2STAE

Anionic salmon trypsin in complex with squash seed inhibitor (cucurbita maxima trypsin inhibitor i)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
222
structure length
222
Chain Sequence
b'IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title High-resolution structures of three new trypsin-squash-inhibitor complexes: a detailed comparison with other trypsins and their complexes.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2staE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2staE02
1TALA 1YPHE 1UTQA 1JIMA 4ZKRU 3ZYDA 4U2WA 2FOHA 1W14U 1HCGA 4U30A 1KSNA 4NG9H 2ZFPH 1DLEA 1ZTJA 4F49A 1YM0A 3KQBA 2GGVB 3LH3A 8ESTE 1ELAA 4UFDH 4TPYA 4GHTA 2STBE 1D9IA 5FCKA 2BD3A 1YPLH 1ZOMA 2H9EH 1QB6A 3ODFA 1TGCA 4H6SB 2NU3E 1O2GH 4IMQA 2G81E 3EYDA 3RMLH 2ASUB 2BLOA 2WPLS 1QQ4A 1TMTH 2VIDA 1SGTA 2FM2A 3RM2H 1XXDA 1ZRBA 2FWWA 2VIQA 2W7UA 1K21H 2OCVB 1QL8A 3FP6E 1GBHA 3AAVA 3KHVA 2VIPA 5J4QA 1ZSLA 1YPMH 1QB9A 1OS8A 3MU0A 2ZHEH 3HGPA 1C4Y2 1LTOA 4MDSA 2Z9GA 1Q31A 1ZYOA 3BTDE 1AE8H 1ELBA 4Y71A 2WV5A 1J9CH 3UOPA 1QR3E 1TGBA 3TH4H 1AWHB 1AQ7A 1Z8JB 2ALVA 2B0FA 4AYYB 3PO1C 4X8SH 1Z1JA 2QXGA 1FMGA 2VIWA 2VNTA 2TGPZ 4HFPB 3VGCB 2A1DB 1FN8A 3ZVGA 4X1NU 3GCTF 4BTIB 2HPPH 4UE7H 1KIGH 2ANWA 2V0BA 1SGDE 4ZXXH 1SLVB 1C1OA 1IQJA 1FIWA 1C5YB 1ZTKA 1GBKA 1UTNA 4DG4A 3KCGH 1LVOA 3GCHC 2UWPA 2ZQ1A 3SJ9A 3H7TA 2AIQA 3TNSA 1TBZH 1RIWB 4A1TA 1O5FH 1TX8A 3SU5A 2GZ8A 3BG4C 3I77A 4CRFA 3SORA 5DK1A 4MNVA 1O2KA 2SGAA 2WYGA 4WXIA 4FVBA 1BDAA 4CH2B 2Y5FA 1SI5H 5H4IB 2HLCA 3ZZ7A 3AW1A 1DWCH 3F9FA 2Z9JA 3LONA 1ZMJA 4RN6A 1DPOA 1YKTA 1GJ7B 2OC1A 2ILNA 1BTUA 1P0SH 1O5DH 4GUXA 2AGIX 1O2MA 3AVZA 5EOKA 1T31A 3RLYH 5HM9A 1LMWB 1F0UA 1GL1A 3BTEE 2PKSB 2AH4X 1K22H 3BG8A 2H1UA 1O5EH 1PFXC 1XUGA 1W0ZU 2PUQH 1SMFE 1GJDB 1TMUH 3PLKA 3SJKA 3A7TA 3SU1A 1DANH 1TABE 1ETSH 3PV4A 5CE1A 2ODYB 3LIWA 2P3UB 3PROA 5TJXA 5FPTA 1F0TA 4OGYA 4YLQH 1J8AA 1K1LA 2QN5T 4KELA 1ZHPA 2DUCA 1BZXE 3E3TA 3TLOA 5JBBS 3S9BA 1NRSH 1RJXB 2ZGJA 2GZ9A 3T5FH 4SGAE 2EI6A 5B6OA 3L33A 2BD2A 1Q2WA 1CHGA 3ZVDA 1UTPA 1T32A 3EAJA 1ZLRA 1ZMLA 7ESTE 1XUJA 1SVPA 1EZXC 1MU6B 3ZZ3A 1JWTA 4RKJB 1MTUA 3SUDA 4D9QA 5I46H 1AY6H 4B2CA 3ZZ8A 6CHAB 1TLDA 2FO9A 1HBTH 4LK4A 1KLIH 1GPZA 3QGJA 1U6QA 3C27B 1GBDA 3GY3A 5L2YH 3A7WA 1BTWA 4ZHLU 1GI3A 4E06H 3ATIA 1XMNB 1O2SA 4A1XA 1E35B 2HPQH 2FI5E 4E05H 2ZDKA 4AFUA 2ZDNA 2FLBH 2WPIS 1CQQA 1MQ6A 1N8OB 3W95A 3ZV8A 1O2UA 3O8CA 3V12A 4FUHA 1G3CA 1SR5C 1GJ5H 3IG6B 2G5VA 3MH5A 1QL9A 1OP2A 4VGCB 3UFAA 8GCHG 1SGFG 2G4TA 4K1TA 1DICA 1O3CA 1ABJH 1CBWC 1OKXA 3KL6A 3T62A 3PLBA 1ZRKA 2P93A 2TGDA 3RXJA 4ABAA 4Y6DA 5L2ZH 2FS9A 1T8OA 3T28A 1O2NA 2Z3DA 3GYMA 4FUBA 1Y5AT 3RXAA 2QCYA 1YC0A 3ATKA 5F6MA 2UUYA 2VWLA 3V7TA 2OC7A 2A4QA 3SUFA 3PYHA 3NZIA 5GWZA 4JCNA 1V6DA 1UJ1A 2FLRH 2VVCA 5DPAA 1P2OA 1SQAA 4MVNA 3BTHE 1IAUA 4TWWA 2SGQE 3BTWE 4Y79A 3VEQB 2XC0A 1F0RA 3T29A 1G9IE 1LCYA 3NWUA 1HAYB 3PM3A 1GMHF 1BQYA 2PKAA 3SNDA 3SV2H 1KY9A 1SC8U 1EX3A 4F4OC 3VXEH 1S5SA 1GVKB 2PWXA 1PYTC 2PSYA 2QIQA 1TNIA 1LVBA 2RDLA 3MU8A 4GCHF 1QL7A 1L2EA 3M37A 3RXFA 5I25A 1C2JA 4Z6AH 1EASA 2FOGA 1RGQA 3PMAB 1MTNB 1OP0A 5FPYA 1C9PA 1Y3VA 1PQAA 2P3TB 4YT7H 1IQKA 1G30B 5EQRA 3GYLB 1EPTA 2W26A 3W94A 1JOUB 2Z94A 4A92A 1NM6A 3EE0B 1O2OA 1ARBA 4NA7A 1MH0A 3VPKA 2SGEE 1EOJA 1KDQA 2QXHA 3P8OA 1D3TB 1UMAH 2P8OB 1S84A 2Y6TA 1S81A 1O0DH 2Y7ZA 2GTBA 1H8DH 3ZZ5A 2BY9X 3ITIA 1QQUA 2GKVE 4CRGA 1WTHD 4X2WA 3M7QA 1DOJA 1SQTA 4IC6A 3PLPA 1GJ8B 2FOAA 2WUCA 1S0QA 1Z1IA 1FY4A 4DURA 1C2FA 1TNJA 1DWEH 3V3MA 1KXFA 4BTUB 3GISB 3U8OH 3M36A 1C2EA 1GHXH 1CA0C 1AFQB 1W8BH 1VCQA 1P01A 2AIPA 2ANYA 2XTTB 1KXDA 4UEHH 1ZMNA 2A2QH 2OC0A 5T3HA 1UVUH 3SU0A 1ORFA 2Z9LA 3M5OA 1D3QB 1GDUA 3A86A 1MKXK 3BTME 4NGAH 2PKSC 2TGTA 3HATH 2WINI 3P70B 1O2PA 1V2TT 3SV7A 4CREA 3TGKE 1A5HA 1YGCH 2R0KA 1EJNA 1O2YA 4DY7B 1EKBB 2OXSA 4ABHA 2ULLA 1YP9A 2XW9A 2ZPQA 1FONA 1MZDA 4MPVA 1ELVA 1H9LB 1CVWH 3SUEA 5EU8A 2JKHA 1H9IE 3PWCA 1E38B 1UCYE 3MTYA 3SJIA 2GT8A 4Y76A 3LGTA 1FPCH 2ZNKH 4AYVB 2BQ6B 1JRTA 1Z8RA 3PMBB 1TFXA 1RS0A 3OY5U 1DE7H 1IQNA 4HGCA 2GDEH 1BOQA 2XBYA 2F9VA 1AKSA 5BPEA 4YTAA 2GV6A 1RRKA 1CGJE 3T25A 1BRUP 3STJA 1INCA 4I32A 3TH3H 1J14A 4NA9H 2K1QA 1TE0A 4Q7XA 4J2YB 3PO1B 4MLFB 1GJ6A 4ZH8A 3F6UH 3QUMP 3ZVCA 2DE9A 2J4IA 2JH5D 2ZHWH 1HUTH 4I8KA 5K7RA 1W11U 3UNRA 1GI4A 4B76A 3E0NB 4MNWA 1QIXB 3GY8A 3TPIZ 1O2HA 5LPRA 1V2MT 2HOBA 1O5GH 2R2MB 1A4WH 1P10A 3LH1A 3Q00A 2P95A 3GCHB 2B7DH 1CO7E 1O2LA 1ETRH 3FP7E 1C5MD 1TNGA 4DJZB 1SG8B 1P2KA 2BD4A 4YOJA 3RLWH 2ZDLA 1OWDA 1AZ8A 3BG4B 3GY4A 4BXSA 1CGHA 2ODPA 2BY8X 1VCWA 5DGJA 5FBEA 4ZROA 1XXFA 1HGTH 1FZZA 7KMEH 3AAUA 3A83A 3GCTG 2BQ7B 5E0HA 3SV6A 1B5GH 1P2NA 3DT0H 8LPRA 3ODDA 2IJOB 2ZTXA 2BVSH 4I7YH 1YPJH 1V2JT 3U1IB 2QF3A 2THFB 2ZTYA 3IWMA 3MWIU 4AG1A 1LDTT 1FY3A 4BAOB 4PROA 1K1NA 3ZZAA 1SPJA 2FOMB 1YBWA 1HJ8A 1NU9A 1A1RA 1SLUB 2ZKSA 1ZTLA 1OP8A 1NY22 1ZZZA 1G32B 3ATWA 2F9PA 1P11E 1YLCA 2OINA 1P02A 2R0LA 1GJ9B 2F9NA 4X8UH 1CHOF 4Y0ZE 1HIAB 1GHAF 3UIRA 1L0ZA 2OBOA 3E91A 3OTJE 1G37A 2J92A 2CF8H 2WV4A 3SJ8A 1SFQB 1VJ9U 3M35A 