2FX4A

Bovine trypsin bound by 4-piperidinebutyrate to make acylenzyme complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords trypsin
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fx4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fx4A02
1GPZA 1GI7B 2AS9A 1P0SH 5E2PA 3V13A 3B9FH 2PHBA 1WCZA 3RXRA 5SGAE 1ZJDA 2BLOA 2VIQA 4NIXA 1CT4E 1O31A 1RTLA 1C1WH 3UNQA 1H9IE 4TY6A 4TWYA 3O8DA 1H8DH 2PTNA 4KELA 1GJAB 4X8VH 3SQEE 3SI3H 1TA2A 4FU9A 2ZDLA 1Z1JA 1ZRKA 1PFXC 1TALA 5A8XA 1P2QA 1MKXH 2VIWA 1WTHD 3BG4B 1QNJA 3UREA 1K1OA 3SGBE 3STIA 1NT1A 1UO6A 3UNRA 1ANEA 1DY8A 3ODDA 3GY6A 2J95A 2ZNKH 2XCFA 1BTHH 2BLWA 2Q6FA 2J92A 2FYRA 1C2FA 3RMMH 1WYKA 1CO7E 1EUFA 4X6OA 3U8OH 4AZ2B 2P3FH 3MU5A 1C1VH 1F0UA 5DP8A 1DWEH 2JH0D 4OS5A 2FS9A 3BTME 2R2MB 2OD3B 2PKSB 1YCPK 3E0NB 2HNTF 4JYUH 4K2YA 3VGCB 3QK1A 8LPRA 3B8JA 1W7GH 2ZI2H 5ETXA 5TJXA 2BYAX 3SU0A 2ZGHA 2HLCA 1HYLA 1UVPA 2BDCA 2Q6DA 3MFJA 3A7TA 1T31A 2OC1A 2WPHS 4X1NU 5G4BA 1BTYA 1ZRBA 4XBCA 3K6YA 1GBIA 1O3DA 1ZHMA 1THSH 1C5VA 1EAWA 2A2XH 2ALPA 3MOCA 3TJVA 4F4OC 1XKBC 2GGVB 4NIVA 1UTQA 2GTBA 1BHXF 1F5RA 3PLBA 4FXGH 1TOCB 3KQEA 3Q3KA 2ZCKP 1UTJA 2DE9A 1WAYB 3RMLH 4E7NA 2Z9JA 4BAKB 1HBTH 1O2IA 2ANMH 2ZDAH 4H4FA 1RRKA 2FS8A 2ANKH 1QFKH 1IQNA 1NRSH 2WUBA 4WVPE 1FY3A 1EPTA 2SGEE 1DXWA 1O2WA 1NM6A 2IN2A 2Z3DA 5L6NH 3EDXB 4X2VA 1QGFA 3M35A 4D9RA 1GBJA 4MPWA 4JCNA 1YLCA 1BCUH 1PPBH 2AMPA 2BY6X 3SBKA 4BXSA 1J17T 1IQHA 4ASHA 3VB7A 1N8OB 3KQCA 3KQDA 4DCDA 1BTXA 4ABIA 1BT7A 1OWIA 3RM0H 1UCYE 1C5YB 4D76A 5C67A 1DDJA 1GHZA 2THFB 2Z9LA 3RXQA 6GCHF 1SFIA 3RC5A 1GJBB 3GY4A 4XBBA 3MNSA 2PV9B 1Y59T 3U8RH 1SOZA 4ABAA 5GXPA 3A85A 3A83A 3P8OA 1O3BA 2BX3A 1EPTC 4NSYA 2Z7FE 2A4GA 3RXOA 1LVYA 3T2NA 1GCDA 1V2QT 2GZ8A 1NTPA 1MCVA 3A84A 3K65B 1MAXA 1SGQE 3GY5A 1O5EH 1XUFA 1GMHF 4O03A 4FVDA 2F9BH 4YOJA 1Z6EA 3OSYA 2ZO3H 1O3OA 1W2KH 4Q7XA 2ZHEH 3RXUA 1YM0A 4BTTB 1PJPA 4OS1A 3SNBA 1P2OA 4MNWA 1PPFE 2FI3E 3G01A 1TMTH 3VXEH 3TLOA 3FFGA 4DT7B 1LPZB 1LCYA 1ZGIA 1Z8IB 9LPRA 2J4IA 1RD3B 4BNRA 4X8TH 3TJNA 2BD8A 3BEFB 4RKOB 4LZ4B 4DIIH 1AQ7A 2BD2A 1BITA 2G5VA 2CJIA 3VB6A 1RTFB 1GMDG 2V35A 4UFEH 1VGCC 5JBAS 1Y5AT 1IQMA 1V2VT 1K9OE 4U2WA 3RU4T 1G2MA 1FQ3A 3A7XA 3BEIB 1KDQB 3SO3A 3SJOA 2OINA 4Y79A 1HPGA 5AHGH 1TMBH 5ABWA 1GDQA 2FOFA 1ELBA 1VCPA 1EAUA 1BTPA 1T8NA 7KMEH 1QBVH 1J8AA 1FY1A 1SI5H 5T3HA 1HIAB 3CS0A 1QL7A 1DX5M 1BMNH 1FAXA 2BX4A 1H9LB 4UEHH 3NCLA 5CMXH 4X8UH 1TGTA 1SG8B 1MU6B 3UUZA 2BVSH 1FONA 2FX4A 5GIBA 4CR5A 3PWCA 1GJ7B 2V6NA 2W5EA 1L4DA 1P2IA 3RXAA 3S7KB 4CRFA 3RXPA 2FDAA 5FBIA 2ZU4A 2W3KA 2QF0A 2P95A 2W7SA 2ZWLH 2OUAA 1BQYA 1DFPA 2CHAC 1B5GH 4HGCA 2BDBA 4X6NA 2NU0E 3ZZ9A 3TH4H 1BJVA 1HAYB 1O3AA 1O5BB 1P3EA 1XUGA 1NU7B 2FTMA 1SHHB 3EE0B 