3E90B

West nile vi rus ns2b-ns3protease in complexed with inhibitor naph-kkr-h
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
176
structure length
173
Chain Sequence
GGGVLWDTKEYKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWHTTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWKLQHKWNGQDEVQMIVVEPGKNVKNVRTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGKRMDEPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NS2B cofactor
publication title Structure of West Nile virus NS3 protease: ligand stabilization of the catalytic conformation
pubmed doi rcsb
source organism West nile virus
total genus 29
structure length 173
sequence length 176
chains with identical sequence D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e90B02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3e90B01
3E3TA 4UFDH 4KTCA 1EP6A 1CHOG 2FS8A 2H5DA 1DLEA 2Q6DA 4LZ4B 2ANYA 3JZ1B 2IJOB 3A83A 5EU8A 2H9EH 1XKAC 2ZO3H 2UUYA 2GZ7A 2NU3E 1C4U2 5ABWA 3GCNA 3ZVFA 8KME2 2BX3A 3SU6A 1ANDA 3RC6A 1LVYA 4AB9A 2LPRA 4K60A 4ZUHA 2C8ZB 4RN6A 5EPNA 4D7GA 1JRTA 3RXGA 1J14A 2V35A 1YPGH 3DFJA 1SLXB 1G3DA 3RXKA 1O2HA 4WH6A 3MH5A 1NESE 3FANA 2RCEA 4JYTA 4J1YA 4JZIA 4CR9A 5H4IB 1BUIA 2ZFPH 5ESTE 3SUDA 1K1MA 1GHYH 3UTUH 1GJ5H 1EZUC 1O3EA 2FIRH 1JMOH 2ZGCA 3ZZ9A 3GY4A 1ZJKA 2QA9E 3MNSA 3SNCA 4UDWH 2BYAX 3I29A 2FODA 4J2YB 1QQ4A 3RXPA 4M9FA 2ZCLP 1GI9B 4FUFA 3RXAA 5GJ4B 4RKOB 1E36B 1CA0C 1OWDA 3MU4A 4DOQA 1SG8B 7ESTE 2G4UA 2XC5A 1OS8A 3A86A 4WXVA 3SNAA 3A7VA 3PLKA 1DWCH 1O3NA 1EAWA 1GJAB 2AYWA 1C1NA 5CHAC 1K21H 1LDTT 2TRMA 1TPAE 2PTNA 3HK3B 2XBYA 3RXJA 2NWNA 2ASUB 3F9HA 2ODQA 4WH8A 1P11E 4OGXA 1T32A 2CHAC 1HNEE 1HAHH 2OBQA 2FOFA 4CBNA 5C1XA 3PM3A 1QBVH 5DJ7A 1ARBA 1HGTH 1EQ9A 1IHSH 2WPIS 1EX3A 3LGYA 1AHTH 1C5UA 4VGCC 3RXUA 3F9FA 1GMCF 4MLFB 3H5CB 4YZUA 2H2ZA 4K8YA 1UCYH 1H9LB 1A5IA 2BOHB 1DWDH 1TGSZ 3T62A 2G4TA 3LPRA 3PV4A 1AE5A 3QTOH 1P2IA 1LQEA 3F6UH 4IBLH 4NGAH 4OS7A 1XM1A 4Y79A 2F9NA 1OYTH 1C4Y2 1HPGA 4MG3A 1TQ7B 2XBVA 1IQIA 3FZDA 1ZPCA 2G8TA 4KP0A 4QT8C 2D26C 1GJ4H 2IOTA 2OCVB 2FOGA 3DT0H 4BXSA 1DWBH 1ELCA 5DP4A 2BTCE 1BTWA 1QL7A 3A7TA 2J95A 3QZQA 4JZ1A 1X7AC 2WYJA 3P95A 2ZFTA 1LKBA 5T3HA 4JYVH 3K65B 2ZHFH 4WXIA 3SZNA 2PKSB 4WVPE 1XUHA 1GHWH 3RXDA 3OU0A 5GWZA 1IQKA 9ESTA 1O3OA 4MPUA 2ZZUH 1YKTA 2C8WB 2QGRA 3ZZ4A 1WYKA 3SJKA 1GCTC 1VCWA 1MMJN 1ETRH 2SGPE 3RU4D 2GDDA 1K1NA 1GI1A 1T8LA 3NKKA 1CQQA 2FP7B 2Z94A 1CA0B 1E0FD 1CT4E 4Q7ZA 2OTVA 3NUMA 1QRWA 3MO3A 5CHAB 3PV2A 4R0IA 2SGEE 2AERH 1SGQE 3A8AA 1EAUA 1DY8A 6ESTA 6GCHF 1F2SE 2AH4X 2Z7FE 3ZYDA 2VIVA 2W3KA 5TJXA 2ZU2A 1UK2A 2ZHWH 3BTME 3PWCA 2SGFE 4DIHH 1A5HA 4MDSA 4B75A 1GBLA 1J15A 5L30H 1K22H 1E34B 3D49H 2R9PA 3AK5A 2GDEH 2PWXA 1OOKB 1PPGE 4VGCB 1HAYB 1O2YA 2ZCHP 3SNEA 1SGYE 4FUDA 4FUBA 1DX5M 1AKSB 3S69A 1O5CB 4ABIA 3VEQB 1HAOH 2HOBA 1CU1A 2BDHA 3PO1C 4CH2B 1HB0B 4MPWA 1O3AA 4ZXYH 5GXPA 4RSPA 1IQNA 4FU7A 1TWXB 1C5ZB 3M7TA 3VB5A 3L33A 1WQVH 3BG8A 1PPZA 4GSOA 5GCHF 1SOTA 3RLWH 1D3QB 1H4WA 1P3EA 4CRDA 3LU9B 2BD4A 3ESTA 1TONA 4ZKRU 1NFWA 2AGEX 5EPYA 2Z9KA 1O31A 2NU0E 1C1TA 4A1VA 2PHBA 2PR3A 3KQEA 1FY3A 1GHBG 5LPEA 5FX6A 2Q6GA 4DCDA 1CA8B 1HFDA 1G3CA 3TK6A 2J38A 3LGUA 4CHAC 1U6QA 1PJPA 1GJCB 2XYAA 4FVDA 1AFEH 2HWLB 1NROH 3RXEA 1HYLA 2G5NA 1O5EH 3PLBA 5E2PA 5L6NH 3A7XA 1DS2E 1YPHC 1A0JA 3GY2A 1GL1A 1WAYB 4BAHB 2OQUA 1N6XA 2HPPH 2ZQ2A 3SGAE 1GCTB 3P8NA 3E8LA 1BMMH 4AORA 1EAIA 5C67A 4XBDA 5EQSA 3ZVAA 1ZRKA 1OPHB 2OD3B 1S85A 2GCHG 1ANCA 1AZ8A 4X8TH 1VCPA 2J94A 3RXLA 1QFKH 1GMHG 1FAKH 4U30A 1CSOE 2ZEBA 4NSYA 1HIAB 2M5TA 2VIQA 3SW2B 1QRZA 2F9OA 4DT7B 3SI4H 1RS0A 4IGDA 5LPFA 4ABBA 5SGAE 3DHKH 4IC5A 2GGVB 4MNWA 3A88A 1CGHA 1LQDB 3D23A 2WINI 2GZ8A 1IAUA 2A45B 3SU3A 1P2KA 1ELTA 4K8BA 1GL0E 5K0HA 1L1GA 1LPKB 1QURH 2Z3DA 3PROA 1P2OA 1HAPH 3T27A 3LC5A 2VWOA 2VVCA 4Y0ZE 1C1VH 1O5AB 3G01A 1BRBE 2D1JA 1AB9C 3ATMA 2O8LA 1HCGA 3EA7A 3RXMA 2BD3A 1GI0A 2BM2A 3Q76A 2J2UA 1MU6B 1EOJA 1QRXA 1W13U 4ABJA 3PV5A 1KIGH 1P9UA 2UUFB 5C3NA 1THPB 3SGQE 1GMDG 1A5GH 1UK4A 4ABEA 4BAKB 4ZMAH 5FCKA 1TPSA 4XBCA 3AVZA 1SQOA 3M5NA 1ZHPA 3VXEH 1IQGA 3D65E 2BY5X 2Z3CA 3P92A 2HGTH 5EODA 2P59A 3A7YA 1GG6C 2ZF0H 4SGAE 8ESTE 2ALPA 4KTUA 1HRTH 3UWJH 3KQBA 1UHBB 4AZ2B 1SGEE 1FY4A 1WUNH 2W7SA 5F6MA 1C1QA 2VNTA 4I8JA 2BD2A 1SVPA 5L2ZH 2RA3A 1AFQC 1O2PA 1TQ0B 2QXJA 1V2ST 1LHFH 2TBSA 2GX4A 2A7HA 4YOJA 3TIUA 3IG6B 1BTHH 5CE1A 1C2DA 1BMLA 2PFEA 1G32B 1O2JA 1ELFA 1G37A 5EW2H 4IN1A 2P3UB 3HK6B 3V12A 1PPFE 2F9UA 3F9EA 4GAWA 3GDSA 2BMGB 1Y5BT 1N6YA 4NA7A 1HAXB 2G5VA 1N8OC 5TCCA 3GY7A 1O3JA 2XCFA 2FYRA 2ZHEH 2ZGBH 4X1PU 1ELGA 2UWPA 4I33A 2ZFSA 4JK6A 1C5VA 3VFEA 2FTLE 2QYIA 1C5RA 1Z6JH 1DOJA 3GYMA 4BNRA 2P16A 3STIA 2QF3A 3LOXA 3RXIA 1T8NA 4FU9A 7GCHF 4JCNA 1MTNB 3BIVH 1YPLH 1TNHA 4ZHLU 3MNBA 1DFPA 5T1VA 4ZROA 3GYLB 5B6OA 1QJ1B 5EGMA 2Y5GA 2Q1JA 5DKMA 2WYGA 1B7XB 3KEEA 2R0LA 1O3LA 3DFLA 3MO9A 2CXVA 5E0HA 1NRRH 2ZI2H 2DE9A 2C8YB 1C2HA 1KLIH 3ZZ8A 3SV6A 2BQ6B 2P94A 4K1SA 1GPZA 1AB9B 1VJAU 5FBEA 1RXPA 2QF0A 4K2YA 5J4QA 3QK1A 1SGNE 1FQ3A 4A6LA 2P93A 1P2MA 2XW9A 4X8UH 2EI7A 1O2QA 3U8TH 3E90B 3PTNA 4NZQA 