3E90B

West nile vi rus ns2b-ns3protease in complexed with inhibitor naph-kkr-h
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
176
structure length
173
Chain Sequence
b'GGGVLWDTKEYKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWKLQHKWNGQDEVQMIVVEPGKNVKNVRTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGKRMDEPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS2B cofactor
publication title Structure of West Nile virus NS3 protease: ligand stabilization of the catalytic conformation
pubmed doi rcsb
source organism West nile virus
molecule tags Hydrolase
total genus 29
structure length 173
sequence length 176
chains with identical sequence D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e90B02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3e90B01
1SQTA 3RUOA 1AVXA 1BTHH 2ALPA 3SI3H 2OK5A 5GDSH 2GGVB 3GDSA 3LGYA 4ABGA 1TIOA 4FUDA 3W95A 3DT0H 1C2MA 2BDHA 2FLBH 2Z94A 3STIA 1BBRK 1MZDA 1YKTA 2BLWA 5FHTA 3NWUA 5EPYA 5E2OA 1GCTB 2VGCB 1FPHH 2ZU1A 3UREA 1C1NA 2QCYA 1NFUA 3LKWA 4FU8A 2SGFE 2FM2A 3TITA 4A5TS 2BD2A 4AYYB 1V2LT 5TCCA 1AE8H 1THRH 9ESTA 4QT8C 1C2KA 3HGNA 4UEHH 1AFQB 2ZU2A 1GI5A 1KXBA 2W3KA 4BOHA 2A4QA 1CVWH 2ZQ2A 2Z7FE 3EAJA 3ZVFA 2FOBA 1TGCA 2HPQH 4MQAA 1NFXA 1YLCA 3U9AH 4CR5A 2W3IA 1MTUA 1V3XA 2GP9B 2TGDA 1OWJA 4ZKSU 1NU9A 2ZCHP 3UQVA 1O3PB 1GG6C 4MG3A 1O3LA 2Y6TA 2FI5E 2CN0H 3KQEA 3SUEA 3UR6A 4HTCH 3MH7A 1YPKH 1BBRH 1YGCH 2Y7ZA 4NA8A 3OY6U 1Y5UT 3SJIA 2LNCA 1A1RA 3HKIB 1DDJA 1NRQH 4IN1A 2BDBA 5EU8A 1QB1A 3DUXH 1NY22 3I78A 5HGGA 4B75A 3A7VA 2ZHFH 2CHAC 1XXDA 5LPFA 3A8CA 5F8ZA 3SV9A 1Z6JH 1UTQA 5A09A 1O3CA 1C2HA 1C1UH 1DWBH 1NC6A 2QV1A 2VIVA 1T8MA 2CF8H 1LPKB 2ANKH 5EPNA 4GHQA 1GVLA 1ELAA 1IQJA 1GMHG 1IQLA 3SUDA 3A89A 4B76A 4FUEA 2J92A 1DANH 1XXFA 1GI2A 1V2TT 1EZQA 1HXFH 4B2AA 2P94A 4DW2U 2EA3A 3PWBA 2BD9A 4YOIA 1MZAA 1O2OA 1O3GA 1Z1JA 4A1XA 3NPSA 1J8AA 3S9AA 1GJBB 1LHEH 3RDZA 3ZYEA 1HDTH 1TNGA 1TRMA 2RA0A 3PMJA 4INLA 2A4OA 2PSXA 3TIUA 2Y5HA 4DIIH 2DUCA 1T7CA 2BZAA 3TNTA 1VJAU 3M3VA 2OINA 3ZZDA 2WPJS 1C2JA 2OUAA 1GMDG 1PFXC 1OS8A 2SGEE 4D9QA 3KIDU 3M3TA 1F0TA 1DXWA 1QIXB 3M7TA 4BTTB 3Q3XA 3BG4B 4LZ1H 4UFEH 2UWLA 4ABAA 1BIOA 1GMHF 2BD8A 5DP6A 1WXRA 2ALVA 1EX3A 2AMDA 2BD4A 1FIZA 2W26A 1TPOA 2VVVA 3S7KB 1SC8U 2BY7X 1FDPA 1B0EA 3ZV9A 3SUFA 5A8YA 2ZHWH 3MU1A 2IOTA 3ATLA 3F6UH 1TX6A 1N6YA 2Z9GA 3MH4A 2FS9A 2IN2A 1EJMA 3NXPA 2BMGB 3MFJA 2PHBA 1Y5AT 3ZVDA 2UUJB 2XBYA 1FN8A 2BVXH 2BY9X 4BXWA 1ZMJA 2FOAA 4IN2A 1GBFA 3TJOA 3A7WA 4NCYA 1KYNA 1EATA 2A5IA 1GBTA 5CHAB 4IC5A 3JZ1B 3F68H 2ZGCA 2FIRH 1KXAA 2TIOA 1HAVB 3GCTG 2PTCE 3FP8E 9LPRA 1NRSH 2UWPA 2P8OC 2WPIS 4FUIA 1RS0A 1FY1A 1KXDA 3F9HA 2Z9KA 3ZZCA 5J4QA 1TB6H 4B73A 1A3EH 3P95A 1A3BH 1PPCE 3A82A 3EYDA 2W7UA 2ZC9H 2FX6A 1BDAA 3LH3A 5C20A 1F5LA 3U69H 3BTDE 2BVSH 1TA6A 4K1EA 5T3HA 1O2KA 4ABDA 5AVDA 2THFB 1OSSA 3RXAA 1G32B 2HLCA 1A0HB 1LPZB 3SHAH 4K1SA 2XC4A 1P01A 1IQEA 1CSOE 2BY6X 3TH2H 1Z8RA 4B2BA 1O2QA 2OP9A 1G36A 1WAYB 2VBCA 5GWZA 3RXBA 1HAIH 1FZZA 2G5NA 2JETC 1O2GH 3EE0B 3KGPA 3OX7U 4WXVA 4VGCB 5I25A 3QGJA 2NU3E 5J4SA 3EDXB 5GPIB 3SU4A 4I7YH 3QX5H 4BAOB 2Z3CA 2JKHA 2SNVA 4YT7H 2GT7A 2ZKSA 4K8BA 1ELGA 1Z7KA 1HAVA 5C1UA 2Z9IA 4KTSA 3UWJH 1WU1A 2XBWA 1G2LA 5F8TA 5FPTA 1GGDB 1C1OA 2Q6FA 1TMUH 1LKBA 4X8UH 4Y8ZA 5DP7A 1EJAA 1VCWA 4AFSA 1BT7A 1QNJA 1C5RA 4NSYA 3PO1C 1K22H 1K1MA 1TBZH 1TRNA 1YF4A 1YYY1 2PV9B 8GCHF 3E3TA 4DG4A 4U30A 2FYRA 3E6PH 1GJDB 1C1WH 4OS2A 3AK5A 4NZQA 2AMPA 3K9XB 1A2CH 1VITG 2O8MA 1JIRA 5AFYH 1P8VC 1N8OC 1AD8H 1P57B 2VIWA 3TJVA 1C1VH 3QGNB 1C5LH 2EC9H 3A8DA 2P16A 4JYTA 5FX5A 5E0HA 1S0QA 3T62A 1H1BA 5LH8A 3D65E 3KQDA 5T6FA 1M9UA 2D26C 3S0NA 1FI8A 1C1RA 2AYWA 1D6WA 1TGBA 1UCYE 2P93A 1P2KA 1WOFA 1V2MT 3PTNA 4SGAE 1AO5A 2V3HH 1RIWB 1P2JA 3RM0H 1OKXA 4XBBA 1D3TB 4YOJA 1LVOA 3QUMP 4Q2KA 4SGBE 3ATKA 3MNXA 3MNSA 1D3DB 2BXUH 3QK1A 1GHXH 1C2GA 4Q80A 1CGIE 1GI3A 1O38A 1XM1A 1TQ7B 1CGJE 1RTKA 4D8NA 1SGFA 1ABIH 1B0FA 5GNDA 2ZDAH 1H9IE 1V2UT 3E0NB 4YO9A 4NWKA 1ZPZA 5DJ7A 2IJD1 3TK6A 2FOCA 4CRDA 2CF9H 6LPRA 1A5GH 4TYDA 2BDYA 3U8TH 2ZDNA 5CE1A 1LQDB 5IDKA 1D4PB 1TNIA 1NFWA 3V13A 4Y76A 3TGJE 1C5UA 1IQKA 3P8OA 1QFKH 3T27A 2XW9A 1C9PA 4X6MA 1LQEA 1O30A 2BVRH 3LONA 2Z6BD 1WQSA 1S83A 4WXIA 2ZCKP 1BMAA 4OS5A 4ZXXH 5C2ZA 2BY5X 1KTTB 1ZJDA 3I29A 1PQ8A 2B9LA 5SGAE 5AHGH 2BD3A 1XVMA 1BMMH 1ZPCA 1G3BA 3NCLA 1B7XB 1C5MD 4CH2B 4R8TB 3RXRA 4YZUA 2CGAA 4XBDA 2XTTB 4X1NU 1A61H 1G3EA 4AZ2B 1P09A 4AGJA 4OM9A 1EJNA 3M7UA 1SGDE 2FYQA 1LMWB 1EAXA 4MPXA 3ZZ8A 1SGPE 3W94A 4K8YA 3UPEA 1RFNA 2ZPQA 2OBOA 2G8TA 3RXFA 1O5GH 3ZV8A 1GCTC 3A7TA 3MYWA 2VGCC 5DP8A 1TPPA 4DVAU 1EKBB 2VIDA 1HLTH 3UNQA 1O2JA 3VGCB 1O2MA 1MBMA 2A5KA 5CMXH 1BTUA 4WJG2 1YCPM 1AFQC 2PFEA 2OCVB 1YC0A 1HAYB 7ESTE 1GVZA 3OU0A 1ANDA 1PPBH 5EQSA 5GCHG 4IBLH 2ZG0H 4JMYA 1LVMA 4IS5A 3AW1A 2QF0A 2PW8H 2A2XH 1OP2A 1GI4A 2AERH 3VEQB 4BTUB 3LJOA 4I8LA 1BBRE 3RM2H 1Z8JB 4NG9H 2GZ8A 4ZHAA 4CRAA 1UHBB 2IPHA 2DE9A 1CE5A 4NGAH 3SORA 1O2WA 1IQGA 5DK1A 3RLWH 1D3QB 2WINI 1H9HE 1EPTC 1PYTC 1SGNE 2Z3DA 4D7FA 1F7ZA 2GCTB 2F91A 2QXHA 2ZDVH 3DA9B 2BLOA 1AWFH 1O5EH 