CU1A 4DVAU 1ELEE 1Y3VA 1NRRH 3U1IB 3FKSD 2C8ZB 3CNRA 3KNXA 5GWZA 2HPPH 3GY6A 4JZ1A 2H9EH 1CHOF 2VWNA 1V2KT 4NZLA 2H6MA 5B6LA 1W14U 1ETRH 1C2MA 4WMDA 1EZXC 1LQEA 1THPB 1MTNC 3TNSA 6CHAC 5FL7D 1O30A 1CT2E 5EW1H 1TNGA 5JYIA 1FUJA 1MAYA 2P3FH 1GBCA 1VITG 2JKHA 5DPAA 1AE5A 3TK5A 4X8UH 1NRPH 2SGPE 2A4OA 1EP5A 2G00A 2WZQA 3V3MA 3L3TA 4CRCA 1EB2A 3BTHE 2QN5T 4ASUD 3BTEE 3P70B 4IMQA 3FANA 2AMPA 4OS1A 3STIA 2BDAA 2XWAA 2JETC 4MLFB 5T6FA 1SVPA 1GBJA 4U2WA 1HFDA 2BD2A 4DT4A 1DUEA 2FMJA 3UWIA 4U01A 2ZC9H 2HOBA 4B1TA 1FY8E 4RT0A 2CF8H 2ZGXH 4KTSA 2ZEBA 5A0BA 3P8FA 1GHBF 5GCHG 4RT1A 2O8UA 1TX8A 2ODQA 1TNHA 4NA8A 1QY6A 3UREA 2HGTH 1UTJA 3FVFB 3MYWA 3LGIA 1AIXH 3SZEA 2ODPA 2WPHS 1F5LA 1EZSC 1Y3YA 3DA9B 4X2YA 3OY6U 2CXVA 1WU1A 1LO6A 1A46H 5F53A 3A7WA 5DN6D 2Z3DA 4SGBE 1C2EA 2BX4A 1UTPA 4Y76A 1QR3E 3AVZA 3N7EA 3F3BA 2V6NA 3PMHB 1PPFE 2CV3A 2O8MA 5C5OA 4MPVA 1W0KD 1Q3XA 1C4U2 1GPZA 1TGSZ 2HPQH 1BCUH 1OS8A 1KIGH 5F8TA 2BY6X 2JDID 1IHSH 2G4UA 2DE9A 4H6SB 5EIYA 2TRMA 2UWPA 1H8ED 1P57B 2G5NA 2W7SA 3FZDA 4NGAH 1W13U 1YWUA 3U8RH 1X7AC 5ETXA 1BRCE 4TWWA 2WUBA 1QJ7B 2HLDD 2Z7FE 4Q80A 4WF8A 1V2MT 3SGBE 4UONA 4AYYB 2GCHG 1ELAA 4GLYA 1IQKA 4XSKU 1AB9C 2YMSC 4A1TA 1HBTH 1H1BA 2VWOA 4TY6A 4DGJA 1GJ7B 2HWLB 2ALVA 4DJZB 5FHTA 3QLPH 1TNIA 1TRMA 3F0OA 2J34A 3HGPA 2XC0A 1CT0E 4PROA 4Y10E 4BAOB 2V7QD 2D26C 2J97A 1GGDB 1FV9A 1ELDE 1UW7A 4P02A 3GY3A 1GHYH 1EFRD 2FLBH 1CE5A 3A83A 3T26A 1UCYH 3KGPA 5JB8S 1HDTH 5TJXA 3SV8A 2AFQB 4Y7BA 3DUXH 4YZUA 2Y81A 1C5PA 4K3JA 1HJAC 1MQ6A 3BTFE 1E79D 1A3BH 3T28A 4MPXA 1S5SA 3Q3YA 2XC4A 4NA7A 1BTWA 1ESAA 4YESB 2FS8A 1OP2A 1C1QA 1K2I1 5FPSA 2QF3A 3RXUA 3SZNA 2XBXA 2ZPQA 1H9LB 4FU8A 1QRZA 3T29A 1HAIH 2FM2A 3A8BA 4SGAE 2QXJA 3RLWH 1K1IA 1ZTJA 5EOKA 1F0UA 1HAPH 4ISNA 1BRBE 3CS0A 4KELA 1GI0A 1XUHA 1LHDH 1O2KA 1MCVA 2M2AA 3BTGE 1TALA 3U1JB 4Z0KA 