1TYNA 4AFZA 1BTPA 1FPCH 3MMGA 1DXPA 4D7FA 1HV7A 2SNWA 4NIVA 2A2QH 3C27B 2ZU3A 4INKA 1EPTB 1CGJE 3H7TA 1J16A 3GDUA 2XTTB 1SMFE 3MHWU 5DP5A 3OTPA 1KYNA 1A2CH 1P03A 4YO9A 2WPJS 3A8BA 1DUEA 1C4V2 3EDXB 2QV1A 1P09A 1F0SA 2OC7A 4LOYH 4ABGA 1AFQB 5DPAA 3L6PA 1Y59T 3MNXA 4ZHAA 4BTTB 1QL9A 2CJIA 1O2WA 1A0LA 3F9GA 1A0HB 1UVPA 1O2KA 2OLGA 3NZIA 1OXGA 4TPYA 1CE5A 1DITH 4HFPB 1FAXA 1IHTH 2BLQA 1GBAA 4LXBH 1YPJH 3FAOA 2HLCA 2FWWA 3K2UA 2ZA5A 3KIDU 1SR5C 1HAVA 5B6LA 1BHXB 1SGIB 1N8OB 1C1PA 1BTYA 2TIOA 4ZKSU 4HZHA 3UIRA 1BRAA 5IYTA 3TJNA 1W10U 2PKAA 1ZSJA 2ZTZA 5C2ZA 1K9OE 2JETC 3MU8A 1BJVA 2BQ7B 1DANH 2EC9H 4HI3A 1VCQA 3K6ZA 1WXRA 4AB8A 2YNBA 4X1NU 1YGCH 1EXFA 2BXUH 2ZIQH 3SUEA 5J4SA 1TX8A 3IITA 3SJ8A 1O37A 3MU1A 5G4BA 1FV9A 3RDZA 3SU4A 1BIOA 4UD9H 4AGKA 1JXPA 3LDXH 1EB1H 1MAYA 2STBE 1OSSA 4AX9H 1NTPA 2FS9A 1WBGB 2IN2A 3M7QA 4D9RA 1XUFA 2ZPSA 1SOZA 1SLUB 4PROA 1XXFA 3SUGA 4FUCA 1NU7B 1KXFA 1JIMA 4OS2A 1C2JA 1V2RT 2PW8H 3HGNA 2LNCA 1D3TB 3TK5A 1TGBA 1BMNH 3RMMH 5I46H 2BDAA 3LJOA 2QN5T 2FESH 1NN6A 4CRAA 2Y7ZA 2Z9GA 1W7GH 1TIOA 1L4ZA 3BV9B 1O34A 4H6TA 3NPSA 1EUFA 1JIRA 2WV4A 3U8RH 2GP9B 5DP9A 1IQLA 1EJNA 1ABJH 1F0TA 3ATIA 2Q6FA 4ZAEA 4KTSA 2O8TA 5DP7A 3W95A 3GCOA 1MTSA 1BT7A 5AHGH 3BG4C 1DSTA 5T6FA 2PKSC 1O5FH 3RXOA 4B1TA 1SLWB 4IMZA 1RTFB 3Q3YA 2FPZA 3JZ2B 3SHAH 1KXEA 8GCHG 1O35A 1G3BA 1EJMA 2WPHS 4JZEH 2AEIH 5C20A 5TCAA 2B9LA 4TY7A 1VR1H 1C5QA 3ZZ5A 1TA6A 1UTMA 5E2OA 2YOLA 1RTKA 3AW0A 3VPKA 1YPKH 1AKSA 2DE8A 4NSVA 2FLRH 3RMLH 1HDTH 1BRCE 1VITG 2BY8X 1P8VC 3R3GB 3KCGH 1GHZA 2VVUA 1PQ7A 3VB4A 1TNGA 1KLJH 1P06A 4NWLA 3ZZAA 5JBCS 1AD8H 2Y7XA 3E16B 1GBTA 3V3MA 1AWFH 1O3PB 4IS5A 3SZEA 1UVOA 1UTPA 3V0XA 1CBWC 1XVMA 1F0UA 2JETB 2XNIA 3RXHA 2R3YA 2ZHQH 4TWWA 1O30A 1FLEE 1YCPM 2A4OA 3U9AH 1ZTJA 1SI5H 3RXVA 1KDQB 2GV6A 1G36A 1GHXH 1MKXK 1O2SA 4UONA 1ZHMA 1G9IE 2ZDVH 1BZXE 3FZZA 5A09A 1DPOA 1Y3WA 1YM0A 3A8CA 4X6MA 4A92A 2PSYA 1T4UH 4Y8XA 2B8OH 2I6QA 3GY5A 1BBRE 1XUKA 3ZZ6A 3UFAA 4WMEA 3UNSA 1ESBA 2ULLA 1HXFH 1GHAF 4D76A 1NRSH 5GNDA 2AMQA 1JWTA 2ZGXH 1GI8B 5DP6A 1KTSB 1O2NA 1Z1JA 1QR3E 3ATKA 3QLPH 3P70B 1TNKA 5HM9A 1KSNA 2H9HA 5F8ZA 2W3IA 1C5LH 5ESBA 3H09A 2AMDA 3O8BA 1TPPA 3MU0A 1C5WB 1EOLA 1L1JA 1S5SA 2QXGA 2XWBI 1O2IA 2VGCB 5FXLA 1DICA 3M36A 1O5GH 1NY22 1K1JA 4BAQB 1ABIH 1ZRBA 1B5GH 3ZZBA 4H6SB 1P2JA 1H9IE 3BG4B 2BDBA 3TNSA 1KXAA 2GTBA 1PPEE 1A61H 2Y5HA 4CREA 4NFFA 1WTGH 3P8OA 1SB1H 3F1SB 3EE0B 2C3SA 1ZTLA 1MUEB 1MD7A 5T6DA 1DWEH 1O2MA 1O2ZA 2VIWA 2HNTE 1AE8H 2BXTH 3M3SA 1OX1A 1ANEA 1L4DA 1GVKB 2B7DH 2BZ6H 1K1OA 1O32A 2CMYA 1TRMA 2A7CA 1BB0B 1AUJA 4ISIH 5GIBA 2BVSH 5JBTA 4B71A 1MZAA 1V2TT 2OK5A 3LH1A 4Z6AH 1C1OA 2A2XH 2O8WA 1FPHH 1CHGA 2FEQH 3A7WA 1BHXF 4LK4A 1C5OH 3W94A 3MWIU 3U1IB 2H1UA 1A3EH 2PGBB 3ZVBA 1G2MA 2BD9A 1GDQA 4DIIH 3BTWE 3TJOA 1EZSC 2IJD1 4O9VA 1Z1IA 3V7TA 1OWJA 1AUTC 4TWYA 2GCTC 1KTTB 1MQ5A 3Q77A 1CBWB 1ZGVA 1D6WA 3CENA 2R0KA 4THNH 2ZTYA 4YT6H 1MTUA 2BDIA 1ANBA 2ALVA 1NFUA 2H9TH 4BTIB 2WPKS 4B73A 1BMAA 1MZDA 1W2KH 2ZECA 3OTJE 1BJUA 2G81E 2FOCA 1IQFA 2ZG0H 1TOCB 1XKBC 2ZP0H 4Y7BA 8LPRA 2ODYB 3S9AA 5E8EH 2TGAA 3TGKE 1C5YB 1ARCA 4K3JA 7LPRA 4KGAA 4RI0A 1Z7KA 3OY5U 5DGJA 3S0NA 3A84A 1O3GA 2BY9X 1DUAA 2KAIA 1QQUA 4OGYA 3TGIE 1V2OT 2V0BA 1O2OA 2WV9A 1MCVA 2VIOA 4SGBE 2BDCA 1QCPA 1LVOA 7KMEH 1C9TA 1V2NT 3P17H 1TALA 4AFSA 2UWOA 2XBWA 4A1XA 5JDUB 4ISNA 4GCHF 4RKJB 3CP7A 5DP3A 5IDKA 4AFUA 1THRH 1YP9A 1DVAH 2ZFRH 3ENSB 1GDUA 3BSQA 1O0DH 1GJ9B 2BOKA 5HM2A 1ELEE 1TMUH 1NS3A 4A1TA 1AY6H 3S9BA 2F91A 1WQSA 1AVGH 1GGDB 4FUHA 4Y8ZA 3RC4A 2RDLA 1HLTH 4MTBA 1GMCG 2JKHA 1UVSH 1TMBH 1ZSKA 1V2QT 4DG4A 5DO4H 4UFGH 2OP9A 5C5OA 1SGFA 3ITIA 4U2WA 1FMGA 4ABDA 1SGFG 3RXRA 3TGJE 2ZDMA 3HPTB 1A1RA 2B0FA 1GWAA 1LTOA 2FM2A 3BEUA 3E6PH 3O8DA 2D2DA 3C1KA 2FMJA 3ZV8A 1Z8RA 3SU0A 4UFFH 3VB6A 1ZSLA 1RIWC 2HRVA 1D3PB 1MTNC 3BEFB 3UUZA 1SC8U 3MH7A 4OS5A 1V2LT 1A3BH 3IWMA 1CGIE 1O3KA 1F5KU 1IQMA 1TBRH 1SHHB 1LVBA 5E0GA 2VB0A 1AO5A 1GJ8B 3M35A 1O2XA 2Z9JA 1QBOA 1W8BH 1AVWA 2WUCA 4NIXA 5FPYA 3UPEA 2ANMH 1F5LA 2GCTB 2ZU5A 1W11U 1QL8A 1DSUA 4KELA 4CBOA 2AGIX 4I8LA 2V6NA 5E0JA 2JH6D 4Z0KA 1AVXA 3Q00A 4UFEH 3SV8A 2XRCA 1SL3A 1ESAA 2TGPZ 3ZVEA 2SGDE 2OC0A 4O3TA 2AIQA 2EEKA 1SSXA 5AF9H 1T4VH 1MKWK 5FCRA 1GBHA 3DUXH 2R2MB 1D4PB 2F9BH 1EPTC 1YPMH 1MTVA 1MKXH 3FFGA 2BY7X 1P9SA 3PLPA 4K69A 1QY6A 4JK5A 3FP7E 1UCYE 4OM9A 1GBJA 1VGCC 1WTHD 1O2GH 3PMHB 1T8OA 3RXBA 1W3CA 4UEHH 3GY6A 1BITA 1V2VT 1GI4A 1GBEA 2AFQB 3M5MA 3UWIA 3NK8A 1QGFA 1NFXA 2EA3A 2WUBA 2WPLS 1LHEH 2ZDKA 1YC0A 2OUAA 3SQHE 4BAMB 3R0FA 5GPIB 1ID5H 3SJIA 3UNRA 5FPTA 4IMQA 1SGCA 2ZFQH 1P10A 3TH4H 1Q2WA 1CHOF 4F49A 4MNYA 4CR5A 1C2LA 2WHXA 1XMNB 3QDZB 3VGCC 1LPGB 5T6GA 2FI4E 4YM9A 3LKWA 1JBUH 3K6YA 4K5ZA 5FAHA 1TRYA 3UOUA 2IPHA 1P2NA 1BDAA 2F83A 4DJZB 3AAUA 4JMYA 1ZZZA 1YLCA 1ZR0A 1L0ZA 3FVFB 1SQTA 2Z9LA 2HVXA 1TX7A 3SV9A 1V3XA 3RM2H 1AI8H 4I8KA 5GCHG 1GBDA 1HJ8A 2A31A 3UR9A 1V2PT 3H7OA 2Y81A 1RIWB 3GCTG 5A8YA 2R3UA 3GOVB 2FX4A 1GBCA 4OS4A 2YNAA 5EQRA 1YPEH 3VB7A 1AQ7A 1SHYA 3BTEE 2OXSA 5HMAA 2D8WA 4WMDA 1MTWA 4FUIA 1DY9A 5A2MH 1NFYA 4Y6DA 4Y10E 1UTKA 3SOSA 5HXFA 1D6RA 