2SFAA 4AG1A 1O5CB 2VWMA 1SQOA 2Z9JA 2Y82A 1P2QA 3L33A 4ZH8A 1F0UA 2PLXA 1AY6H 5EXMA 2VWLA 4X6OA 3O8CA 5DO4H 3AASA 3BTEE 4B71A 3RXCA 5JDUB 2RDLA 2QAAA 1GHYH 3BTHE 2CV3A 2ZTZA 1FUJA 4NZLA 3P17H 3MU0A 1O3KA 3LGVA 3OSYA 1G3CA 1O2ZA 3RXVA 3QZRA 4AFZA 5LGOA 2AMQA 1O3HA 2GCHG 1HJ9A 2H9EH 1C4Y2 3F9EA 1W7XH 3TU7H 1ESAA 2FS8A 5A0CA 3A7ZA 4AX9H 2OC0A 1XVOA 4NSVA 2HRVA 2A2QH 4U01A 2O8UA 7GCHF 1CA0B 1V2JT 1BRUP 2ZWLH 3BG8A 1BCUH 2GMTC 2OBQA 3KCGH 2G55A 1PJPA 1D3PB 5GXPA 1UHBA 2VVUA 3VB4A 3E91A 1EAWA 2V3OH 1NS3A 2G4TA 4DT7B 4BAHB 4U32A 4Y79A 2W7SA 1GI6A 1O2RA 2CXVA 4IMZA 3MNCA 1C2FA 2GDEH 3ATMA 1EP6A 3BG4C 2J95A 4J1YA 3ZVAA 1FIWA 3STJA 2FTMA 1FY4A 1O2HA 3PROA 1OXGA 1T4UH 2GVFA 4JYUH 4ABIA 4D76A 3HATH 2A32A 1S6HA 1O2PA 1MCTA 4ABBA 4LZ4B 3V7TA 1BTXA 2A0QB 1P9SA 1O2TA 1JIMA 2D2DA 3BV9B 4NIXA 1O5BB 3UWIA 1L1GA 2WPLS 1DFPA 2FEQH 1CT0E 3MO6A 1G2MA 5GJ4B 3U98H 2NU4E 1O3DA 2ZA5A 1DWEH 4XFQA 4AB9A 3PV2A 5CHAC 1TOCB 1L4DA 3SGBE 1INCA 5DPAA 1JRSA 1O34A 3N7OA 3SNCA 4Y7AA 2P59A 4I8HA 5JB9S 1CQQA 2OQ5A 3ITIA 1C5XB 3UNRA 2AIQA 3LU9B 1XUGA 1H9LB 2VB0A 5HM9A 3E90B 1LHDH 4ABFA 3S9BA 4TY7A 1O3MA 1QURH 2R2MB 3GY2A 2YNAA 1PPEE 1TRYA 3NKKA 4A1VA 2Y80A 3M35A 4Y0YE 1HV7A 1W7GH 1CBWB 2XCFA 5B6OA 1MQ5A 4ZROA 1AE5A 1BA8B 3E16B 3SJ8A 1HNEE 1NRPH 1QHRB 2GZ7A 4LOYH 1QTFA 2FMJA 3UQOA 1ELVA 3ZZBA 1O3OA 1SLUB 4CHAB 2Y5GA 2V35A 2BD5A 3BIUH 1TNJA 1T32A 2FOGA 4J2YB 5C1XA 3A81A 1QQUA 1HB0B 1ARBA 2ODQA 1GBEA 3ODFA 1K1JA 5EW2H 1TE0A 1Q2WA 2O8LA 3FZDA 4FUBA 5EXLA 3ATIA 3MH6A 1B5GH 2Y81A 1L4ZA 3ZZ9A 4TPYA 2FODA 1HAZB 1UK4A 3SU1A 3FFGA 4LK4A 2QIQA 1GGDC 1XUJA 2QA9E 1Z8IB 3GY5A 1UVUH 1AI8H 2FESH 3EA8A 1TGNA 4WH8A 1GI1A 2PKSC 1AZZA 2FO9A 4HFPB 3QZQA 3Q3YA 1TFXA 4X2XA 1EB2A 3B23B 1C5ZB 4AFQA 4RKJB 1C5WB 5EODA 3E8LA 4Q7YA 1S85A 1HBTH 4OGYA 1AMHA 2I6QA 4JK6A 3TH4H 4KP0A 1P0SH 5L6NH 2BOKA 3RXTA 1KIGH 1AU8A 1TWXB 1W2KH 2UUYA 2A45B 3P8NA 1QJ1B 1MD8A 3SO3A 2ANYA 2ZECA 5FX6A 2NU1E 4NIYA 2OC7A 2VH6A 2CJIA 1ARCA 2UUFB 5TJXA 2PTNA 1IQMA 3IWMA 1LTOA 4NA7A 4Y8XA 3LGUA 2AH4X 3TNSA 1QR3E 2V6NA 1NU7B 3VB5A 1OWIA 4O97A 4DURA 1AUTC 2AS9A 3KL6A 5EGMA 2Z3EA 4MDSA 5A0AE 1GL0E 2HWLB 2D8WA 1QL9A 4DGJA 3UOPA 3ZZ6A 1PYTD 3V12A 3VPKA 3ELAH 1F5RA 1O2UA 4R0IA 1VGCC 3SU0A 1MKWK 3ZVCA 2O8WA 1ELFA 3GDVA 1ESBA 3SNDA 1QL7A 3Q77A 2OC8A 2AGIX 2PWXA 1P04A 1EAUA 1H4WA 1SLWB 4ISHH 3A8BA 2VIPA 5EG4A 5F03A 3TGIE 3VXEH 1UVOA 2FXRA 1XX9A 3PTBA 3WY8A 4ISOA 1ANEA 5TCAA 4A6LA 3BTQE 1BJVA 1OP8A 1HCGA 4UD9H 1ANBA 3MMGA 2XYAA 1UTLM 3ZVEA 3T2NA 7KMEH 3QTVH 2WYJA 3BTGE 1V2RT 1EZXC 3MI4A 3ZVGA 1HGTH 3MU8A 1SFQB 2SGQE 1E38B 1LCYA 4MLFB 3P70B 1P02A 4Z0KA 3LGIA 1FY5A 3H5CB 3RMLH 1W13U 1MKWH 1QCPA 4KGAA 5FAHA 2GKVE 1LHGH 3TVJB 1O5DH 1GBHA 1E0FD 3MHWU 4KTCA 5E2PA 1GJ5H 5FCRA 3LGTA 1NRRH 2F9OA 5B6LA 2ZFRH 1O3FA 2BY8X 1SLVB 5A8ZA 3BF6H 4DCDA 2FPZA 1SGFG 5HXFA 2Y5FA 8GCHG 1KY9A 1Z1IA 6ESTA 1LKAA 1V6DA 1ZRBA 4LXBH 4FU9A 4KELA 2F9UA 2AEIH 3RXIA 3RC5A 4Z6AH 1EP5A 1C2DA 1GPZA 3PLPA 4O3TA 1GJ6A 1V2ST 4X8SH 3VGCC 1DWDH 5JB8S 1W12U 4JK5A 2NU2E 1DXPA 2XC0A 1MU8B 1IQHA 3F1SB 2G52A 1MMJN 2ZU5A 1XKAC 3OTPA 1P2MA 2BDAA 2PR3A 1YP9A 3C1KA 2HNTF 2ZGHA 4K60A 2FLRH 3ESTA 1ZPBA 6CHAB 1HAOH 1EB1H 1QJ7B 1SI5H 3PLBA 3Q00A 4FUFA 1PQAA 2CHAB 1O36A 3MU4A 1KTSB 4AYVB 4GCHG 1C4V2 1TBRH 1L0ZA 2H5CA 4OS4A 3UOUA 4K69A 1OYQA 3P8GA 4X2WA 1RXPA 1ZSLA 3RU4E 1BTPA 4CBNA 2H2ZA 4H42U 3NUMA 1WV7H 1DE7H 1T31A 4FVDA 1IAUA 2ZP0H 2UUKB 5DKMA 2WYGA 3BEIB 1BUIA 4ASHA 4NFFA 3L6PA 3TK5A 2VINA 1FV9A 3GY8A 2V0BA 2J38A 1SGRE 4PROA 1UMAH 1P11E 1YBWA 1HJAB 4ZAEA 1RTLA 3AW0A 3HK6B 1PPGE 2R2WU 1AIXH 2P3UB 2ZDLA 3K65B 1YPHE 3MNBA 1GHAG 1BTZA 2G4UA 1ZHPA 3AVZA 3BIVH 1C5SA 3ZYDA 2AGEX 4GCHF 3OYPA 3GDUA 2C8YB 3M3SA 1C5OH 1OPHB 1PQ5A 5C3NA 1DLEA 3ZZ3A 3AAUA 5T1VA 1K1LA 1TLDA 2VH0A 2QXGA 1L2EA 5LPEA 1ZTJA 1OX1A 1O3IA 1E35B 3RP2A 1F0RA 1CA0C 3ZZ7A 4I31A 2C8ZB 1IQIA 3T5FH 1C5YB 1ZHMA 4E7NA 3GYLB 1ZRKA 1XUKA 1ZSJA 3SV7A 5T6DA 8LPRA 5HYOA 5H4IB 2FX4A 5DP4A 3UR9A 1GHAF 4FUGA 3RMMH 1A4WH 5EXNA 1Z71A 1BJUA 1NROH 1ELDE 1HYLA 3KF2A 2FWWA 4CRCA 1UTPA 3B8JA 4OS1A 1GBJA 3SU6A 1AN1E 1J15A 5JBTA 3M5OA 4I32A 4OS6A 5LPRA 1GJ8B 3H7OA 1TYNA 1L1JA 3SBKA 1P05A 1ORFA 2ZTXA 2P3FH 1J16A 4K5ZA 3GOVB 3C27B 2OTVA 1Y3YA 4B6EA 2VWOA 2R0KA 1C2EA 2WZQA 1P12E 2A4RA 1X7AC 3K6ZA 1EOLA 1S0RA 3PV4A 1O2VA 1ETRH 3G01A 3BTME 4U2WA 3RMOH 2P95A 2C8XB 1QBOA 1GBIA 2F9BH 1C1SA 2YOLA 2FDAA 1TA2A 1NT1A 4X2VA 1H8IH 5AFZH 2IJOB 3PYHA 2Q6GA 3EGKH 2NWNA 1WYKA 1GI9B 3O8BA 1C5QA 2R0LA 2ZNKH 3HGPA 3A7XA 1OWHA 3PB1E 3RU4D 1SGYE 2RG3A 1O39A 3RXUA 1LVBA 1P10A 2BM2A 1CBWC 1XUHA 1RTFB 3IG6B 3T26A 2GTBA 2G81E 1XKBC 3RXEA 4H4FA 2AIPA 1SGEE 5DG6A 1TQ0B 3SNBA 2F83A 2J34A 1GJ7B 4CHAC 3A85A 1ELCA 1JWTA 4ZXYH 1V2QT 2VWNA 5BPEA 4NA9H 1KXCA 4BTIB 1NO9H 4A92A 1ZZZA 4GHTA 3RC4A 1Z8GA 1MTNB 2A5AA 2PKAB 3QLPH 3GCHB 3R3GB 4IGDA 1Q3XA 1PPZA 1LO6A 3U8OH 1J14A 2AGGX 4F49A 1YPLH 3KEEA 1JXPA 1V2PT 1O32A 2C8WB 7GCHG 4MVNA 1H8DH 1JBUH 1MCVA 3SNAA 3TLOA 5C5NA 2ZEBA 3Q3KA 1CHOF 4HI3A 1Y5BT 2RA3A 1ZYOA 2G00A 4FXGH 1XMNB 1KLJH 4KTUA 1BRCE 1ESTA 1BRBE 2PGQB 3TJUA 3HK3B 3FVFB 1CO7E 1TGTA 4MNXA 2A7HA 1FY8E 3QWCH 