5JBAS 1RTFB 1VITF 1GHVH 1ZHRA 1BBRE 2W26A 2FXRA 1GI9B 3E0NB 2Q6GA 4OS6A 2BM2A 1IAUA 1IQHA 4K60A 4DIHH 1EP6A 4FETA 2ZDLA 4HI3A 1BB0B 1NM6A 1PPCE 1E1QD 2BLQA 2FOHA 1NC6A 1SOTA 1C5TA 1WCZA 1FN6A 1FY3A 3S9BA 1O35A 2TIOA 4ABIA 1C5XB 3RXSA 3RXRA 1JIMA 4A1XA 1J8AA 1AE8H 2SGDE 3ATLA 1KXCA 3GY2A 2VVUA 3VXEH 2QV1A 1QB1A 5A0AE 9LPRA 1ZOMA 2Z9LA 5GCHF 5DP4A 2BMGB 1LVYA 2CHAB 2JH6D 1TABE 3Q3KA 4CRAA 2PV9B 2A45B 3ATKA 1W11U 5A8ZA 4ABBA 1N8OC 3G01A 1V2LT 3SJ9A 3F0PA 4FU9A 1HAXB 1P2KA 1ESBA 1O3HA 1DSUA 1P8VC 3EE0B 3F6UH 1GBAA 2BY5X 2IOTA 2WPJS 1GJAB 4MNXA 1FPHH 1O3IA 4Y0YE 3UFAA 2FX4A 2ZFFH 1C2KA 2GCTC 1RD3B 1B0FA 4FUIA 2GJGA 2QE7D 1Z8JB 2RCEA 4ASHA 2VIDA 3UY9A 1QA0A 4K1TA 2ZHDA 1Z6EA 1SQTA 1HAVA 4D7FA 1G3DA 3VEQB 3BTDE 2P93A 1Y3XA 2VIOA 2QXIA 1DOJA 1NRQH 2Q6DA 5E0HA 2Z6BD 4BXWA 3I77A 1UHBA 1EQ9A 2PW8H 3GY7A 2PGBB 3A88A 4B71A 1RRKA 2KAIA 1D3PB 1P2NA 2ZDAH 1C9PA 2ZTXA 1GI1A 2GCHF 4NZQA 2M5TA 1SLWB 1O2SA 1DFPA 4I8GA 1N6XA 5EXNA 1SGFG 1QBOA 1P9SA 3F9HA 2NWNA 4AZ2B 1GMHG 1S6HA 5GXPA 1FN8A 1ZSKA 1DUAA 3MMGA 1CSOE 1RTLA 2B9LA 1LHEH 3VG8A 1HPGA 2K1QA 1GJ9B 3RXGA 2W6JD 4A7IB 4CH2B 3PMJA 4AFUA 1EAWA 1P2IA 1UTMA 3MH7A 1ZMLA 1HUTH 3LIWA 1JWTA 3NUMA 2GD4B 1TB6H 2XBWA 3URCA 2A7JA 2CK3D 4B73A 1P2OA 3GY4A 4NIWA 3TGKE 1FIZA 1YPEH 1V2OT 3P95A 4FUDA 1PJPA 3WWBA
chains in the Genus database with same CATH topology
1NFXA 3C27B 1XKAC 3NPSA 3PTBA 4CHAC 1T31A 1C2GA 1KXFA 1BQYA 1BHXF 2FLRH 3VB6A 2B5TB 1DLEA 1QQ4A 4OS7A 1EPTA 1Y5BT 2A32A 1FLEE 2NU0E 3BG8A 3ELAH 1QRWA 2W3IA 1SLUB 3ZZCA 1CGHA 3F9GA 1A5IA 1C5VA 5L2YH 4IC5A 1XM1A 1DVAH 1XXDA 1CGIE 1NZQH 1J15A 1SGQE 2AIQA 1V3XA 2BY9X 2FESH 1E38B 1OWKA 1TX6A 3B23B 1CT4E 4TY7A 1BMNH 2XCFA 1C1NA 3PLPA 2BD4A 1QJ1B 3BEUA 5JBTA 3AW1A 1Y3WA 2OXSA 1TBRH 1C2DA 2ZTYA 5C67A 1BBRK 3EGKH 1UTLM 4K1SA 3RXDA 3S7KB 3GCHC 1FY1A 2F9BH 1MCTA 