8GCHF 3UREA 3MTYA 5CMXH 4TY6A 4XBBA 1PYTC 3BTTE 4B2BA 1UVTH 2PV9B 5C1YA 2W26A 3A89A 3RMNH 1WU1A 4K1EA 1ZHRA 3BN9A 3ZZCA 2BLWA 3QWCH 4X8SH 5C5NA 2A4QA 4TPIZ 1O3DA 1V6DA 1P57B 4B2CA 1YBWA 1ZPZA 1DLKB 1S0RA 1NT1A 1K1IA 4FU8A 4NIWA 2OQ5A 1GBKA 3A81A 3N7OA 4MNXA 2BLVA 1OKXA 3DD2H 3ZYEA 3M61U 1TOMH 1F7ZA 1ZOMA 2SNVA 2FOBA 3RXSA 1WCZA 3MI4A 4GHQA 1DT2A 1MAXA 4IW4E 1TA2A 1VGCB 5AVDA 3TU7H 1OWKA 1TLDA 3F68H 2ZU1A 4X1RU 1B0FA 1GBBA 1ACBE 2QY0B 2ZGHA 1GI2A 3T29A 2ZQ1A 3KQCA 1QA7A 3RU4T 2FI5E 3SNDA 4OS1A 1GI5A 3LH3A 1MQ6A 2C8XB 3U69H 3BF6H 2UUJB 1PPBH 1EASA 3M3TA 4E7NA 4ABHA 2W5EA 3SO3A 3VGCB 2C4FH 2WZQA 2VWNA 4DGJA 4MQAA 4TYDA 1NC6A 1GDNA 2CF8H 3LONA 3M3VA 1C1UH 2VWLA 3Q3KA 3LGTA 3T25A 1V2JT 4FUEA 3GDVA 2P3TB 2H5CA 1Y5AT 1RJXB 3CS7A 1ETTH 1O3MA 3UR6A 2VH0A 3TITA 2A4RA 2ILNA 4CH8B 4D9QA 3SJOA 1IQEA 4GUXA 3ZVGA 4X6PA 3TVJB 1AMHA 2VWMA 1GI3A 1SFQB 4FXGH 1C2IA 3GICB 5FX5A 4ZH8A 1W12U 1GVZA 1S6FA 1Y3UA 2VJ1A 3MU5A 1NRNH 1ZYOA 1LMWB 2BLOA 1FDPA 1TABE 1UMAH 1C1MA 2PGQB 3NXPA 5I25A 4GHTA 4BXWA 1GBMA 1LKAA 1EJAA 1T31A 4HTCH 2ODPA 3SN8A 1ZMNA 1Y3VA 4M7GA 1HXEH 2ZPQA 5F8XA 4FVBA 1S6HA 3U98H 1GCDA 3RUOA 1S83A 2CN0H 2ZKSA 3I77A 3ZZ3A 1N1LA 1Y3XA 1JOUB 4YTAA 4XE4A 1GBFA 3LJJA 1TGCA 2VGCC 4Y11E 1HUTH 4U32A 3A80A 1Z71A 2O8UA 1P0SH 3BTDE 3KNXA 2G55A 3NCLA 3UY9A 3O8CA 2K1QA 1NZQH 1ZMLA 4JZDH 3AASA 2BY6X 7GCHG 3RC5A 1CT2E 3KF2A 1MKWH 1NM6A 1O39A 1IQJA 5F8TA 4NZLA 3SI3H 5JPMH 1AU8A 1NRPH 1O2RA 2FZZA 1TMTH 4XSKU 2G00A 4X2YA 3DA9B 3BTFE 4Q2KA 2V3OH 3E91A 1VZQH 4I8GA 1ORFA 2RG3A 1HBTH 1T7CA 1PPHE 1S81A 4ABFA 9LPRA 1O2VA 1FY1A 1S84A 4YT7H 1P04A 3TLOA 4ZHMU 1JRSA 2GT7A 3SV2H 1V2UT 1P2QA 2DUCA 5FBIA 3P8FA 1Y8TA 2BQWB 1ZTKA 2Y80A 2ANKH 4R8TB 4MPVA 3A85A 3E1XB 2ZNKH 3PMBB 2ZHDA 4Y8YA 1V2MT 1FN6A 4MVNA 4XDEA 2BD8A 2BB4A 1ZPBA 2VINA 2H6MA 3P6ZB 1LVMA 1TFXA 2J9NA 2CGAA 2EI6A 3BTQE 1SGRE 1CVWH 1GHBF 1UJ1A 2VH6A 1C9PA 3SHCH 1O2UA 3MFJA 1KXCA 3ZVCA 2AS9A 4DW2U 1PPCE 2J4IA 1MBMA 3M7UA 3QTVH 3SU5A 4X2XA 1ZJDA 3GCHB 3RU4E 1B0EA 2VBCA 1L1NA 3EQ0H 1QB6A 3SYJA 2BHGA 2QC2A 3KGPA 3LGVA 1ZGIA 1KY9A 3RM0H 1C2MA 1QHRB 2F9VA 1TGNA 1GI6A 3SJ9A 4Y0YE 3O8RA 1C2FA 2SFAA 2GCHF 2XC0A 1W0YH 5AFZH 2O9QA 1SGPE 1GMHF 2FLBH 3TNTA 2A5KA 1HIAA 1NRQH 2PUQH 1F0RA 2FI3E 1K2I1 1HAVB 1QB9A 1T8MA 4BAOB 3GY3A 2XXLA 1LO6A 2PKAB 4B6EA 2C90B 3AAVA 3UOPA 6CHAC 1C5MD 1GGDC 1GHVH 2ZDLA 1ELBA 2GVFA 3TJUA 3HATH 1BTUA 5DK1A 2FOAA 1XXDA 4I32A 1C5SA 1SGDE 1C2GA 4BANB 3ZZDA 4AG1A 1THSH 5JYIA 3HGPA 4Q7YA 1FZZA 2FTMA 4YLUA 3ATLA 2GV7A 4INLA 1SGTA 4IN2A 2ZCKP 1D9IA 3M5OA 4D8NA 1CT0E 3SNBA 1BBRK 2HNTC 2V3HH 4E05H 1O3HA 3PMAB 3QGNB 1YCPH 5A8XA 2G51A 1Z6EA 5LH8A 1OWIA 1AN1E 1GJ7B 1W14U 1GMDF 3BTGE 4CRGA 2VIDA 4LZ1H 3FP6E 1EAXA 1LHGH 2ZWLH 2PSXA 1QA0A 4NWKA 1ELDE 2BDGA 2GZ9A 1OWHA 2NU4E 1TB6H 1TPOA 3V13A 3ZVDA 1QNJA 2CV3A 5EXLA 3URDA 1O5BB 1LPZB 1ESTA 1RD3B 1UHBA 4I8HA 2TGDA 4NG9H 6LPRA 2CHAB 3EAJA 2P8OC 2AGGX 4X2VA 4XFQA 1C1WH 3VB3A 1EZXC 1KLTA 1C5XB 1EZQA 2BD7A 4AN7A 3B8JA 1KXBA 4CRBA 3SORA 1AWHB 1QB1A 3A8DA 1NU9A 3M5LA 3WY8A 2A0QB 2B5TB 1O3CA 1ZMJA 3A82A 1RGQA 2F4LA 1XUIA 4CRCA 4ISOA 1V2KT 3UQOA 3NWUA 3KQDA 4UE7H 4ASHA 1P05A 4AFQA 4Y76A 5HGGA 3MH4A 1MCTA 3UQVA 2ZTXA 1RTLA 1BTXA 1MBQA 1OP0A 5A0AE 5LPRA 3SU1A 1A4WH 1XUJA 1FXYA 3TH2H 2O8MA 4WWYA 2Y5FA 4X6NA 3QX5H 2FYQA 4Y71A 5K7RA 2AMPA 1P01A 1G3EA 3GCTF 3B23B 1SQAA 4WMFA 1PFXC 1GJDB 4JYUH 3HKIB 1BQYA 2ANWA 6CHAB 3ATWA 1C1SA 3T5FH 1WSSH 2AIPA 4AG2A 2BVRH 2FX6A 1TBQH 1BA8B 1V2WT 2TGTA 1EP5A 1S0QA 1YPHE 3K9XB 4E7RG 3KHVA 1J8AA 3RMOH 3RLYH 1FONA 1NO9H 3B9FH 4BTUB 1H9HE 3I78A 4INHA 1GHAG 3SV7A 1NPMA 2Z6BD 5EXMA 1FY8E 2ZFFH 1BCUH 1RRKA 4IC6A 1TNIA 3OX7U 1FJSA 1UVUH 4ZXXH 2NU2E 1TGTA 5HYOA 2BX4A 2ZDAH 1FUJA 1EPTA 3LT3A 5ETXA 1Z8IB 1EB2A 3FP8E 1W7XH 1PQ5A 1H8IH 1SPJA 1UTLM 3T2NA 3TJVA 2A32A 2Y82A 1O3BA 4GVUA 1GJBB 3ODDA 1H8DH 3BEIB 4AYVB 1C2KA 2OBOA 3QGJA 1O3IA 2JH0D 1UTJA 1OP2A 1UK3A 3KN2A 1LCYA 2P8OB 3OYPA 2TPIZ 1CO7E 5F03A 1QBNA 2RA0A 2VVVA 4A5TS 2SGAA 5EW1H 1TX6A 3OSYA 2A4GA 2HPQH 5LGOA 2W7UA 1ZLRA 4GLYA 4DVAU 1PQAA 4MPXA 1LHDH 1MU8B 4U01A 4X2WA 5EQQA 3PB1E 4AOQA 2BVXH 2F9PA 3RXCA 4X8VH 4FUJA 4JZFH 1O36A 4O03A 2C93B 2A5AA 3TPIZ 4X1SU 3SUFA 2FXRA 1FY5A 4YLQH 4BOHA 4DURA 4O3UA 1WOFA 1ELAA 3PO1B 3QUMP 1RFNA 1Q31A 1TNJA 3LIWA 3E0PB 1Y5UT 1FN8A 2PTCE 1J9CH 3LC3A 3PWBA 6GCHG 4FUGA 1G30B 2GD4B 1K1LA 4Q7XA 4F4OC 3EA8A 4YESB 4CRFA 1A46H 2GMTC 5DP8A 1SFIA 5JB9S 1UTNA 1W0ZU 3PTBA 4B2AA 1IOEA 4ZKOU 2FOHA 1FNIA 2OC1A 4AYYB 1M9UA 2XC4A 2OINA 1SLVB 5BRRE 1O2TA 1P02A 3RP2A 3VXFH 3EA9A 1QTFA 5FPSA 1VJ9U 4ABAA 1EKBB 4ISHH 1FIZA 1AIXH 2ZDNA 3SGBE 1INCA 1UO6A 3BTHE 3QN7A 3EYDA 1TE0A 2HALA 1H1BA 1XVOA 2ZGJA 5JB8S 4CHAB 2PUXB 5JBAS 2EI8A 2P95A 4H4FA 5EG4A 2XWAA 1YLDA 3QO6A 1Q3XA 4MNVA 2A7JA 1F5RA 2GKVE 3BIUH 4ISLA 2XBXA 2VIPA 1Z8GA 3MYWA 5PTPA 2P3FH 2R2WU 1UCYK 5FHTA 2KAIB 4I7YH 2QCYA 3L3TA 1VITH 1QIXB 3CS0A 1HJAC 2ZC9H 4X1QU 3UNQA 3RXFA 3D62A 3S7HB 1BBRH 1PQ8A 1C1RA 4A7IB 1BRUP 1TRNA 4GCHG 4I31A 5L2YH 3AW1A 1HJ9A 1O38A 2GT8A 4B74A 4Q80A 2A1DB 5EOKA 3U1JB 2G52A 4DY7B 1BTZA 3T28A 1O3FA 4H42U 4X0WU 1ELVA 2I6SA 2ZPRA 1TNLA 2FOEA 4HGCA 