2ZIQH 4YM9A 1O2NA 3EQ0H 1U6QA 1HAXB 3IITA 4CRBA 2TGAA 5L30H 2BDIA 3MOCA 2J4IA 3GISB 1EUFA 1O3JA 1FAKH 2BQ6B 2BHGA 3UY9A 1LVYA 4ZKOU 1SHHB 2ZFPH 1EOJA 3BTTE 4HZHA 1O2IA 2O8TA 2GD4B 2ZHDA 4M7GA 5C5OA 3O8DA 5EW1H 1UVTH 1MAXA 4YESB 1GHZA 2HVXA 2PKAA 3KHVA 4MNYA 1Q31A 2Q1JA 1KXFA 5ESTE 5HM2A 5FCKA 1KDQB 1SOZA 2QXJA 2XBXA 3I77A 3SV2H 2VNTA 2VIOA 1QGFA 1UVSH 4WF8A 3RXHA 1QA0A 2BTCE 1FN6A 3UTUH 3P92A 3UNSA 5E8EH 1V2NT 2K1QA 2LPRA 1GI7B 3F9GA 4O9VA 4I33A 5F6MA 2B5TB 1TAWA 3TK9A 1E34B 3SHCH 1EXFA 1G30B 1TNHA 2M5TA 2ZPSA 3NK8A 4BXSA 1ZR0A 4GLYA 2WUCA 2TGTA 3T28A 1MTVA 2JH0D 2ZF0H 2C90B 3FANA 4NFEA 3ATWA 3HPTB 2PGBB 1S82A 1A5IA 1F2SE 3SZNA 3SGAE 2H1UA 2HOBA 2BQ7B 2FOMB 1FQ3A 1SGCA 1O31A 1FXYA 1S81A 1ZSKA 3M7QA 4X0WU 3V3MA 1ANCA 1SB1H 3B9FH 3S69A 4XOJA 4X2YA 1QY6A 1HRTH 4JZIA 4CR9A 4RKOB 4DOQA 4WWYA 1GL1A 2FOEA 1HFDA 3RXJA 1DPOA 1TOMH 3KQBA 4BANB 1SFIA 1FPCH 1QA7A 3DFLA 3MH5A 3SJ9A 1Y3XA 1KDQA 1C2LA 1N6XA 1QJ6B 2GDDA 1E36B 2QN5T 4HGCA 2STAE 3LC3A 2VIQA 1AGJA 3KNXA 3VXFH 4O3UA 2RCEA 1AFEH 3SV6A 1BITA 1GJAB 1GJ9B 2F4LA 3M61U 6GCHG 3SGQE 5K7RA 4X8TH 1NTPA 1GHBF 3SZEA 1DSTA 2AFQB 1YPMH 3GY6A 3QN7A 1E37B 4BAKB 3GICB 4IMQA 1SPJA 1MTSA 3E1XB 3RXOA 3UIRA 4UFFH 1DM4B 1ZTLA 1IHTH 3D62A 2XNIA 2BB4A 1S5SA 5A2MH 1YCPK 2ODYB 4VGCC 1ELEE 4FUCA 4TY6A 3LT3A 3URDA 2TGPZ 1A46H 2DE8A 1MD7A 1IOEA 1AB9B 1DITH 1HXEH 1VCQA 1WBGB 4B1TA 3A7YA 2ZFQH 4IC6A 2PUXB 1V2VT 2QC2A 3U1IB 1ZHRA 1OP0A 4ZHMU 3HKJB 1PPFE 2TRMA 2SNWA 4MPVA 1LHCH 1TX7A 3MO3A 6GCHF 2HNTC 4UDWH 3FP7E 4WH6A 1EPTB 1W11U 1CGHA 1NESE 3FP6E 4E7RG 6CHAC 2A7CA 4B2CA 1XUIA 2ZFFH 1AUJA 2H9TH 2F9VA 1FMGA 1BB0B 3EA9A 2XBVA 1CT2E 1YCPH 1HJ8A 1UTOA 4Q7XA 1W0ZU 1O3EA 2ANMH 1O33A 4H6TA 3OTJE 3CP7A 3U8RH 1AVGH 4WMFA 5A8XA 3K6YA 4UFDH 1RRKA 2ZTYA 4MNWA 4Q7ZA 2TPIZ 4X1SU 3CS7A 3SU3A 4IW4E 3Q76A 1A0JA 1YPGH 4UE7H 4XE4A 2B0FA 2XCNA 1HJAC 1N1LA 2GV7A 4F4OC 5BRRE 1ETTH 1BOQA 1XUFA 2XC5A 2PSYA 1HAGE 2ILNA 4X1RU 5EQQA 5E0GA 1RIWC 1GVKB 3PMAB 1GBCA 1P06A 4D7GA 1G37A 1ABJH 1QB9A 4Y8YA 1LPGB 1VJ9U 3LC5A 2GMTB 4GUXA 5FPYA 2F9PA 2XXLA 2R3UA 3GY4A 5K0HA 4ABJA 1CT4E 1O37A 3UFAA 1GJCB 2NU0E 3A83A 3DFJA 2WV9A 1UO6A 1DVAH 1O3BA 1SGQE 4KKDA 4MPWA 1EPTA 4JZ1A 2ANWA 2OC1A 4NIWA 1K2I1 2QYIA 4WMDA 2O9QA 3LOXA 3TPIZ 4RSPA 1FAXA 1W0YH 4INHA 1QBNA 2C93B 5ETXA 1KLTA 4ISLA 3ZZAA 4AG2A 4BNRA 5JBBS 4CRGA 2SGDE 2HALA 4ESTE 3LJJA 4TPIZ 1PPHE 3LIWA 1HAPH 3ZZ4A 4GSOA 1O2LA 3FAOA 1CHGA 2OQUA 4M9FA 1S6FA 1YPHC 3MO9A 3TJNA 1GMDF 1YPJH 3RXKA 3BTWE 3RXQA 2GV6A 1GI8B 3L3TA 3URCA 1QQ4A 2A31A 4OS7A 1MQ6A 1DWCH 3MU5A 5L2ZH 3K2UA 2HNTE 4Y71A 5PTPA 4ZMAH 2F3CE 3P6ZB 1UTKA 1C1QA 1TGSZ 2BD7A 3LH1A 2B8OH 3SQHE 5JPMH 4YT6H 2ESTE 3MTYA 1RJXB 1QL8A 1C1TA 3A80A 4X6PA 3JZ2B 5GIBA 2GX4A 2JH6D 4FU7A 1GI0A 3SYJA 1SQAA 4XDEA 3SNEA 1DX5M 1K21H 1C4U2 2WHXA 4MPUA 1DY8A 4JCNA 5JBAS 5HMAA 1AVWA 1Z6EA 5E0JA 4NIVA 1Y3UA 4GAWA 3SV8A 2VU8E 2WPHS 2WUBA 3SN8A 1KXEA 4UONA 4FUHA 1YLDA 3GCNA 1WCZA 2ZU3A 1TABE 3D49H 1GG6B 3GCTF 5FBIA 2BLVA 2ZFSA 1BTWA 1W14U 1GWAA 1GJ4H 4BAQB 5JYIA 2H5DA 3SOSA 1DT2A 1ZMLA 1MH0A 1GBLA 3GY3A 1UJ1A 3M36A 2EI6A 2PUQH 1IHSH 1GHWH 4E05H 2B7DH 3BTKE 1MTWA 1AQ7A 1HAHH 1O5AB 3RMNH 5I46H 1EAIA 2QGRA 1A0LA 1CU1A 1MTNC 4I8KA 4DY7B 2R3YA 4RI0A 2PKSB 3GCHC 1D6RA 1TNKA 1DUEA 2ASUB 4YLQH 2GCTC 3PLKA 4X8VH 3BTFE 3M5LA 1TNLA 1G3DA 2TBSA 1DSUA 1MKXK 1O3AA 1IQFA 4AOQA 2FTLE 1TALA 1JOUB 1K9OE 4WVPE 3RXMA 1G9IE 4ZUHA 5DP9A 2A7JA 8ESTE 2C3SA 2ZCLP 1FY3A 1GDQA 1UVPA 1NPMA 4DIHH 1C1MA 4A7IB 1SSXA 2ZPRA 1VZQH 2W5EA 1DICA 1P3EA 1T8LA 4Y6DA 1C5PA 1C9TA 2GT8A 1THSH 1Y59T 4ZKNU 4CBOA 2G51A 1K28D 1YPEH 2WV5A 3R0FA 1BTYA 3KN2A 4JZFH 2ZI2H 2FOHA 3E0PB 3RXGA 1AWHB 4H6SB 1ELTA 4ZKRU 4AORA 1ELBA 2GZ9A 5FXLA 3VFEA 5EQRA 4ABHA 2EI7A 1A5HA 1JMOH 5ESBA 2ZU4A 1BHXF 1BHXB 5ABWA 3FZZA 1OWDA 1CA8B 5G4BA 7LPRA 1ZOMA 2UWOA 1NRNH 1VITF 1EQ9A 2FOFA 3A84A 5C1YA 1MKXH 3LGWA 3CENA 3NZIA 1VGCB 1NM6A 1O3NA 4D9RA 3H7TA 3SI4H 2ZHEH 3EA7A 1GBAA 2OLGA 5F8XA 1V2OT 2STBE 3SQEE 1O5FH 3AAVA 1UTNA 3SU5A 2VJ1A 4AN7A 3BEUA 3SJOA 3PMHB 1QBVH 1W8BH 1NZQH 1ZJKA 3S7HB 1SGTA 2JH5D 1C5VA 3KQCA 3LPRA 1FONA 3T25A 1VR1H 4YLUA 1K1PA 4K3JA 2R9PA 4Y0ZE 1Y3VA 4BAMB 3PV5A 1MU6B 4A1TA 1W10U 4B74A 4ABEA 1GBKA 2P8OB 1LDTT 3A86A 2QXIA 1O2XA 3VB7A 1T8OA 2FI3E 1UK3A 1SMFE 1SG8B 2YNBA 4ISIH 1TPAE 1J17T 1KLIH 3PMBB 4X1QU 2BLQA 1QRXA 2H6MA 1P2IA 2ZGXH 1P2OA 1K1NA 5DP3A 2BOHB 2FI4E 3GYMA 4DJZB 3UUZA 2BZ6H 2ODPA 1ID5H 3SU2A 3M5MA 1F92A 1QB6A 1FLEE 2ULLA 3BN9A 2ZO3H 4ISNA 2BDGA 1NN6A 1P2NA 4JYVH 1ZMNA 1WTHD 5IYTA 4K1TA 1GHVH 2Y7XA 1EZSC 3LDXH 2KAIB 1T4VH 4Y7BA 3ENSB 3PM3A 2OD3B 1OYTH 1GBDA 1Y8TA 2JETB 2ZFTA 3F9FA 5EOKA 1K1IA 3ZVBA 5T6GA 5JBCS 4WMEA 1CHOG 3O8RA 1PQ7A 2BQWB 3D23A 2J2UA 2FZZA 1QRZA 1P9UA 1O35A 4XBCA 3TGKE 2D1JA 1SR5C 3ODDA 4MTBA 4CREA 4GVUA 4X1PU 1TBQH 1SVPA 1SL3A 1BRAA 3ZZ5A 2EEKA 2VVCA 4NWLA 4Y11E 1OWEA 1LHFH 2BYAX 3TH3H 4MNVA 3GCOA 3VB6A 2SGPE 1UCYK 1V2WT 2EI8A 1P03A 1BMNH 3PWCA 1WUNH 1VCPA 1AKSB 1AB9C 2BXTH 4AFUA 3PO1B 4K2YA 3SJKA 1WSSH 4Y10E 5FPSA 1K1OA 2CMYA 1VITH 1MUEB 1O2SA 4YOGA 3DD2H 1FJSA 3RXLA 3T29A 1THPB 1SHYA 2ZQ1A 1TONA 1N8OB 1F5KU 1A7SA 2ZDMA 3BSQA 