1O39A 2ZHQH 5LPFA 1H8DH 1ELCA 1D3DB 4MPWA 3ODDA 3HK6B 1VITH 1PFXC 2TGTA 4NIYA 1NESE 3NKKA 5E2OA 2R0KA 1VGCB 4GHTA 1DSTA 1F0TA 2WUCA 1KTTB 2PWXA 1DM4B 3V7TA 4B76A 2Y5GA 5JB9S 3GDUA 2QA9E 5AHGH 5EXLA 1GJCB 3VGCC 2ZECA 1O2ZA 1VCWA 2PUXB 5E0GA 2R2WU 1KXBA 1OKXA 1OYTH 5FX5A 1DXPA 2LPRA 3SNAA 3Q3XA 3S69A 1C5ZB 2P8OC 1TPPA 2SGQE 1SQOA 3P92A 2GDEH 1TRYA 1SGNE 1GVZA 1GMCG 3QGJA 5A2MH 5F8ZA 2OINA 2A2XH 4ZKSU 3ZZ9A 4AGJA 4X2WA 1ZPBA 1YCPK 1MAXA 2F83A 3ATIA 1IQEA 1YLDA 1A2CH 3OYPA 4J1YA 1A0JA 5GPIB 1LKBA 2G81E 3GYMA 2ZU2A 1GHZA 4ABEA 1A0LA 1MH0A 3A8CA 2P94A 1H8IH 1O37A 1V2VT 4TPYA 3RXOA 1LCYA 3PLBA 1AUJA 1BRUP 1FDPA 1C5YB 5AF9H 3GDVA 2A4GA 5HM9A 2D1JA 2XTTB 2PKSB 5LH8A 3MHWU 2QF0A 4UFDH 4VGCB 3F1SB 1GMHF 5FPTA 1W0YH 1O2YA 1WQVH 2TGDA 1MZDA 4ZHMU 1KYNA 2BQ7B 1Y5AT 1GL0E 1Y8TA 4E7RG 1E0FD 2ZTZA 1GG6B 3U9AH 4ISLA 3UWJH 2HRVA 3EA8A 3LGTA 2OBQA 2STBE 1MBQA 1MBMA 3ZV9A 1W12U 2BDGA 1GHAG 1IQJA 2Y7ZA 2P59A 4GPGA 2UUJB 1ANBA 1C5MD 1YPMH 2R9PA 2FOAA 1C4Y2 1FIWA 3BTKE 4Z6AH 1HAOH 1K28D 2AERH 4ISHH 2WPKS 4IS5A 1A7SA 3E1XB 2BVRH 3RXJA 3URDA 1BTYA 1PQAA 3MO6A 1WYKA 2Z9IA 3SO3A 1Z6JH 2BDYA 4X1RU 1V2JT 4Y71A 3LDXH 1LQDB 4ZXXH 1IQFA 1JXPA 1KDQB 2HLCA 4UE7H 2H5CA 4I31A 3VB5A 2WV4A 3SUDA 1ZYOA 1T8LA 1HAGE 1PPBH 1KXEA 4IGDA 1J16A 4INHA 1QJ6B 3SQEE 2ZGJA 2CGAA 3IITA 1Z1IA 1G2MA 2O8WA 1MU8B 3LONA 1D3TB 4TWYA 2ANMH 1NFUA 1IHTH 4ISOA 2Y7XA 3GCHB 3A8AA 2AGIX 1GJ5H 3HKJB 1ESTA 2BD5A 1O3OA 4X6OA 2WV5A 1M9UA 2ANKH 5JDUB 1BMMH 1ETSH 3O8RA 1O2UA 3A81A 2C90B 5G4BA 3GISB 5GIBA 4UFFH 3SHAH 2OP9A 4K5ZA 3VGCB 1GJ8B 1P12E 3UUZA 1O3AA 2ZI2H 2BD9A 2XYAA 2SGAA 3UR6A 1MTSA 4JZFH 2OBOA 2I6QA 1ETTH 1PPHE 4IN1A 1W7XH 2P8OB 4E06H 1KLIH 3M5MA 3TGIE 1O5GH 2V3OH 1GMCF 3H5CB 1GJ6A 3RXVA 4HTCH 4Q7ZA 3MU4A 3L33A 4AFZA 4MNYA 3ZZ4A 4FXGH 4I8HA 3SOSA 2HALA 3RXFA 5AFZH 4JZIA 4WWYA 1XVMA 1S0RA 4JYUH 