5FAHA 4ABBA 1KXBA 4A6LA 1HB0B 4CREA 1GJ9B 2BLVA 1K1IA 3BIUH 2EEKA 4FUJA 1ZSLA 1GVZA 2PKAA 1OS8A 2GDEH 2D2DA 2Y5GA 2VVCA 1EASA 1TQ0B 1OWEA 2YNAA 2ESTE 4NA8A 1V2RT 1YCPH 2UWLA 1F7ZA 4Q80A 1RJXB 3VB4A 1WOFA 2GMTC 5CE1A 2NU3E 5DP9A 1DY9A 3RXEA 3HPTB 3KCGH 1ZTLA 1O0DH 5EQQA 2ZGXH 2A2QH 4WH8A 3A86A 4ZHAA 1O3JA 1AIXH 3EAJA 3BTQE 2WV5A 1IQIA 2FOGA 1OX1A 1C1MA 3P95A 1OYTH 1T7CA 5TCAA 3VFEA 1EPTB 1C5TA 3M5NA 4IGDA 3RMOH 1SGRE 4RN6A 2Z94A 2PLXA 3RM2H 3QUMP 1DE7H 4DVAU 1A0LA 3UTUH 4JZDH 5EGMA 3AVZA 4WXIA 2F9PA 2SNVA 3M7UA 4AFSA 3C1KA 1C4Y2 1TYNA 1C2IA 2HPPH 2VIDA 3SNDA 3ZVEA 1G32B 6CHAC 4I8GA 1JOUB 4A1TA 2C4FH 1D6RA 2XBYA 3SGQE 1V6DA 2QAAA 4TYDA 4SGAE 2Y7ZA 1KTTB 1XXDA 2GZ9A 4YZUA 5DP3A 1O39A 1OOKB 1J15A 2I6QA 2A0QB 1IOEA 3ZZ3A 2P3UB 5PTPA 3KNXA 4WMFA 3BTHE 4X1SU 4XFQA 1W11U 3ATKA 4AFUA 1TGSZ 1ELEE 1E36B 1YLDA 4ZHMU 1VCWA 4SGBE 2RA3A 3BTFE 3SUFA 3ATIA 1PPHE 2FI5E 1O38A 2O8WA 4KP0A 3H7TA 1ZMJA 4KGAA 4INKA 3CENA 3E0PB 1GBTA 1O2OA 3Q76A 3MYWA 1XVOA 4YTAA 2VWLA 1C9TA 1QA0A 1T8MA 2QIQA 5FBEA 1WUNH 3M7TA 4ISOA 4ZXYH 1DVAH 2YOLA 4IMZA 1SGDE 2R2WU 2Y5FA 4R8TB 3TH2H 1MTSA 3P8GA 7GCHG 1TRYA 3ENSB 2FLBH 5LGOA 2GV7A 4JK6A 2GKVE 2FOHA 1AY6H 2CXVA 3LGVA 1PPCE 3OX7U 3GY2A 1GMCG 1Y5BT 3UFAA 4AFZA 1A1RA 2A32A 2QN5T 4IW4E 4DJZB 1O32A 1P03A 3M3TA 4ZKRU 3RXDA 1ZGVA 1KSNA 5DO4H 1H9HE 2ZPQA 1QJ7B 1UK4A 4X2WA 1UTMA 4Y8YA 4AG2A 3EA8A 4BXWA 3FZZA 1V2ST 3TGIE 2CMYA 2TIOA 1C1PA 4OS6A 3M5OA 2QV1A 1KLIH 1OWJA 3UR6A 3MTYA 4CRDA 3ZVBA 2FXRA 2FX6A 2PGBB 1QQUA 3M3VA 4Y8XA 4Y76A 2XW9A 1SGIB 3AW0A 2ZKSA 2O8LA 1AGJA 4MQAA 2CHAB 1LPKB 8KME2 2Y81A 4ZAEA 1CGIE 1F0TA 1L4ZA 1TPSA 3ATMA 1Q31A 3A7WA 1GVLA 1LDTT 1YGCH 2AMDA 1T8OA 4WWYA 1DXPA 2TGPZ 4YLQH 4UDWH 5EXMA 1THRH 1UK3A 3UIRA 2LPRA 4NSVA 3TK6A 6GCHG 2ZEBA 1SGFG 1SOTA 1NFYA 1P2MA 1UVTH 3K6ZA 1C1QA 1C5PA 3LPRA 5EW2H 3I78A 1MQ6A 1GVKB 1P3CA 1J14A 1O3IA 5A8YA 3UOPA 1GI1A 5FCRA 3RXFA 3URCA 1A3BH 1EATA 1G30B 3LC5A 1TRNA 1W10U 3P8NA 1NFXA 3GY8A 3NUMA 1B7XB 1S6HA 4K8YA 3K2UA 3AAUA 3GICB 4FUEA 2HGTH 2AGIX 3CS7A 2F91A 3DT0H 3T26A 4NZQA 1QB1A 2Z9KA 2A1DB 1CGJE 1TGBA 3TGKE 2HNTC 2DE8A 1CU1A 1OYQA 6CHAB 1D3PB 5A0AE 4ISHH 2PKAB 1EJNA 3RDZA 2XCNA 4I33A 4A92A 2ZF0H 3QZRA 1VITH 3HK3B 3LGUA 2GVFA 3Q77A 3OY5U 2BDHA 5JB9S 1SLVB 2R9PA 3OU0A 5JPMH 1MAYA 2TRMA 5LH8A 2KAIA 3DA9B 5F8XA 1EP6A 5JB8S 2BY7X 1TE0A 2VVVA 3QX5H 1JIRA 2ZU2A 1V2WT 1TRMA 4D8NA 5FX5A 3SNEA 1PQ7A 1AVWA 4J1YA 4MNVA 5EOKA 3UQOA 1YPHC 1TX7A 1AHTH 1G37A 1YC0A 5T6GA 1BA8B 3BTDE 4B2AA 1C1OA 1ETSH 2AERH 1C5LH 4ZKNU 1LQDB 3GYMA 4OGXA 1C2DA 3ZZ5A 1MU8B 2M5TA 1SGFA 1S0QA 1LHCH 4Y7AA 4DIHH 3U9AH 1ZZZA 3TNTA 1P2KA 2XC5A 3RXJA 1Z6JH 4M7GA 1UVOA 4NFEA 4AX9H 1UVUH 2V3HH 1SGTA 4LK4A 5DP4A 5C2ZA 1INCA 1MZDA 1EZXC 4XE4A 