6ESTA 3TVJB 3RXBA 4BAKB 1NO9H 5DG6A 2CHAC 5L30H 1DY9A 1QHRB 1HAVA 4JZEH 1P2IA 4ZKNU 1TPOA 1AVGH 3QDZB 4DIHH 1THRH 1HPGA 3STIA 1VJAU 4BNRA 1F5RA 4ZXYH 1ELDE 4DW2U 1ZHRA 4KTSA 4UFFH 1YCPK 5JBAS 4WF8A 3GICB 2FX6A 1OWIA 2Z9KA 3QK1A 3ENSB 2P94A 5FAHA 1GDNA 2ZFRH 1Z7KA 1P9SA 1FY5A 1NFWA 5F8XA 5FXLA 1O5CB 2ZPSA 5DP9A 5AFZH 4ABJA 6LPRA 3QWCH 2ZGXH 1C5OH 1SGYE 3E1XB 2XCFA 5GDSH 4ABFA 1AO5A 4K1EA 1TGTA 2C8ZB 3P6ZB 1H4WA 1NRQH 3ZVFA 2OQUA 5GXPA 1NFXA 1KYNA 1GJCB 1QBVH 1HAPH 1ETTH 1UTMA 1GBTA 3FVFB 3UUZA 5A0BA 1B0FA 1O3FA 2RA3A 4X6NA 3UNQA 5CMXH 2BMGB 3LGWA 3BTQE 4LOYH 1O3BA 3SHCH 1UO6A 1K28D 1A0JA 2GT7A 2WPJS 3RXMA 3A88A 3Q3XA 1Z6JH 1TPAE 6GCHG 1QRZA 1NT1A 1C5VA 1AFQC 3RUOA 1WBGB 3FANA 2W5EA 2ZO3H 1CBWB 4OGXA 4HI3A 3E6PH 2BX3A 1HB0B 3BF6H 2FZZA 2F83A 2ZPRA 2ZI2H 1FAXA 2ZU3A 3UTUH 1XKAC 3LGVA 3U8RH 3RMOH 1ZGIA 2RA0A 2PGQB 2BXTH 4Y10E 2VH0A 4ZHMU 1O2WA 5EG4A 2VVUA 1T8MA 3EQ0H 4MPXA 2BYAX 1QNJA 1AB9B 3GCOA 3MO9A 5TCCA 3RXSA 1AI8H 3VB3A 1SGFA 1GBCA 2PGBB 1SQOA 2PHBA 1UVSH 1QY6A 4WH6A 2XBWA 3GOVB 1YPHC 1TNKA 2BVXH 2GP9B 3SO3A 1P2MA 2GX4A 1L1GA 2P59A 3BTFE 3VB4A 1XX9A 1BRCE 3MNCA 1ZSKA 5JDUB 4ABEA 1THSH 2JH0D 4OS5A 1SOTA 3DFLA 4XBDA 2ZIQH 2ZFTA 2TPIZ 5EGMA 3A8CA 1QRWA 3A8DA 3ZZDA 2IPHA 3LJOA 5A0AE 2Z9IA 2R3UA 5JBTA 1IQMA 5DP8A 5EXLA 2ZF0H 4D9RA 3A89A 1GMHG 3SGQE 3CENA 3MMGA 2ZGBH 2WUBA 1BTHH 1GI0A 3O8BA 1KTSB 3GY2A 1WUNH 1O3MA 4IN2A 4AB9A 4UFGH 7GCHF 1O3JA 5E0JA 4OS4A 1AHTH 5GIBA 5SGAE 4GCHG 3U1JB 3ELAH 1FPHH 1BTPA 1E0FD 5ESBA 1G3EA 1QA0A 1DFPA 1QB1A 2HALA 5J4SA 1GBEA 3AASA 4YZUA 1ARCA 3VXFH 1PPEE 4AN7A 3HKIB 3ZV9A 2J34A 4ISIH 4A6LA 3BEIB 1WV7H 1GMCG 5C1UA 1KXEA 2ZGHA 4H6TA 4YLUA 1QA7A 2C90B 4YOGA 1CA0B 1Y5UT 2ZA5A 1F2SE 3MNXA 1TOCB 3O8RA 2BDAA 3K65B 3TNTA 1GI6A 1VZQH 4YO9A 1WQSA 1A3EH 1UHBB 5HGGA 4ZHAA 2BDGA 1PQ8A 1V3XA 5TCAA 4OS2A 2PUXB 4A5TS 3UR6A 2I6SA 2KAIB 2CXVA 2ZHQH 5LH8A 1ZPBA 3EA8A 1HFDA 2Z7FE 3F9EA 1W3CA 4GAWA 1C5QA 1UTOA 1C1UH 3L6PA 4FXGH 4NIVA 3FAOA 5F03A 1A2CH 5HM2A 1O3AA 4Z0KA 1OPHB 2VVVA 3U69H 3QGNB 3VFEA 5C67A 1PYTD 4J1YA 4JMYA 1IQHA 2VWNA 3OYPA 2Q6GA 1H9HE 1TNLA 1XVOA 2PSXA 2QY0B 1BBRE 2BM2A 3QN7A 1K1OA 2UWLA 1HAIH 2ZG0H 1Y3YA 5EW1H 2R3YA 1O33A 4A7IB 1HAOH 4Q7YA 1FAKH 2BOKA 4CRAA 3E16B 1O3GA 2BY7X 2D2DA 1EZSC 4XBCA 2PLXA 3LC5A 3H7OA 6GCHF 1RTKA 3TK5A 1KLTA 2GMTC 1YPKH 4Y11E 3KEEA 3O8DA 1YCPM 5DJ7A 3TJUA 3GDSA 5A0CA 2CF9H 4DOQA 4KTCA 4MG3A 4E7RG 1L1JA 1FV9A 2J95A 3U9AH 5FX6A 1F5LA 3TK6A 3BN9A 4UD9H 1LPKB 2GD4B 2SGFE 1A61H 1EAIA 1XUFA 1HAZB 1UCYH 1TQ0B 3LGUA 2ZCKP 3RDZA 1K2I1 2JETB 3CS0A 1NRRH 2ZP0H 3MU4A 3MU5A 1H8IH 3P95A 1FIZA 5EPNA 2BD7A 4DGJA 1EP5A 1SLXB 4CR9A 1TA6A 1HJAC 5C5OA 4FUGA 4ZKOU 5IDKA 1QRXA 2EA3A 2GVFA 3RU4T 1AE5A 2BD5A 2BDHA 3SNEA 2G55A 2A5AA 1BTYA 2BVRH 1TONA 3F9HA 2XXLA 3E90B 1C4U2 1MU8B 1SOZA 1W7XH 4B2AA 4NWKA 1AVWA 2M5TA 1G2MA 1BRBE 3Q3YA 3HPTB 1BJVA 3MO3A 3P8GA 4X1RU 2ZTZA 1WTGH 1P04A 2Y7XA 1Q3XA 3M3TA 1AB9C 1O39A 1JBUH 1BRAA 3BIVH 2BTCE 3E0PB 4TY6A 3B8JA 1A3BH 1JMOH 3UY9A 1DDJA 1GI1A 4NA8A 2AFQB 2VIOA 4O97A 3EA7A 1QBOA 2CHAB 2FOEA 1DS2E 2PTCE 3ZVAA 1C1VH 5L6NH 2Y5HA 2AERH 2AYWA 1WAYB 3A7YA 3I29A 3GCNA 1GBBA 2NWNA 2G5NA 3SNBA 4JZDH 2A5KA 1ZSJA 3P17H 1LHFH 2ZWLH 4QT8C 1WU1A 3RU4E 1D6WA 1KXCA 3H5CB 1K1JA 1CHOG 1QJ6B 1GHAG 9LPRA 2YOLA 1C5PA 1DXWA 2VH6A 1O3EA 1D3PB 3KQDA 1JXPA 3MO6A 3QO6A 1GMCF 3M5MA 1HJ9A 5C3NA 1TBRH 2H9TH 2ZZUH 4KP0A 4BTTB 1BHXF 2HGTH 3QTOH 3RXGA 5A8XA 3A87A 1FY8E 1DVAH 3MFJA 2OP9A 5EW2H 2XBVA 2C8XB 1KLJH 3LU9B 1FDPA 1AWFH 1MKWH 1LHCH 3A7ZA 2G4UA 2CV3A 1GG6C 5DP5A 4K60A 1UTLM 2QXIA 1TGNA 4K1SA 1XUIA 4FU7A 5ESTE 3UWIA 2BDYA 5T6GA 2FEQH 1QGFA 2BLVA 1V2UT 3M61U 1GCTC 4FUJA 1P2QA 1THPB 2ALPA 2FODA 2EEKA 4AZ2B 3ZZ9A 4FUFA 3A80A 1W7GH 2B5TB 4BAMB 1EZUC 4X1PU 1T8NA 2A2XH 2ANMH 2PR3A 4O03A 1SL3A 1GHZA 1ID5H 3WY8A 1IQEA 4ZAEA 4AB8A 3LDXH 3URCA 3RXLA 3RXRA 1SLWB 3OSYA 1O36A 4DCDA 1O2TA 1FXYA 1X7AC 2FESH 2D1JA 1TRYA 2ZU4A 3EGKH 1P9UA 2VWOA 2ZU1A 4M7GA 2XC4A 2ZCLP 1WYKA 2P3FH 1TNHA 3A7VA 1P2JA 3FFGA 3NK8A 5FBIA 1IOEA 1MTWA 1C1PA 3GY5A 1UK3A 1V2LT 1XVMA 2AEIH 2OUAA 2O8MA 2ZDVH 1GBLA 1UTJA 1BMNH 1BTZA 1VITG 5JPMH 1IQLA 3R0FA 1P03A 3MNSA 5LPFA 1T4UH 1VCPA 1CA8B 1OYTH 2ZFFH 3RXOA 1K1PA 1YPEH 1TYNA 4CHAC 4XDEA 3SNAA 1C2IA 4LZ4B 1GBJA 3RXDA 4Y7AA 2EC9H 3BEUA 1SGRE 3S7HB 2PW8H 1SHYA 1SFIA 1AU8A 4JYTA 3GDVA 3QZRA 2F3CE 2VU8E 2W3IA 1ELCA 4ZKSU 1L1NA 1O5AB 3M5NA 1MZAA 1EAWA 2ANKH 2UUFB 2Q1JA 2VINA 4CBOA 4TY7A 3IITA 2V35A 1AD8H 4AFQA 1MBQA 4D7FA 4INHA 1NS3A 2JETC 2VJ1A 1EB1H 1D4PB 2O8TA 3SI4H 1O2XA 4XFQA 3UREA 2STAE 1QTFA 4FUIA 5GPIB 1GI2A 1ZHMA 1WOFA 5FHTA 2HNTE 1OWHA 1MCTA 2QAAA 1EB2A 2ZFSA 1JIRA 3LKWA 1HIAA 4NFFA 4FUDA 3KN2A 3RM0H 3S69A 1NESE 4I31A 1V2RT 1O3OA 1GBMA 1EATA 1TMBH 1Y3UA 1AIXH 7GCHG 3T27A 2OD3B 1FN6A 3MNBA 3SU2A 3FZZA 1CT2E 2ZDMA 4WY3A 1QFKH 1O2VA 3SN8A 1GMDG 3G01A 1TAWA 1QCPA 3SBKA 4I8LA 4K8YA 1P3CA 3MYWA 4Y8YA 4K5ZA 3NKKA 4NZQA 1BITA 4BAHB 1DUAA 1BMMH 5G4BA 3PMJA 1AFEH 4O3TA 2FX4A 2H5DA 2SNWA 1BJUA 1LKAA 3RXUA 4CRCA 2FPZA 3QLPH 1MTVA 5DP6A 1G3DA 1OYQA 1D3DB 1T4VH 2BDIA 1EQ9A 1O3HA 1XUKA 4B71A 1C2LA 