5DJ7A 4XFQA 1F5KU 1A1RA 7ESTE 1S85A 1ZSJA 3V12A 2ASUB 2G5VA 1VR1H 6LPRA 1O31A 3MO9A 2Z9KA 3M3SA 1SHYA 3CENA 3CS7A 1SMFE 1TNLA 1TNKA 1GI7B 4FUGA 3RXBA 5CE1A 2CHAC 5I46H 4HFPB 1TGCA 1TGBA 2YNBA 3SU5A 3VPKA 2TPIZ 3TH4H 1XUGA 4AFQA 5EG4A 1EASA 3LJOA 1BTUA 1P2MA 1DT2A 1ZPCA 1HAYB 1LHCH 4ZKRU 1GBFA 2EEKA 3O8DA 4X1QU 4XBBA 1YCPM 1HAZB 3LH3A 4XBCA 4F4OC 4INKA 4LXBH 3RMNH 3SU2A 1K1NA 5DP5A 1QB9A 1QFKH 4K1EA 4UFEH 3VB3A 2BDIA 2GVFA 1CA0B 3P8GA 2HVXA 3IG6B 5H4IB 5FAHA 1MD8A 4JK6A 3TJNA 1F0SA 1JOUB 8ESTE 1GHAF 2G4TA 2Y5HA 3Q00A 2GMTB 5HMAA 2GDDA 2FYQA 3V0XA 2ZCLP 1YPJH 1ZGVA 3MU1A 1GHWH 1FZZA 1DX5M 2XNIA 2BB4A 1SB1H 3EYDA 1P04A 4K69A 1SHHB 4OS4A 1T4VH 3EA7A 1ANCA 2LNCA 2J38A 1BMLA 1K22H 1OXGA 3ZVAA 3T2NA 1EOJA 1GBMA 1OWEA 1T8MA 2ZF0H 4UDWH 4ZROA 3A85A 1EAXA 3MNXA 1THSH 3RU4T 1S82A 3R3GB 3EQ0H 4IC6A 3RC6A 9ESTA 2BDBA 1C2HA 1LHGH 3T62A 1VJAU 2F9PA 2A5IA 5LPEA 2BOKA 1F0RA 2PFEA 4D9RA 3A7ZA 3TK6A 1OSSA 1Z8IB 4X1PU 2BLOA 1QL9A 1JRTA 1ID5H 1C9TA 4I7YH 1ACBE 1O5CB 2A7CA 3SNEA 1SPJA 5HXFA 3UOPA 3GICB 5K7RA 5L2ZH 1P05A 3KQCA 3CP7A 3S9AA 1V6DA 2JH5D 2ZPSA 3MH4A 4ZXYH 2OUAA 1QCPA 1QTFA 3E91A 1AU8A 3A86A 3M7UA 2G51A 1O3LA 2H5DA 4IBLH 1EKBB 4QT8C 2FOCA 1QNJA 1UVSH 2P95A 1GBTA 1SLVB 2BD7A 4YTAA 5C3NA 4HZHA 4DY7B 1YBWA 4U30A 1D6WA 1A3EH 2XW9A 3SORA 2P16A 2EI7A 3MU0A 3I29A 4MTBA 1ELTA 2D8WA 4XE4A 3PMBB 1HCGA 4KTCA 3OY5U 3QN7A 1JMOH 2W5EA 3TH3H 1SGEE 1AVGH 2VWLA 4O3UA 1HIAB 1TPOA 1GI5A 1NPMA 1O2QA 1TMTH 1GHXH 2IPHA 1V2RT 4KP0A 4O3TA 3ODFA 2BZAA 4YOJA 4X6PA 1YYY1 2ZQ1A 3E6PH 1Z8RA 5F6MA 4MQAA 1N6YA 1QB6A 4XOJA 4I33A 3ZVFA 2ALPA 1C1SA 4DT7B 4AORA 2DUCA 3SQHE 1VGCC 2AMQA 3M7QA 1C2FA 3GDSA 4UFGH 3UQVA 4DURA 2PR3A 1DY9A 3PTNA 3NWUA 1TRNA 4GSOA 3MO3A 2BYAX 1HB0B 2QYIA 4ZUHA 1C1PA 1G36A 3GYLB 4X8VH 2CF9H 3SGQE 1P9UA 2ZFQH 3LOXA 4AB9A 1SG8B 3PV4A 4NSYA 3DFJA 3SU3A 