1RGQA 1TMBH 1OOKB 2OXSA 1TPSA 1MAYA 1ZLRA 3SUGA 3A88A 1BQYA 3RXDA 1DY9A 1GDNA 4B6FA 3QTOH 1DUAA 1O2YA 2ZZUH 2KAIA 1C5NH 1GBMA 1EZUC 2QY0B 4OGXA 5GCHF 3H09A 2A1DB 1BZXE 4FUJA 4O03A 2XRCA 1DLKB 1UTJA 1HIAB 2ZGJA 2I6SA 4ZHLU 2WPKS 1ACBE 1UCYH 4RN6A 1S84A 1BMLA 2F9NA 5DP5A 1DOJA 4X6NA 1AZ8A 1JRTA 3RC6A 4WY3A 3P8FA 4GPGA 1GMCG 5AF9H 1J9CH 1F0SA 1WQVH 1NFYA 1SGIB 3DHKH 2A4GA 3QO6A 3GY7A 3V0XA 1KSNA 1O0DH 1AHTH 1OWKA 1L1NA 1V2KT 2H9HA 1ZGVA 1TMTH 1IQNA 4JZDH 4YTAA 3CS0A 1YM0A 2SGAA 1AKSA 4E06H 1GDUA 3M5NA 2BX4A 2WPMS 4CRFA 1HUTH 5L2YH 2BX3A 2BDCA 3QDZB 1WTGH 2Q6DA 3RLYH 1ZTKA 1EASA 4XSKU 2HPPH 1GBBA 2ZGBH 2J94A 4JZEH 1MBQA 1D9IA 4AB8A 1SOTA 4INKA 3RXSA 2J9NA 3U1JB 2XWBI 2QF3A 5A0BA 4CH8B 1W3CA 3OY5U 1GMCF 1TX8A 1HPGA 4FVBA 4AGKA 1ETSH 1GCDA 1QRWA 4THNH 1SBWA 2FP7B 2GCHF 2HGTH 1RD3B 4I8GA 1T8NA 3MWIU 5C67A 4TWYA 2C4FH 1HIAA 3S9CA 3RU4T 1UTMA 3SW2B 1C5TA 1DS2E 1FNIA 3VB3A 2G5VA 4TWWA 1GHBG 2Z9LA 5FBEA 3BEFB 1UK2A 4I8JA 2XWAA 8KME2 3A8AA 3RXPA 1P3CA 1Y3WA 2ZDKA 3M37A 1C2IA 4UFGH 1SLXB 1ZGIA 1C1PA 2P3TB 2WV4A 3A87A 5DGJA 2ZHQH
chains in the Genus database with same CATH superfamily
1SQTA 3GS9A 3RUOA 1AVXA 1BTHH 2ALPA 2OK5A 3SI3H 5GDSH 2GGVB 3GDSA 2W6ID 3LGYA 4ABGA 1TIOA 4FUDA 3W95A 3DT0H 1C2MA 2BDHA 2FLBH 2Z94A 3STIA 1BBRK 1MZDA 1YKTA 2BLWA 5FHTA 3NWUA 5EPYA 5E2OA 1GCTB 2VGCB 1FPHH 2ZU1A 3UREA 1C1NA 2QCYA 1NFUA 3LKWA 4FU8A 2SGFE 2FM2A 3TITA 4A5TS 2BD2A 4AYYB 1V2LT 5TCCA 1AE8H 1THRH 9ESTA 4QT8C 1C2KA 3HGNA 4UEHH 1AFQB 2ZU2A 1GI5A 1KXBA 2W3KA 4BOHA 2A4QA 1CVWH 2ZQ2A 2HVYB 2Z7FE 3EAJA 3ZVFA 2FOBA 1TGCA 2KCYA 2HPQH 4MQAA 1NFXA 1YLCA 3U9AH 4CR5A 2W3IA 1MTUA 1V3XA 2GP9B 2TGDA 1OWJA 2K8IA 4ZKSU 1NU9A 2ZCHP 3UQVA 1O3PB 1GG6C 4MG3A 1NBMD 1O3LA 2Y6TA 2FI5E 2CN0H 3KQEA 3SUEA 3UR6A 4HTCH 3MH7A 1YPKH 1BBRH 3WWBA 3VG8A 1YGCH 2Y7ZA 4NA8A 3OY6U 1Y5UT 3SJIA 2LNCA 1A1RA 3HKIB 1DDJA 1NRQH 3FO8D 4IN1A 5KEDA 2BDBA 5EU8A 1QB1A 3DUXH 1NY22 3I78A 5HGGA 4B75A 3A7VA 2ZHFH 2CHAC 1XXDA 5LPFA 3A8CA 5F8ZA 3SV9A 1Z6JH 1UTQA 5A09A 2L6OA 1O3CA 1C2HA 1C1UH 1DWBH 1NC6A 2QV1A 2VIVA 1T8MA 2CF8H 1LPKB 2RFKC 2ANKH 5EPNA 4GHQA 1GVLA 1ELAA 1IQJA 1GMHG 1IQLA 3SUDA 3A89A 4B76A 4FUEA 2J92A 1DANH 1XXFA 1GI2A 1V2TT 1EZQA 2L74A 1HXFH 4B2AA 2P94A 4DW2U 2EA3A 3PWBA 2BD9A 4YOIA 1MZAA 1O2OA 1O3GA 1Z1JA 4A1XA 3NPSA 1J8AA 3S9AA 1GJBB 1LHEH 3RDZA 3ZYEA 1HDTH 1TNGA 1TRMA 2RA0A 3PMJA 4INLA 2A4OA 2PSXA 3TIUA 2Y5HA 4DIIH 2DUCA 1T7CA 2BZAA 3TNTA 1VJAU 3M3VA 2OINA 3ZZDA 2WPJS 1C2JA 4FETA 2OUAA 1GMDG 1PFXC 1OS8A 2SGEE 4D9QA 3KIDU 3M3TA 1F0TA 1DXWA 1QIXB 3M7TA 4BTTB 3Q3XA 3BG4B 4LZ1H 4UFEH 2UWLA 4ABAA 1BIOA 1GMHF 2BD8A 5DP6A 1WXRA 2ALVA 1EX3A 2AMDA 2BD4A 1FIZA 2W26A 1TPOA 2VVVA 3S7KB 1SC8U 2BY7X 1FDPA 1B0EA 3ZV9A 3SUFA 5A8YA 2ZHWH 3MU1A 2IOTA 3ATLA 3F6UH 1TX6A 1N6YA 2Z9GA 3MH4A 2FS9A 2IN2A 1EJMA 3NXPA 2BMGB 3MFJA 2PHBA 1Y5AT 3ZVDA 2UUJB 2XBYA 1FN8A 2BVXH 2BY9X 4BXWA 1ZMJA 2FOAA 4IN2A 1GBFA 3TJOA 1H8ED 3A7WA 4NCYA 1KYNA 1EATA 2A5IA 1GBTA 5CHAB 4IC5A 3JZ1B 3F68H 2ZGCA 2FIRH 1KXAA 2TIOA 1HAVB 3GCTG 2PTCE 3FP8E 4HG6A 9LPRA 1NRSH 2UWPA 2P8OC 2WPIS 4FUIA 1RS0A 1FY1A 1KXDA 3F9HA 2Z9KA 3ZZCA 5CDFE 5J4QA 1TB6H 4B73A 1A3EH 2J97A 3P95A 1A3BH 5CHBA 1PPCE 3A82A 3EYDA 2W7UA 2ZC9H 2FX6A 1BDAA 3LH3A 5C20A 1F5LA 3U69H 3BTDE 2BVSH 1TA6A 2XNDD 4K1EA 5T3HA 1O2KA 4ABDA 5AVDA 2THFB 1OSSA 3RXAA 1G32B 2HLCA 1A0HB 1LPZB 2W6JD 3SHAH 4K1SA 2XC4A 1P01A 1IQEA 1CSOE 2BY6X 3TH2H 1Z8RA 4B2BA 1O2QA 2OP9A 1G36A 1WAYB 2VBCA 5GWZA 3RXBA 1HAIH 1FZZA 2G5NA 2JETC 1O2GH 3EE0B 3KGPA 3OX7U 4WXVA 4VGCB 5I25A 3QGJA 2NU3E 5J4SA 3EDXB 5GPIB 3SU4A 4I7YH 3QX5H 4BAOB 2Z3CA 2JKHA 2QF4A 2SNVA 4YT7H 2GT7A 2ZKSA 4K8BA 1ELGA 1Z7KA 1HAVA 5C1UA 2Z9IA 4KTSA 3UWJH 1WU1A 2XBWA 1G2LA 5F8TA 2KZ4A 5FPTA 1GGDB 1C1OA 2Q6FA 1TMUH 1LKBA 4X8UH 4Y8ZA 5DP7A 2EY4C 1EJAA 1VCWA 3W1EA 4AFSA 1BT7A 1QNJA 1C5RA 4NSYA 1YWUA 3PO1C 1K22H 1K1MA 1TBZH 1TRNA 1YF4A 1YYY1 2KCOA 2PV9B 8GCHF 3E3TA 4DG4A 4U30A 2FYRA 3E6PH 1GJDB 1C1WH 4OS2A 3AK5A 4NZQA 2AMPA 3K9XB 1A2CH 1VITG 2O8MA 1JIRA 5AFYH 1P8VC 1N8OC 1AD8H 1P57B 2VIWA 4XD7D 3TJVA 1C1VH 3QGNB 1C5LH 2EC9H 3A8DA 2P16A 4JYTA 5FX5A 5E0HA 1S0QA 3T62A 1H1BA 5EJZA 5LH8A 3D65E 3KQDA 5T6FA 1M9UA 2D26C 3S0NA 1FI8A 1C1RA 2AYWA 1D6WA 1TGBA 1UCYE 2P93A 1P2KA 1MABB 1WOFA 1V2MT 3PTNA 4SGAE 1AO5A 2V3HH 1RIWB 1P2JA 3RM0H 1OKXA 4XBBA 1D3TB 4YOJA 1LVOA 4YXWD 3QUMP 4Q2KA 4SGBE 3ATKA 3MNXA 3MNSA 1D3DB 2BXUH 3QK1A 1GHXH 1C2GA 4Q80A 1CGIE 1GI3A 1O38A 1XM1A 1TQ7B 1CGJE 1RTKA 4D8NA 1SGFA 1ABIH 1B0FA 5GNDA 2ZDAH 1H9IE 1V2UT 3E0NB 4YO9A 4NWKA 1ZPZA 2IJD1 5DJ7A 3TK6A 2FOCA 4CRDA 2CF9H 6LPRA 1A5GH 4TYDA 2BDYA 3U8TH 2ZDNA 5CE1A 4P00A 1LQDB 5IDKA 1D4PB 1TNIA 1NFWA 3V13A 4Y76A 3TGJE 1C5UA 1IQKA 3P8OA 1QFKH 3T27A 2XW9A 1C9PA 4X6MA 1LQEA 1O30A 2BVRH 3LONA 3N7EA 2Z6BD 1WQSA 1S83A 3F2GA 4WXIA 2ZCKP 1BMAA 4OS5A 4ZXXH 5C2ZA 2BY5X 1KTTB 1ZJDA 3I29A 1PQ8A 2B9LA 5SGAE 5AHGH 2BD3A 1XVMA 1BMMH 1ZPCA 1G3BA 3NCLA 1B7XB 1C5MD 1VKYA 4TT3D 4CH2B 4R8TB 3RXRA 4YZUA 2CGAA 4XBDA 2XTTB 4X1NU 1A61H 1G3EA 4AZ2B 1P09A 3ZIAD 4AGJA 2J98B 4OM9A 1EJNA 5HIYA 3M7UA 1SGDE 2FYQA 1LMWB 1EAXA 4MPXA 3ZZ8A 1SGPE 3UB0A 3W94A 4K8YA 