1PPBH 1J15A 3BIUH 1QJ7B 4WMDA 5T6FA 1RD3B 4X2XA 3PMHB 4NZLA 3RXCA 3SUGA 1BMLA 4K69A 1C2DA 2NU2E 4FU8A 2AGEX 2J94A 4INLA 4BAQB 2ZEBA 3RXIA 3ESTA 1P09A 2GV7A 1D6RA 3GY6A 2G8TA 4OS1A 1BMAA 1OWEA 4X6PA 1QJ1B 3I78A 3MI4A 2FP7B 2WYJA 2ZC9H 1UK4A 1NC6A 2OLGA 1BT7A 1AGJA 2NU4E 3V13A 2GMTB 1SSXA 1BHXB 2PFEA 1C1WH 5AF9H 1O35A 3HKJB 3HK6B 3GDUA 1W2KH 1ESBA 1G2LA 3S0NA 1E36B 4IN1A 4K2YA 4RKOB 4XOJA 1XM1A 3N7OA 1OX1A 1MKXH 1YF4A 4RSPA 1Z8IB 4XE4A 3TIUA 4DIIH 1MTSA 4TWYA 4O9VA 2OC8A 1BBRH 1C5TA 4U01A 2SGDE 4UDWH 3LPRA 4X6MA 4R8TB 1MAXA 1OWKA 1EPTC 1O2JA 1HJAB 4NIYA 4CBNA 3MHWU 2O8WA 1RTFB 3BV9B 4Q2KA 1SGIB 3ZZBA 1TX7A 1LPZB 1VITF 1O2QA 1TRNA 1XKBC 2VB0A 4NCYA 4ABIA 4I33A 4UFEH 1GJAB 5EXMA 1DWDH 4GVUA 1ZJKA 4O3UA 3SI3H 2TRMA 2V3OH 2FDAA 1DLKB 1O2RA 2ZDAH 4IMZA 2A4GA 1A0LA 3SU3A 1UCYK 3V0XA 3BSQA 1P06A 1V2ST 2B8OH 1GGDC 3Q76A 2OTVA 1O5BB 4IBLH 5DP3A 3MOCA 3UNSA 1O32A 2A32A 4NSVA 5C1XA 1P05A 5JB8S 1SHHB 4AGKA 2HNTF 3PB1E 3ATLA 1O3IA 2PV9B 3UQOA 1MD8A 4X1QU 4Y0YE 1TOMH 1ZGVA 2A45B 2F9UA 2FI4E 4MQAA 4FVDA 1HV7A 3BTKE 5E2PA 1ELTA 5HXFA 1NROH 1LPGB 2NU0E 4X1SU 5DKMA 1C5LH 4CRBA 4CH8B 2C4FH 1VGCC 5EODA 1C4V2 4FUCA 1M9UA 4IS5A 4R0IA 3VB7A 1GVLA 2GCTC 3LJJA 5BRRE 1C1QA 5CHAC 1Z8GA 2C8WB 1TA2A 1O3DA 2BQWB 5GCHG 4ABGA 1HLTH 4D7GA 4X0WU 3TJVA 1ZJDA 4WWYA 4WMEA 1EJAA 1HRTH 4FU9A 4WH8A 1ESTA 1W10U 2TGAA 1GG6B 1GBAA 4WXVA 1BIOA 2QYIA 3F1SB 1GMDF 1A7SA 1EJMA 1FLEE 2IOTA 5E8EH 3ZVEA 3LGYA 4ISNA 2Q6DA 4ESTE 1UHBA 2QC2A 3A8BA 3UQVA 3PTNA 2EI8A 2O8UA 4BXWA 1FY1A 4Q80A 1S83A 2KAIA 1A0HB 1GVZA 3K9XB 1GCTB 1Y59T 3RP2A 4AFSA 3M5LA 3A81A 1V2QT 4B2BA 5FX5A 1GBIA 1TB6H 4BOHA 1WQVH 3T2NA 2OQ5A 2VWMA 2SGPE 2YNAA 2H2ZA 1ACBE 1PJPA 2TIOA 1ELEE 1UVPA 5EQSA 1O2IA 4CRDA 1C5SA 4MPUA 1MCVA 3RXTA 1GI8B 1C2KA 1OOKB 2G00A 1YYY1 1E37B 2WPHS 1MKWK 1EUFA 2HWLB 3TGIE 1CSOE 4X6OA 2BY5X 1S82A 5GJ4B 3PTBA 2F91A 1LKBA 3A7XA 1YCPH 1C2HA 3B23B 2D26C 2CGAA 1UTKA 3ZZCA 4ASHA 2QGRA 2FOCA 1NFYA 5E2OA 2PTNA 1W0YH 1FNIA 2H5CA 2SFAA 1CU1A 1ELFA 1GI9B 3ATMA 3D65E 1FUJA 1NZQH 3FP8E 2DE8A 4U32A 3RXPA 3SU6A 1GI5A 2CJIA 2C93B 2J38A 4AG2A 4HZHA 3CP7A 1C5ZB 1GHWH 1PQ5A 5A8ZA 2O8LA 1F0SA 2V3HH 1NU7B 1FJSA 1GBFA 1E34B 1W12U 3S9AA 2WPMS 1C5UA 5C20A 3UR9A 2XC5A 1V2OT 4XSKU 4AOQA 4X2VA 3SZNA 1A5IA 2ZECA 2Z6BD 1DY8A 4OS6A 1SGNE 4CHAB 2BXUH 2W7SA 3RXEA 4XBBA 1C1SA 1SGQE 2NU1E 2Y5GA 1TGSZ 2CMYA 2UWOA 3UWJH 1K1MA 1KTTB 1TIOA 1DITH 2GCHF 1O3LA 1XUHA 1LHGH 4TPIZ 2BHGA 1IHTH 1FI8A 2BB4A 1TWXB 1C5RA 1TRMA 1V2VT 2R9PA 5A2MH 1RTLA 4JZIA 1LVYA 2BZ6H 3TH2H 2VIVA 3LOXA 1BA8B 4AORA 2AMDA 1OSSA 1P3EA 5F8ZA 1MQ5A 5ETXA 4JK6A 4AX9H 3RU4D 2ZCHP 1K9OE 1VR1H 1S0RA 3D62A 1HXFH 1NRPH 1Z71A 1B7XB 5FCRA 3TJNA 1O30A 1C5XB 2J9NA 3KNXA 2ZU5A 5HMAA 1HAXB 4B1TA 3DD2H 1L4ZA 2GZ7A 1BTXA 2A0QB 3LC3A 3MU1A 2UUJB 2VGCC 2F9BH 1O2ZA 3SNCA 2BDCA 3SW2B 1LVMA 1AMHA 1O37A 4I8HA 1NN6A 1VITH 3SQHE 3DFJA 4B75A 1GJ4H 1PPGE 2R2WU 1WCZA 2XWBI 4SGBE 3BTTE 1LHEH 3LGIA 2C8YB 3ZZ4A 5DO4H 1V2PT 2BLWA 1SGPE 2XNIA 2TBSA 1F92A 1BUIA 2FTMA 1GHVH 2AGGX 1MAYA 1DM4B 3MH7A 4ZUHA 2QF0A 5GCHF 1O34A 2SNVA 2FOFA 5C2ZA 2BY6X 4I8GA 2FS8A 1F7ZA 4X8TH 1GWAA 1GJBB 1ABIH 1DX5M 1HAGE 3M7UA 3LT3A 4ABDA 1W13U 1DSTA 4GHQA 4ISLA 2QXJA 4HTCH 2A4RA 5LGOA 2XRCA 4JYVH 1UVTH 3KQEA 1RFNA 2FI3E 3SU4A 2Y81A 4AGJA 3D49H 3TU7H 1N1LA 3SQEE 3NPSA 2ODQA 1QBNA 1ANCA 2QA9E 3T26A 2I6QA 1TBQH 3P8FA 4D8NA 3F68H 1H1BA 1UK2A 4KTUA 4X2YA 2HVXA 4BANB 3SJOA 1CE5A 1ANDA 3R3GB 4NWLA 1C2GA 2F9OA 2O9QA 3RXQA 1O3KA 1J17T 3MH4A 3QZQA 1L4DA 1NRNH 3DHKH 2FYRA 3M3SA 3DA9B 3VGCC 1UVOA 2PKAB 1GI7B 3RC5A 1T8LA 4GLYA 4E7NA 1O3NA 1MUEB 1IQFA 4ABBA 5AVDA 1J16A 3NUMA 3P8NA 2A7HA 3DUXH 1G36A 1SBWA 1LHDH 1Y3WA 3UPEA 1ANBA 1O38A 5AHGH 1RIWC 2LNCA 3QX5H 1EAUA 1FQ3A 1ESAA 4ISHH 1EP6A 1B0EA 4MNYA 2IN2A 5E0GA 1BB0B 3C1KA 1GCDA 1AUJA 2Q6FA 1DWBH 1DXPA 1C2MA 3NCLA 1P12E 3BTGE 1S6HA 1EPTB 1PPHE 3TK9A 3RXHA 1C5NH 3ZYEA 3M7TA 1DUEA 4DT7B 1WSSH 2C3SA 1LO6A 3SHAH 1A46H 3KF2A 2A5IA 1KDQB 4B74A 1CGIE 1PPFE 4INKA 3TGJE 1AVXA 4H42U 3A8AA 4WVPE 1GHBG 2CN0H 2FIRH 1KXBA 3CS7A 4THNH 4CR5A 2QV1A 2LPRA 4DVAU 5DP4A 1HXEH 1IQIA 1C1NA 4KKDA 1SGCA 4YESB 2ZGCA 4Q7ZA 1GGDB 3Q77A 5FPSA 3U98H 2EI7A 1PPCE 1BCUH 1BBRK 3RC6A 4I8JA 2Y80A 3VB5A 2BZAA 4KGAA 2BD9A 3SOSA 1EOLA 1P8VC 3K6ZA 1GHYH 1SB1H 4JZFH 3TITA 1HDTH 3URDA 1F5KU 1O3PB 2H9HA 3RC4A 3KQCA 1DSUA 2RCEA 3K2UA 4NIXA 4Y8ZA 3RMNH 5LPEA 1IQGA 1O31A 4A1VA 1VGCB 1ZR0A 5JBCS 1SGEE 1MD7A 1TPPA 5EXNA 3BEFB 1QURH 2Y82A 2GCTB 4LZ1H 2Z3EA 1RXPA 3JZ1B 2ZHFH 3HGNA 5CHAB 2ZU2A 3K6YA 1S6FA 6CHAC 2ZFQH 8GCHF 3EDXB 3A85A 1EXFA 2V6NA 4UONA 4YM9A 1YLDA 9ESTA 5T6DA 1CT0E 1AN1E 1Y5BT 2ZHDA 5HYOA 3S7KB 1AKSB 2AMPA 5A09A 1TX6A 4LXBH 1N8OC 3U8TH 2FOBA 3PWBA 3RMMH 1ZPZA 3EA9A 4Y7BA 1C1MA 4D76A 4B73A 1C5WB 1JRSA 1T7CA 1V2NT 2BDBA 2XBXA 4GSOA 1K1IA 4JZ1A 1NTPA 4VGCC 5EPYA 3F9GA 3JZ2B 1N6YA 1AZZA 5IYTA 4WMFA 5C5NA 2XCNA 2FTLE 1PPZA 2FYQA 2A7JA 2W3KA 3KIDU 2RG3A 5EQQA 3S9CA 3ZVBA 3Q3KA 1C9TA 4MTBA 1EZQA 4NFEA 3RXVA 1Z6EA 1TPSA 4H4FA 4NSYA 1HAHH 4ISOA 1LQEA 3ZZ6A 1NFUA 2JH6D 1OXGA 3RXKA 2AMQA 3OU0A 2HRVA 4IC5A 3SV8A 2Z3CA 2A7CA 4Y8XA 2H6MA 1AUTC 1N6XA 1MBMA 4ZMAH 2P16A 1GDQA 3E8LA 4TYDA 2HNTC 3P92A 2ZQ2A 3SGBE 1IHSH 1YPGH 1NPMA 5K0HA 3TJOA 1A5GH 1HNEE 2BLQA 1PQ7A 2D8WA 3D23A 1GL0E 4K8BA 4OS7A 2BD8A 2YNBA 2AS9A 1V2WT 4FUEA 1P57B 1CT4E 1EAXA 1LQDB 1MMJN 1Y8TA 3KGPA 8KME2 3HK3B 2WPKS 3AW0A 1ZPCA 4MNXA 1MTNC 1C1TA 2BX4A 1C1RA 2OBQA 5AFYH 3SGAE 4MPWA 3FZDA 3L3TA 5DP7A 3SV9A 4WJG2 1S85A 2J2UA 4IW4E 5F8TA 3M3VA 3MH6A 1HAVB 2ESTE 3OX7U 3NXPA 4K3JA 4JK5A 4YT6H 1DT2A 2B9LA 2G52A 3GY7A 1ELGA 4X8VH 2P8OC 1GHBF 1V2KT 4IGDA 1TQ7B 3OY6U 5A8YA 2G51A 5PTPA 2UUKB 3VB6A 1Y3XA 2GDDA 2XWAA 3B9FH 3UOUA 4NIWA 1G3BA 3A82A 3QTVH 2GCHG 1ANEA 2FMJA 3A84A 7LPRA 5ABWA 1KXAA 4AFZA 5JYIA 2XYAA 5JB9S 2A31A 1HYLA 2VGCB 4YOIA 2FXRA 5C1YA 2BOHB 2A4OA 4JYUH 4GPGA 1OWJA