2UUKB 3ZVDA 1GL0E 1Y3VA 2HWLB 1TWXB 1KY9A 4LXBH 2BVXH 3E91A 3LGTA 3U1JB 4NA7A 2K1QA 3U1IB 3MNBA 1QJ1B 2A7CA 1KDQA 1O37A 5GDSH 1ANBA 1K28D 4YOIA 2O9QA 2AIPA 3NZIA 1HAVA 1ESBA 1Z1IA 1QBNA 1UJ1A 2SGAA 1CHOG 5LPRA 1EOJA 2TGAA 2B8OH 1CQQA 1QB9A 3P8FA 5C1YA 4D9QA 1EP5A 1BRAA 4MNXA 1NC6A 1ZSKA 1VITG 1HIAA 4CBNA 3PV4A 3TH3H 1MTNB 1W12U 2FPZA 3AAVA 4OS7A 1GI5A 3GCNA 1MTWA 4O97A 4DGJA 2BZ6H 1GGDC 1HRTH 3GDSA 1HUTH 1P9UA 1UTLM 2AEIH 5J4SA 5DP7A 3PM3A 3A8BA 2BY8X 2C8YB 3PMHB 1Z8RA 1O2NA 1YBWA 1TIOA 1P9SA 3BTKE 3FP7E 3R3GB 1C4U2 1LHEH 2QGRA 2F3CE 1KXAA 3F9GA 4B75A 2WPLS 3KQBA 3U98H 1HJ8A 2RA0A 2ZQ1A 1Q3XA 2BOKA 1VZQH 1BBRK 2SFAA 1GBMA 2XYAA 1AE5A 1IQGA 1HAIH 4GHTA 7LPRA 1C5NH 3M37A 1SPJA 2EI8A 4WF8A 3SORA 3QTOH 1GBBA 1KXCA 1ZJKA 1GDNA 3BIVH 2OBOA 3QN7A 5B6OA 1FZZA 1OSSA 4MPXA 2W26A 1O3PB 2V0BA 3BF6H 2UWOA 3RXLA 3A8CA 3VB5A 2GP9B 1UCYH 5GCHF 3UOUA 3WY8A 2BD4A 1QTFA 3M7QA 8GCHG 4Q2KA 3RP2A 1C2HA 1PQAA 4OS2A 3GISB 3BTTE 1WU1A 1HJAC 4AGKA 3D49H 2VWMA 2ZGBH 1L1NA 1UK2A 1TX6A 1C2EA 1UTKA 1OWHA 1FMGA 2P59A 2H9EH 1L1JA 2SGFE 4B76A 1CBWC 1NRPH 1S5SA 4NWLA 1IAUA 1OP8A 4GPGA 1SGEE 1NFUA 4NZLA 1BHXB 5C5NA 3TIUA 5L30H 4X6MA 1N1LA 2WPKS 4K1SA 1ELTA 4YLUA 1HNEE 1HAXB 1JWTA 2HOBA 1LVBA 1Y5UT 2F9VA 4U01A 1DWBH 1D3QB 3RXIA 2BXTH 5AFZH 1ZMLA 1YPMH 1XX9A 3EA9A 4WH6A 1O3LA 1KIGH 1YKTA 1SGNE 4I8LA 2FEQH 4BAHB 2G52A 3SU2A 1GBDA 3NKKA 2KAIB 2BDIA 3P70B 1G2LA 3DHKH 4D7GA 4NFFA 1XUJA 2AYWA 2FM2A 1TBZH 2ODPA 3NWUA 1O2ZA 1KLJH 1Z71A 3MU4A 2JKHA 3KEEA 4JZEH 1BDAA 4VGCC 2BZAA 3I77A 1XM1A 5F6MA 4O3TA 4FUHA 2OC8A 1XVMA 2FLRH 5DKMA 2ZTZA 2A31A 2Y5HA 2Z9GA 1EQ9A 5HYOA 2HRVA 2C8XB 1BMMH 1O2TA 1YPGH 4ABEA 1LPGB 1GI9B 4AYYB 2ANYA 2PW8H 3RXBA 1GHAF 2A5AA 2TPIZ 1S82A 1TBQH 1ZOMA 5F8ZA 2D26C 4MPUA 2Y7XA 5CHAC 2XBWA 1ELFA 1GGDB 5T6DA 1TPAE 5JBCS 1HGTH 1UHBA 4Q7YA 3SHCH 3I29A 1W7XH 5JDUB 1SVPA 4K1TA 1ABIH 5I46H 1K1NA 1TMUH 2VVUA 4I8KA 3A87A 2BVRH 2VWOA 1FPCH 2P8OC 1TNGA 4IC6A 1D3DB 2H9HA 3PROA 3HATH 1SSXA 3PLPA 3EGKH 5K7RA 4UD9H 1HAVB 2PTCE 1Y8TA 3PLKA 1CGHA 2G5NA 2VIPA 1GHXH 1TGCA 3SU6A 1FAKH 1F0SA 3N7OA 3SZNA 1P09A 1Y3YA 1GHVH 1DT2A 1Z7KA 3M5MA 3GCOA 4JK5A 4Q7ZA 4ABDA 2J38A 3W95A 2VH6A 1EZQA 1VJAU 1O5CB 5HM9A 3TK5A 3GYLB 3E8LA 3PTNA 1YPEH 2EI6A 5FPSA 3F9FA 1D3TB 4HTCH 1ZYOA 1MH0A 3ATLA 1DOJA 1ETTH 1Z8GA 2V3OH 1WQVH 3LC3A 1G3BA 4ABGA 1Y3UA 2QXGA 1DUEA 1E0FD 1W8BH 1E35B 1HJAB 2D1JA 3LKWA 5A0CA 3C27B 3E6PH 1K22H 4NCYA 2PWXA 3KGPA 2O8TA 2ZGCA 3DD2H 3NK8A 4X2XA 3MO9A 4BAOB 3T62A 1CBWB 1GBFA 1NZQH 1UTPA 3RUOA 3MH7A 2BQ7B 2BD7A 2C3SA 2ALVA 6ESTA 2GCHG 4B2BA 4RKJB 3ITIA 1C2MA 1C5UA 1QY6A 1P2JA 2OC7A 3A88A 2AH4X 2STBE 1K21H 4IS5A 1QA7A 1O3EA 2NWNA 3MH6A 3FAOA 4R0IA 2ZU3A 1GJDB 4CRCA 3M3SA 2CN0H 2ZQ2A 5C1XA 1O5DH 1P11E 