3UPEA 1RFNA 2ZPQA 2OBOA 2G8TA 3RXFA 1O5GH 3ZV8A 1GCTC 3A7TA 3MYWA 2VGCC 5DP8A 1TPPA 3DSOA 4DVAU 1EKBB 2VIDA 1HLTH 3UNQA 1O2JA 3VGCB 1O2MA 1MBMA 2A5KA 5CMXH 1BTUA 4WJG2 1YCPM 1AFQC 2OCVB 1YC0A 2PFEA 1HAYB 2J5UA 7ESTE 1GVZA 3OU0A 1ANDA 1PPBH 5EQSA 5GCHG 4IBLH 2ZG0H 1WDIA 4JMYA 1LVMA 4IS5A 3AW1A 2QF0A 2PW8H 2A2XH 1OP2A 1GI4A 2AERH 3VEQB 4BTUB 3LJOA 4I8LA 1BBRE 3RM2H 1Z8JB 4NG9H 1YLNA 2GZ8A 4ZHAA 4CRAA 1UHBB 2IPHA 2DE9A 1CE5A 4NGAH 2J98A 3SORA 2JDID 1O2WA 1IQGA 5DK1A 3RLWH 1D3QB 2WINI 1H9HE 1EPTC 1PYTC 1SGNE 2Z3DA 4D7FA 1F7ZA 2GCTB 2F91A 2QE7D 2QXHA 2ZDVH 3DA9B 1QZ8A 2BLOA 3NRLA 1AWFH 1O5EH 2SFAA 4AG1A 1O5CB 2VWMA 1SQOA 2Z9JA 2Y82A 1P2QA 3L33A 4ZH8A 1F0UA 2PLXA 1AY6H 5EXMA 2VWLA 4X6OA 3O8CA 5DO4H 3AASA 3BTEE 4B71A 2IPQX 3RXCA 5JDUB 2RDLA 1SQRA 2QAAA 1GHYH 3BTHE 2CV3A 2ZTZA 1FUJA 4NZLA 3P17H 3MU0A 1O3KA 3LGVA 3OSYA 1G3CA 1O2ZA 3RXVA 3QZRA 4AFZA 5LGOA 2AMQA 1O3HA 2GCHG 1HJ9A 2H9EH 1C4Y2 3F9EA 1W7XH 3TU7H 1ESAA 2FS8A 5A0CA 3A7ZA 4AX9H 2OC0A 1XVOA 4NSVA 2HRVA 2HLDD 2A2QH 4U01A 2O8UA 7GCHF 1CA0B 1V2JT 1BRUP 2ZWLH 3BG8A 1BCUH 2GMTC 2OBQA 3KCGH 2YMSD 2G55A 1PJPA 1D3PB 5GXPA 1UHBA 2VVUA 3VB4A 3E91A 3OEED 1EAWA 2V3OH 1NS3A 3N7DA 2G4TA 4DT7B 4BAHB 4U32A 4Y79A 2W7SA 1GI6A 1O2RA 2CXVA 4IMZA 3MNCA 1C2FA 2GDEH 3ATMA 1EP6A 3BG4C 2J95A 4J1YA 3ZVAA 1FIWA 3STJA 4ACBA 2RDEA 2FTMA 1FY4A 1O2HA 3PROA 1OXGA 1E79D 1T4UH 2GVFA 4JYUH 4ABIA 4D76A 3HATH 2A32A 1S6HA 1O2PA 1MCTA 5FL7D 4ABBA 4LZ4B 3V7TA 1BTXA 2A0QB 1P9SA 1O2TA 1JIMA 2D2DA 3BV9B 5C94A 4NIXA 1O5BB 3UWIA 1L1GA 2WPLS 1DFPA 2FEQH 1CT0E 3MO6A 1G2MA 5GJ4B 3U98H 2NU4E 1O3DA 2QF5A 2ZA5A 1DWEH 3PV2A 4XFQA 4AB9A 5CHAC 1TOCB 1L4DA 3SGBE 1INCA 5DPAA 1JRSA 1O34A 3N7OA 3SNCA 4Y7AA 2P59A 4I8HA 5JB9S 1CQQA 2OQ5A 3ITIA 4DT4A 1C5XB 5KGOA 3UNRA 2AIQA 3LU9B 1XUGA 1H9LB 2VB0A 5HM9A 3E90B 1LHDH 4ABFA 3S9BA 4TY7A 5C0UA 1O3MA 1QURH 2R2MB 3GY2A 2YNAA 1PPEE 1TRYA 3NKKA 4A1VA 2Y80A 3M35A 4Y0YE 1HV7A 1W7GH 1CBWB 2XCFA 5B6OA 1MQ5A 4ZROA 1AE5A 1BA8B 3E16B 3SJ8A 1HNEE 1NRPH 1QHRB 2GZ7A 4LOYH 1QTFA 2FMJA 3UQOA 1ELVA 3ZZBA 1O3OA 1SLUB 4CHAB 2Y5GA 2V35A 2BD5A 3BIUH 1TNJA 1T32A 2FOGA 4J2YB 5C1XA 3A81A 1QQUA 1HB0B 4P02A 1ARBA 2ODQA 1GBEA 3ODFA 1K1JA 5EW2H 1TE0A 1Q2WA 2O8LA 3FZDA 4FUBA 5EXLA 3ATIA 3MH6A 1B5GH 2Y81A 1L4ZA 3ZZ9A 4TPYA 2FODA 5EIYA 1HAZB 1UK4A 3SU1A 3FFGA 4LK4A 2QIQA 1GGDC 1XUJA 2QA9E 1Z8IB 3GY5A 1UVUH 1AI8H 2FESH 3EA8A 1TGNA 4WH8A 1GI1A 2PKSC 1AZZA 2FO9A 3PRBA 4HFPB 3QZQA 3OFND 3Q3YA 1TFXA 4X2XA 1EB2A 3B23B 1C5ZB 4AFQA 4RKJB 1C5WB 5EODA 3E8LA 4Q7YA 1S85A 1HBTH 4OGYA 1AMHA 2I6QA 4JK6A 3TH4H 4KP0A 1P0SH 5L6NH 2BOKA 3RXTA 1KIGH 1AU8A 1TWXB 1W2KH 2UUYA 2A45B 3P8NA 1QJ1B 1MD8A 3SO3A 2ANYA 2ZECA 5FX6A 2NU1E 4NIYA 2OC7A 2VH6A 2CJIA 1ARCA 2UUFB 5TJXA 2PTNA 1IQMA 3IWMA 1LTOA 4NA7A 4Y8XA 3LGUA 2LELA 2AH4X 3TNSA 1QR3E 2V6NA 1NU7B 3VB5A 1OWIA 4O97A 4DURA 1AUTC 2AS9A 3KL6A 5EGMA 2Z3EA 4MDSA 5A0AE 1GL0E 2HWLB 2D8WA 1QL9A 4DGJA 3UOPA 5DSFA 3ZZ6A 1PYTD 3V12A 3VPKA 3ELAH 1F5RA 1O2UA 4R0IA 1VGCC 3SU0A 1MKWK 3ZVCA 2O8WA 1ELFA 3GDVA 1ESBA 3SNDA 1QL7A 3WW7A 3Q77A 1BMFD 2AGIX 2OC8A 2PWXA 1P04A 1EAUA 1H4WA 1SLWB 3FKSD 4ISHH 3A8BA 2VIPA 5EG4A 5F03A 3TGIE 3VXEH 1OHHD 1UVOA 2FXRA 5HIZA 1XX9A 3PTBA 3WY8A 4ISOA 1ANEA 5TCAA 4A6LA 3BTQE 1BJVA 1OP8A 1HCGA 4UD9H 1ANBA 3MMGA 2XYAA 1UTLM 3ZVEA 3T2NA 7KMEH 3QTVH 3KYFA 2WYJA 3BTGE 1V2RT 1EZXC 3MI4A 3ZVGA 1HGTH 3MU8A 1SFQB 2SGQE 1E38B 1LCYA 4MLFB 3P70B 1P02A 5HKKD 4Z0KA 3LGIA 1FY5A 3H5CB 3RMLH 1W13U 1MKWH 1QCPA 4KGAA 5FAHA 2GKVE 3CNRA 1LHGH 3TVJB 1O5DH 1GBHA 1E0FD 3MHWU 4KTCA 5E2PA 1GJ5H 5FCRA 3LGTA 1NRRH 2F9OA 5B6LA 2ZFRH 1E1RD 1O3FA 2BY8X 1SLVB 4F48B 5A8ZA 3BF6H 4DCDA 2FPZA 1SGFG 5HXFA 2Y5FA 8GCHG 1KY9A 1Z1IA 2EQNA 6ESTA 1LKAA 1V6DA 1ZRBA 4LXBH 4FU9A 4KELA 2F9UA 2AEIH 3RXIA 3RC5A 4Z6AH 1EP5A 1C2DA 1GPZA 3PLPA 4O3TA 1GJ6A 1V2ST 4X8SH 5EJLA 3VGCC 1DWDH 2PP6A 5JB8S 1W12U 4JK5A 3DSPA 2NU2E 1DXPA 2XC0A 1MU8B 1IQHA 3F1SB 2G52A 1MMJN 2ZU5A 1XKAC 3OTPA 1P2MA 2BDAA 1SKYE 2PR3A 1YP9A 3C1KA 2HNTF 2ZGHA 4K60A 2FLRH 3OEHD 3ESTA 1ZPBA 2KCPA 6CHAB 1HAOH 1EB1H 1QJ7B 1SI5H 1FX0B 3PLBA 3Q00A 4FUFA 1PQAA 2CHAB 1O36A 3MU4A 1KTSB 4AYVB 4GCHG 1C4V2 1TBRH 3U28C 1L0ZA 2H5CA 4OS4A 3UOUA 4K69A 1OYQA 3P8GA 4X2WA 1RXPA 1ZSLA 3RU4E 1BTPA 4CBNA 2H2ZA 4H42U 3NUMA 1WV7H 1DE7H 1T31A 4FVDA 1IAUA 2ZP0H 2UUKB 5DKMA 2WYGA 3BEIB 1BUIA 4ASHA 4NFFA 3L6PA 3TK5A 2VINA 1FV9A 3GY8A 2V0BA 2J38A 1SGRE 4PROA 1UMAH 1P11E 1YBWA 1HJAB 4ZAEA 1RTLA 3AW0A 3HK6B 1PPGE 1K0HA 2R2WU 1AIXH 2P3UB 2ZDLA 3K65B 1YPHE 3MNBA 1GHAG 1BTZA 2G4UA 1ZHPA 3AVZA 3BIVH 1C5SA 3ZYDA 2AGEX 4GCHF 2F43B 3OYPA 3GDUA 2C8YB 3M3SA 1C5OH 1OPHB 1PQ5A 5C3NA 1DLEA 3ZZ3A 3AAUA 5T1VA 1K1LA 1TLDA 2VH0A 2QXGA 1L2EA 5LPEA 1ZTJA 1OX1A 1O3IA 1E35B 3RP2A 1F0RA 1CA0C 3ZZ7A 4I31A 2C8ZB 1IQIA 3T5FH 1C5YB 1ZHMA 4E7NA 3GYLB 1ZRKA 1XUKA 1ZSJA 3SV7A 3F0PA 5T6DA 8LPRA 5HYOA 5H4IB 2FX4A 5DP4A 3UR9A 1GHAF 4FUGA 3RMMH 1A4WH 5EXNA 1Z71A 1BJUA 1NROH 1ELDE 1HYLA 3KF2A 2FWWA 4CRCA 1UTPA 3B8JA 4OS1A 1GBJA 3SU6A 1AN1E 1J15A 5JBTA 3M5OA 4I32A 4OS6A 5LPRA 1GJ8B 3H7OA 1TYNA 1L1JA 3SBKA 1P05A 1ORFA 2ZTXA 2P3FH 1J16A 4K5ZA 3GOVB 3C27B 2OTVA 1Y3YA 