chains in the Genus database with same CATH superfamily
1TALA 1YPHE 1UTQA 1JIMA 4ZKRU 3ZYDA 4U2WA 2FOHA 1W14U 1HCGA 4U30A 1KSNA 4Q4LA 4NG9H 2ZFPH 1DLEA 1ZTJA 4F49A 1YM0A 3KQBA 2GGVB 3LH3A 8ESTE 1ELAA 4UFDH 4TPYA 4GHTA 2STBE 1D9IA 5FCKA 2BD3A 1YPLH 1ZOMA 2H9EH 1QB6A 3ODFA 1TGCA 4H6SB 2NU3E 1O2GH 4IMQA 2G81E 3EYDA 3RMLH 2ASUB 2BLOA 2WPLS 1QQ4A 1TMTH 2VIDA 1SGTA 2FM2A 3RM2H 1XXDA 1ZRBA 2FWWA 2VIQA 3DSPA 2W7UA 1K21H 2OCVB 1QL8A 3FP6E 1GBHA 3AAVA 3KHVA 2VIPA 5J4QA 1ZSLA 1YPMH 1QB9A 1OS8A 3MU0A 2ZHEH 3HGPA 1C4Y2 1LTOA 4MDSA 2Z9GA 1Q31A 1ZYOA 5C0UA 3BTDE 1AE8H 1ELBA 4Y71A 2WV5A 1J9CH 3UOPA 1QR3E 1TGBA 3TH4H 4B6FA 1AWHB 1AQ7A 1Z8JB 2ALVA 2B0FA 4AYYB 3PO1C 4X8SH 1Z1JA 2QXGA 1FMGA 2VIWA 2VNTA 2TGPZ 3N99A 4HFPB 3VGCB 2A1DB 1FN8A 1MABB 3ZVGA 4X1NU 3GCTF 4BTIB 2HPPH 4UE7H 1KIGH 2ANWA 3SZEA 2V0BA 1SGDE 4ZXXH 1SLVB 1C1OA 1IQJA 1FIWA 1C5YB 1ZTKA 1GBKA 1UTNA 4DG4A 5C17A 3KCGH 1LVOA 3GCHC 2UWPA 2ZQ1A 3SJ9A 3H7TA 2AIQA 3TNSA 1TBZH 1RIWB 4TT3D 4A1TA 1O5FH 1TX8A 3SU5A 2GZ8A 3BG4C 3URDA 3I77A 4CRFA 3SORA 5DK1A 4MNVA 1O2KA 2SGAA 2WYGA 4WXIA 4FVBA 4Z1MD 1BDAA 4CH2B 2Y5FA 1SI5H 5H4IB 2HLCA 3ZZ7A 3AW1A 1DWCH 3F9FA 2Z9JA 3LONA 4OM9A 1ZMJA 4RN6A 1DPOA 1YKTA 1GJ7B 2OC1A 2ILNA 1BTUA 1P0SH 1O5DH 4GUXA 2AGIX 1O2MA 3AVZA 5EOKA 1T31A 3RLYH 5HM9A 2K0QA 1LMWB 1F0UA 1GL1A 3BTEE 2PKSB 2AH4X 1K22H 3BG8A 2H1UA 4RT0A 1O5EH 1PFXC 1XUGA 1W0ZU 2V3MA 2PUQH 1SMFE 1GJDB 1TMUH 3PLKA 3SJKA 3A7TA 3SU1A 1DANH 1TABE 1ETSH 3PV4A 5CE1A 2ODYB 3LIWA 2P3UB 3PROA 5TJXA 5FPTA 1F0TA 4OGYA 4YLQH 1J8AA 1K1LA 2QN5T 4KELA 1ZHPA 2DUCA 1BZXE 3E3TA 3TLOA 5JBBS 3S9BA 1NRSH 1RJXB 2ZGJA 2GZ9A 3T5FH 4SGAE 2EI6A 5B6OA 3L33A 2BD2A 1Q2WA 1CHGA 3ZVDA 1UTPA 1T32A 3EAJA 1ZLRA 1ZMLA 7ESTE 1XUJA 1SVPA 1EZXC 1MU6B 3ZZ3A 5KGOA 1JWTA 4RKJB 1MTUA 3SUDA 4D9QA 5B6LA 5I46H 1AY6H 4B2CA 3ZZ8A 6CHAB 1TLDA 2FO9A 1HBTH 4LK4A 1KLIH 1GPZA 3QGJA 1U6QA 3C27B 1GBDA 3GY3A 5L2YH 3A7WA 1BTWA 4ZHLU 1GI3A 4E06H 3ATIA 1XMNB 1O2SA 4A1XA 1E35B 2HPQH 2FI5E 4E05H 2ZDKA 4AFUA 2ZDNA 2FLBH 2QF4A 2WPIS 1CQQA 1MQ6A 1N8OB 3W95A 3ZV8A 1O2UA 3O8CA 1SQRA 3V12A 4FUHA 1G3CA 1SR5C 1GJ5H 3IG6B 2G5VA 3MH5A 1QL9A 1OP2A 4VGCB 3UFAA 8GCHG 1SGFG 2G4TA 4K1TA 1DICA 1O3CA 3OTPA 1ABJH 1CBWC 1OKXA 3KL6A 3T62A 3PLBA 1ZRKA 2P93A 2TGDA 3RXJA 4ABAA 4Y6DA 5L2ZH 2FS9A 1T8OA 3T28A 1O2NA 2Z3DA 3GYMA 4FUBA 1Y5AT 3RXAA 2QCYA 1YC0A 3ATKA 5F6MA 2UUYA 2VWLA 3V7TA 2OC7A 2A4QA 3SUFA 3PYHA 3NZIA 3CNRA 5GWZA 4JCNA 1V6DA 1UJ1A 2FLRH 2VVCA 5DPAA 1P2OA 1SQAA 4MVNA 3BTHE 1IAUA 4TWWA 2WZQA 2SGQE 3BTWE 3UB0A 4Y79A 3VEQB 2XC0A 1F0RA 2F4LA 3T29A 4F55A 1G9IE 1LCYA 3NWUA 1HAYB 3PM3A 1GMHF 1BQYA 2PKAA 3SNDA 3SV2H 1KY9A 1QZ8A 1SC8U 1EX3A 4F4OC 3VXEH 1S5SA 1GVKB 2PWXA 1PYTC 2PSYA 2QIQA 1TNIA 1LVBA 2RDLA 3MU8A 4GCHF 1QL7A 1L2EA 3M37A 3RXFA 5I25A 1C2JA 4Z6AH 1EASA 2FOGA 1RGQA 3PMAB 1MTNB 1OP0A 5FPYA 1C9PA 1Y3VA 1PQAA 2P3TB 4YT7H 1IQKA 1G30B 3N7EA 5EQRA 3GYLB 1EPTA 2W26A 3W94A 1JOUB 2Z94A 4A92A 2JDID 1NM6A 2EQNA 3EE0B 1O2OA 1ARBA 4NA7A 1MH0A 3VPKA 2SGEE 1EOJA 1KDQA 2QXHA 3P8OA 1D3TB 2YMSC 1UMAH 2P8OB 1S6LA 1S84A 2Y6TA 3WWBA 1S81A 1O0DH 2Y7ZA 2GTBA 1H8DH 3ZZ5A 2BY9X 3ITIA 1QQUA 2GKVE 4CRGA 1WTHD 4X2WA 3M7QA 1DOJA 1SQTA 4IC6A 3PLPA 1GJ8B 2FOAA 2WUCA 1S0QA 1Z1IA 1FY4A 4DURA 1C2FA 1TNJA 1DWEH 3V3MA 1KXFA 4BTUB 3GISB 3U8OH 3SYJA 3M36A 1C2EA 1GHXH 1CA0C 1AFQB 1EFRD 1W8BH 1VCQA 1P01A 2AIPA 2ANYA 2XTTB 1KXDA 4UEHH 1ZMNA 2A2QH 2OC0A 5T3HA 1UVUH 3SU0A 1ORFA 2Z9LA 3M5OA 1D3QB 1GDUA 3A86A 1MKXK 3BTME 4NGAH 2PKSC 2TGTA 3HATH 2WINI 3P70B 1O2PA 1V2TT 3SV7A 4CREA 3TGKE 1A5HA 1YGCH 2R0KA 1EJNA 1O2YA 4DY7B 1EKBB 2OXSA 4ABHA 2ULLA 1YP9A 2XW9A 2ZPQA 1FONA 1MZDA 4MPVA 1ELVA 1H9LB 1CVWH 3SUEA 5EU8A 2JKHA 1H9IE 3PWCA 1E38B 1UCYE 3MTYA 3SJIA 2GT8A 4Y76A 4FETA 3LGTA 1FPCH 2ZNKH 4AYVB 2BQ6B 1JRTA 1Z8RA 3PMBB 1TFXA 1RS0A 3OY5U 1DE7H 1IQNA 4HGCA 2GDEH 1BOQA 2XBYA 3DCLA 1H8HD 2F9VA 1AKSA 5BPEA 4YTAA 2GV6A 3FN8A 1RRKA 1CGJE 3T25A 1BRUP 3STJA 1INCA 4I32A 3TH3H 1J14A 4NA9H 2K1QA 1TE0A 4Q7XA 4J2YB 3PO1B 4MLFB 1GJ6A 4ZH8A 3F6UH 3QUMP 3ZVCA 2DE9A 2J4IA 2JH5D 2ZHWH 1HUTH 4I8KA 5K7RA 1W11U 3UNRA 1GI4A 4B76A 3E0NB 1YLNA 4MNWA 1QIXB 3GY8A 3TPIZ 1O2HA 5LPRA 1V2MT 2HOBA 1O5GH 2R2MB 1A4WH 1P10A 3LH1A 3Q00A 2P95A 3GCHB 2B7DH 1CO7E 1O2LA 1ETRH 2KCOA 3FP7E 1C5MD 1TNGA 4DJZB 1SG8B 1P2KA 2BD4A 4YOJA 3RLWH 2ZDLA 1OWDA 1AZ8A 3BG4B 2WV9A 