2PKAB 2Y82A 2EC9H 4GAWA 1AFEH 1KLJH 1LDTT 1GVLA 5HM2A 1ZHPA 1XX9A 1TPAE 2ZHWH 3VFEA 4E05H 1HAVB 1QIXB 1O2IA 3ZVCA 5T3HA 3TGJE 1Y3UA 4CH8B 1YPGH 1TWXB 5DGJA 1DWBH 3M5LA 1O5AB 5AFYH 4U32A 1UTKA 1UHBB 1KY9A 3TPIZ 1HLTH 3SGAE 3MOCA 3ESTA 1J17T 4OGYA 3SNDA 4H4FA 2STAE 4AG2A 1JBUH 1INCA 1H9HE 4JK5A 2B7DH 2SGFE 4CR9A 2BD3A 2OQ5A 4CREA 3I78A 3SNBA 1D6RA 1AD8H 3EA9A 2ZU5A 2A2QH 8KME2 1F7ZA 3SUFA 3WY8A 1O3NA 2PKSC 1BBRH 3PM3A 3EAJA 3SJIA 3HK3B 4VGCC 4WY3A 3ZZAA 1O2TA 1TPSA 2VB0A 2JH0D 3O8BA 3QTVH 1G37A 3H7TA 3S9CA 5C2ZA 3D65E 5LPRA 1GJDB 4Q2KA 2GV6A 1YPHC 2F9UA 1Z71A 2ZKSA 4BANB 2FI3E 2Z3CA 1NFWA 1VZQH 4X1NU 1OWIA 3SV6A 1V2QT 1GG6C 1ZTLA 2SNVA 1O3EA 1FJSA 1CGJE 2ZNKH 4X1SU 2UWLA 3UOUA 4AN7A 4ZHLU 5C1XA 2ZO3H 3ITIA 2NU1E 3QZQA 5CHAB 2BY7X 1A5GH 1TMBH 3TK9A 3SI4H 1EXFA 1F2SE 1YPKH 2FTLE 1C1TA 2Y80A 2G52A 1KXAA 1ANDA 3LU9B 4RKOB 5DP8A 5FXLA 1EJAA 3KHVA 4KTUA 5C1UA 5ESBA 1O3PB 3OX7U 2ZU4A 3TU7H 2VU8E 2FDAA 3SV9A 1YCPH 1LPKB 1TOMH 4OGXA 3VB7A 4YLQH 1GBKA 4NFEA 1WBGB 2BZ6H 1HAHH 4DG4A 3LT3A 4FUEA 3ZZDA 5BPEA 4DIIH 3F68H 3U8TH 1QHRB 4E7NA 3E16B 3EDXB 1HRTH 4LK4A 4J2YB 1WOFA 3RMOH 5EQRA 2AYWA 1AHTH 1RGQA 3A84A 1PQ5A 3A87A 5EQSA 4WXVA 1OWJA 2OC7A 3SBKA 4DW2U 3BEFB 2Y6TA 3HGNA 4O03A 2VVCA 2ZGCA 1UVUH 1O2HA 1RIWB 1UTNA 2A5KA 1GI3A 2UUYA 3T5FH 1CO7E 3FZZA 1O2XA 1EAIA 1FONA 3MI4A 1G3BA 1SFIA 3ZVBA 2FIRH 1BTXA 1C1OA 1AWHB 3FP7E 2NU3E 2XWBI 1ZJDA 1MTVA 4BAMB 1TBQH 2GV7A 3SJKA 4AFSA 3QZRA 1WQSA 1ZZZA 2QGRA 1UO6A 4Q7YA 1U6QA 1S0QA 3LGUA 4MNVA 2BY8X 2R3UA 5EU8A 5C1YA 1SGTA 3Q76A 1UMAH 3QK1A 3RXPA 2H9HA 1PQ8A 1FAXA 1FQ3A 3A8DA 1HXFH 1W0ZU 2AH4X 4H6TA 3B8JA 1E36B 1C2IA 1TQ7B 4A5TS 2THFB 2F9OA 2J94A 2Z9JA 3SV2H 1BRAA 1K1JA 1XVOA 5FBIA 2R0LA 2GZ7A 2QIQA 1SR5C 3SNCA 3TLOA 2IJOB 2XBYA 1MTUA 3Q77A 2BHGA 3BTME 4ABGA 1A61H 2F91A 1YKTA 2PTNA 2O8LA 2F9VA 1GCTB 4NWKA 