4B6EA 3FN8A 2VWOA 2R0KA 1C2EA 2WZQA 3KYGA 1P12E 2A4RA 1X7AC 3K6ZA 1EOLA 1S0RA 3PV4A 1O2VA 1ETRH 3G01A 3BTME 4U2WA 3RMOH 2P95A 2C8XB 1E1QD 1QBOA 1GBIA 2F9BH 1C1SA 2YOLA 2FDAA 4TSFD 1TA2A 1NT1A 4X2VA 1H8IH 5AFZH 2IJOB 3PYHA 2Q6GA 3EGKH 2NWNA 1WYKA 1GI9B 3O8BA 3FOAA 1C5QA 2R0LA 2ZNKH 3HGPA 3A7XA 1OWHA 3PB1E 5DN6D 3RU4D 3KQ5A 1SGYE 2RG3A 1O39A 3RXUA 1LVBA 3N99A 1P10A 2BM2A 1CBWC 1XUHA 1RTFB 3IG6B 3T26A 2GTBA 2G81E 1XKBC 3RXEA 4H4FA 2AIPA 1SGEE 5DG6A 1TQ0B 3SNBA 2F83A 2J34A 1GJ7B 4CHAC 3A85A 4ACAA 1ELCA 1JWTA 4ZXYH 1V2QT 2VWNA 5BPEA 4NA9H 1KXCA 4BTIB 1NO9H 4A92A 1ZZZA 4GHTA 3RC4A 1Z8GA 1MTNB 2A5AA 2PKAB 3QLPH 2YMSB 3GCHB 3R3GB 4IGDA 1Q3XA 1PPZA 1LO6A 3U8OH 1J14A 2AGGX 4F49A 1YPLH 3KEEA 1JXPA 1V2PT 1O32A 2C8WB 7GCHG 2GJGA 3F0OA 4MVNA 1H8DH 1JBUH 1MCVA 3SNAA 3TLOA 5C5NA 2ZEBA 3Q3KA 1CHOF 2CK3D 4HI3A 3MQKC 1Y5BT 2RA3A 1ZYOA 5EJ1A 2G00A 4FXGH 1XMNB 1KLJH 4KTUA 1BRCE 1ESTA 1BRBE 2PGQB 3TJUA 3HK3B 3FVFB 1CO7E 1TGTA 4MNXA 2A7HA 1FY8E 3QWCH 4ZCNA 2ZIQH 4YM9A 1O2NA 3EQ0H 1U6QA 1HAXB 1UW7A 3IITA 4CRBA 2TGAA 5L30H 2BDIA 3MOCA 2J4IA 3GISB 1EUFA 1O3JA 1FAKH 2BQ6B 2BHGA 2K0QA 1LVYA 3UY9A 4ZKOU 1SHHB 1NBME 2ZFPH 1EOJA 3BTTE 4HZHA 2M2AA 1O2IA 2O8TA 2GD4B 2ZHDA 4M7GA 5C5OA 3O8DA 5EW1H 1UVTH 1MAXA 4YESB 3DSGA 1GHZA 2HVXA 2PKAA 3KHVA 4MNYA 1Q31A 2Q1JA 1KXFA 5ESTE 5HM2A 5FCKA 1KDQB 1SOZA 2QXJA 2XBXA 3I77A 3SV2H 2LP6A 2VNTA 2VIOA 1QGFA 1UVSH 4WF8A 3RXHA 1QA0A 2BTCE 1FN6A 3UTUH 3P92A 3UNSA 5E8EH 1V2NT 2K1QA 2LPRA 1GI7B 3F9GA 4O9VA 4I33A 5F6MA 2B5TB 1TAWA 3TK9A 1E34B 3SHCH 1EXFA 1G30B 1TNHA 2M5TA 2ZPSA 3NK8A 4BXSA 1ZR0A 3EE7A 4GLYA 2WUCA 2TGTA 3T28A 1MTVA 2JH0D 2ZF0H 2C90B 2KM0A 3FANA 4NFEA 3ATWA 3HPTB 2PGBB 4Q63A 1S82A 1A5IA 1F2SE 3SZNA 3SGAE 2H1UA 2HOBA 2BQ7B 2FOMB 1FQ3A 1SGCA 1O31A 1FXYA 1S81A 1ZSKA 3M7QA 4X0WU 3V3MA 1ANCA 1SB1H 2XOKD 3B9FH 3S69A 4XOJA 4X2YA 1QY6A 1HRTH 4JZIA 4CR9A 4RKOB 4DOQA 4WWYA 1GL1A 2FOEA 1HFDA 3RXJA 1DPOA 4RT0A 1TOMH 1S6LA 3KQBA 4BANB 1SFIA 1FPCH 1QA7A 3DFLA 1COWD 3MH5A 3SJ9A 1Y3XA 1KDQA 1C2LA 1N6XA 1QJ6B 2GDDA 1E36B 2KX4A 2QN5T 4HGCA 2JJ2D 2STAE 3LC3A 2VIQA 1AGJA 3KNXA 3VXFH 4O3UA 2RCEA 1AFEH 3SV6A 1BITA 1GJAB 1GJ9B 2F4LA 3M61U 6GCHG 3SGQE 5K7RA 4X8TH 1NTPA 1GHBF 3SZEA 1DSTA 2AFQB 1YPMH 3GY6A 3QN7A 1E37B 4BAKB 3GICB 4IMQA 1SPJA 1MTSA 3E1XB 3RXOA 3UIRA 4UFFH 1DM4B 1ZTLA 1IHTH 3D62A 2XNIA 2BB4A 1S5SA 5A2MH 1YCPK 2ODYB 4VGCC 1ELEE 4Q4LA 4FUCA 4TY6A 3LT3A 3URDA 2TGPZ 1A46H 2DE8A 1MD7A 1IOEA 1AB9B 1DITH 1HXEH 1VCQA 1WBGB 4B1TA 3A7YA 2ZFQH 4IC6A 2PUXB 1V2VT 2QC2A 3U1IB 1ZHRA 1OP0A 4ZHMU 3HKJB 1PPFE 2TRMA 2SNWA 4MPVA 1LHCH 1TX7A 3MO3A 6GCHF 2HNTC 4UDWH 1W0JD 3FP7E 1H8HD 4WH6A 1EPTB 1W11U 1CGHA 1NESE 3FP6E 4E7RG 6CHAC 2A7CA 4B2CA 1XUIA 2ZFFH 1AUJA 2H9TH 2F9VA 1FMGA 1BB0B 3EA9A 2XBVA 1CT2E 1YCPH 1HJ8A 1UTOA 4Q7XA 1W0ZU 1O3EA 2ANMH 1O33A 4H6TA 3OTJE 3CP7A 3U8RH 1AVGH 4WMFA 5A8XA 3K6YA 4UFDH 1RRKA 2ZTYA 4MNWA 4Q7ZA 2TPIZ 4X1SU 3CS7A 3SU3A 4IW4E 3Q76A 1A0JA 1YPGH 4UE7H 4XE4A 2B0FA 2XCNA 1HJAC 2KCAA 5C0TA 1N1LA 2GV7A 4F4OC 3OE7D 5BRRE 1ETTH 1BOQA 1XUFA 2XC5A 2PSYA 1HAGE 2ILNA 4X1RU 5EQQA 5E0GA 1RIWC 1GVKB 3PMAB 1GBCA 1P06A 4D7GA 1G37A 1ABJH 1QB9A 4Y8YA 1LPGB 1VJ9U 3LC5A 2GMTB 4GUXA 5FPYA 2F9PA 2XXLA 2R3UA 3GY4A 5K0HA 4ABJA 1CT4E 4F55A 1O37A 3UFAA 1GJCB 2NU0E 2WV9A 3A83A 3DFJA 1UO6A 1DVAH 1O3BA 1SGQE 4KKDA 4MPWA 1EPTA 4JZ1A 2ANWA 2OC1A 4NIWA 1K2I1 2QYIA 4WMDA 2O9QA 3LOXA 3TPIZ 4RSPA 1FAXA 1W0YH 4INHA 5KECA 1QBNA 2C93B 5ETXA 1KLTA 4ISLA 3ZZAA 4AG2A 4BNRA 5JBBS 4CRGA 2SGDE 2HALA 4ESTE 3LJJA 4TPIZ 1PPHE 3LIWA 1HAPH 3ZZ4A 4GSOA 1O2LA 3FAOA 1CHGA 2OQUA 4M9FA 1S6FA 1YPHC 3MO9A 3TJNA 1GMDF 1YPJH 3RXKA 3BTWE 3RXQA 2GV6A 1GI8B 3L3TA 3URCA 2KR7A 1QQ4A 2A31A 4OS7A 1MQ6A 1DWCH 3MU5A 5L2ZH 3K2UA 2HNTE 4Y71A 5PTPA 4ZMAH 3UAIC 2F3CE 3P6ZB 1UTKA 1C1QA 2V3MA 1TGSZ 2BD7A 3LH1A 2B8OH 3SQHE 5JPMH 4YT6H 2ESTE 3MTYA 1RJXB 1QL8A 1C1TA 3A80A 4X6PA 3JZ2B 5GIBA 2GX4A 2JH6D 4FU7A 1GI0A 3SYJA 1SQAA 4XDEA 3SNEA 1DX5M 1K21H 1C4U2 2WHXA 4MPUA 1DY8A 4JCNA 5JBAS 5HMAA 1AVWA 1Z6EA 5E0JA 4NIVA 1Y3UA 4GAWA 3SV8A 2VU8E 2WPHS 2WUBA 3SN8A 1KXEA 4UONA 5F53A 4FUHA 1YLDA 3GCNA 1WCZA 2ZU3A 1TABE 3D49H 1GG6B 3GCTF 5FBIA 2BLVA 2ZFSA 1BTWA 1W14U 1GWAA 1GJ4H 4BAQB 5JYIA 2H5DA 3SOSA 1DT2A 1ZMLA 1MH0A 1GBLA 3GY3A 1UJ1A 3M36A 2EI6A 2PUQH 1IHSH 1GHWH 4E05H 2B7DH 3BTKE 1MTWA 1AQ7A 1HAHH 1O5AB 3RMNH 5I46H 1EAIA 2QGRA 1A0LA 1CU1A 1MTNC 4I8KA 4DY7B 2R3YA 4RI0A 2PKSB 2YMSC 3GCHC 2KFWA 1D6RA 2JJ1D 1TNKA 1DUEA 2ASUB 4YLQH 2GCTC 3PLKA 4X8VH 3BTFE 3M5LA 1TNLA 1G3DA 2TBSA 1DSUA 1MKXK 1O3AA 1IQFA 4AOQA 2FTLE 1TALA 1JOUB 1K9OE 4WVPE 3RXMA 1G9IE 4ZUHA 5DP9A 2A7JA 8ESTE 2C3SA 3PRDA 2ZCLP 1FY3A 1GDQA 1UVPA 1NPMA 4RT1A 4DIHH 1C1MA 4A7IB 1SSXA 2ZPRA 1VZQH 2W5EA 1DICA 1P3EA 1T8LA 4Y6DA 4FOUC 1C5PA 1C9TA 2GT8A 1THSH 1Y59T 4ZKNU 4CBOA 2G51A 1K28D 1YPEH 2WV5A 3R0FA 1BTYA 3KN2A 4JZFH 2ZI2H 2FOHA 3E0PB 3RXGA 1AWHB 4H6SB 1ELTA 4ZKRU 4AORA 1ELBA 2GZ9A 5FXLA 3VFEA 5EQRA 4ABHA 2EI7A 1A5HA 1JMOH 5ESBA 2ZU4A 1BHXF 1BHXB 1YY3A 5ABWA 3FZZA 1OWDA 1CA8B 5G4BA 7LPRA 1ZOMA 2UWOA 1NRNH 1VITF 1EQ9A 2FOFA 3A84A 5C1YA 1MKXH 3LGWA 4XRNA 2JIZD 3CENA 3NZIA 1VGCB 