2QE7D 3GY4A 4BXSA 3N7DA 1CGHA 2ODPA 2BY8X 1VCWA 5DGJA 5FBEA 4ZROA 1XXFA 1HGTH 2WHXA 5HIZA 1FZZA 7KMEH 3AAUA 3A83A 3GCTG 2BQ7B 5E0HA 3UAIC 3SV6A 1B5GH 1P2NA 3DT0H 8LPRA 3ODDA 2IJOB 4B6EA 2ZTXA 2BVSH 4I7YH 1YPJH 1V2JT 3U1IB 2QF3A 2THFB 2ZTYA 3IWMA 4ACAA 3MWIU 4AG1A 1LDTT 1FY3A 4BAOB 4PROA 1K1NA 3ZZAA 1SPJA 2FOMB 1YBWA 1HJ8A 1NU9A 1A1RA 1SLUB 2ZKSA 1ZTLA 1OP8A 1NY22 1ZZZA 1G32B 3ATWA 2F9PA 1P11E 1YLCA 2OINA 1P02A 2R0LA 1GJ9B 2F9NA 4X8UH 1CHOF 4Y0ZE 2F43B 1HIAB 1GHAF 3UIRA 1L0ZA 2OBOA 3E91A 3OTJE 1G37A 2J92A 2CF8H 2WV4A 3SJ8A 1SFQB 1VJ9U 3M35A 6ESTA 3TVJB 3RXBA 4BAKB 1NO9H 5DG6A 2CHAC 5L30H 1DY9A 1QHRB 1HAVA 4JZEH 1P2IA 4ZKNU 1TPOA 1AVGH 3QDZB 4DIHH 1THRH 1HPGA 3STIA 1VJAU 4BNRA 1F5RA 4ZXYH 1ELDE 4DW2U 1ZHRA 4KTSA 4UFFH 1YCPK 2IPQX 5JBAS 4WF8A 1W0KD 3GICB 2FX6A 1OWIA 2Z9KA 3QK1A 3ENSB 2P94A 5FAHA 1GDNA 2ZFRH 1Z7KA 1P9SA 1FY5A 1NFWA 5F8XA 2AHME 1O5CB 2ZPSA 5FXLA 5DP9A 5AFZH 4ABJA 6LPRA 3QWCH 4I86A 2ZGXH 1C5OH 1SGYE 3E1XB 2XCFA 5GDSH 4ABFA 1AO5A 4K1EA 1TGTA 2C8ZB 3P6ZB 1H4WA 1NRQH 3ZVFA 2OQUA 5GXPA 3FO8D 1NFXA 5HKKD 1KYNA 1GJCB 5T1VA 1QBVH 3FOAA 1HAPH 1ETTH 1UTMA 1GBTA 3FVFB 3UUZA 5A0BA 1B0FA 1O3FA 2RA3A 4X6NA 3UNQA 5CMXH 2BMGB 3LGWA 3BTQE 4LOYH 1O3BA 3SHCH 1UO6A 1K28D 1A0JA 2GT7A 2WPJS 3RXMA 3A88A 3Q3XA 1Z6JH 1TPAE 6GCHG 1QRZA 1NT1A 3OEHD 1C5VA 1AFQC 3RUOA 1WBGB 3FANA 2W5EA 2ZO3H 1CBWB 4OGXA 4AC9A 2RDEA 4HI3A 3E6PH 2BX3A 1HB0B 3BF6H 2FZZA 2F83A 1WDIA 2ZI2H 2ZPRA 1FAXA 2ZU3A 3UTUH 1XKAC 3LGVA 3OE7D 3U8RH 3RMOH 1ZGIA 2RA0A 2PGQB 2BXTH 4Y10E 2VH0A 4ZHMU 1O2WA 5EG4A 2VVUA 1E1RD 1T8MA 2LELA 3EQ0H 4MPXA 2BYAX 1QNJA 1AB9B 5KECA 3GCOA 3MO9A 5TCCA 3RXSA 1AI8H 3VB3A 1SGFA 1GBCA 2PGBB 1SQOA 2PHBA 1UVSH 1QY6A 4WH6A 2XBWA 3GOVB 1YPHC 1TNKA 2BVXH 2GP9B 3SO3A 1P2MA 2GX4A 1L1GA 2P59A 3BTFE 3VB4A 1XX9A 1BRCE 3MNCA 1ZSKA 5JDUB 4ABEA 1THSH 2PP6A 2JH0D 4OS5A 1SOTA 3DFLA 4XBDA 2ZIQH 2ZFTA 2TPIZ 5EGMA 3A8CA 5DSFA 1QRWA 3A8DA 3ZZDA 2IPHA 3LJOA 5A0AE 2Z9IA 2R3UA 5JBTA 1IQMA 5DP8A 5EXLA 2ZF0H 4D9RA 3A89A 1GMHG 3SGQE 3CENA 3MMGA 2ZGBH 1E79D 2WUBA 1BTHH 1GI0A 3O8BA 1KTSB 3GY2A 1WUNH 1O3MA 4IN2A 4AB9A 4UFGH 7GCHF 1O3JA 5E0JA 2YMSB 4OS4A 1AHTH 5GIBA 5SGAE 4GCHG 3U1JB 1FX0B 1FPHH 1BTPA 3ELAH 1E0FD 5ESBA 1G3EA 5FL7D 1QA0A 1DFPA 1QB1A 2HALA 5J4SA 1GBEA 3AASA 4YZUA 1ARCA 3VXFH 1PPEE 4AN7A 3HKIB 3ZV9A 2J34A 4ISIH 4A6LA 3BEIB 1WV7H 1GMCG 2JJ1D 5C1UA 1KXEA 2ZGHA 4H6TA 4YLUA 1QA7A 2C90B 4YOGA 1CA0B 2WPDD 1Y5UT 2ZA5A 1F2SE 3MNXA 2KX4A 1TOCB 3O8RA 2BDAA 3K65B 3TNTA 1GI6A 1VZQH 4YO9A 1WQSA 1A3EH 1UHBB 5HGGA 4ZHAA 2BDGA 1PQ8A 1V3XA 5TCAA 4OS2A 2PUXB 4A5TS 3UR6A 2I6SA 2KAIB 2CXVA 2ZHQH 5LH8A 1ZPBA 3EA8A 1HFDA 1OHHD 2Z7FE 3F9EA 1W3CA 4GAWA 1C5QA 1UTOA 1C1UH 3L6PA 4FXGH 4NIVA 3FAOA 5F03A 1A2CH 5HM2A 1O3AA 4Z0KA 1OPHB 2VVVA 3U69H 3QGNB 3VFEA 5C67A 1PYTD 4J1YA 4JMYA 1IQHA 2VWNA 3OYPA 2Q6GA 1H9HE 1TNLA 1XVOA 2PSXA 2QY0B 1BBRE 2BM2A 3QN7A 1K1OA 2UWLA 1HAIH 2ZG0H 1Y3YA 5EW1H 2R3YA 1O33A 4A7IB 1HAOH 4Q7YA 5F53A 1FAKH 2BOKA 4CRAA 3E16B 1O3GA 2BY7X 2D2DA 1EZSC 4XBCA 2PLXA 3LC5A 3H7OA 6GCHF 1RTKA 3TK5A 1KLTA 2GMTC 1YPKH 2YMSD 3EE7A 4Y11E 3KEEA 3O8DA 1YCPM 5DJ7A 3TJUA 3GDSA 5A0CA 2CF9H 4DOQA 3KYGA 4KTCA 4MG3A 4E7RG 1L1JA 1FV9A 2J95A 3U9AH 5FX6A 1F5LA 3TK6A 3BN9A 4UD9H 1LPKB 2GD4B 2SGFE 1A61H 2KFWA 1EAIA 1XUFA 1HAZB 1UCYH 1TQ0B 3LGUA 2ZCKP 3RDZA 3MQKC 1K2I1 2JETB 2VBCA 3CS0A 1NRRH 2ZP0H 3MU4A 3MU5A 1COWD 1H8IH 3P95A 1FIZA 4ZCNA 5EPNA 2BD7A 4DGJA 1EP5A 1SLXB 4CR9A 1TA6A 1HJAC 5C5OA 4FUGA 4ZKOU 5IDKA 1QRXA 2EA3A 2GVFA 3RU4T 1AE5A 2BD5A 2BDHA 3SNEA 2G55A 2A5AA 1BTYA 2BVRH 1TONA 3F9HA 2XXLA 3E90B 1SKYE 1C4U2 1MU8B 1SOZA 1W7XH 4B2AA 4NWKA 1AVWA 2M5TA 1G2MA 1BRBE 3Q3YA 3HPTB 1BJVA 3MO3A 3P8GA 4X1RU 2ZTZA 1WTGH 1P04A 2Y7XA 5C94A 1Q3XA 3M3TA 1AB9C 1O39A 1JBUH 1BRAA 3BIVH 2BTCE 3E0PB 4TY6A 3B8JA 1A3BH 1JMOH 3UY9A 1DDJA 1GI1A 4NA8A 2AFQB 2VIOA 4O97A 3EA7A 1QBOA 2CHAB 2FOEA 1DS2E 2PTCE 3ZVAA 1C1VH 5L6NH 2Y5HA 2AERH 2CK3D 2AYWA 1WAYB 3A7YA 3I29A 3GCNA 1GBBA 2NWNA 2G5NA 3SNBA 4JZDH 2A5KA 1ZSJA 3P17H 1LHFH 2ZWLH 4QT8C 1WU1A 3RU4E 1D6WA 1KXCA 3H5CB 1K1JA 1CHOG 1QJ6B 1GHAG 9LPRA 2YOLA 1C5PA 1DXWA 2VH6A 1O3EA 1D3PB 3KQDA 1JXPA 3MO6A 3QO6A 1GMCF 3M5MA 1HJ9A 5C3NA 1TBRH 2H9TH 2ZZUH 4KP0A 4BTTB 1BHXF 2HGTH 3QTOH 3RXGA 5A8XA 4HG6A 3A87A 1FY8E 1DVAH 3MFJA 2OP9A 5EW2H 2XBVA 2C8XB 1KLJH 3LU9B 1FDPA 1AWFH 1MKWH 1LHCH 3A7ZA 2G4UA 2CV3A 1GG6C 5DP5A 4K60A 1UTLM 2QXIA 2L6OA 1TGNA 4K1SA 1XUIA 5EJ1A 4FU7A 5ESTE 3UWIA 2BDYA 3WWFA 5T6GA 2FEQH 1QGFA 2BLVA 1V2UT 3M61U 1GCTC 2KCPA 4FUJA 1P2QA 1THPB 2ALPA 2FODA 2EEKA 4AZ2B 3F2GA 3ZZ9A 4FUFA 3A80A 1W7GH 2B5TB 2JIZD 4BAMB 1EZUC 4X1PU 1T8NA 2A2XH 2ANMH 2PR3A 4O03A 1SL3A 1GHZA 1ID5H 3WY8A 1YWUA 1IQEA 4ZAEA 4AB8A 3LDXH 3URCA 3RXLA 3RXRA 1SLWB 5HIYA 3OSYA 1O36A 4DCDA 1O2TA 1FXYA 1X7AC 2FESH 2D1JA 1TRYA 2ZU4A 3EGKH 2WSSD 1P9UA 2EY4C 2VWOA 2ZU1A 2J97A 4M7GA 2XC4A 2ZCLP 1WYKA 2P3FH 1TNHA 3A7VA 1P2JA 3FFGA 3NK8A 5FBIA 1IOEA 1MTWA 1C1PA 3GY5A 1UK3A 1V2LT 1XVMA 2AEIH 2OUAA 2O8MA 2ZDVH 1GBLA 1UTJA 1BMNH 1BTZA 1VITG 5JPMH 1IQLA 3R0FA 1P03A 3MNSA 5LPFA 1T4UH 1VCPA 1CA8B 1OYTH 2ZFFH 3RXOA 