2A7HA 1CE5A 1BBRH 1L2EA 1B0EA 5EG4A 5HMAA 2XBVA 5C5OA 2W3IA 1ELGA 1AFQC 4IMQA 2QY0B 3M36A 2NU1E 4CRAA 1D6WA 1DWCH 3SV9A 3BTEE 4H42U 2QXIA 1JIMA 1P02A 2P93A 1NPMA 5A8ZA 4ESTE 1C2GA 1TB6H 2H9TH 1ZLRA 3QLPH 1S0RA 4IBLH 4DURA 4WY3A 2O8UA 4BOHA 4Y6DA 3FP6E 2R3YA 4UFGH 2VH0A 1SQTA 3ZV8A 3EQ0H 3ATWA 4Y0YE 1O35A 1D4PB 5CHAB 1NS3A 2BDGA 1K2I1 4QT8C 3VXFH 3SV8A 4ZMAH 1GJCB 1TX8A 1EAXA 1P01A 1JRTA 2A5KA 3AW1A 4O9VA 5AF9H 1P12E 1XXFA 4Y0ZE 2EI7A 5GWZA 1VGCB 4FUBA 3T25A 2B5TB 3UR9A 3ZZDA 2GZ7A 2CF9H 5BPEA 3F68H 2IPHA 2JETC 3DUXH 3HKIB 4K8BA 2YNBA 2PR3A 1ELVA 1ZR0A 1C1TA 1O3HA 1O34A 2Y82A 1EX3A 1TNKA 4Y71A 1TBRH 1FN6A 1TPPA 3BEUA 4FUIA 2GT8A 5EPNA 1FUJA 4HZHA 3KL6A 2ZDKA 2EA3A 4WXVA 2H6MA 4BTIB 3ELAH 1M9UA 3PMJA 3TNSA 4MPVA 2C90B 2VGCC 1UCYK 2ZFTA 5C1UA 1A61H 2ULLA 1L0ZA 1H4WA 1L1GA 1UHBB 5GCHG 3D62A 3S9CA 1V2TT 3V0XA 2BB4A 1GI6A 2ZA5A 2BHGA 1S85A 2LNCA 2PSXA 1YCPM 1MTVA 2QC2A 2ZDNA 3GCHC 1F0RA 1VR1H 3P6ZB 2P94A 1ZPCA 4K1EA 1WTGH 1O33A 3MNCA 4X6PA 3UY9A 2HALA 3Q3YA 1EB1H 2BTCE 1TFXA 1O36A 3PO1C 3F9EA 1GI4A 1XMNB 4X1QU 3IITA 1LVOA 1AO5A 1AB9C 3PTBA 1G36A 2VJ1A 5E2OA 1O30A 2R0LA 4IC5A 2IOTA 2OQ5A 4B71A 4CR9A 1DSUA 2ZFFH 2B0FA 2TGTA 1HXFH 3KIDU 2VIOA 3PB1E 4MDSA 1ETRH 3RMNH 1O5FH 2AGGX 1ORFA 1FJSA 3SJKA 1O3KA 4ABFA 1OXGA 2GMTB 4DG4A 3NXPA 1S6FA 4JZIA 2BDAA 4IN1A 4ISLA 1DANH 1GWAA 2ZPRA 1WBGB 4Z0KA 1GBAA 1ELAA 1A0JA 2H5DA 2ZU1A 2XWBI 1W0ZU 1QCPA 1FI8A 1W13U 4J2YB 2ZFSA 1EZSC 2F9UA 1TOMH 5JBBS 1GMHG 4ZXXH 1V2LT 2ANWA 3F6UH 2A5IA 2BM2A 1O3FA 3PMBB 1XUHA 1O2PA 1UTOA 3S9AA 2ZHDA 3RXGA 1AMHA 2I6SA 4JYVH 2A4QA 2PSYA 3A89A 4WMDA 1C5ZB 4FUCA 1H1BA 1BMLA 2C8ZB 2WINI 1FV9A 4DW2U 3DFJA 3SV7A 3TPIZ 3F9HA 5EXNA 1HJ9A 1EKBB 5FCKA 3A7VA 1LKBA 1ZHPA 4AFQA 1NRQH 4JZ1A 4ZKOU 2DUCA 4B73A 1CA0C 1ZSJA 2WUCA 1XKAC 5FPTA 5F8TA 3ZZ6A 5EXLA 3TVJB 4F49A 4K60A 4GVUA 3R0FA 2HVXA 1GI3A 1JRSA 4JYTA 2BD9A 5EODA 1IQLA 1C1NA 3T27A 5IYTA 5A2MH 3ODFA 4YM9A 2BDYA 3TITA 1ESTA 3LGWA 3UNSA 5E0GA 4UFDH 4D7FA 4TWWA 3CP7A 2FZZA 1CVWH 1K1PA 4H6TA 2JETB 3RXKA 3PWBA 2ZG0H 1C5QA 4NG9H 1TLDA 1TQ7B 1O5AB 2ILNA 2OTVA 3PMAB 2GD4B 2ZFQH 1CSOE 3SW2B 4MTBA 4U30A 2OC0A 3LJJA 1O2YA 3QGNB 4GCHF 4A7IB 4MVNA 3H5CB 3IWMA 4AB9A 1GJ5H 1TNHA 3U8TH 1ACBE 4FU7A 5EQSA 1FPHH 4YESB 3BSQA 1N6YA 4ZROA 1GI0A 2VGCB 4YOGA 4H6SB 3L3TA 3E3TA 1GJ6A 1BTUA 2H5CA 3RLYH 2ZP0H 2XXLA 3TJUA 3E1XB 2FO9A 3GCHB 1BTWA 3KF2A 3MU1A 3ZVAA 3ZZ4A 2ZFRH 1SBWA 3JZ2B 1WQSA 2IJOB 3QO6A 1RGQA 1PQ8A 1V2NT 3SU4A 3GCTF 4MG3A 1T8LA 2BD5A 4DY7B 5T6FA 1DICA 1OKXA 3QWCH 1ESAA 4FVBA 3PO1B 2J9NA 3ZYDA 1O2GH 1KTSB 1AB9B 2BMGB 2VU8E 5FHTA 1GHBF 2STAE 1DUAA 4LZ1H 3MO6A 1PPEE 1PPZA 3DFLA 5DK1A 4I7YH 1TONA 1FIWA 3EA7A 1NY22 3RLWH 4Y8ZA 2RG3A 1AUJA 1XUIA 5EU8A 2FWWA 2XRCA 3P17H 1ELCA 