1NM6A 1O3NA 4D9RA 3H7TA 3SI4H 2ZHEH 3EA7A 1GBAA 2OLGA 5F8XA 1V2OT 2STBE 3SQEE 1O5FH 3AAVA 1UTNA 3SU5A 4ASUD 2VJ1A 4AN7A 3BEUA 3SJOA 3PMHB 1QBVH 1W8BH 1NZQH 1ZJKA 3S7HB 1SGTA 2JH5D 1C5VA 3KQCA 3LPRA 1FONA 3T25A 1VR1H 4YLUA 1K1PA 4K3JA 2R9PA 4Y0ZE 1Y3VA 4BAMB 3PV5A 1MU6B 3OAAD 4A1TA 1W10U 4B74A 4ABEA 1GBKA 2P8OB 1LDTT 3A86A 2QXIA 1O2XA 3VB7A 1T8OA 2FI3E 1UK3A 1SMFE 1SG8B 2YNBA 4ISIH 5C17A 1TPAE 1J17T 1KLIH 3PMBB 4X1QU 2BLQA 1QRXA 2H6MA 1P2IA 2ZGXH 1P2OA 1K1NA 5DP3A 1W0KD 2BOHB 2FI4E 3GYMA 4DJZB 3UUZA 2BZ6H 2ODPA 1ID5H 3SU2A 3M5MA 1F92A 1QB6A 1FLEE 2ULLA 3BN9A 2ZO3H 4ISNA 2BDGA 1NN6A 1P2NA 4JYVH 1ZMNA 1WTHD 5IYTA 4K1TA 1GHVH 2Y7XA 1EZSC 3LDXH 2KAIB 1T4VH 4Y7BA 3ENSB 3PM3A 2OD3B 1OYTH 1GBDA 1Y8TA 3WWFA 2JETB 2ZFTA 3F9FA 5EOKA 1K1IA 3ZVBA 5T6GA 5JBCS 4WMEA 1CHOG 3O8RA 1PQ7A 2BQWB 3D23A 2J2UA 2FZZA 1QRZA 1P9UA 1O35A 4XBCA 3TGKE 2D1JA 1SR5C 3ODDA 4MTBA 4CREA 4GVUA 4X1PU 2WPDD 1TBQH 1SVPA 1SL3A 1BRAA 2V7QD 3ZZ5A 2EEKA 2VVCA 4NWLA 4Y11E 1OWEA 1LHFH 2BYAX 3TH3H 4MNVA 3GCOA 3VB6A 2SGPE 1UCYK 5IK2D 1V2WT 2EI8A 1P03A 1BMNH 3PWCA 1WUNH 4Z1MD 1VCPA 1AKSB 1AB9C 2BXTH 4AFUA 3PO1B 4K2YA 3SJKA 1WSSH 4Y10E 5FPSA 1K1OA 2CMYA 1VITH 1MUEB 2AHME 1O2SA 4YOGA 1KMHB 3DD2H 1FJSA 3RXLA 3T29A 1THPB 1SHYA 2ZQ1A 1TONA 1N8OB 1F5KU 1A7SA 2ZDMA 3BSQA 1RGQA 1TMBH 1OOKB 2OXSA 1TPSA 1MAYA 1ZLRA 3SUGA 3A88A 1BQYA 3RXDA 1DY9A 1GDNA 4B6FA 3QTOH 1DUAA 1O2YA 2ZZUH 2KAIA 1C5NH 1GBMA 1EZUC 2QY0B 4OGXA 5GCHF 3H09A 2A1DB 1BZXE 4FUJA 4O03A 2XRCA 1DLKB 1UTJA 1HIAB 2ZGJA 2I6SA 4ZHLU 2WPKS 1ACBE 1UCYH 4RN6A 1S84A 1BMLA 2F9NA 5DP5A 1DOJA 4X6NA 1AZ8A 1JRTA 3RC6A 4WY3A 3P8FA 4GPGA 1GMCG 5AF9H 1J9CH 1F0SA 1WQVH 1NFYA 1SGIB 3DHKH 2A4GA 3QO6A 3GY7A 3DCLA 3V0XA 1KSNA 1O0DH 1AHTH 1OWKA 1L1NA 1V2KT 2H9HA 1ZGVA 1TMTH 1IQNA 4JZDH 4AC9A 4YTAA 3CS0A 1YM0A 2SGAA 1AKSA 4E06H 1GDUA 3M5NA 2BX4A 2WPMS 4CRFA 1HUTH 5L2YH 2BX3A 2BDCA 3QDZB 1WTGH 2Q6DA 3F2HA 3RLYH 1ZTKA 1EASA 4XSKU 2HPPH 1GBBA 2ZGBH 2J94A 4JZEH 1MBQA 1D9IA 4AB8A 1SOTA 4INKA 3RXSA 3F3BA 2J9NA 3U1JB 2XWBI 2QF3A 5A0BA 2WSSD 4CH8B 1W3CA 3OY5U 1GMCF 1TX8A 1HPGA 4FVBA 4AGKA 1EFRD 1ETSH 1GCDA 1QRWA 4THNH 1SBWA 2FP7B 2GCHF 2HGTH 1RD3B 4I8GA 1T8NA 3MWIU 5C67A 4TWYA 2C4FH 1HIAA 3S9CA 3RU4T 1UTMA 3SW2B 1C5TA 1DS2E 1FNIA 4I86A 3VB3A 2G5VA 3F2FA 4TWWA 1GHBG 2Z9LA 5FBEA 3BEFB 1UK2A 4I8JA 2XWAA 8KME2 3A8AA 3RXPA 1P3CA 1Y3WA 2ZDKA 3M37A 1C2IA 4UFGH 1SLXB 1ZGIA 1C1PA 2P3TB 2WV4A 3A87A 5DGJA 2ZHQH
chains in the Genus database with same CATH topology
1SQTA 3GS9A 3RUOA 1AVXA 1BTHH 2ALPA 3SI3H 2OK5A 5GDSH 2GGVB 3GDSA 2W6ID 3LGYA 4ABGA 1TIOA 4FUDA 3W95A 3DT0H 1C2MA 2BDHA 2FLBH 2Z94A 3STIA 1BBRK 1MZDA 1YKTA 2BLWA 5FHTA 3NWUA 5EPYA 5E2OA 1GCTB 2VGCB 1FPHH 2ZU1A 3UREA 1C1NA 2QCYA 1NFUA 3LKWA 4FU8A 2SGFE 2FM2A 3TITA 4A5TS 2BD2A 4AYYB 1V2LT 5TCCA 1AE8H 1THRH 9ESTA 4QT8C 1C2KA 3HGNA 4UEHH 1AFQB 2ZU2A 1GI5A 1KXBA 2W3KA 4BOHA 2A4QA 1CVWH 2ZQ2A 2Z7FE 3EAJA 3ZVFA 2FOBA 1TGCA 2KCYA 2HPQH 4MQAA 1NFXA 1YLCA 3U9AH 4CR5A 2W3IA 1MTUA 1V3XA 2GP9B 2TGDA 1OWJA 4ZKSU 2K8IA 1NU9A 2ZCHP 3UQVA 1O3PB 1GG6C 4MG3A 1NBMD 1O3LA 2Y6TA 2FI5E 2CN0H 3KQEA 3SUEA 3UR6A 4HTCH 3MH7A 1YPKH 1BBRH 3WWBA 3VG8A 1YGCH 2Y7ZA 4NA8A 3OY6U 1Y5UT 3SJIA 2LNCA 1A1RA 3HKIB 1DDJA 1NRQH 3FO8D 4IN1A 2BDBA 5EU8A 1QB1A 3DUXH 1NY22 3I78A 5HGGA 4B75A 3A7VA 2ZHFH 2CHAC 1XXDA 5LPFA 3A8CA 5F8ZA 3SV9A 1Z6JH 1UTQA 5A09A 2L6OA 1O3CA 1C2HA 1C1UH 1DWBH 1NC6A 2QV1A 2VIVA 1T8MA 2CF8H 1LPKB 2ANKH 5EPNA 4GHQA 1GVLA 1ELAA 1IQJA 1GMHG 1IQLA 3SUDA 3A89A 4B76A 4FUEA 2J92A 1DANH 1XXFA 1GI2A 1V2TT 1EZQA 1HXFH 4B2AA 2P94A 4DW2U 2EA3A 3PWBA 2BD9A 4YOIA 1MZAA 1O2OA 1O3GA 1Z1JA 4A1XA 3NPSA 1J8AA 3S9AA 1GJBB 1LHEH 3RDZA 3ZYEA 1HDTH 1TNGA 1TRMA 2RA0A 3PMJA 4INLA 2A4OA 2PSXA 3TIUA 2Y5HA 4DIIH 2DUCA 1T7CA 2BZAA 3TNTA 1VJAU 3M3VA 2OINA 3ZZDA 2WPJS 1C2JA 4FETA 2OUAA 1GMDG 1PFXC 1OS8A 2SGEE 4D9QA 3KIDU 3M3TA 1F0TA 1DXWA 1QIXB 3M7TA 4BTTB 3Q3XA 3BG4B 4LZ1H 4UFEH 2UWLA 4ABAA 1BIOA 1GMHF 2BD8A 5DP6A 1WXRA 2ALVA 1EX3A 2AMDA 2BD4A 1FIZA 2W26A 1TPOA 2VVVA 3S7KB 1SC8U 2BY7X 1FDPA 1B0EA 3ZV9A 3SUFA 5A8YA 2ZHWH 3MU1A 2IOTA 3ATLA 3F6UH 1TX6A 1N6YA 2Z9GA 3MH4A 2FS9A 2IN2A 1EJMA 3NXPA 2BMGB 3MFJA 2PHBA 1Y5AT 3ZVDA 2UUJB 2XBYA 1FN8A 2BVXH 2BY9X 4BXWA 1ZMJA 2FOAA 4IN2A 1GBFA 3TJOA 1H8ED 3A7WA 4NCYA 1KYNA 1EATA 2A5IA 1GBTA 5CHAB 4IC5A 3JZ1B 3F68H 2ZGCA 2FIRH 1KXAA 2TIOA 1HAVB 3GCTG 2PTCE 3FP8E 9LPRA 1NRSH 2UWPA 2P8OC 2WPIS 4FUIA 1RS0A 1FY1A 1KXDA 3F9HA 2Z9KA 3ZZCA 5J4QA 5CDFE 1TB6H 4B73A 1A3EH 3P95A 1A3BH 5CHBA 1PPCE 3A82A 3EYDA 2W7UA 2ZC9H 2FX6A 1BDAA 3LH3A 5C20A 1F5LA 3U69H 3BTDE 2BVSH 1TA6A 2XNDD 4K1EA 5T3HA 1O2KA 4ABDA 5AVDA 2THFB 1OSSA 3RXAA 1G32B 2HLCA 1A0HB 1LPZB 2W6JD 3SHAH 4K1SA 2XC4A 1P01A 1IQEA 1CSOE 2BY6X 3TH2H 1Z8RA 4B2BA 1O2QA 2OP9A 1G36A 1WAYB 2VBCA 5GWZA 3RXBA 1HAIH 1FZZA 2G5NA 2JETC 1O2GH 3EE0B 3KGPA 3OX7U 4WXVA 4VGCB 5I25A 3QGJA 2NU3E 5J4SA 3EDXB 5GPIB 3SU4A 4I7YH 3QX5H 4BAOB 2Z3CA 2JKHA 2QF4A 2SNVA 4YT7H 2GT7A 2ZKSA 4K8BA 1ELGA 1Z7KA 1HAVA 5C1UA 2Z9IA 4KTSA 3UWJH 1WU1A 2XBWA 1G2LA 5F8TA 2KZ4A 5FPTA 1GGDB 1C1OA 2Q6FA 1TMUH 1LKBA 4X8UH 4Y8ZA 5DP7A 3W1EA 1EJAA 1VCWA 4AFSA 