1AZZA 1BOQA 1QJ7B 2QXIA 2NU1E 2FOMB 2QAAA 1D3DB 3STJA 2BZAA 3MH6A 3A87A 5A0CA 5C1UA 1MD8A 2BDYA 3U8OH 2Z9IA 1AGJA 3MNCA 1VITF 2BD5A 5A8ZA 1J17T 2THFB 1HAGE 3S7KB 1WV7H 4NA9H 3BTKE 1MH0A 3QZRA 1UTQA 3MOCA 1S82A 1OYQA 4OS6A 1HAZB 4B6FA 1HAIH 3E0NB 2XCNA 1YCPK 5BPEA 3HKJB 1TAWA 4O97A 2GMTB 2A5IA 4Y7AA 3TK9A 1E37B 1KDQA 3ODFA 1QJ6B 3A7ZA 3URCA 1G2LA 2SGQE 3LGIA 1LHCH 1P12E 3M37A 3RXQA 2JH5D 4AGJA 1K1PA 1K28D 3RXTA 3TH3H 2QIQA 1GG6B 2WV5A 1DXWA 1P3CA 1C5PA 1O33A 4WF8A 1PYTD 3SU2A 4WY3A 5JBBS 2Y6TA 1FI8A 5AFYH 2STAE 4YOIA 5DG6A 3T26A 1ETSH 4NIYA 4ESTE 1GBIA 3PYHA 4KKDA 2HNTF 4NFEA 1DM4B 2J92A 1C5TA 2VU8E 1XX9A 4XOJA 3LGWA 3MO6A 1SBWA 1FIWA 5GDSH 1KXDA 3PMJA 1DE7H 1C2EA 1XUGA 3GISB 4NA8A 2CF9H 1E35B 1OWEA 2UUKB 1UTOA 5A0BA 3ELAH 1GI7B 4ZKNU 1O2LA 1Z8JB 3P8GA 3S9CA 1YYY1 2QXHA 2FDAA 3GY8A 1GJ6A 1TBZH 4X6OA 5EXNA 3SBKA 1Y3YA 2J34A 2PLXA 3SQEE 4WJG2 1L2EA 1IQHA 3ZV9A 3EGKH 2ZU4A 2WPMS 2FO9A 3Q3XA 3OY6U 3ZZ7A 1EATA 1O5DH 1HJAB 1A7SA 1F92A 3GCHC 1GVLA 1E38B 4B76A 2Z3EA 4E06H 2ESTE 3KL6A 4NCYA 4K1TA 1C5NH 1DDJA 1OP8A 2UWLA 2F3CE 4YOGA 2OC8A 4GPGA 1YF4A
chains in the Genus database with same CATH superfamily
3E3TA 4UFDH 4KTCA 3W1EA 1EP6A 1CHOG 2FS8A 2H5DA 1DLEA 2IPQX 2Q6DA 4LZ4B 2ANYA 3FO8D 3JZ1B 2IJOB 3A83A 5EU8A 2H9EH 1XKAC 2ZO3H 2UUYA 2GZ7A 2NU3E 1C4U2 4P02A 5ABWA 3GCNA 3ZVFA 1SKYE 8KME2 2BX3A 3SU6A 1ANDA 3OEED 3RC6A 1LVYA 4AB9A 2LPRA 4K60A 4ZUHA 2C8ZB 4RN6A 5EPNA 2HVYB 4D7GA 2KCOA 1JRTA 3RXGA 1J14A 2V35A 1YPGH 3DFJA 1SLXB 1G3DA 3RXKA 1O2HA 4WH6A 3MH5A 1NESE 3FANA 2RCEA 4JYTA 4J1YA 4JZIA 4CR9A 5H4IB 1BUIA 2ZFPH 5ESTE 3SUDA 1K1MA 1GHYH 3UTUH 1GJ5H 1EZUC 1O3EA 2FIRH 1JMOH 2ZGCA 3ZZ9A 3GY4A 1ZJKA 2QA9E 3MNSA 3SNCA 4UDWH 2BYAX 3I29A 2FODA 4J2YB 1QQ4A 3RXPA 4M9FA 2ZCLP 5C94A 1GI9B 4FUFA 3RXAA 5GJ4B 4RKOB 3WW7A 1E36B 1CA0C 1OWDA 3MU4A 4DOQA 1SG8B 7ESTE 2G4UA 2XC5A 1OS8A 3A86A 4WXVA 3SNAA 3A7VA 3PLKA 1DWCH 1O3NA 1EAWA 1GJAB 2AYWA 1C1NA 2RFKC 5CHAC 1K21H 1LDTT 2TRMA 1TPAE 2PTNA 3HK3B 2XBYA 3RXJA 3PRBA 2NWNA 2ASUB 1VKYA 3F9HA 2ODQA 4WH8A 1P11E 4OGXA 1T32A 2CHAC 1HNEE 1HAHH 1OHHD 2OBQA 2FOFA 4CBNA 2V3MA 5C1XA 3PM3A 1QBVH 5DJ7A 1ARBA 1HGTH 1EQ9A 1IHSH 2WPIS 1EX3A 3LGYA 1AHTH 1C5UA 4VGCC 3RXUA 3F9FA 1GMCF 4MLFB 3H5CB 4YZUA 2H2ZA 4K8YA 1UCYH 1H9LB 1A5IA 2BOHB 1DWDH 1TGSZ 3T62A 2G4TA 3LPRA 3PV4A 1AE5A 3QTOH 1P2IA 1LQEA 3F6UH 4IBLH 4NGAH 4OS7A 1XM1A 4Y79A 2HLDD 2F9NA 1OYTH 1C4Y2 1HPGA 4MG3A 3U28C 1TQ7B 2XBVA 1IQIA 3FZDA 1ZPCA 2G8TA 4KP0A 4QT8C 2D26C 1GJ4H 2IOTA 2OCVB 2FOGA 3DT0H 4BXSA 3F0OA 1DWBH 1ELCA 5DP4A 2BTCE 1BTWA 1QL7A 3A7TA 2J95A 3QZQA 4JZ1A 1X7AC 2WYJA 3P95A 2ZFTA 1LKBA 5T3HA 4JYVH 3K65B 2ZHFH 4WXIA 3SZNA 2PKSB 4WVPE 1XUHA 1GHWH 3RXDA 3OU0A 5GWZA 1IQKA 9ESTA 1O3OA 4MPUA 2ZZUH 1YKTA 2C8WB 2QGRA 3ZZ4A 1WYKA 3SJKA 1GCTC 1VCWA 1MMJN 1ETRH 2SGPE 3RU4D 2GDDA 1K1NA 1GI1A 1T8LA 3NKKA 1CQQA 2FP7B 2Z94A 1CA0B 1E0FD 1CT4E 4Q7ZA 2OTVA 3NUMA 1QRWA 3MO3A 5CHAB 3PV2A 4R0IA 2SGEE 2AERH 1SGQE 3A8AA 1EAUA 1DY8A 6ESTA 6GCHF 1F2SE 2AH4X 2Z7FE 3ZYDA 2VIVA 2W3KA 5TJXA 2ZU2A 1UK2A 2ZHWH 3BTME 3PWCA 2SGFE 1NBME 4DIHH 1A5HA 4MDSA 4B75A 1GBLA 1J15A 5L30H 1K22H 1E34B 3D49H 2R9PA 3AK5A 2GDEH 2PWXA 1OOKB 1PPGE 4VGCB 1HAYB 1O2YA 2ZCHP 3SNEA 1SGYE 4FUDA 4FUBA 1DX5M 1AKSB 3S69A 1O5CB 4ABIA 3VEQB 1HAOH 2HOBA 1KMHB 1CU1A 2BDHA 3PO1C 4CH2B 1HB0B 4MPWA 1O3AA 4ZXYH 5GXPA 4RSPA 1IQNA 4FU7A 1TWXB 1C5ZB 3M7TA 1W0JD 3VB5A 3L33A 1WQVH 3BG8A 1PPZA 4GSOA 5GCHF 1SOTA 3RLWH 1D3QB 1H4WA 1P3EA 4CRDA 3LU9B 2BD4A 3ESTA 1TONA 4ZKRU 1NFWA 2AGEX 5EPYA 2Z9KA 1O31A 2NU0E 1C1TA 4A1VA 2PHBA 4ACAA 2PR3A 3KQEA 1FY3A 4AC9A 1GHBG 5LPEA 5FX6A 2Q6GA 1YWUA 4DCDA 1CA8B 3F2HA 1HFDA 1G3CA 3TK6A 2J38A 3LGUA 4CHAC 1U6QA 1PJPA 1GJCB 2XYAA 4FVDA 1AFEH 2HWLB 1NROH 3RXEA 1COWD 1HYLA 2G5NA 1O5EH 3PLBA 5E2PA 5L6NH 3A7XA 2K8IA 1DS2E 1YPHC 2M2AA 1A0JA 3GY2A 1GL1A 1WAYB 1UW7A 4BAHB 2OQUA 1N6XA 2HPPH 2ZQ2A 3SGAE 1GCTB 3P8NA 3E8LA 1BMMH 4AORA 1EAIA 5C67A 4XBDA 5EQSA 3ZVAA 1ZRKA 1OPHB 2OD3B 2JDID 1S85A 2GCHG 3DSPA 1ANCA 1AZ8A 4X8TH 1VCPA 2J94A 3RXLA 1QFKH 1GMHG 1FAKH 4U30A 1CSOE 2ZEBA 4NSYA 1HIAB 2M5TA 4XRNA 2VIQA 1MABB 1QRZA 2F9OA 3SW2B 4DT7B 3SI4H 1RS0A 4IGDA 5LPFA 4ABBA 5SGAE 3DHKH 4IC5A 3FKSD 2GGVB 4MNWA 3A88A 1CGHA 1LQDB 3D23A 2WINI 2GZ8A 1IAUA 2A45B 3SU3A 1P2KA 1ELTA 4K8BA 1GL0E 5K0HA 1L1GA 1LPKB 1QURH 2Z3DA 3PROA 1P2OA 1HAPH 3T27A 3LC5A 2VWOA 2VVCA 4Y0ZE 1C1VH 1O5AB 3G01A 1BRBE 2D1JA 4RT1A 1AB9C 3ATMA 2O8LA 1HCGA 3EA7A 3RXMA 2BD3A 1GI0A 2BM2A 3Q76A 2J2UA 1MU6B 1EOJA 1QRXA 1W13U 4ABJA 3PV5A 1KIGH 1P9UA 2UUFB 5C3NA 1THPB 3SGQE 1GMDG 1A5GH 1UK4A 4ABEA 4BAKB 4ZMAH 5FCKA 1TPSA 4XBCA 3AVZA 2JJ2D 1SQOA 3M5NA 1ZHPA 3VXEH 1IQGA 3D65E 2BY5X 1EFRD 2Z3CA 3P92A 2HGTH 5EODA 2P59A 3A7YA 3PRDA 1GG6C 2ZF0H 4SGAE 8ESTE 2ALPA 4KTUA 1HRTH 3KYGA 3UWJH 4YXWD 3KQBA 1UHBB 4AZ2B 1SGEE 1FY4A 1WUNH 2W7SA 5F6MA 1C1QA 2VNTA 4I8JA 2BD2A 1SVPA 5CHBA 5L2ZH 1W0KD 2RA3A 1AFQC 1O2PA 1TQ0B 2QXJA 1V2ST 1LHFH 2TBSA 2GX4A 2A7HA 4YOJA 4TSFD 3TIUA 3IG6B 1BTHH 5CE1A 2KCPA 1C2DA 1BMLA 2PFEA 1G32B 1O2JA 1ELFA 1G37A 5EW2H 4IN1A 2P3UB 3HK6B 3V12A 1PPFE 2F9UA 3F9EA 2J98A 4GAWA 3GDSA 2BMGB 1Y5BT 1N6YA 