1LQEA 4FUFA 2FYQA 1P05A 1HV7A 1SC8U 1FDPA 3IG6B 4INLA 4ISNA 5H4IB 5I25A 3RC6A 3BN9A 1KXDA 2PUQH 1NRNH 3RXTA 4K69A 3VB3A 1ZPBA 2AGEX 2WYJA 1GDUA 4THNH 3SUGA 5AFYH 4A1XA 1GCTC 3SUEA 1A2CH 1FXYA 1HCGA 2Z9IA 7GCHF 4GLYA 5GJ4B 2ZECA 3GY7A 2WYGA 1MBQA 2VWNA 1P8VC 4FU8A 4IN2A 4YO9A 1QJ6B 1GMCF 1AE8H 1K1LA 2P3TB 1FLEE 2FTLE 1C5OH 4OGYA 4AORA 2ZTXA 1LTOA 2ZHQH 2BXUH 1V2PT 1RFNA 3ZVGA 3ESTA 1HLTH 1CA0B 1SQAA 3UQVA 1JBUH 4KKDA 1O3CA 2ZHFH 3BG8A 5LPFA 1N6XA 1C2LA 4B74A 4XDEA 2PUXB 3SOSA 1C1RA 3QZQA 1IQEA 1CHGA 1V3XA 1VCQA 3A8AA 2ODYB 4FUDA 2D8WA 5A09A 1EAIA 2XC4A 5DG6A 2ZIQH 3QDZB 1O2JA 1YF4A 1BB0B 3LIWA 4NWKA 3MMGA 5JYIA 1OWDA 3ZZBA 3M61U 3UWIA 3ZYEA 4Y11E 1RIWC 1AUTC 1EZUC 2FI4E 2WPMS 2ZTYA 1SHYA 2ZCHP 4NA9H 1QL9A 3LH1A 2BOHB 1KXFA 1QIXB 4RSPA 4ABHA 5DGJA 2FODA 1AU8A 1TGNA 1PYTC 3D23A 3D65E 3U69H 3LU9B 3GDVA 1BIOA 2F9OA 1O2UA 3MO3A 1ANCA 2J2UA 1QURH 2Q1JA 1EOLA 2JH5D 2Z3EA 5EQRA 1A46H 2FOAA 2JH6D 4AYVB 2PFEA 5L2ZH 3RXVA 1LHGH 2VINA 1ANDA 1AVXA 1C4V2 4E06H 1TNLA 1EXFA 3HKJB 3RU4E 2ASUB 4UE7H 3FANA 1O2RA 1DM4B 3SU1A 5C20A 1IQFA 4B2CA 4JZFH 2FMJA 1BTZA 1AVGH 3RU4D 1V2MT 2ZC9H 3E90B 3RXCA 2AMQA 1O2VA 5GPIB 1SLWB 2OXSA 7ESTE 3SV6A 2F83A 2GT7A 2BQ6B 1C5MD 3A7ZA 1MZAA 5ESTE 3O8BA 1Z8JB 4CRGA 1AWFH 3MU8A 2ZHWH 4AOQA 1DLEA 4JMYA 3L33A 3S69A 4TPYA 4NGAH 6LPRA 4HI3A 1WV7H 1THPB 4BAQB 5E8EH 5C3NA 2QXJA 1BUIA 4WJG2 1QR3E 3OYPA 4I8HA 5LPEA 1PQ5A 1J9CH 4B1TA 1MKWK 3LGYA 2QF3A 3TU7H 1HAOH 2R3UA 2B7DH 1RS0A 1P04A 1MD8A 1XUKA 2OQUA 2Z3CA 1PPGE 4GSOA 1C5XB 1YP9A 1HAZB 1SLXB 3A8DA 4CH2B 3LDXH 2EC9H 4Y7BA 1V2OT 2ZZUH 1QRWA 3ZZAA 1EJAA 2QYIA 3SUDA 2NU2E 8ESTE 4WMEA 1WSSH 1GBEA 1O2KA 1GCTB 3JZ1B 4XSKU 3HGNA 3SI4H 1Y3XA 1HAGE 2GCTC 1JXPA 2CGAA 1QBOA 3MI4A 2G8TA 1QRXA 2FP7B 2SGQE 3MH4A 3SJIA 2ZPSA 1BRCE 1MTUA 2FESH 1C9PA 1SB1H 1TA6A 3SHAH 1IQKA 4CBOA 1NESE 1LO6A 4ISIH 1NN6A 2FOEA 3SGAE 3V12A 1K1MA 4HFPB 1DPOA 4X1RU 3BTGE 3SU3A 1YYY1 3ZVCA 4CRBA 1ZMNA 3ZZCA 1E34B 1HAPH 2BQWB 4NIYA 1MMJN 1CT2E 2FOCA 1E38B 3B23B 3T28A 1CHOF 2R0KA 2NU4E 1CA8B 2F9NA 1Y3WA 1HFDA 4KTCA 1HDTH 4U32A 5FXLA 3BTWE 1O5GH 1QL8A 1V2UT 4KTUA 1TAWA 1YPKH 1HAHH 2OLGA 3TGJE 1MBMA 2BLQA 1KLTA 1VITF 4YT7H 1ID5H 5J4QA 1SGPE 5FPYA 2SGDE 3RXHA 3SQHE 3UWJH 1SR5C 1LHDH 2QXHA 3LONA 2VB0A 1AI8H 1DS2E 1C5WB 4BANB 1GBHA 1RIWB 1ARBA 1S83A 3LH3A 4GCHG 4FUGA 2Q6GA 3OY6U 1S81A 1F92A 3LJOA 1A7SA 1E37B 1SGCA 2WV4A 1OP2A 3SJ8A 1C5SA 3LGIA 2CF8H 1X7AC 1LMWB 1P57B 1UTNA 3FP8E 3T5FH 2XWAA 2ZCLP 2UUJB 3K9XB 2BY9X 5DP5A 3A7YA 4X2YA 2C8WB 2P16A 1LVMA 3S9BA 1A0HB 2GV6A 2SNWA 4VGCB 1AKSA 3V7TA 1P06A 4ZUHA 1A5IA 1OP0A 2HNTE 5DJ7A 1C5RA 1GG6C 1B0FA 1SFQB 1SMFE 3SNCA 4XOJA 2UUYA 2G81E 2BY5X 1FN8A 1MUEB 3KN2A 1MKXK 1O2MA 4MLFB 3VPKA 3GCTG 4A5TS 1G3EA 