1BT7A 1QNJA 1C5RA 4NSYA 3PO1C 1K22H 1K1MA 1TBZH 1TRNA 1YF4A 1YYY1 2KCOA 2PV9B 8GCHF 3E3TA 4DG4A 4U30A 2FYRA 3E6PH 1GJDB 1C1WH 4OS2A 3AK5A 4NZQA 2AMPA 3K9XB 1A2CH 1VITG 2O8MA 1JIRA 5AFYH 1P8VC 1N8OC 1AD8H 1P57B 2VIWA 4XD7D 3TJVA 1C1VH 3QGNB 1C5LH 2EC9H 3A8DA 2P16A 4JYTA 5FX5A 5E0HA 1S0QA 3T62A 1H1BA 5LH8A 3D65E 3KQDA 5T6FA 1M9UA 2D26C 3S0NA 1FI8A 1C1RA 2AYWA 1D6WA 1TGBA 1UCYE 2P93A 1P2KA 1MABB 1WOFA 1V2MT 3PTNA 4SGAE 1AO5A 2V3HH 1RIWB 1P2JA 3RM0H 1OKXA 4XBBA 1D3TB 4YOJA 1LVOA 4YXWD 3QUMP 4Q2KA 4SGBE 3ATKA 3MNXA 3MNSA 1D3DB 2BXUH 3QK1A 1GHXH 1C2GA 4Q80A 1CGIE 1GI3A 1O38A 1XM1A 1TQ7B 1CGJE 1RTKA 4D8NA 1SGFA 1ABIH 1B0FA 5GNDA 2ZDAH 1H9IE 1V2UT 3E0NB 4YO9A 4NWKA 1ZPZA 5DJ7A 2IJD1 3TK6A 2FOCA 4CRDA 2CF9H 6LPRA 1A5GH 4TYDA 2BDYA 3U8TH 2ZDNA 5CE1A 1LQDB 5IDKA 1D4PB 1TNIA 1NFWA 3V13A 4Y76A 3TGJE 1C5UA 1IQKA 3P8OA 1QFKH 3T27A 2XW9A 1C9PA 4X6MA 1LQEA 1O30A 2BVRH 3LONA 3N7EA 2Z6BD 1WQSA 1S83A 3F2GA 4WXIA 2ZCKP 1BMAA 4OS5A 4ZXXH 5C2ZA 2BY5X 1KTTB 1ZJDA 3I29A 1PQ8A 2B9LA 5SGAE 5AHGH 2BD3A 1XVMA 1BMMH 1ZPCA 1G3BA 3NCLA 1B7XB 1C5MD 4CH2B 4TT3D 4R8TB 3RXRA 4YZUA 2CGAA 4XBDA 2XTTB 4X1NU 1A61H 1G3EA 4AZ2B 1P09A 3ZIAD 4AGJA 4OM9A 1EJNA 3M7UA 1SGDE 2FYQA 1LMWB 1EAXA 4MPXA 3ZZ8A 1SGPE 3UB0A 3W94A 4K8YA 3UPEA 1RFNA 2ZPQA 2OBOA 2G8TA 3RXFA 1O5GH 3ZV8A 1GCTC 3A7TA 3MYWA 2VGCC 5DP8A 1TPPA 3DSOA 4DVAU 1EKBB 2VIDA 1HLTH 3UNQA 1O2JA 3VGCB 1O2MA 1MBMA 2A5KA 5CMXH 1BTUA 4WJG2 1YCPM 1AFQC 2PFEA 2OCVB 1YC0A 1HAYB 2J5UA 7ESTE 1GVZA 3OU0A 1ANDA 1PPBH 5EQSA 5GCHG 4IBLH 2ZG0H 4JMYA 1LVMA 4IS5A 3AW1A 2QF0A 2PW8H 2A2XH 1OP2A 1GI4A 2AERH 3VEQB 4BTUB 3LJOA 4I8LA 1BBRE 3RM2H 1Z8JB 4NG9H 2GZ8A 4ZHAA 4CRAA 1UHBB 2IPHA 2DE9A 1CE5A 4NGAH 3SORA 2JDID 1O2WA 1IQGA 5DK1A 3RLWH 1D3QB 2WINI 1H9HE 1EPTC 1PYTC 1SGNE 2Z3DA 4D7FA 1F7ZA 2GCTB 2F91A 2QXHA 2QE7D 2ZDVH 3DA9B 2BLOA 3NRLA 1AWFH 1O5EH 2SFAA 4AG1A 1O5CB 2VWMA 1SQOA 2Z9JA 2Y82A 1P2QA 3L33A 4ZH8A 1F0UA 2PLXA 1AY6H 5EXMA 2VWLA 4X6OA 3O8CA 5DO4H 3AASA 3BTEE 4B71A 3RXCA 5JDUB 2RDLA 2QAAA 1GHYH 3BTHE 2CV3A 2ZTZA 1FUJA 4NZLA 3P17H 3MU0A 1O3KA 3LGVA 3OSYA 1G3CA 1O2ZA 3RXVA 3QZRA 4AFZA 5LGOA 2AMQA 1O3HA 2GCHG 1HJ9A 2H9EH 1C4Y2 3F9EA 1W7XH 3TU7H 1ESAA 2FS8A 5A0CA 3A7ZA 4AX9H 2OC0A 1XVOA 4NSVA 2HRVA 2HLDD 2A2QH 4U01A 2O8UA 7GCHF 1CA0B 1V2JT 1BRUP 2ZWLH 3BG8A 1BCUH 2GMTC 2OBQA 3KCGH 2YMSD 2G55A 1PJPA 1D3PB 5GXPA 1UHBA 2VVUA 3VB4A 3E91A 3OEED 1EAWA 2V3OH 1NS3A 3N7DA 2G4TA 4DT7B 4BAHB 4U32A 4Y79A 2W7SA 1GI6A 1O2RA 2CXVA 4IMZA 3MNCA 1C2FA 2GDEH 3ATMA 1EP6A 3BG4C 2J95A 4J1YA 3ZVAA 1FIWA 3STJA 2FTMA 1FY4A 1O2HA 3PROA 1OXGA 1E79D 1T4UH 2GVFA 4JYUH 4ABIA 4D76A 3HATH 2A32A 1S6HA 1O2PA 1MCTA 5FL7D 4ABBA 4LZ4B 3V7TA 1BTXA 2A0QB 1P9SA 1O2TA 1JIMA 2D2DA 3BV9B 4NIXA 1O5BB 3UWIA 1L1GA 2WPLS 1DFPA 2FEQH 1CT0E 3MO6A 1G2MA 5GJ4B 3U98H 2NU4E 1O3DA 2QF5A 2ZA5A 1DWEH 4XFQA 4AB9A 3PV2A 5CHAC 1TOCB 1L4DA 3SGBE 1INCA 5DPAA 1JRSA 1O34A 3N7OA 3SNCA 4Y7AA 2P59A 4I8HA 5JB9S 1CQQA 2OQ5A 3ITIA 4DT4A 1C5XB 3UNRA 2AIQA 3LU9B 1XUGA 1H9LB 2VB0A 5HM9A 3E90B 1LHDH 4ABFA 3S9BA 4TY7A 5C0UA 1O3MA 1QURH 2R2MB 3GY2A 2YNAA 1PPEE 1TRYA 3NKKA 4A1VA 2Y80A 3M35A 4Y0YE 1HV7A 1W7GH 1CBWB 2XCFA 5B6OA 1MQ5A 4ZROA 1AE5A 1BA8B 3E16B 3SJ8A 1HNEE 1NRPH 1QHRB 2GZ7A 4LOYH 1QTFA 2FMJA 3UQOA 1ELVA 3ZZBA 1O3OA 1SLUB 4CHAB 2Y5GA 2V35A 2BD5A 3BIUH 1TNJA 1T32A 2FOGA 4J2YB 5C1XA 3A81A 1QQUA 1HB0B 1ARBA 2ODQA 1GBEA 3ODFA 1K1JA 5EW2H 1TE0A 1Q2WA 2O8LA 3FZDA 4FUBA 5EXLA 3ATIA 3MH6A 1B5GH 2Y81A 1L4ZA 3ZZ9A 4TPYA 2FODA 1HAZB 1UK4A 3SU1A 3FFGA 4LK4A 2QIQA 1GGDC 1XUJA 2QA9E 1Z8IB 3GY5A 1UVUH 1AI8H 2FESH 3EA8A 1TGNA 4WH8A 1GI1A 2PKSC 1AZZA 2FO9A 3PRBA 4HFPB 3QZQA 3OFND 3Q3YA 1TFXA 4X2XA 1EB2A 3B23B 1C5ZB 4AFQA 4RKJB 1C5WB 5EODA 3E8LA 4Q7YA 1S85A 1HBTH 4OGYA 1AMHA 2I6QA 4JK6A 3TH4H 4KP0A 1P0SH 5L6NH 2BOKA 3RXTA 1KIGH 1AU8A 1TWXB 1W2KH 2UUYA 2A45B 3P8NA 1QJ1B 1MD8A 3SO3A 2ANYA 2ZECA 5FX6A 2NU1E 4NIYA 2OC7A 2VH6A 2CJIA 1ARCA 2UUFB 5TJXA 2PTNA 1IQMA 3IWMA 1LTOA 4NA7A 4Y8XA 3LGUA 2LELA 2AH4X 3TNSA 1QR3E 2V6NA 1NU7B 3VB5A 1OWIA 4O97A 4DURA 1AUTC 2AS9A 3KL6A 5EGMA 2Z3EA 4MDSA 5A0AE 1GL0E 2HWLB 2D8WA 1QL9A 4DGJA 3UOPA 5DSFA 3ZZ6A 1PYTD 3V12A 3VPKA 3ELAH 1F5RA 1O2UA 4R0IA 1VGCC 3SU0A 1MKWK 3ZVCA 2O8WA 1ELFA 3GDVA 1ESBA 3SNDA 1QL7A 3WW7A 3Q77A 1BMFD 2OC8A 2AGIX 2PWXA 1P04A 1EAUA 1H4WA 1SLWB 3FKSD 4ISHH 3A8BA 2VIPA 5EG4A 5F03A 3TGIE 3VXEH 1OHHD 1UVOA 2FXRA 1XX9A 3PTBA 3WY8A 4ISOA 1ANEA 5TCAA 4A6LA 3BTQE 1BJVA 1OP8A 1HCGA 4UD9H 1ANBA 3MMGA 2XYAA 1UTLM 3ZVEA 3T2NA 7KMEH 3QTVH 2WYJA 3BTGE 1V2RT 1EZXC 3MI4A 3ZVGA 1HGTH 3MU8A 1SFQB 2SGQE 1E38B 1LCYA 4MLFB 3P70B 1P02A 5HKKD 4Z0KA 3LGIA 1FY5A 3H5CB 3RMLH 1W13U 1MKWH 1QCPA 4KGAA 5FAHA 2GKVE 1LHGH 3TVJB 1O5DH 1GBHA 1E0FD 3MHWU 4KTCA 5E2PA 1GJ5H 5FCRA 3LGTA 1NRRH 2F9OA 5B6LA 2ZFRH 1E1RD 1O3FA 2BY8X 1SLVB 5A8ZA 3BF6H 4DCDA 2FPZA 1SGFG 5HXFA 2Y5FA 8GCHG 1KY9A 1Z1IA 6ESTA 1LKAA 1V6DA 1ZRBA 4LXBH 4FU9A 4KELA 2F9UA 2AEIH 3RXIA 3RC5A 4Z6AH 1EP5A 1C2DA 1GPZA 3PLPA 4O3TA 1GJ6A 1V2ST 4X8SH 3VGCC 1DWDH 5JB8S 1W12U 4JK5A 3DSPA 2NU2E 1DXPA 2XC0A 1MU8B 1IQHA 3F1SB 2G52A 1MMJN 2ZU5A 1XKAC 3OTPA 1P2MA 2BDAA 1SKYE 2PR3A 1Y