4NA7A 1HAXB 2G5VA 1N8OC 5TCCA 3GY7A 1O3JA 2XCFA 2FYRA 2ZHEH 2ZGBH 4X1PU 1ELGA 2UWPA 4I33A 3F3BA 2ZFSA 4JK6A 1C5VA 3VFEA 2FTLE 2QYIA 1C5RA 1Z6JH 1DOJA 3GYMA 4BNRA 2P16A 3STIA 2QF3A 3LOXA 3RXIA 1T8NA 4FU9A 7GCHF 4JCNA 1MTNB 3BIVH 1YPLH 1TNHA 4ZHLU 3MNBA 1DFPA 5T1VA 4ZROA 2J97A 3GYLB 5B6OA 5KECA 1QJ1B 5EGMA 2Y5GA 2Q1JA 3CNRA 5DKMA 2WYGA 1B7XB 3KEEA 2R0LA 1O3LA 3DFLA 3MO9A 2CXVA 2AHME 5E0HA 1NRRH 2ZI2H 2DE9A 2C8YB 1C2HA 1KLIH 3ZZ8A 3SV6A 2PP6A 2BQ6B 2P94A 4K1SA 1GPZA 1AB9B 1VJAU 5FBEA 1RXPA 2QF0A 2W6ID 4K2YA 5J4QA 3QK1A 1SGNE 1FQ3A 4A6LA 2P93A 1P2MA 2XW9A 4X8UH 2EI7A 1O2QA 3U8TH 3E90B 3PTNA 4NZQA 1TYNA 4AFZA 1BTPA 1FPCH 3MMGA 1DXPA 4D7FA 1HV7A 2SNWA 4NIVA 2A2QH 3C27B 2ZU3A 4INKA 1EPTB 1CGJE 3H7TA 1J16A 3GDUA 2XTTB 1SMFE 3MHWU 3OTPA 5DP5A 1KYNA 1A2CH 1P03A 4YO9A 2WPJS 3A8BA 1DUEA 1C4V2 3EDXB 2QV1A 1P09A 1F0SA 2OC7A 4LOYH 4FETA 1AFQB 4ABGA 5DPAA 3L6PA 1Y59T 3MNXA 4ZHAA 4BTTB 1QL9A 2CJIA 2KM0A 1O2WA 1A0LA 3F9GA 1A0HB 1UVPA 1O2KA 2OLGA 3NZIA 1OXGA 4TPYA 1CE5A 1DITH 4HFPB 1FAXA 1IHTH 2GJGA 2BLQA 1GBAA 4LXBH 1YPJH 3FAOA 2HLCA 2FWWA 3K2UA 2ZA5A 3KIDU 1SR5C 1HAVA 5B6LA 1BHXB 1SGIB 1N8OB 4XD7D 1C1PA 1BTYA 2TIOA 4ZKSU 4HZHA 3UIRA 1BRAA 5IYTA 3TJNA 1W10U 2PKAA 1ZSJA 2ZTZA 5C2ZA 1K9OE 2JETC 3MU8A 1BJVA 2BQ7B 1DANH 2EC9H 3F0PA 4HI3A 1VCQA 3K6ZA 1WXRA 4AB8A 2YNBA 2W6JD 1YGCH 4X1NU 1EXFA 2BXUH 2ZIQH 3SUEA 5J4SA 1TX8A 2CK3D 3IITA 3SJ8A 1O37A 3MU1A 5G4BA 1FV9A 3RDZA 3SU4A 1BIOA 4UD9H 4AGKA 1JXPA 3LDXH 1EB1H 1MAYA 2STBE 1OSSA 4AX9H 1NTPA 2FS9A 1WBGB 2IN2A 3M7QA 4D9RA 1XUFA 2ZPSA 1SOZA 1SLUB 4PROA 1XXFA 3SUGA 4FUCA 1NU7B 1KXFA 1JIMA 4OS2A 1C2JA 1V2RT 2PW8H 5EJZA 3HGNA 2LNCA 1D3TB 3TK5A 1TGBA 1BMNH 3RMMH 5I46H 2BDAA 3LJOA 2QN5T 2FESH 3OAAD 1NN6A 4CRAA 2Y7ZA 2Z9GA 1W7GH 1TIOA 1L4ZA 3BV9B 1O34A 4H6TA 3NPSA 1EUFA 1JIRA 2WV4A 3U8RH 2GP9B 5DP9A 1IQLA 1EJNA 1ABJH 1F0TA 2EY4C 3ATIA 2Q6FA 4ZAEA 4KTSA 2O8TA 5DP7A 3W95A 3GCOA 1MTSA 1BT7A 5AHGH 3BG4C 1DSTA 5T6FA 2PKSC 1O5FH 3RXOA 4B1TA 1SLWB 4IMZA 1RTFB 3Q3YA 2FPZA 3JZ2B 3SHAH 1KXEA 8GCHG 1O35A 1G3BA 1SQRA 4ACBA 1EJMA 2WPHS 4JZEH 2AEIH 5C20A 5TCAA 2B9LA 4TY7A 1VR1H 1C5QA 3ZZ5A 1TA6A 1UTMA 5E2OA 2YOLA 1RTKA 3AW0A 3VPKA 1YPKH 1AKSA 2DE8A 4NSVA 3FN8A 2FLRH 3RMLH 1HDTH 1BRCE 1VITG 2BY8X 1P8VC 3R3GB 3KCGH 5HKKD 1GHZA 2VVUA 1PQ7A 3VB4A 1TNGA 1KLJH 1P06A 4NWLA 3ZZAA 5JBCS 1AD8H 2Y7XA 3E16B 1GBTA 3V3MA 1AWFH 1O3PB 4IS5A 3SZEA 1UVOA 1UTPA 3V0XA 1CBWC 1XVMA 1F0UA 2JETB 2XNIA 3RXHA 2R3YA 2ZHQH 4TWWA 1O30A 1FLEE 1YCPM 2A4OA 3U9AH 1ZTJA 1SI5H 3RXVA 1KDQB 2V7QD 2GV6A 1G36A 1GHXH 1MKXK 1O2SA 4UONA 1ZHMA 1G9IE 2ZDVH 1BZXE 3FZZA 5A09A 1DPOA 1Y3WA 1YM0A 3A8CA 4X6MA 4A92A 2PSYA 1T4UH 4Y8XA 5C0TA 2B8OH 2I6QA 3GY5A 1BBRE 1XUKA 3ZZ6A 3UFAA 4WMEA 3UNSA 1ESBA 2ULLA 1HXFH 3DCLA 1GHAF 5GNDA 1NRSH 4D76A 2AMQA 1JWTA 2ZGXH 1GI8B 5DP6A 1KTSB 1O2NA 1Z1JA 1QR3E 3ATKA 3QLPH 3P70B 1TNKA 5HM9A 1KSNA 2H9HA 5F8ZA 2W3IA 1C5LH 5ESBA 3H09A 2AMDA 3O8BA 1TPPA 3MU0A 1C5WB 1EOLA 1L1JA 1S5SA 2QXGA 2XWBI 5IK2D 1O2IA 2VGCB 5FXLA 1DICA 3M36A 1O5GH 1NY22 4ZCNA 1K1JA 4BAQB 1ABIH 3GS9A 1ZRBA 1B5GH 3ZZBA 4H6SB 1P2JA 1H9IE 3BG4B 2BDBA 3TNSA 1KXAA 2GTBA 1PPEE 1A61H 2Y5HA 4CREA 4NFFA 1WTGH 3P8OA 1SB1H 3F1SB 3EE0B 2C3SA 1ZTLA 1MUEB 1MD7A 5T6DA 1DWEH 1O2MA 1O2ZA 2VIWA 2HNTE 1AE8H 2BXTH 3M3SA 2KR7A 1OX1A 1ANEA 1L4DA 1GVKB 2B7DH 2BZ6H 1K1OA 1O32A 2CMYA 5DSFA 1TRMA 2A7CA 1BB0B 1AUJA 4ISIH 5GIBA 2BVSH 5JBTA 4B71A 1MZAA 1V2TT 5CDFE 2OK5A 3LH1A 4Z6AH 1C1OA 2A2XH 2O8WA 1FPHH 1CHGA 3F2FA 2FEQH 3A7WA 1BHXF 4LK4A 1C5OH 3W94A 3MWIU 3U1IB 2H1UA 1A3EH 2PGBB 3ZVBA 1G2MA 2XNDD 2BD9A 1GDQA 4DIIH 3BTWE 3TJOA 1EZSC 2IJD1 4O9VA 1Z1IA 3V7TA 1OWJA 1AUTC 4TWYA 2GCTC 1KTTB 1MQ5A 3Q77A 1CBWB 1ZGVA 1D6WA 3CENA 2R0KA 4THNH 2ZTYA 4YT6H 1MTUA 2BDIA 1ANBA 2ALVA 1NFUA 2H9TH 4HG6A 4BTIB 2WPKS 4B73A 1BMAA 1MZDA 1W2KH 2ZECA 3OTJE 1BJUA 2G81E 2FOCA 1IQFA 2ZG0H 1TOCB 1XKBC 2ZP0H 4Y7BA 8LPRA 2ODYB 3S9AA 5E8EH 2TGAA 3TGKE 1C5YB 1ARCA 4K3JA 7LPRA 4KGAA 4RI0A 1Z7KA 3OY5U 5DGJA 3S0NA 3A84A 1O3GA 2BY9X 1DUAA 2KAIA 1QQUA 4OGYA 3TGIE 1V2OT 2V0BA 1O2OA 2WV9A 1MCVA 2VIOA 4SGBE 2BDCA 1QCPA 1LVOA 7KMEH 1C9TA 1V2NT 3P17H 1TALA 4AFSA 2UWOA 2XBWA 4A1XA 5JDUB 4ISNA 4GCHF 4RKJB 3CP7A 5DP3A 5IDKA 4AFUA 1THRH 1YP9A 1DVAH 2ZFRH 3ENSB 1GDUA 1S6LA 3BSQA 1O0DH 1GJ9B 2BOKA 2KCYA 5HM2A 1ELEE 1TMUH 4F48B 1NS3A 4A1TA 1AY6H 3S9BA 2F91A 1WQSA 1AVGH 1GGDB 4FUHA 4Y8ZA 1NBMD 3RC4A 2RDLA 1HLTH 4MTBA 1GMCG 2JKHA 1UVSH 1TMBH 1ZSKA 3UB0A 1V2QT 4DG4A 5DO4H 4UFGH 2OP9A 5C5OA 1SGFA 3ITIA 4U2WA 1FMGA 4ABDA 1SGFG 3RXRA 3TGJE 2ZDMA 3HPTB 1A1RA 2B0FA 1GWAA 1LTOA 2FM2A 3BEUA 3E6PH 3O8DA 2D2DA 3C1KA 2FMJA 3ZV8A 1Z8RA 3SU0A 4UFFH 3VB6A 1ZSLA 1RIWC 2HRVA 1D3PB 1MTNC 3BEFB 3UUZA 1SC8U 3MH7A 4OS5A 1V2LT 1A3BH 3IWMA 1CGIE 1O3KA 1F5KU 1IQMA 1TBRH 1SHHB 3N99A 1LVBA 5E0GA 2VB0A 1AO5A 1GJ8B 3M35A 4Q4LA 1O2XA 2Z9JA 1QBOA 1W8BH 1AVWA 2WUCA 4NIXA 5FPYA 3UPEA 2ANMH 1F5LA 2GCTB 2ZU5A 1W11U 1QL8A 1DSUA 4KELA 1E1RD 2KZ4A 4CBOA 2AGIX 4I8LA 2V6NA 5E0JA 2JH6D 4Z0KA 1AVXA 3Q00A 4UFEH 3SV8A 2XRCA 4Q63A 1SL3A 1ESAA 2TGPZ 3ZVEA 2SGDE 2OC0A 4O3TA 2AIQA 2EEKA 1SSXA 5AF9H 1T4VH 1MKWK 5FCRA 1GBHA 3DUXH 2R2MB 