1IHTH 4CH8B 1BRUP 1OPHB 9ESTA 1MQ5A 1EJMA 1C2JA 1AN1E 3HK6B 4TY7A 1TABE 1FY4A 2ZGJA 1P2NA 2Y6TA 1HXEH 8GCHF 1GHBG 4AN7A 4XBDA 4ZH8A 4GUXA 1AFEH 2FIRH 1YPHE 1MCTA 2Z6BD 4INHA 2PGQB 4I32A 2BD3A 3STJA 2G55A 3V3MA 4X0WU 2G51A 2UWPA 4Z6AH 3GY3A 2ZFPH 1OWKA 2P8OB 1BBRE 3AASA 4TPIZ 3W94A 3RC4A 2C93B 3O8CA 1T4VH 3TJOA 3A82A 5HM2A 1AZ8A 1FY8E 1QQ4A 4X1PU 5EW1H 1A4WH 1GHWH 1GI2A 1H8IH 4UFFH 1NROH 1O2LA 1A3EH 1BOQA 4Y10E 1DITH 1QB6A 4CHAC 3UPEA 3MNXA 2XTTB 2GX4A 1W14U 2OP9A 3SJ9A 3ZZ8A 1JMOH 2GDDA 4AG1A 5AVDA 2A45B 1CT0E 1F5KU 1QRZA 2SGPE 1W3CA 4I8JA 1A5HA 2UUFB 4E05H 1F2SE 1O2HA 2FOMB 2GCTB 3L6PA 1O2QA 3SV2H 3URDA 1A5GH 1ARCA 5DP6A 2VIVA 2HPQH 1ABJH 1V2KT 1G3DA 2B9LA 3PYHA 4NIWA 2XC0A 4AB8A 4ZHLU 2XNIA 2ZDVH 3QTVH 1GHYH 3LOXA 3H7OA 1KXEA 1IHSH 1ELDE 1U6QA 3BG4C 1AZZA 3Q3XA 1KYNA 2ZU5A 4A1VA 1GJ4H 1G3CA 1BRBE 3MU0A 4LOYH 1ZTJA 4PROA 3E16B 3O8RA 1BZXE 1VJ9U 1NU9A 3QGJA 1F5LA 1RXPA 1W0YH 1P10A 5DPAA 1BJUA 4O3UA 1MTNC 3A80A 1QHRB 5K0HA 1GL1A 2TBSA 2H1UA 3MHWU 1AWHB 1NRRH 4UONA 3F1SB 2XBXA 2G00A 3NPSA 1K1JA 1DWDH 4OS4A 3Q00A 3EYDA 1GBLA 2PKSC 3RXSA 4ABJA 2A4RA 3VGCC 1AD8H 4BAMB 3MH5A 3VEQB 1MKWH 2OBQA 1GMDF 5L2YH 3HGPA 4DOQA 1YPJH 3GOVB 1FIZA 2O8MA 4GHQA 2Y80A 2RDLA 5IDKA 2AIQA 1T4UH 1S84A 1AFQB 1IQJA 5ESBA 1O3GA 2RCEA 1FNIA 2ODQA 3S7HB 1O2XA 4YT6H 5HXFA 1SLUB 2A7JA 5JBTA 1ZTKA 3OTJE 3RXMA 1LHFH 1C2KA 3SN8A 1J16A 1GI8B 2J94A 3FZDA 1LKAA 1UMAH 1GG6B 1TNIA 3BV9B 1SQOA 1DSTA 1YPLH 1O2SA 1GHAG 2A4OA 5BRRE 1C1SA 2VNTA 2J34A 1ZHRA 4MNYA 3MWIU 2FOBA 3GDUA 3ZZ7A 1GJ8B 5E0HA 1D9IA 4AGJA 3TK9A 1MD7A 1NFWA 1GBKA 1BMAA 3P92A 5A0BA 3SNAA 4X8SH 2G4UA 4BTUB 1SL3A 2W7UA 1FY5A 3FVFB 2TGDA 4GAWA 3S0NA 3M5LA 2CV3A 3ZV9A 3KHVA 1EB2A 5E0JA 1NO9H 1O3NA 1SGYE 1AKSB 1ZPZA 2H2ZA 1O3MA 2ZDMA 5HGGA 1DLKB 4ZKSU 2G4TA 2AFQB 1TPOA 4K5ZA 3T29A 2WPJS 1G9IE 4E7RG 1N8OC 2OCVB 1PYTD 1TNJA 2GCHF 1V2JT 1T32A 2QA9E 1C1UH 5F03A 3ZVFA 4CHAB 5EPYA 4I31A 4K3JA 3LT3A 1RTKA 5TCCA 1GBCA 1UVSH 1Q2WA 3SU5A 5FX6A 4KTSA 3A81A 2WPIS 2QCYA
chains in the Genus database with same CATH superfamily
4Q4LA 1GPZA 1GI7B 4FOUC 2AS9A 1P0SH 5E2PA 5C17A 3V13A 3B9FH 2PHBA 1WCZA 3RXRA 5SGAE 1ZJDA 2BLOA 2VIQA 4NIXA 1CT4E 2QF5A 1O31A 1RTLA 1C1WH 3UNQA 1H9IE 4TY6A 4TWYA 3O8DA 1H8DH 2PTNA 4KELA 1GJAB 4X8VH 3SQEE 3SI3H 1TA2A 4FU9A 2ZDLA 1Z1JA 1ZRKA 1PFXC 1TALA 5A8XA 1P2QA 1MKXH 2VIWA 1WTHD 3BG4B 1QNJA 3UREA 1K1OA 3SGBE 2K0QA 3STIA 1NT1A 1UO6A 3UNRA 4I86A 1ANEA 1DY8A 3ODDA 3GY6A 2J95A 2ZNKH 2XCFA 1BTHH 2BLWA 2Q6FA 2J92A 2FYRA 1C2FA 3RMMH 1WYKA 1CO7E 1EUFA 4X6OA 3U8OH 4AZ2B 2P3FH 3MU5A 1C1VH 1F0UA 5DP8A 1DWEH 2JH0D 4OS5A 2FS9A 3BTME 2R2MB 2OD3B 4Z1MD 2PKSB 1YCPK 3E0NB 2HNTF 4JYUH 4K2YA 3VGCB 3QK1A 8LPRA 3B8JA 1W7GH 2ZI2H 5ETXA 5TJXA 2BYAX 3SU0A 