2FS9A 4FVDA 2UUFB 5EPNA 3DD2H 1EJNA 1DWCH 1ZLRA 1PPGE 1Y59T 4X6MA 1FNIA 1HJ8A 1UVTH 3TJOA 4YLUA 4AX9H 5HYOA 4AG1A 4YT6H 1SL3A 2ZDNA 2HNTE 3M35A 5DG6A 3SUGA 1DS2E 3ZVDA 1SGYE 3RXCA 2VINA 4B74A 3QDZB 1CA8B 4MPUA 3RMLH 2J4IA 1ZSLA 2IN2A 2RDLA 1TNJA 1IQNA 1W3CA 2VIQA 3DHKH 1MTWA 3BTQE 3E0PB 3A80A 1C5UA 3MWIU 1RJXB 2H2ZA 2PGQB 2PLXA 2C3SA 2C8WB 3MFJA 2QC2A 2FOMB 1CA0C 1G32B 2XBVA 1G9IE 3D62A 4Y8XA 1TA6A 1W2KH 1AKSB 1TBZH 1GI6A 3A7VA 2VWMA 2ZDVH 4BNRA 3S7HB 4CBOA 5EXMA 2GMTC 5HGGA 2ZFSA 2AS9A 3FP6E 1RFNA 1P3EA 4FUBA 2FWWA 4B2CA 1CBWB 4DOQA 4FUHA 3LGYA 5E8EH 3LJJA 5A0CA 3UPEA 1ABJH 1QL7A 3S0NA 1C1UH 1K1MA 2W7UA 3M5NA 5GJ4B 2ZHFH 3RLYH 4JYVH 1GBHA 2F9NA 1O0DH 3FAOA 2BDCA 1OPHB 5E2PA 5EODA 3RXQA 2FOBA 2XC5A 3PO1B 1BITA 4X2XA 3ZZ3A 2AIPA 1XKBC 1C1MA 2C8YB 2J2UA 1O5EH 3RM0H 1C1RA 3DFLA 2EI6A 2GT8A 3SW2B 3MNCA 1AQ7A 2BLWA 3RDZA 3NZIA 8LPRA 1PPEE 1GI4A 3TH2H 1NY22 1GDNA 3RM2H 1O38A 1MZAA 1P06A 1O2OA 1ZR0A 4GUXA 1EX3A 2PUQH 3PB1E 3QGNB 3KF2A 1B7XB 4A92A 1O3DA 4OS2A 1HV7A 1HXEH 3UQOA 3MU5A 3ZV8A 1GCDA 1K9OE 1A5HA 1AVXA 1P01A 3LGVA 1OP0A 2XXLA 1TFXA 5SGAE 1BTPA 4BTTB 2ILNA 5ESTE 4BAHB 1PYTD 1UK3A 2J92A 1TGNA 3BG4C 2FI5E 2VNTA 3AAVA 4M7GA 1TONA 1LVOA 3SU1A 1KSNA 4O9VA 3ATWA 1E34B 1TAWA 3N7OA 1F92A 2Q1JA 2ZG0H 1GI8B 2BDHA 3T25A 2Z94A 2ZDMA 5C5NA 2BXTH 4R0IA 1V2NT 2YNAA 1G2LA 1P0SH 3RC4A 1P11E 3TVJB 1AVWA 2BQ6B 2WYJA 5B6OA 3A89A 3ZYEA 4B2BA 4GCHG 2FOEA 3TITA 1JRSA 2GKVE 1GBLA 2ZP0H 2TGPZ 3BN9A 1NROH 3R0FA 5L6NH 2A0QB 1ELBA 1C2JA 2O9QA 1THRH 2Z9GA 4WJG2 2VVVA 1NT1A 1BZXE 1BOQA 1WSSH 5F8XA 1MKXK 1L4ZA 5DK1A 4KKDA 2QCYA 2ZQ2A 1LVBA 3P8NA 1IOEA 1WAYB 1CVWH 2GGVB 1GBEA 3UNQA 1DPOA 3OSYA 2WINI 3U69H 4BTUB 2ZIQH 3ZZ8A 1DWDH 1O3CA 1MKWK 3A7TA 4B2AA 2VGCB 4D8NA 4THNH 1SGFA 1DXWA 4YOGA 3HPTB 1O34A 1QL8A 1YGCH 1O5BB 2A4QA 3LH1A 4OS5A 1O3GA 1TMUH 2FI4E 3E8LA 4IW4E