1K1PA 1YPEH 1TYNA 4CHAC 4XDEA 3SNAA 1C2IA 4LZ4B 1GBJA 3RXDA 4Y7AA 2EC9H 3BEUA 2KM0A 1SGRE 3S7HB 2PW8H 1SHYA 1SFIA 1AU8A 4JYTA 3GDVA 3QZRA 2F3CE 2VU8E 2W3IA 1ELCA 4ZKSU 1L1NA 1O5AB 3M5NA 1MZAA 1EAWA 2ANKH 2UUFB 2Q1JA 2VINA 4CBOA 4TY7A 3IITA 2V35A 4F48B 2HVYB 1AD8H 2J98B 4AFQA 2KZ4A 1MBQA 4D7FA 4INHA 1NS3A 2JETC 2VJ1A 1EB1H 1D4PB 2O8TA 3SI4H 1O2XA 4XFQA 3UREA 2STAE 2OK5A 1QTFA 4FUIA 5GPIB 1GI2A 1ZHMA 1WOFA 5FHTA 2HNTE 1OWHA 1MCTA 2QAAA 1EB2A 2ZFSA 1JIRA 3LKWA 1HIAA 4NFFA 4FUDA 3KN2A 3RM0H 3S69A 1NESE 4I31A 1V2RT 1O3OA 1GBMA 1Y3UA 1EATA 1NBME 1TMBH 1AIXH 7GCHG 3T27A 2OD3B 1FN6A 3MNBA 3SU2A 3FZZA 1CT2E 2ZDMA 4WY3A 1QFKH 1O2VA 3F2HA 3SN8A 1GMDG 3G01A 1TAWA 1QCPA 2QF5A 3SBKA 4I8LA 2RFKC 4K8YA 1P3CA 3MYWA 4Y8YA 4K5ZA 3NKKA 4NZQA 1BITA 4BAHB 1DUAA 1BMMH 5G4BA 3PMJA 1AFEH 4O3TA 2FX4A 2H5DA 2SNWA 1BJUA 4P02A 1LKAA 3RXUA 4CRCA 2HLDD 2FPZA 3QLPH 1MTVA 5DP6A 1G3DA 1OYQA 1D3DB 1T4VH 2BDIA 4P00A 1EQ9A 1O3HA 1XUKA 4B71A 1C2LA 1PPBH 1J15A 3BIUH 1QJ7B 4WMDA 5T6FA 1RD3B 4X2XA 3PMHB 4NZLA 3RXCA 3SUGA 1BMLA 4K69A 1C2DA 2NU2E 4FU8A 2AGEX 2J94A 4INLA 4BAQB 2ZEBA 3RXIA 3ESTA 1P09A 2GV7A 1D6RA 2LP6A 3GY6A 2G8TA 4OS1A 1BMAA 1OWEA 4X6PA 1QJ1B 3I78A 3MI4A 2FP7B 2WYJA 2ZC9H 1UK4A 1NC6A 2OLGA 1BT7A 1AGJA 2NU4E 3V13A 2GMTB 1SSXA 1BHXB 2PFEA 1C1WH 5AF9H 1O35A 3HKJB 3HK6B 3GDUA 1W2KH 1ESBA 1G2LA 3S0NA 1E36B 4IN1A 5IK2D 4K2YA 3WW7A 4RKOB 4XOJA 1XM1A 3N7OA 1OX1A 1MKXH 1YF4A 4RSPA 3VG8A 1Z8IB 4XE4A 3TIUA 4DIIH 1MTSA 4TWYA 4O9VA 2OC8A 1BBRH 1C5TA 4U01A 2SGDE 4TSFD 4UDWH 3F3BA 3LPRA 4X6MA 4R8TB 1MAXA 1OWKA 1EPTC 1O2JA 1HJAB 4NIYA 4CBNA 3MHWU 2O8WA 1RTFB 3BV9B 4Q2KA 1SGIB 3ZZBA 1TX7A 1LPZB 1VITF 1O2QA 1TRNA 1XKBC 2VB0A 4NCYA 4ABIA 4I33A 3AK5A 4UFEH 1GJAB 5EXMA 1DWDH 4GVUA 1ZJKA 4O3UA 3SI3H 2TRMA 2V3OH 2FDAA 1DLKB 1O2RA 2ZDAH 4FOUC 2A4GA 1A0LA 4IMZA 3SU3A 1KMHB 1UCYK 3V0XA 3BSQA 1P06A 1V2ST 2B8OH 1GGDC 3Q76A 2OTVA 1O5BB 4IBLH 5DP3A 3MOCA 2KCYA 1O32A 3UNSA 2A32A 4NSVA 5C1XA 1P05A 5JB8S 1SHHB 4AGKA 2HNTF 3PB1E 3PV5A 3ATLA 1O3IA 2PV9B 3UQOA 1MD8A 4X1QU 4Y0YE 1TOMH 1ZGVA 2A45B 2F9UA 2FI4E 4MQAA 4FVDA 1HV7A 3BTKE 5E2PA 1ELTA 5HXFA 1NROH 1LPGB 2NU0E 4X1SU 5DKMA 1C5LH 4CRBA 4CH8B 2C4FH 1VGCC 5EODA 1C4V2 4FUCA 1M9UA 4IS5A 4R0IA 3VB7A 1GVLA 2GCTC 3LJJA 5BRRE 3DSOA 1C1QA 5CHAC 1Z8GA 2C8WB 1TA2A 1O3DA 2BQWB 5GCHG 4ABGA 1HLTH 4D7GA 3H09A 4X0WU 3TJVA 1ZJDA 4WWYA 4WMEA 1EJAA 1HRTH 4FU9A 4WH8A 1ESTA 1W10U 2TGAA 1GG6B 1GBAA 4WXVA 1BIOA 2QYIA 3F1SB 1GMDF 5KEDA 1A7SA 1EJMA 1FLEE 2IOTA 5E8EH 3ZVEA 3LGYA 4ISNA 2Q6DA 4ESTE 1UHBA 2QC2A 3A8BA 3UQVA 3PTNA 2EI8A 2O8UA 4BXWA 1FY1A 4Q80A 1UW7A 1S83A 2KAIA 1A0HB 1GVZA 3K9XB 1GCTB 1Y59T 3RP2A 4AFSA 3M5LA 5EIYA 3A81A 1V2QT 4B2BA 5FX5A 1GBIA 1TB6H 4BOHA 1WQVH 3T2NA 2OQ5A 2VWMA 2SGPE 2YNAA 2H2ZA 1ACBE 1PJPA 2TIOA 1ELEE 1UVPA 5EQSA 1O2IA 3NRLA 1C5SA 4MPUA 4CRDA 1MCVA 3RXTA 1GI8B 1C2KA 1OOKB 2G00A 1YYY1 1E37B 2WPHS 1MKWK 1EUFA 4RT1A 2HWLB 3TGIE 1CSOE 4X6OA 2BY5X 1S82A 5GJ4B 3PTBA 2F91A 1LKBA 3A7XA 1YCPH 1C2HA 3B23B 2D26C 2CGAA 2GJGA 1UTKA 3ZZCA 4ASHA 2QGRA 1VKYA 2FOCA 1NFYA 5E2OA 2PTNA 1W0YH 1FNIA 2H5CA 2SFAA 1CU1A 1ELFA 4DT4A 1GI9B 3ATMA 3D65E 1FUJA 1NZQH 3FP8E 2DE8A 4U32A 3RXPA 3SU6A 1GI5A 2CJIA 2C93B 2J38A 4AG2A 4HZHA 3CP7A 1C5ZB 1GHWH 1PQ5A 5A8ZA 2O8LA 1F0SA 2V3HH 1NU7B 1FJSA 1GBFA 1E34B 1W12U 3S9AA 2WPMS 1C5UA 5C20A 3UR9A 2XC5A 1V2OT 4XSKU 4AOQA 4X2VA 3SZNA 1A5IA 2ZECA 2Z6BD 1DY8A 4OS6A 1SGNE 4CHAB 2BXUH 2W7SA 3RXEA 4XBBA 1C1SA 1SGQE 2NU1E 2Y5GA 1TGSZ 2CMYA 2UWOA 3UWJH 1K1MA 1KTTB 1TIOA 1DITH 2GCHF 1O3LA 1XUHA 1LHGH 4TPIZ 2BHGA 1IHTH 1FI8A 3OAAD 2BB4A 1TWXB 1C5RA 1TRMA 1V2VT 2R9PA 5A2MH 1RTLA 4JZIA 1LVYA 2BZ6H 3TH2H 2VIVA 3LOXA 1BA8B 4AORA 4YXWD 2AMDA 1OSSA 2W6ID 1P3EA 5F8ZA 1MQ5A 5ETXA 3PRDA 4JK6A 4AX9H 3U28C 3RU4D 2ZCHP 1K9OE 1VR1H 1S0RA 3D62A 1HXFH 1NRPH 1Z71A 1B7XB 5FCRA 3TJNA 1O30A 1C5XB 2J9NA 3KNXA 2ZU5A 3KQ5A 1HAXB 5HMAA 4B1TA 3DD2H 1L4ZA 2GZ7A 1BTXA 2A0QB 3LC3A 3MU1A 2UUJB 2VGCC 2F9BH 1H8ED 1O2ZA 3SNCA 2BDCA 3SW2B 1LVMA 1AMHA 1O37A 4I8HA 1NN6A 1VITH 3GS9A 3SQHE 3DFJA 4B75A 1GJ4H 1PPGE 2R2WU 1WCZA 2XWBI 4SGBE 3BTTE 1LHEH 3LGIA 2C8YB 3ZZ4A 5DO4H 1V2PT 2BLWA 1SGPE 2XNIA 2TBSA 1F92A 1BUIA 2FTMA 1GHVH 2AGGX 1MAYA 1DM4B 3MH7A 4ZUHA 2QF0A 4XD7D 1K0HA 5GCHF 1O34A 2SNVA 2FOFA 5C2ZA 2BY6X 4I8GA 2FS8A 1F7ZA 4X8TH 1WXRA 1GWAA 1GJBB 1ABIH 1DX5M 1HAGE 3M7UA 3LT3A 4ABDA 1W13U 1DSTA 2IJD1 4GHQA 3F0PA 4ISLA 2QXJA 4HTCH 2A4RA 2V7QD 5LGOA 2XRCA 4JYVH 1UVTH 3KQEA 1RFNA 2FI3E 3SU4A 2Y81A 4AGJA 3D49H 3TU7H 1N1LA 3SQEE 3NPSA 2ODQA 1QBNA 1ANCA 2QA9E 3T26A 2I6QA 1TBQH 3P8FA 4D8NA 3F68H 1H1BA 1UK2A 4KTUA 4X2YA 2HVXA 4BANB 3SJOA 3KYFA 1CE5A 1ANDA 3R3GB 4NWLA 1C2GA 2F9OA 2O9QA 3RXQA 1O3KA 1J17T 3MH4A 3QZQA 1L4DA 1NRNH 3DHKH 3F0OA 2FYRA 3M3SA 3DA9B 3VGCC 1UVOA 2PKAB 1GI7B 3RC5A 1T8LA 4GLYA 4E7NA 1O3NA 1MUEB 1IQFA 2M2AA 4ABBA 5AVDA 1J16A 3NUMA 3P8NA 2A7HA 3DUXH 1G36A 1SBWA 3PRBA 1LHDH 1Y3WA 3UPEA 1ANBA 1O38A 5AHGH 1RIWC 2K8IA 2LNCA 3QX5H 1EAUA 1FQ3A 1ESAA 4ISHH 1EP6A 1B0EA 4MNYA 2IN2A 5E0GA 1BB0B 3C1KA 1GCDA 1AUJA 2Q6FA 1DWBH 2KR7A 2W6JD 1DXPA 1C2MA 3NCLA 1P12E 3BTGE 3OEED 