1D4PB 2F9BH 1EPTC 1YPMH 1MTVA 1MKXH 3FFGA 2BY7X 1P9SA 3PLPA 3KYFA 4K69A 1QY6A 4JK5A 3FP7E 1UCYE 4OM9A 1GBJA 1VGCC 1WTHD 1O2GH 2EQNA 1T8OA 3PMHB 3RXBA 1W3CA 4UEHH 3GY6A 1BITA 1V2VT 1GI4A 1GBEA 2AFQB 3M5MA 3UWIA 3NK8A 1QGFA 1NFXA 2EA3A 2WUBA 2WPLS 1LHEH 2ZDKA 1YC0A 2OUAA 3SQHE 5DN6D 4BAMB 3R0FA 5GPIB 1ID5H 3SJIA 3UNRA 5FPTA 4IMQA 1SGCA 2KFWA 1P10A 2L6OA 2ZFQH 1Q2WA 3TH4H 1CHOF 4F49A 4MNYA 4CR5A 1C2LA 2WHXA 1QZ8A 1XMNB 3QDZB 3VGCC 1LPGB 5T6GA 2FI4E 4YM9A 3LKWA 1JBUH 3K6YA 4K5ZA 5FAHA 1TRYA 3UOUA 2IPHA 1P2NA 1BDAA 2F83A 4DJZB 3AAUA 4JMYA 1ZZZA 1YLCA 1ZR0A 1L0ZA 3FVFB 1SQTA 2Z9LA 2HVXA 1TX7A 3SV9A 1V3XA 3RM2H 3EE7A 1AI8H 1H8HD 4I8KA 5GCHG 1GBDA 1HJ8A 2A31A 3UR9A 1V2PT 3H7OA 3N7EA 2Y81A 1RIWB 3GCTG 5A8YA 2R3UA 3GOVB 2FX4A 1GBCA 4OS4A 2YNAA 5EQRA 1YPEH 4DT4A 3VB7A 1AQ7A 1SHYA 3BTEE 2OXSA 5HMAA 2D8WA 4WMDA 1MTWA 4FUIA 1DY9A 5A2MH 1NFYA 4Y6DA 2JJ1D 4Y10E 1UTKA 3SOSA 5HXFA 1D6RA 8GCHF 3UREA 3MTYA 5CMXH 4TY6A 4XBBA 1PYTC 3BTTE 4B2BA 1UVTH 2PV9B 5C1YA 2W26A 3A89A 3RMNH 1WU1A 4K1EA 1ZHRA 3BN9A 3ZZCA 2BLWA 3QWCH 4X8SH 5C5NA 2A4QA 4TPIZ 1O3DA 1V6DA 1P57B 4B2CA 1YBWA 1ZPZA 1DLKB 1S0RA 1NT1A 1K1IA 4FU8A 4NIWA 2OQ5A 1GBKA 3A81A 3N7OA 4MNXA 2BLVA 1OKXA 3DD2H 3ZYEA 3M61U 1TOMH 1F7ZA 1ZOMA 2SNVA 2FOBA 3RXSA 1WCZA 3MI4A 4GHQA 1DT2A 1MAXA 4IW4E 1TA2A 1VGCB 5AVDA 3TU7H 4FOUC 1OWKA 1TLDA 3F68H 2ZU1A 4X1RU 1B0FA 3NRLA 1GBBA 1ACBE 2QY0B 2ZGHA 1GI2A 3T29A 2ZQ1A 3KQCA 1QA7A 3RU4T 2FI5E 3SNDA 4OS1A 1GI5A 3LH3A 1MQ6A 2C8XB 3U69H 3BF6H 2UUJB 1PPBH 1EASA 3M3TA 4E7NA 5F53A 4ABHA 2KX4A 2W5EA 3SO3A 2C4FH 2WZQA 3VGCB 2VWNA 4DGJA 4MQAA 4TYDA 1NC6A 1GDNA 2CF8H 3LONA 3M3VA 1C1UH 2VWLA 4I86A 3Q3KA 3LGTA 3T25A 1V2JT 4FUEA 3GDVA 2P3TB 2H5CA 3DSGA 1Y5AT 1RJXB 3CS7A 1ETTH 1O3MA 3UR6A 2VH0A 3TITA 2A4RA 2ILNA 4CH8B 4D9QA 3SJOA 1IQEA 4GUXA 3ZVGA 4X6PA 3TVJB 1AMHA 2VWMA 1GI3A 1SFQB 4FXGH 1C2IA 3GICB 5FX5A 4ZH8A 1W12U 1GVZA 1S6FA 1Y3UA 2VJ1A 3MU5A 1NRNH 1ZYOA 1LMWB 2BLOA 1FDPA 1TABE 1UMAH 1C1MA 2PGQB 3NXPA 5I25A 4GHTA 4BXWA 1GBMA 1LKAA 1EJAA 1T31A 4HTCH 4RT0A 2ODPA 3SN8A 1ZMNA 1Y3VA 4M7GA 1HXEH 2ZPQA 5F8XA 4FVBA 1S6HA 3U98H 1GCDA 3RUOA 3WWFA 1S83A 2CN0H 2ZKSA 3I77A 3ZZ3A 1N1LA 1BMFD 1Y3XA 1JOUB 4YTAA 4XE4A 1GBFA 3LJJA 1TGCA 2VGCC 4Y11E 2J98B 1HUTH 4U32A 3A80A 1Z71A 2O8UA 2YMSB 1P0SH 3BTDE 3KNXA 2G55A 1K0HA 3NCLA 3UY9A 3O8CA 2K1QA 1NZQH 1ZMLA 4JZDH 3AASA 2BY6X 7GCHG 3RC5A 1CT2E 3KF2A 1MKWH 1NM6A 1O39A 1H8ED 1IQJA 5F8TA 1E1QD 4NZLA 3SI3H 5JPMH 1AU8A 1NRPH 1O2RA 2FZZA 1TMTH 4XSKU 2G00A 4X2YA 3DA9B 3BTFE 4Q2KA 2V3OH 3E91A 1VZQH 4I8GA 1ORFA 2RG3A 1HBTH 1T7CA 1PPHE 1S81A 4ABFA 9LPRA 1O2VA 1FY1A 1S84A 2LP6A 1P04A 4YT7H 3TLOA 4ZHMU 1JRSA 2GT7A 3SV2H 1V2UT 1P2QA 2DUCA 5FBIA 3P8FA 1Y8TA 2BQWB 1ZTKA 2Y80A 2ANKH 4R8TB 4MPVA 3OEHD 3A85A 3E1XB 2ZNKH 3PMBB 2ZHDA 4Y8YA 1V2MT 1FN6A 4MVNA 4XDEA 2BD8A 2BB4A 1ZPBA 2KCAA 2VINA 2H6MA 3P6ZB 1LVMA 1TFXA 2J9NA 2CGAA 2EI6A 3DSOA 3BTQE 1SGRE 2QE7D 1CVWH 1GHBF 2WPDD 1UJ1A 2VH6A 1C9PA 3SHCH 1O2UA 3MFJA 1KXCA 3ZVCA 2AS9A 4DW2U 1PPCE 2J4IA 1MBMA 3M7UA 3QTVH 2WSSD 4Z1MD 3SU5A 4X2XA 1ZJDA 3GCHB 3RU4E 1B0EA 2VBCA 1L1NA 3EQ0H 1QB6A 3SYJA 2BHGA 2L74A 2QC2A 3KGPA 3LGVA 1ZGIA 3ZIAD 1KY9A 3RM0H 1C2MA 1QHRB 2F9VA 1TGNA 2RDEA 1GI6A 3SJ9A 4Y0YE 3O8RA 1C2FA 2SFAA 2GCHF 2XC0A 1W0YH 5AFZH 2O9QA 1SGPE 1GMHF 2FLBH 3TNTA 2A5KA 1HIAA 1NRQH 2PUQH 1F0RA 2FI3E 1K2I1 1HAVB 3OE7D 1QB9A 1T8MA 4BAOB 2K0QA 3GY3A 2XXLA 1LO6A 2PKAB 4B6EA 2C90B 3AAVA 3UOPA 6CHAC 1C5MD 1GGDC 1GHVH 2ZDLA 1ELBA 2GVFA 3TJUA 3HATH 1BTUA 5DK1A 2FOAA 1XXDA 4I32A 1C5SA 1SGDE 1C2GA 4BANB 3ZZDA 4AG1A 1THSH 5JYIA 3HGPA 4Q7YA 1FZZA 2FTMA 4YLUA 3ATLA 2GV7A 4INLA 1SGTA 4IN2A 2ZCKP 1D9IA 3M5OA 4D8NA 1CT0E 3SNBA 1BBRK 2HNTC 2V3HH 4E05H 1O3HA 3PMAB 3QGNB 1YCPH 5A8XA 2G51A 1Z6EA 5LH8A 1OWIA 1AN1E 1WDIA 1GJ7B 1W14U 1GMDF 3BTGE 4CRGA 2VIDA 4LZ1H 3FP6E 1EAXA 1LHGH 2ZWLH 2PSXA 1QA0A 4NWKA 1ELDE 2BDGA 2GZ9A 5KEDA 1OWHA 2NU4E 3MQKC 1TB6H 1TPOA 3V13A 3ZVDA 1QNJA 2CV3A 5EXLA 3URDA 1O5BB 1LPZB 1ESTA 1RD3B 1UHBA 4I8HA 2TGDA 4NG9H 6LPRA 2CHAB 3EAJA 2P8OC 2AGGX 4X2VA 4XFQA 1C1WH 3VB3A 1EZXC 1KLTA 1C5XB 2XOKD 1EZQA 2BD7A 4AN7A 3B8JA 1KXBA 4CRBA 3SORA 1AWHB 1QB1A 3A8DA 1NU9A 3M5LA 3WY8A 2A0QB 2B5TB 1O3CA 1ZMJA 3A82A 1RGQA 2F4LA 1XUIA 4CRCA 4ISOA 1V2KT 3UQOA 3NWUA 3KQDA 4UE7H 4ASHA 1P05A 2J5UA 4AFQA 4Y76A 5HGGA 3MH4A 1MCTA 3UQVA 2ZTXA 1RTLA 1BTXA 1MBQA 4ASUD 1OP0A 5A0AE 5LPRA 3SU1A 1A4WH 1XUJA 1FXYA 3TH2H 2O8MA 4WWYA 2Y5FA 3F2GA 4X6NA 3QX5H 2FYQA 4Y71A 5K7RA 2AMPA 1P01A 1G3EA 3GCTF 3B23B 1SQAA 4WMFA 1PFXC 1GJDB 4JYUH 3HKIB 1BQYA 2ANWA 6CHAB 3ATWA 1C1SA 2QF4A 3T5FH 1WSSH 2AIPA 4AG2A 1YY3A 2BVRH 2FX6A 1TBQH 1BA8B 1V2WT 2TGTA 1EP5A 1S0QA 1YPHE 3K9XB 4E7RG 3KHVA 1J8AA 3RMOH 3RLYH 1FONA 1NO9H 3B9FH 4BTUB 1H9HE 3I78A 4INHA 1GHAG 3SV7A 1NPMA 2Z6BD 5EXMA 1FY8E 2ZFFH 1BCUH 1RRKA 4IC6A 1TNIA 3OX7U 1FJSA 1UVUH 4ZXXH 2NU2E 1TGTA 5HYOA 2BX4A 2ZDAH 1FUJA 1EPTA 3LT3A 5ETXA 1Z8IB 1EB2A 3FP8E 1W7XH 1PQ5A 1H8IH 1SPJA 1UTLM 3T2NA 3TJVA 2A32A 2Y82A 1O3BA 4GVUA 1GJBB 3ODDA 1H8DH 3BEIB 4AYVB 1C2KA 2OBOA 3QGJA 1O3IA 2JH0D 1UTJA 1OP2A 1UK3A 3KN2A 1LCYA 2P8OB 1E79D 3OYPA 2TPIZ 2QF5A 1CO7E 5F03A 