2ZGHA 2HLCA 1HYLA 1UVPA 2BDCA 2Q6DA 3MFJA 3A7TA 1T31A 2OC1A 2WPHS 4X1NU 5G4BA 1BTYA 1ZRBA 4XBCA 3K6YA 1GBIA 1O3DA 1ZHMA 1THSH 1C5VA 1EAWA 2A2XH 2ALPA 3MOCA 3TJVA 4F4OC 1XKBC 2GGVB 4NIVA 1UTQA 2GTBA 1BHXF 1F5RA 3PLBA 4FXGH 1TOCB 3KQEA 3Q3KA 2ZCKP 1UTJA 2DE9A 1WAYB 3RMLH 4E7NA 2Z9JA 4BAKB 1HBTH 1O2IA 2ANMH 2KR7A 2ZDAH 4H4FA 1RRKA 2FS8A 5HIZA 2ANKH 1QFKH 1IQNA 1NRSH 2WUBA 4WVPE 1FY3A 1EPTA 2SGEE 1DXWA 3FN8A 1O2WA 1NM6A 2IN2A 2Z3DA 4RI0A 5L6NH 3EDXB 4X2VA 1QGFA 3M35A 4D9RA 1GBJA 4MPWA 4JCNA 1YLCA 1BCUH 1PPBH 2AMPA 2BY6X 3SBKA 4BXSA 1J17T 1IQHA 4ASHA 3VB7A 1N8OB 3KQCA 3KQDA 4DCDA 1BTXA 5HKKD 4ABIA 1BT7A 1OWIA 3RM0H 1UCYE 1C5YB 4D76A 5C67A 1DDJA 1GHZA 2THFB 2Z9LA 3RXQA 6GCHF 2KFWA 1SFIA 3RC5A 1GJBB 2HLDD 3GY4A 4XBBA 3MNSA 2PV9B 1Y59T 3U8RH 1SOZA 4ABAA 5GXPA 3A85A 3A83A 3P8OA 1O3BA 2BX3A 1EPTC 4NSYA 2Z7FE 4HG6A 2A4GA 3RXOA 1LVYA 3T2NA 4RT1A 1GCDA 1V2QT 2GZ8A 1NTPA 1MCVA 3A84A 3K65B 1MAXA 1SGQE 3GY5A 1O5EH 1XUFA 1GMHF 4O03A 2L6OA 4FVDA 2F9BH 4YOJA 1Z6EA 3OSYA 2ZO3H 1O3OA 1W2KH 4Q7XA 2ZHEH 3RXUA 1YM0A 4BTTB 1PJPA 4OS1A 3SNBA 1P2OA 4MNWA 1PPFE 2FI3E 2XOKD 3G01A 1TMTH 3VXEH 3TLOA 3FFGA 4DT7B 1LPZB 1LCYA 1ZGIA 2W6ID 1Z8IB 9LPRA 2J4IA 1RD3B 4BNRA 4X8TH 3TJNA 2BD8A 3BEFB 4RKOB 4LZ4B 4DIIH 1AQ7A 2BD2A 1BITA 2G5VA 2CJIA 3KYGA 3VB6A 1RTFB 1GMDG 2V35A 4UFEH 1VGCC 5JBAS 1Y5AT 1IQMA 1V2VT 1K9OE 4U2WA 3RU4T 1G2MA 1FQ3A 3A7XA 3BEIB 1KDQB 3SO3A 3SJOA 2OINA 4Y79A 1HPGA 5AHGH 1TMBH 3SYJA 5ABWA 1GDQA 2FOFA 1ELBA 1VCPA 1EAUA 1BTPA 1T8NA 1W0JD 7KMEH 1QBVH 1J8AA 1FY1A 1SI5H 5T3HA 1HIAB 3CS0A 1QL7A 1DX5M 1BMNH 1FAXA 2BX4A 1H9LB 4UEHH 3NCLA 5CMXH 4X8UH 1TGTA 1SG8B 1MU6B 3UUZA 2BVSH 1FONA 2FX4A 5GIBA 3OE7D 4CR5A 3PWCA 1GJ7B 2V6NA 2W5EA 1L4DA 1P2IA 3RXAA 2JJ1D 3S7KB 4CRFA 4YXWD 3RXPA 2FDAA 3NRLA 5FBIA 2ZU4A 2W3KA 2QE7D 2QF0A 2P95A 2W7SA 2ZWLH 2OUAA 1BQYA 1DFPA 2CHAC 4ACBA 1B5GH 4HGCA 2BDBA 4X6NA 2NU0E 3ZZ9A 3TH4H 1BJVA 1HAYB 1O3AA 1O5BB 1P3EA 1XUGA 1NU7B 2FTMA 1SHHB 3EE0B 3ZIAD 5FAHA 4ABBA 1KXBA 4A6LA 1HB0B 4CREA 1GJ9B 2BLVA 1K1IA 3BIUH 2EEKA 4FUJA 1ZSLA 1GVZA 2PKAA 1OS8A 2GDEH 2D2DA 2VBCA 2Y5GA 2VVCA 1EASA 1TQ0B 1OWEA 2YNAA 2ESTE 4NA8A 2YMSD 5C0UA 1V2RT 1YCPH 2UWLA 2W6JD 1F7ZA 4Q80A 1RJXB 3VB4A 1WOFA 2GMTC 5CE1A 2NU3E 5DP9A 1DY9A 3RXEA 3HPTB 3KCGH 1ZTLA 1O0DH 5EQQA 2ZGXH 2A2QH 4WH8A 5B6LA 3A86A 4ZHAA 1O3JA 1AIXH 3EAJA 3BTQE 2WV5A 1IQIA 2FOGA 1OX1A 1C1MA 3P95A 1OYTH 1T7CA 5TCAA 3VFEA 1EPTB 1C5TA 3M5NA 4IGDA 3RMOH 1SGRE 2PP6A 4RN6A 2Z94A 3F2HA 2PLXA 3RM2H 3QUMP 1DE7H 4DVAU 1A0LA 3UTUH 4JZDH 5EGMA 3AVZA 4WXIA 2F9PA 2SNVA 3M7UA 4AFSA 3C1KA 1C4Y2 1TYNA 1C2IA 2HPPH 2VIDA 3SNDA 3ZVEA 1G32B 6CHAC 4I8GA 1JOUB 4A1TA 3PV2A 2C4FH 1D6RA 2XBYA 3SGQE 1V6DA 2QAAA 4TYDA 4SGAE 2Y7ZA 1KTTB 1XXDA 2GZ9A 