1S6HA 1EPTB 1PPHE 3TK9A 3RXHA 1BMFD 1C5NH 3ZYEA 3M7TA 1DUEA 4DT7B 1WSSH 2C3SA 1LO6A 3SHAH 1A46H 3KF2A 2A5IA 1KDQB 4B74A 1CGIE 1PPFE 4INKA 3TGJE 1AVXA 4H42U 3A8AA 4WVPE 1GHBG 2CN0H 2FIRH 1KXBA 3CS7A 4THNH 4CR5A 2QV1A 2LPRA 3W1EA 4DVAU 5DP4A 1HXEH 1IQIA 1C1NA 4KKDA 3ZIAD 1SGCA 4YESB 2ZGCA 4Q7ZA 1GGDB 3Q77A 5FPSA 5EJLA 3U98H 2EI7A 1PPCE 1BCUH 1BBRK 3RC6A 4I8JA 2Y80A 1NBMD 3VB5A 2BZAA 4KGAA 2BD9A 3SOSA 1EOLA 1P8VC 1YY3A 1GHYH 1SB1H 3K6ZA 4JZFH 1HDTH 3TITA 2XNDD 1F5KU 1O3PB 2H9HA 3RC4A 3KQCA 1DSUA 3F2FA 5EJZA 2RCEA 3K2UA 4NIXA 4Y8ZA 3RMNH 5LPEA 1IQGA 2J98A 1O31A 4A1VA 1VGCB 1ZR0A 5JBCS 1SGEE 1MD7A 1TPPA 5EXNA 3BEFB 1QURH 2Y82A 2GCTB 4LZ1H 2Z3EA 1RXPA 3JZ1B 2ZHFH 3HGNA 5CHAB 3DSGA 2ZU2A 3K6YA 1S6FA 6CHAC 2ZFQH 5DN6D 8GCHF 3EDXB 3A85A 1EXFA 2KCAA 2V6NA 4UONA 4YM9A 1YLDA 9ESTA 5T6DA 1CT0E 1AN1E 1Y5BT 2ZHDA 5HYOA 3S7KB 1AKSB 2AMPA 5A09A 1TX6A 4LXBH 1N8OC 2XOKD 2FOBA 3PWBA 3U8TH 3RMMH 1ZPZA 3EA9A 4Y7BA 1C1MA 4D76A 4B73A 1C5WB 1JRSA 1T7CA 1V2NT 4Q63A 2BDBA 2XBXA 4GSOA 1K1IA 4JZ1A 1NTPA 2JJ2D 3FKSD 4VGCC 5EPYA 3F9GA 3JZ2B 5GNDA 1E1QD 1N6YA 1AZZA 5IYTA 4WMFA 5C5NA 1W0JD 2XCNA 2FTLE 1PPZA 2FYQA 2A7JA 2W3KA 3KIDU 2RG3A 5EQQA 3S9CA 3ZVBA 3Q3KA 1C9TA 4MTBA 1EZQA 4NFEA 3RXVA 1Z6EA 1TPSA 4H4FA 4NSYA 2J5UA 4M9FA 1HAHH 4ISOA 1LQEA 3ZZ6A 1NFUA 2JH6D 1OXGA 3RXKA 4ASUD 2AMQA 3OU0A 2HRVA 4IC5A 3SV8A 2Z3CA 2A7CA 4Y8XA 2H6MA 1AUTC 1N6XA 1MBMA 4ZMAH 2P16A 1GDQA 3E8LA 4TYDA 2HNTC 3P92A 2ZQ2A 3SGBE 1IHSH 1YPGH 1NPMA 5K0HA 3TJOA 1A5GH 1HNEE 2BLQA 1PQ7A 3PV2A 2D8WA 3D23A 1GL0E 4K8BA 4OS7A 2BD8A 2YNBA 2AS9A 4RI0A 2L74A 1V2WT 4FUEA 1P57B 1CT4E 1EAXA 1LQDB 1MMJN 1Y8TA 3KGPA 8KME2 3HK3B 2WPKS 3AW0A 1ZPCA 4MNXA 1MTNC 1C1TA 2BX4A 1C1RA 2OBQA 5AFYH 3SGAE 4MPWA 3FZDA 3L3TA 5DP7A 3SV9A 4WJG2 1S85A 2J2UA 4IW4E 4XRNA 5F8TA 3M3VA 3MH6A 1HAVB 2ESTE 3OX7U 3NXPA 4K3JA 4JK5A 4YT6H 1DT2A 2B9LA 2G52A 3GY7A 1ELGA 4X8VH 2P8OC 1GHBF 1V2KT 4IGDA 1TQ7B 4ACBA 3OY6U 5A8YA 2G51A 3OFND 2UUKB 5PTPA 3VB6A 5CDFE 1Y3XA 2GDDA 2XWAA 3B9FH 5C0TA 3UOUA 4NIWA 1G3BA 3A82A 3QTVH 2GCHG 1ANEA 2FMJA 3A84A 7LPRA 5ABWA 1KXAA 4AFZA 5JYIA 2XYAA 5JB9S 2A31A 1HYLA 2VGCB 4YOIA 2FXRA 5C1YA 2BOHB 2A4OA 4JYUH 5CHBA 4GPGA 1OWJA
chains in the Genus database with same CATH topology
1TALA 1YPHE 1UTQA 1JIMA 4ZKRU 3ZYDA 4U2WA 2FOHA 1W14U 1HCGA 4U30A 1KSNA 4NG9H 2ZFPH 1DLEA 1ZTJA 4F49A 1YM0A 3KQBA 2GGVB 3LH3A 8ESTE 1ELAA 4UFDH 4TPYA 4GHTA 2STBE 1D9IA 5FCKA 2BD3A 1YPLH 1ZOMA 2H9EH 1QB6A 3ODFA 1TGCA 4H6SB 2NU3E 1O2GH 4IMQA 2G81E 3EYDA 3RMLH 2ASUB 2BLOA 2WPLS 1QQ4A 1TMTH 2VIDA 1SGTA 2FM2A 3RM2H 1XXDA 1ZRBA 2FWWA 2VIQA 2W7UA 1K21H 2OCVB 1QL8A 3FP6E 1GBHA 3AAVA 3KHVA 2VIPA 5J4QA 1ZSLA 1YPMH 1QB9A 1OS8A 3MU0A 2ZHEH 3HGPA 1C4Y2 1LTOA 4MDSA 2Z9GA 1Q31A 1ZYOA 3BTDE 1AE8H 1ELBA 4Y71A 2WV5A 1J9CH 3UOPA 1QR3E 1TGBA 3TH4H 1AWHB 1AQ7A 1Z8JB 2ALVA 2B0FA 4AYYB 3PO1C 4X8SH 1Z1JA 2QXGA 1FMGA 2VIWA 2VNTA 2TGPZ 4HFPB 3VGCB 2A1DB 1FN8A 3ZVGA 4X1NU 3GCTF 4BTIB 2HPPH 4UE7H 1KIGH 2ANWA 2V0BA 1SGDE 4ZXXH 1SLVB 1C1OA 1IQJA 1FIWA 1C5YB 1ZTKA 1GBKA 1UTNA 4DG4A 3KCGH 1LVOA 3GCHC 2UWPA 2ZQ1A 3SJ9A 3H7TA 2AIQA 3TNSA 1TBZH 1RIWB 4A1TA 1O5FH 1TX8A 3SU5A 2GZ8A 3BG4C 3I77A 4CRFA 3SORA 5DK1A 4MNVA 1O2KA 2SGAA 2WYGA 4WXIA 4FVBA 1BDAA 4CH2B 2Y5FA 1SI5H 5H4IB 2HLCA 3ZZ7A 3AW1A 1DWCH 3F9FA 2Z9JA 3LONA 1ZMJA 4RN6A 1DPOA 1YKTA 1GJ7B 2OC1A 2ILNA 1BTUA 1P0SH 1O5DH 4GUXA 2AGIX 1O2MA 3AVZA 5EOKA 1T31A 3RLYH 5HM9A 1LMWB 1F0UA 1GL1A 3BTEE 2PKSB 2AH4X 1K22H 3BG8A 2H1UA 1O5EH 1PFXC 1XUGA 1W0ZU 2PUQH 1SMFE 1GJDB 1TMUH 3PLKA 3SJKA 3A7TA 3SU1A 1DANH 1TABE 1ETSH 3PV4A 5CE1A 2ODYB 3LIWA 2P3UB 3PROA 5TJXA 5FPTA 1F0TA 4OGYA 4YLQH 1J8AA 1K1LA 2QN5T 4KELA 1ZHPA 2DUCA 1BZXE 3E3TA 3TLOA 5JBBS 3S9BA 1NRSH 1RJXB 2ZGJA 2GZ9A 3T5FH 4SGAE 2EI6A 5B6OA 3L33A 2BD2A 1Q2WA 1CHGA 3ZVDA 1UTPA 1T32A 3EAJA 1ZLRA 1ZMLA 7ESTE 1XUJA 1SVPA 1EZXC 1MU6B 3ZZ3A 1JWTA 4RKJB 1MTUA 3SUDA 4D9QA 5I46H 1AY6H 4B2CA 3ZZ8A 6CHAB 1TLDA 2FO9A 1HBTH 4LK4A 1KLIH 1GPZA 3QGJA 1U6QA 3C27B 1GBDA 3GY3A 5L2YH 3A7WA 1BTWA 4ZHLU 1GI3A 4E06H 3ATIA 1XMNB 1O2SA 4A1XA 1E35B 2HPQH 2FI5E 4E05H 2ZDKA 4AFUA 2ZDNA 2FLBH 2WPIS 1CQQA 1MQ6A 1N8OB 3W95A 3ZV8A 1O2UA 3O8CA 3V12A 4FUHA 1G3CA 1SR5C 1GJ5H 3IG6B 2G5VA 3MH5A 1QL9A 1OP2A 4VGCB 3UFAA 8GCHG 1SGFG 2G4TA 4K1TA 1DICA 1O3CA 1ABJH 1CBWC 1OKXA 3KL6A 3T62A 3PLBA 1ZRKA 2P93A 2TGDA 3RXJA 4ABAA 4Y6DA 5L2ZH 2FS9A 1T8OA 3T28A 1O2NA 2Z3DA 3GYMA 4FUBA 1Y5AT 3RXAA 2QCYA 1YC0A 3ATKA 5F6MA 2UUYA 2VWLA 3V7TA 2OC7A 2A4QA 3SUFA 3PYHA 3NZIA 5GWZA 4JCNA 1V6DA 1UJ1A 2FLRH 2VVCA 5DPAA 1P2OA 1SQAA 4MVNA 3BTHE 1IAUA 4TWWA 2SGQE 3BTWE 4Y79A 3VEQB 2XC0A 1F0RA 3T29A 1G9IE 1LCYA 3NWUA 1HAYB 3PM3A 1GMHF 1BQYA 2PKAA 3SNDA 3SV2H 1KY9A 1SC8U 1EX3A 4F4OC 3VXEH 1S5SA 1GVKB 2PWXA 1PYTC 2PSYA 2QIQA 1TNIA 1LVBA 2RDLA 3MU8A 4GCHF 1QL7A 1L2EA 3M37A 3RXFA 5I25A 1C2JA 4Z6AH 1EASA 2FOGA 1RGQA 3PMAB 1MTNB 1OP0A 5FPYA 1C9PA 1Y3VA 1PQAA 2P3TB 4YT7H 1IQKA 1G30B 5EQRA 3GYLB 1EPTA 2W26A 3W94A 1JOUB 2Z94A 4A92A 1NM6A 3EE0B 1O2OA 1ARBA 4NA7A 1MH0A 3VPKA 2SGEE 1EOJA 1KDQA 2QXHA 3P8OA 1D3TB 1UMAH 2P8OB 1S84A 2Y6TA 1S81A 1O0DH 