1QBNA 2RA0A 2VVVA 4A5TS 2SGAA 5EW1H 1TX6A 3OSYA 2A4GA 2HPQH 5LGOA 2W7UA 1ZLRA 4GLYA 4DVAU 1PQAA 4MPXA 5C17A 1LHDH 1MU8B 4U01A 4X2WA 5EQQA 3PB1E 4AOQA 2F43B 2BVXH 2F9PA 3RXCA 4X8VH 4FUJA 4JZFH 1O36A 4O03A 2C93B 1YLNA 2A5AA 3TPIZ 4X1SU 3SUFA 2FXRA 1FY5A 4YLQH 4BOHA 4DURA 4O3UA 1WOFA 1ELAA 3PO1B 3QUMP 4P00A 1RFNA 1Q31A 1TNJA 3LIWA 3E0PB 1Y5UT 1FN8A 2PTCE 1J9CH 3LC3A 3PWBA 6GCHG 4FUGA 1G30B 2GD4B 1K1LA 4Q7XA 4F4OC 3EA8A 4YESB 4CRFA 1A46H 2GMTC 5DP8A 1SFIA 5JB9S 5EJ1A 1UTNA 1W0ZU 3PTBA 4B2AA 1IOEA 4ZKOU 2FOHA 1FNIA 2OC1A 4AYYB 3KQ5A 5C0UA 1M9UA 2XC4A 2OINA 1SLVB 5BRRE 1O2TA 1P02A 3RP2A 3VXFH 3EA9A 1QTFA 5FPSA 1VJ9U 4ABAA 1EKBB 4ISHH 2LELA 1FIZA 1AIXH 5HIZA 3VG8A 2ZDNA 3SGBE 1INCA 1UO6A 3BTHE 3QN7A 3EYDA 1TE0A 2HALA 1H1BA 1XVOA 2ZGJA 5JB8S 4CHAB 2PUXB 5JBAS 2EI8A 2P95A 4H4FA 5EG4A 3OFND 3N7DA 2JIZD 2XWAA 1YLDA 3QO6A 1Q3XA 4MNVA 2A7JA 1F5RA 2GKVE 3BIUH 4ISLA 2XBXA 2VIPA 1Z8GA 3UAIC 3MYWA 5PTPA 2P3FH 2R2WU 1UCYK 5FHTA 2KAIB 4I7YH 2QCYA 3L3TA 1VITH 1FX0B 1QIXB 3CS0A 1HJAC 2ZC9H 4X1QU 3UNQA 3RXFA 5EJLA 3D62A 3S7HB 1BBRH 1PQ8A 1C1RA 4A7IB 1BRUP 1TRNA 4GCHG 4I31A 5L2YH 3AW1A 1HJ9A 1O38A 2GT8A 4B74A 4Q80A 2A1DB 5EOKA 5FL7D 2G52A 3U1JB 4DY7B 1BTZA 3T28A 1O3FA 4H42U 4X0WU 1ELVA 2I6SA 2ZPRA 1TNLA 2FOEA 4HGCA 1AZZA 1BOQA 1QJ7B 2QXIA 2NU1E 2FOMB 2QAAA 1D3DB 3STJA 2BZAA 3MH6A 3A87A 5A0CA 5C1UA 1MD8A 2BDYA 3U8OH 2Z9IA 1AGJA 3MNCA 1VITF 2BD5A 5A8ZA 1J17T 2THFB 1HAGE 2YMSC 3S7KB 1WV7H 4NA9H 5EIYA 3BTKE 1MH0A 3QZRA 1UTQA 3MOCA 1S82A 1OYQA 4OS6A 1HAZB 4B6FA 1HAIH 3E0NB 2XCNA 1YCPK 5KGOA 5BPEA 3HKJB 1TAWA 4O97A 2GMTB 4F55A 2A5IA 4Y7AA 3TK9A 1E37B 1KDQA 3ODFA 1QJ6B 3A7ZA 3URCA 1G2LA 2SGQE 3LGIA 1LHCH 1P12E 3M37A 3RXQA 2JH5D 4AGJA 1K1PA 1K28D 3RXTA 3TH3H 2QIQA 1GG6B 2WV5A 1DXWA 1P3CA 1C5PA 1O33A 4WF8A 1PYTD 3SU2A 3WWBA 4WY3A 5JBBS 2Y6TA 1FI8A 5AFYH 2STAE 4YOIA 5DG6A 3T26A 1ETSH 4NIYA 4ESTE 1GBIA 3FOAA 3PYHA 4KKDA 2HNTF 4NFEA 1DM4B 2J92A 1C5TA 2VU8E 1XX9A 4XOJA 3LGWA 3MO6A 1SBWA 1FIWA 5GDSH 1KXDA 3PMJA 2YMSD 1DE7H 1C2EA 1XUGA 3GISB 4NA8A 2CF9H 1E35B 1OWEA 2UUKB 1UTOA 4TT3D 3ELAH 5A0BA 1GI7B 4ZKNU 1O2LA 1Z8JB 3P8GA 3S9CA 1YYY1 2QXHA 2FDAA 3GY8A 1GJ6A 1TBZH 4X6OA 5EXNA 3SBKA 1Y3YA 2J34A 2PLXA 3SQEE 4WJG2 1L2EA 1IQHA 3ZV9A 3EGKH 2ZU4A 2WPMS 2FO9A 3Q3XA 3OY6U 3ZZ7A 1EATA 1O5DH 1HJAB 1A7SA 1F92A 3GCHC 1GVLA 1E38B 4B76A 2Z3EA 4E06H 2ESTE 3KL6A 4NCYA 4K1TA 1C5NH 1DDJA 1OP8A 2UWLA 5HIYA 2F3CE 4YOGA 2OC8A 4GPGA 1YF4A
chains in the Genus database with same CATH topology
3E3TA 4UFDH 4KTCA 3W1EA 1EP6A 1CHOG 2FS8A 2H5DA 1DLEA 2Q6DA 4LZ4B 2ANYA 3JZ1B 3FO8D 2IJOB 3A83A 5EU8A 2H9EH 1XKAC 2ZO3H 2UUYA 2GZ7A 2NU3E 1C4U2 5ABWA 3GCNA 3ZVFA 1SKYE 8KME2 2BX3A 3SU6A 1ANDA 3OEED 3RC6A 1LVYA 4AB9A 2LPRA 4K60A 4ZUHA 2C8ZB 4RN6A 5EPNA 4D7GA 2KCOA 1JRTA 3RXGA 1J14A 2V35A 1YPGH 3DFJA 1SLXB 1G3DA 3RXKA 1O2HA 4WH6A 3MH5A 1NESE 3FANA 2RCEA 4JYTA 4J1YA 4JZIA 4CR9A 5H4IB 1BUIA 2ZFPH 5ESTE 3SUDA 1K1MA 1GHYH 3UTUH 1GJ5H 1EZUC 1O3EA 2FIRH 1JMOH 2ZGCA 3ZZ9A 3GY4A 1ZJKA 2QA9E 3MNSA 3SNCA 4UDWH 2BYAX 3I29A 2FODA 4J2YB 1QQ4A 3RXPA 4M9FA 2ZCLP 1GI9B 4FUFA 3RXAA 5GJ4B 4RKOB 3WW7A 1E36B 1CA0C 1OWDA 3MU4A 4DOQA 1SG8B 7ESTE 2G4UA 2XC5A 1OS8A 3A86A 4WXVA 3SNAA 3A7VA 3PLKA 1DWCH 1O3NA 1EAWA 1GJAB 2AYWA 1C1NA 5CHAC 1K21H 1LDTT 2TRMA 1TPAE 2PTNA 3HK3B 2XBYA 3RXJA 3PRBA 2NWNA 2ASUB 3F9HA 2ODQA 4WH8A 1P11E 4OGXA 1T32A 2CHAC 1HNEE 1HAHH 2OBQA 1OHHD 2FOFA 4CBNA 5C1XA 3PM3A 1QBVH 5DJ7A 1ARBA 1HGTH 1EQ9A 1IHSH 2WPIS 1EX3A 3LGYA 1AHTH 1C5UA 4VGCC 3RXUA 3F9FA 1GMCF 4MLFB 3H5CB 4YZUA 2H2ZA 4K8YA 1UCYH 1H9LB 1A5IA 2BOHB 1DWDH 1TGSZ 3T62A 2G4TA 3LPRA 3PV4A 1AE5A 3QTOH 1P2IA 1LQEA 3F6UH 4IBLH 4NGAH 4OS7A 1XM1A 4Y79A 2HLDD 2F9NA 1OYTH 1C4Y2 1HPGA 4MG3A 1TQ7B 2XBVA 1IQIA 3FZDA 1ZPCA 2G8TA 4KP0A 4QT8C 2D26C 1GJ4H 2IOTA 2OCVB 2FOGA 3DT0H 4BXSA 3F0OA 1DWBH 1ELCA 5DP4A 2BTCE 1BTWA 1QL7A 3A7TA 2J95A 3QZQA 4JZ1A 1X7AC 2WYJA 3P95A 2ZFTA 1LKBA 5T3HA 4JYVH 3K65B 2ZHFH 4WXIA 3SZNA 2PKSB 4WVPE 1XUHA 1GHWH 3RXDA 3OU0A 5GWZA 1IQKA 9ESTA 1O3OA 4MPUA 2ZZUH 1YKTA 2C8WB 2QGRA 3ZZ4A 1WYKA 3SJKA 1GCTC 1VCWA 1MMJN 1ETRH 2SGPE 3RU4D 2GDDA 1K1NA 1GI1A 1T8LA 3NKKA 1CQQA 2FP7B 2Z94A 1CA0B 1E0FD 1CT4E 4Q7ZA 2OTVA 3NUMA 1QRWA 3MO3A 5CHAB 3PV2A 4R0IA 2SGEE 2AERH 1SGQE 3A8AA 1EAUA 1DY8A 6ESTA 6GCHF 1F2SE 2AH4X 2Z7FE 3ZYDA 2VIVA 2W3KA 5TJXA 2ZU2A 1UK2A 2ZHWH 3BTME 3PWCA 2SGFE 1NBME 4DIHH 1A5HA 4MDSA 4B75A 1GBLA 1J15A 5L30H 1K22H 1E34B 3D49H 2R9PA 3AK5A 2GDEH 2PWXA 1OOKB 1PPGE 4VGCB 1HAYB 1O2YA 2ZCHP 3SNEA 1SGYE 4FUDA 4FUBA 1DX5M 1AKSB 3S69A 1O5CB 4ABIA 3VEQB 1HAOH 2HOBA 1KMHB 1CU1A 2BDHA 3PO1C 4CH2B 1HB0B 4MPWA 1O3AA 4ZXYH 5GXPA 4RSPA 1IQNA 4FU7A 1TWXB 1C5ZB 3M7TA 1W0JD 3VB5A 3L33A 1WQVH 3BG8A 1PPZA 4GSOA 5GCHF 1SOTA 3RLWH 1D3QB 1H4WA 1P3EA 4CRDA 3LU9B 2BD4A 3ESTA 1TONA 4ZKRU 1NFWA 2AGEX 5EPYA 2Z9KA 1O31A 2NU0E 1C1TA 4A1VA 2PHBA 2PR3A 3KQEA 1FY3A 1GHBG 5LPEA 5FX6A 2Q6GA 4DCDA 1CA8B 3F2HA 1HFDA 1G3CA 3TK6A 2J38A 3LGUA 4CHAC 1U6QA 1PJPA 1GJCB 2XYAA 4FVDA 1AFEH 2HWLB 1NROH 3RXEA 1HYLA 2G5NA 1COWD 1O5EH 3PLBA 5E2PA 5L6NH 3A7XA 2K8IA 1DS2E 1YPHC 2M2AA 1A0JA 3GY2A 1GL1A 1WAYB 4BAHB 2OQUA 