2Y7ZA 2GTBA 1H8DH 3ZZ5A 2BY9X 3ITIA 1QQUA 2GKVE 4CRGA 1WTHD 4X2WA 3M7QA 1DOJA 1SQTA 4IC6A 3PLPA 1GJ8B 2FOAA 2WUCA 1S0QA 1Z1IA 1FY4A 4DURA 1C2FA 1TNJA 1DWEH 3V3MA 1KXFA 4BTUB 3GISB 3U8OH 3M36A 1C2EA 1GHXH 1CA0C 1AFQB 1W8BH 1VCQA 1P01A 2AIPA 2ANYA 2XTTB 1KXDA 4UEHH 1ZMNA 2A2QH 2OC0A 5T3HA 1UVUH 3SU0A 1ORFA 2Z9LA 3M5OA 1D3QB 1GDUA 3A86A 1MKXK 3BTME 4NGAH 2PKSC 2TGTA 3HATH 2WINI 3P70B 1O2PA 1V2TT 3SV7A 4CREA 3TGKE 1A5HA 1YGCH 2R0KA 1EJNA 1O2YA 4DY7B 1EKBB 2OXSA 4ABHA 2ULLA 1YP9A 2XW9A 2ZPQA 1FONA 1MZDA 4MPVA 1ELVA 1H9LB 1CVWH 3SUEA 5EU8A 2JKHA 1H9IE 3PWCA 1E38B 1UCYE 3MTYA 3SJIA 2GT8A 4Y76A 3LGTA 1FPCH 2ZNKH 4AYVB 2BQ6B 1JRTA 1Z8RA 3PMBB 1TFXA 1RS0A 3OY5U 1DE7H 1IQNA 4HGCA 2GDEH 1BOQA 2XBYA 2F9VA 1AKSA 5BPEA 4YTAA 2GV6A 1RRKA 1CGJE 3T25A 1BRUP 3STJA 1INCA 4I32A 3TH3H 1J14A 4NA9H 2K1QA 1TE0A 4Q7XA 4J2YB 3PO1B 4MLFB 1GJ6A 4ZH8A 3F6UH 3QUMP 3ZVCA 2DE9A 2J4IA 2JH5D 2ZHWH 1HUTH 4I8KA 5K7RA 1W11U 3UNRA 1GI4A 4B76A 3E0NB 4MNWA 1QIXB 3GY8A 3TPIZ 1O2HA 5LPRA 1V2MT 2HOBA 1O5GH 2R2MB 1A4WH 1P10A 3LH1A 3Q00A 2P95A 3GCHB 2B7DH 1CO7E 1O2LA 1ETRH 3FP7E 1C5MD 1TNGA 4DJZB 1SG8B 1P2KA 2BD4A 4YOJA 3RLWH 2ZDLA 1OWDA 1AZ8A 3BG4B 3GY4A 4BXSA 1CGHA 2ODPA 2BY8X 1VCWA 5DGJA 5FBEA 4ZROA 1XXFA 1HGTH 1FZZA 7KMEH 3AAUA 3A83A 3GCTG 2BQ7B 5E0HA 3SV6A 1B5GH 1P2NA 3DT0H 8LPRA 3ODDA 2IJOB 2ZTXA 2BVSH 4I7YH 1YPJH 1V2JT 3U1IB 2QF3A 2THFB 2ZTYA 3IWMA 3MWIU 4AG1A 1LDTT 1FY3A 4BAOB 4PROA 1K1NA 3ZZAA 1SPJA 2FOMB 1YBWA 1HJ8A 1NU9A 1A1RA 1SLUB 2ZKSA 1ZTLA 1OP8A 1NY22 1ZZZA 1G32B 3ATWA 2F9PA 1P11E 1YLCA 2OINA 1P02A 2R0LA 1GJ9B 2F9NA 4X8UH 1CHOF 4Y0ZE 1HIAB 1GHAF 3UIRA 1L0ZA 2OBOA 3E91A 3OTJE 1G37A 2J92A 2CF8H 2WV4A 3SJ8A 1SFQB 1VJ9U 3M35A 6ESTA 3TVJB 3RXBA 4BAKB 1NO9H 5DG6A 2CHAC 5L30H 1DY9A 1QHRB 1HAVA 4JZEH 1P2IA 4ZKNU 1TPOA 1AVGH 3QDZB 4DIHH 1THRH 1HPGA 3STIA 1VJAU 4BNRA 1F5RA 4ZXYH 1ELDE 4DW2U 1ZHRA 4KTSA 4UFFH 1YCPK 5JBAS 4WF8A 3GICB 2FX6A 1OWIA 2Z9KA 3QK1A 3ENSB 2P94A 5FAHA 1GDNA 2ZFRH 1Z7KA 1P9SA 1FY5A 1NFWA 5F8XA 5FXLA 1O5CB 2ZPSA 5DP9A 5AFZH 4ABJA 6LPRA 3QWCH 2ZGXH 1C5OH 1SGYE 3E1XB 2XCFA 5GDSH 4ABFA 1AO5A 4K1EA 1TGTA 2C8ZB 3P6ZB 1H4WA 1NRQH 3ZVFA 2OQUA 5GXPA 1NFXA 1KYNA 1GJCB 1QBVH 1HAPH 1ETTH 1UTMA 1GBTA 3FVFB 3UUZA 5A0BA 1B0FA 1O3FA 2RA3A 4X6NA 3UNQA 5CMXH 2BMGB 3LGWA 3BTQE 4LOYH 1O3BA 3SHCH 1UO6A 1K28D 1A0JA 2GT7A 2WPJS 3RXMA 3A88A 3Q3XA 1Z6JH 1TPAE 6GCHG 1QRZA 1NT1A 1C5VA 1AFQC 3RUOA 1WBGB 3FANA 2W5EA 2ZO3H 1CBWB 4OGXA 4HI3A 3E6PH 2BX3A 1HB0B 3BF6H 2FZZA 2F83A 2ZPRA 2ZI2H 1FAXA 2ZU3A 3UTUH 1XKAC 3LGVA 3U8RH 3RMOH 1ZGIA 2RA0A 2PGQB 2BXTH 4Y10E 2VH0A 4ZHMU 1O2WA 5EG4A 2VVUA 1T8MA 3EQ0H 4MPXA 2BYAX 1QNJA 1AB9B 3GCOA 3MO9A 5TCCA 3RXSA 1AI8H 3VB3A 1SGFA 1GBCA 2PGBB 1SQOA 2PHBA 1UVSH 1QY6A 4WH6A 2XBWA 3GOVB 1YPHC 1TNKA 2BVXH 2GP9B 3SO3A 1P2MA 2GX4A 1L1GA 2P59A 3BTFE 3VB4A 1XX9A 1BRCE 3MNCA 1ZSKA 5JDUB 4ABEA 1THSH 2JH0D 4OS5A 1SOTA 3DFLA 4XBDA 2ZIQH 2ZFTA 2TPIZ 5EGMA 3A8CA 1QRWA 3A8DA 3ZZDA 2IPHA 3LJOA 5A0AE 2Z9IA 2R3UA 5JBTA 1IQMA 5DP8A 5EXLA 2ZF0H 4D9RA 3A89A 1GMHG 3SGQE 3CENA 3MMGA 2ZGBH 2WUBA 1BTHH 1GI0A 3O8BA 1KTSB 3GY2A 1WUNH 1O3MA 4IN2A 4AB9A 4UFGH 7GCHF 1O3JA 5E0JA 4OS4A 1AHTH 5GIBA 5SGAE 4GCHG 3U1JB 3ELAH 1FPHH 1BTPA 1E0FD 5ESBA 1G3EA 1QA0A 1DFPA 1QB1A 2HALA 5J4SA 1GBEA 3AASA 4YZUA 1ARCA 3VXFH 1PPEE 4AN7A 3HKIB 3ZV9A 2J34A 4ISIH 4A6LA 3BEIB 1WV7H 1GMCG 5C1UA 1KXEA 2ZGHA 4H6TA 4YLUA 1QA7A 2C90B 4YOGA 1CA0B 1Y5UT 2ZA5A 1F2SE 3MNXA 1TOCB 3O8RA 2BDAA 3K65B 3TNTA 1GI6A 1VZQH 4YO9A 1WQSA 1A3EH 1UHBB 5HGGA 4ZHAA 2BDGA 1PQ8A 1V3XA 5TCAA 4OS2A 2PUXB 4A5TS 3UR6A 2I6SA 2KAIB 2CXVA 2ZHQH 5LH8A 1ZPBA 3EA8A 1HFDA 2Z7FE 3F9EA 1W3CA 4GAWA 1C5QA 1UTOA 1C1UH 3L6PA 4FXGH 4NIVA 3FAOA 5F03A 1A2CH 5HM2A 1O3AA 4Z0KA 1OPHB 2VVVA 3U69H 3QGNB 3VFEA 5C67A 1PYTD 4J1YA 4JMYA 1IQHA 2VWNA 3OYPA 2Q6GA 1H9HE 1TNLA 1XVOA 2PSXA 2QY0B 1BBRE 2BM2A 3QN7A 1K1OA 2UWLA 1HAIH 2ZG0H 1Y3YA 5EW1H 2R3YA 1O33A 4A7IB 1HAOH 4Q7YA 1FAKH 2BOKA 4CRAA 3E16B 1O3GA 2BY7X 2D2DA 1EZSC 4XBCA 2PLXA 3LC5A 3H7OA 6GCHF 1RTKA 3TK5A 1KLTA 2GMTC 1YPKH 4Y11E 3KEEA 3O8DA 1YCPM 5DJ7A 3TJUA 3GDSA 5A0CA 2CF9H 4DOQA 4KTCA 4MG3A 4E7RG 1L1JA 1FV9A 2J95A 3U9AH 5FX6A 1F5LA 3TK6A 3BN9A 4UD9H 1LPKB 2GD4B 2SGFE 1A61H 1EAIA 1XUFA 1HAZB 1UCYH 1TQ0B 3LGUA 2ZCKP 3RDZA 1K2I1 2JETB 3CS0A 1NRRH 2ZP0H 3MU4A 3MU5A 1H8IH 3P95A 1FIZA 5EPNA 2BD7A 4DGJA 1EP5A 1SLXB 4CR9A 1TA6A 1HJAC 5C5OA 4FUGA 4ZKOU 5IDKA 1QRXA 2EA3A 2GVFA 3RU4T 1AE5A 2BD5A 2BDHA 3SNEA 2G55A 2A5AA 1BTYA 2BVRH 1TONA 3F9HA 2XXLA 3E90B 1C4U2 1MU8B 1SOZA 1W7XH 4B2AA 4NWKA 1AVWA 2M5TA 1G2MA 1BRBE 3Q3YA 3HPTB 1BJVA 3MO3A 3P8GA 4X1RU 2ZTZA 1WTGH 1P04A 2Y7XA 1Q3XA 3M3TA 1AB9C 1O39A 1JBUH 1BRAA 3BIVH 2BTCE 3E0PB 4TY6A 3B8JA 1A3BH 1JMOH 3UY9A 1DDJA 1GI1A 4NA8A 2AFQB 2VIOA 4O97A 3EA7A 1QBOA 2CHAB 2FOEA 1DS2E 2PTCE 3ZVAA 1C1VH 5L6NH 2Y5HA 2AERH 2AYWA 1WAYB 3A7YA 3I29A 3GCNA 1GBBA 2NWNA 2G5NA 3SNBA 4JZDH 2A5KA 1ZSJA 3P17H 1LHFH 2ZWLH 4QT8C 1WU1A 3RU4E 1D6WA 1KXCA 3H5CB 1K1JA 1CHOG 1QJ6B 1GHAG 9LPRA 2YOLA 1C5PA 1DXWA 2VH6A 1O3EA 1D3PB 3KQDA 1JXPA 3MO6A 3QO6A 1GMCF 3M5MA 1HJ9A 5C3NA 1TBRH 2H9TH 2ZZU