1N6XA 2HPPH 2ZQ2A 3SGAE 1GCTB 3P8NA 3E8LA 1BMMH 4AORA 1EAIA 5C67A 4XBDA 5EQSA 3ZVAA 1ZRKA 1OPHB 2OD3B 2JDID 1S85A 2GCHG 3DSPA 1ANCA 1AZ8A 4X8TH 1VCPA 2J94A 3RXLA 1QFKH 1GMHG 1FAKH 4U30A 1CSOE 2ZEBA 4NSYA 1HIAB 2M5TA 2VIQA 3SW2B 1QRZA 2F9OA 4DT7B 1MABB 3SI4H 1RS0A 4IGDA 5LPFA 4ABBA 5SGAE 3DHKH 4IC5A 3FKSD 2GGVB 4MNWA 3A88A 1CGHA 1LQDB 3D23A 2WINI 2GZ8A 1IAUA 2A45B 3SU3A 1P2KA 1ELTA 4K8BA 1GL0E 5K0HA 1L1GA 1LPKB 1QURH 2Z3DA 3PROA 1P2OA 1HAPH 3T27A 3LC5A 2VWOA 2VVCA 4Y0ZE 1C1VH 1O5AB 3G01A 1BRBE 2D1JA 1AB9C 3ATMA 2O8LA 1HCGA 3EA7A 3RXMA 2BD3A 1GI0A 2BM2A 3Q76A 2J2UA 1MU6B 1EOJA 1QRXA 1W13U 4ABJA 3PV5A 1KIGH 1P9UA 2UUFB 5C3NA 1THPB 3SGQE 1GMDG 1A5GH 1UK4A 4ABEA 4BAKB 4ZMAH 5FCKA 1TPSA 4XBCA 3AVZA 2JJ2D 1SQOA 3M5NA 1ZHPA 3VXEH 1IQGA 3D65E 2BY5X 2Z3CA 3P92A 1EFRD 2HGTH 5EODA 2P59A 3A7YA 3PRDA 1GG6C 2ZF0H 4SGAE 8ESTE 2ALPA 4KTUA 1HRTH 3UWJH 4YXWD 3KQBA 1UHBB 4AZ2B 1SGEE 1FY4A 1WUNH 2W7SA 5F6MA 1C1QA 2VNTA 4I8JA 2BD2A 1SVPA 5L2ZH 5CHBA 1W0KD 2RA3A 1AFQC 1O2PA 1TQ0B 2QXJA 1V2ST 1LHFH 2TBSA 2GX4A 2A7HA 4YOJA 4TSFD 3TIUA 3IG6B 1BTHH 5CE1A 2KCPA 1C2DA 1BMLA 2PFEA 1G32B 1O2JA 1ELFA 1G37A 5EW2H 4IN1A 2P3UB 3HK6B 3V12A 1PPFE 2F9UA 3F9EA 4GAWA 3GDSA 2BMGB 1Y5BT 1N6YA 4NA7A 1HAXB 2G5VA 1N8OC 5TCCA 3GY7A 1O3JA 2XCFA 2FYRA 2ZHEH 2ZGBH 4X1PU 1ELGA 2UWPA 4I33A 3F3BA 2ZFSA 4JK6A 1C5VA 3VFEA 2FTLE 2QYIA 1C5RA 1Z6JH 1DOJA 3GYMA 4BNRA 2P16A 3STIA 2QF3A 3LOXA 3RXIA 1T8NA 4FU9A 7GCHF 4JCNA 1MTNB 3BIVH 1YPLH 1TNHA 4ZHLU 3MNBA 1DFPA 5T1VA 4ZROA 3GYLB 5B6OA 1QJ1B 5EGMA 2Y5GA 2Q1JA 5DKMA 2WYGA 1B7XB 3KEEA 2R0LA 1O3LA 3DFLA 3MO9A 2CXVA 5E0HA 2AHME 1NRRH 2ZI2H 2DE9A 2C8YB 1C2HA 1KLIH 3ZZ8A 3SV6A 2BQ6B 2P94A 4K1SA 1GPZA 1AB9B 1VJAU 5FBEA 1RXPA 2QF0A 2W6ID 4K2YA 5J4QA 3QK1A 1SGNE 1FQ3A 4A6LA 2P93A 1P2MA 2XW9A 4X8UH 2EI7A 1O2QA 3U8TH 3E90B 3PTNA 4NZQA 1TYNA 4AFZA 1BTPA 1FPCH 3MMGA 1DXPA 4D7FA 1HV7A 2SNWA 4NIVA 2A2QH 3C27B 2ZU3A 4INKA 1EPTB 1CGJE 3H7TA 1J16A 3GDUA 2XTTB 1SMFE 3MHWU 5DP5A 3OTPA 1KYNA 1A2CH 1P03A 4YO9A 2WPJS 3A8BA 1DUEA 1C4V2 3EDXB 2QV1A 1P09A 1F0SA 2OC7A 4LOYH 4ABGA 1AFQB 4FETA 5DPAA 3L6PA 1Y59T 3MNXA 4ZHAA 4BTTB 1QL9A 2CJIA 2KM0A 1O2WA 1A0LA 3F9GA 1A0HB 1UVPA 1O2KA 2OLGA 3NZIA 1OXGA 4TPYA 1CE5A 1DITH 4HFPB 1FAXA 1IHTH 2BLQA 1GBAA 4LXBH 1YPJH 3FAOA 2HLCA 2FWWA 3K2UA 2ZA5A 3KIDU 1SR5C 1HAVA 5B6LA 1BHXB 1SGIB 1N8OB 4XD7D 1C1PA 1BTYA 2TIOA 4ZKSU 4HZHA 3UIRA 1BRAA 5IYTA 3TJNA 1W10U 2PKAA 1ZSJA 2ZTZA 5C2ZA 1K9OE 2JETC 3MU8A 1BJVA 2BQ7B 1DANH 2EC9H 4HI3A 3F0PA 1VCQA 3K6ZA 1WXRA 4AB8A 2YNBA 4X1NU 1YGCH 2W6JD 1EXFA 2BXUH 2ZIQH 3SUEA 5J4SA 1TX8A 3IITA 3SJ8A 2CK3D 1O37A 3MU1A 5G4BA 1FV9A 3RDZA 3SU4A 1BIOA 4UD9H 4AGKA 1JXPA 3LDXH 1EB1H 1MAYA 2STBE 1OSSA 4AX9H 1NTPA 2FS9A 1WBGB 2IN2A 3M7QA 4D9RA 1XUFA 2ZPSA 1SOZA 1SLUB 4PROA 1XXFA 3SUGA 4FUCA 1NU7B 1KXFA 1JIMA 4OS2A 1C2JA 1V2RT 2PW8H 3HGNA 2LNCA 1D3TB 3TK5A 1TGBA 1BMNH 3RMMH 5I46H 2BDAA 3LJOA 2QN5T 2FESH 3OAAD 1NN6A 4CRAA 2Y7ZA 2Z9GA 1W7GH 1TIOA 1L4ZA 3BV9B 1O34A 4H6TA 3NPSA 1EUFA 1JIRA 2WV4A 3U8RH 2GP9B 5DP9A 1IQLA 1EJNA 1ABJH 1F0TA 3ATIA 2Q6FA 4ZAEA 4KTSA 2O8TA 5DP7A 3W95A 3GCOA 1MTSA 1BT7A 5AHGH 3BG4C 1DSTA 5T6FA 2PKSC 1O5FH 3RXOA 4B1TA 1SLWB 4IMZA 1RTFB 3Q3YA 2FPZA 3JZ2B 3SHAH 1KXEA 8GCHG 1O35A 1G3BA 1EJMA 2WPHS 4JZEH 2AEIH 5C20A 5TCAA 2B9LA 4TY7A 1VR1H 1C5QA 3ZZ5A 1TA6A 1UTMA 5E2OA 2YOLA 1RTKA 3AW0A 3VPKA 1YPKH 1AKSA 2DE8A 4NSVA 3FN8A 2FLRH 3RMLH 1HDTH 1BRCE 1VITG 2BY8X 1P8VC 3R3GB 3KCGH 5HKKD 1GHZA 2VVUA 1PQ7A 3VB4A 1TNGA 1KLJH 1P06A 4NWLA 3ZZAA 5JBCS 1AD8H 2Y7XA 3E16B 1GBTA 3V3MA 1AWFH 1O3PB 4IS5A 3SZEA 1UVOA 1UTPA 3V0XA 1CBWC 1XVMA 1F0UA 2JETB 2XNIA 3RXHA 2R3YA 2ZHQH 4TWWA 1O30A 1FLEE 1YCPM 2A4OA 3U9AH 1ZTJA 1SI5H 3RXVA 1KDQB 2V7QD 2GV6A 1G36A 1GHXH 1MKXK 1O2SA 4UONA 1ZHMA 1G9IE 2ZDVH 1BZXE 3FZZA 5A09A 1DPOA 1Y3WA 1YM0A 3A8CA 4X6MA 4A92A 2PSYA 1T4UH 4Y8XA 5C0TA 2B8OH 2I6QA 3GY5A 1BBRE 1XUKA 3ZZ6A 3UFAA 4WMEA 3UNSA 1ESBA 2ULLA 1HXFH 3DCLA 1GHAF 4D76A 1NRSH 5GNDA 2AMQA 1JWTA 2ZGXH 1GI8B 5DP6A 1KTSB 1O2NA 1Z1JA 1QR3E 3ATKA 3QLPH 3P70B 1TNKA 5HM9A 1KSNA 2H9HA 5F8ZA 2W3IA 1C5LH 5ESBA 3H09A 2AMDA 3O8BA 1TPPA 3MU0A 1C5WB 1EOLA 1L1JA 1S5SA 2QXGA 2XWBI 5IK2D 1O2IA 2VGCB 5FXLA 1DICA 3M36A 1O5GH 1NY22 4ZCNA 1K1JA 4BAQB 1ABIH 3GS9A 1ZRBA 1B5GH 3ZZBA 4H6SB 1P2JA 1H9IE 3BG4B 2BDBA 3TNSA 1KXAA 2GTBA 1PPEE 1A61H 2Y5HA 4CREA 4NFFA 1WTGH 3P8OA 1SB1H 3F1SB 3EE0B 2C3SA 1ZTLA 1MUEB 1MD7A 5T6DA 1DWEH 1O2MA 1O2ZA 2VIWA 2HNTE 1AE8H 2BXTH 3M3SA 2KR7A 1OX1A 1ANEA 1L4DA 1GVKB 2B7DH 2BZ6H 1K1OA 1O32A 2CMYA 5DSFA 1TRMA 2A7CA 1BB0B 1AUJA 4ISIH 5GIBA 2BVSH 5JBTA 4B71A 1MZAA 1V2TT 5CDFE 2OK5A 3LH1A 4Z6AH 1C1OA 2A2XH 2O8WA 1FPHH 1CHGA 3F2FA 2FEQH 3A7WA 1BHXF 4LK4A 1C5OH 3W94A 3MWIU 3U1IB 2H1UA 1A3EH 2PGBB 3ZVBA 1G2MA 2XNDD 2BD9A 1GDQA 4DIIH 3BTWE 3TJOA 1EZSC 2IJD1 4O9VA 1Z1IA 3V7TA 1OWJA 1AUTC 4TWYA 2GCTC 1KTTB 1MQ5A 3Q77A 1CBWB 1ZGVA 1D6WA 3CENA 2R0KA 4THNH 2ZTYA 4YT6H 1MTUA 2BDIA 1ANBA 2ALVA 1NFUA 2H9TH 4BTIB 2WPKS 4B73A 1BMAA 1MZDA 1W2KH 2ZECA 3OTJE 1BJUA 2G81E 2FOCA 1IQFA 2ZG0H 1TOCB 1XKBC 2ZP0H 4Y7BA 8LPRA 2ODYB 3S9AA 5E8EH 2TGAA 3TGKE 1C5YB 1ARCA 4K3JA 7LPRA 4KGAA <