4YZUA 5DP3A 1O39A 1OOKB 1J15A 2I6QA 2A0QB 1IOEA 3ZZ3A 2P3UB 5PTPA 3KNXA 4WMFA 3BTHE 4X1SU 4XFQA 1W11U 3ATKA 4AFUA 1TGSZ 1ELEE 1E36B 1YLDA 4ZHMU 1VCWA 1E79D 2JDID 4SGBE 2RA3A 3BTFE 3SUFA 3ATIA 1PPHE 2FI5E 1O38A 2O8WA 4KP0A 3H7TA 1ZMJA 4KGAA 4INKA 3CENA 3E0PB 1GBTA 1O2OA 3Q76A 3MYWA 1XVOA 4YTAA 2VWLA 1C9TA 1QA0A 2EY4C 1T8MA 2QIQA 5FBEA 1WUNH 3M7TA 4ISOA 4ZXYH 1DVAH 2YOLA 3FOAA 4IMZA 1WDIA 1SGDE 2R2WU 2Y5FA 4R8TB 3TH2H 1MTSA 3P8GA 7GCHG 1TRYA 3ENSB 2FLBH 5LGOA 2GV7A 4JK6A 2GKVE 2FOHA 1AY6H 2CXVA 3LGVA 1PPCE 3OX7U 3GY2A 1GMCG 1Y5BT 3UFAA 4AFZA 1A1RA 2A32A 2QN5T 4IW4E 4DJZB 4Q63A 1O32A 1P03A 1WXRA 3M3TA 4ZKRU 3RXDA 1ZGVA 1KSNA 5DO4H 1H9HE 2ZPQA 1QJ7B 1UK4A 4X2WA 1UTMA 4Y8YA 4AG2A 3EA8A 4BXWA 3FZZA 1V2ST 3TGIE 2CMYA 2TIOA 1C1PA 4OS6A 3M5OA 2QV1A 1KLIH 1OWJA 3UR6A 3FKSD 2OK5A 3MTYA 4CRDA 3ZVBA 3FO8D 2FXRA 2FX6A 2PGBB 1QQUA 3M3VA 4Y8XA 4Y76A 2XW9A 1SGIB 3AW0A 2ZKSA 2O8LA 1AGJA 4MQAA 2CHAB 1LPKB 8KME2 2Y81A 4ZAEA 3MQKC 1CGIE 1F0TA 1L4ZA 1TPSA 3ATMA 1Q31A 3A7WA 1GVLA 1LDTT 1YGCH 2AMDA 1T8OA 4WWYA 1DXPA 2TGPZ 4YLQH 4UDWH 5EXMA 1THRH 1UK3A 3UIRA 2LPRA 4NSVA 3TK6A 6GCHG 2ZEBA 1SGFG 1SOTA 1NFYA 1P2MA 1UVTH 2YMSC 3K6ZA 1C1QA 1C5PA 3LPRA 5EW2H 3I78A 1MQ6A 1GVKB 1P3CA 1J14A 3UB0A 1O3IA 5A8YA 3UOPA 1GI1A 5FCRA 3RXFA 3URCA 1A3BH 1EATA 1G30B 3LC5A 1TRNA 1W10U 3P8NA 1NFXA 3GY8A 3NUMA 1B7XB 1S6HA 4K8YA 3K2UA 3AAUA 3GICB 4FUEA 2HGTH 2AGIX 3CS7A 2F91A 3DT0H 3T26A 4NZQA 1QB1A 2Z9KA 2A1DB 1CGJE 3W1EA 1TGBA 3TGKE 2CK3D 2HNTC 2DE8A 1CU1A 1OYQA 2KZ4A 6CHAB 1D3PB 5A0AE 4ISHH 2PKAB 1EJNA 3RDZA 2XCNA 4I33A 4A92A 2ZF0H 3QZRA 1VITH 3HK3B 3LGUA 2GVFA 3Q77A 3OY5U 2BDHA 5JB9S 1SLVB 2R9PA 3OU0A 5JPMH 1MAYA 2TRMA 5LH8A 2KAIA 3DA9B 5F8XA 1EP6A 5JB8S 2BY7X 1TE0A 2VVVA 3QX5H 1JIRA 2ZU2A 1V2WT 1TRMA 4D8NA 5FX5A 3SNEA 1PQ7A 1AVWA 4J1YA 4MNVA 5EOKA 3UQOA 1S6LA 1YPHC 1TX7A 1AHTH 1G37A 1YC0A 5T6GA 1BA8B 3BTDE 4B2AA 1C1OA 1ETSH 2AERH 1C5LH 4ZKNU 5EJZA 1LQDB 3GYMA 4OGXA 5C94A 1C2DA 3ZZ5A 1MU8B 2M5TA 1SGFA 1S0QA 1LHCH 4Y7AA 4DIHH 3U9AH 1ZZZA 3TNTA 1P2KA 2XC5A 3RXJA 2L74A 1Z6JH 4M7GA 1UVOA 4NFEA 4AX9H 1UVUH 2V3HH 1SGTA 4LK4A 5DP4A 5C2ZA 1INCA 1MZDA 1EZXC 4XE4A 2UUKB 3ZVDA 1GL0E 1Y3VA 2HWLB 1TWXB 1KY9A 4LXBH 5DN6D 2BVXH 3E91A 3LGTA 3U1JB 4NA7A 2K1QA 3U1IB 3MNBA 1QJ1B 2A7CA 1KDQA 1O37A 5GDSH 1ANBA 1K28D 4YOIA 2O9QA 2AIPA 3NZIA 1HAVA 1ESBA 1Z1IA 1QBNA 1UJ1A 2SGAA 1CHOG 5LPRA 2EQNA 1EOJA 2TGAA 2B8OH 1CQQA 1QB9A 3P8FA 5C1YA 4D9QA 1EP5A 1BRAA 4MNXA 1NC6A 1ZSKA 1VITG 1HIAA 4CBNA 3PV4A 3TH3H 1MTNB 1W12U 2FPZA 3AAVA 4OS7A 1GI5A 3GCNA 1MTWA 4O97A 4DGJA 2BZ6H 1GGDC 1HRTH 3GDSA 1HUTH 1P9UA 1UTLM 2AEIH 5J4SA 5DP7A 3PM3A 3KQ5A 3A8BA 5C0TA 2BY8X 1VKYA 2C8YB 3PMHB 1Z8RA 1O2NA 1YBWA 1TIOA 4ACAA 1P9SA 3BTKE 3FP7E 3R3GB 4XD7D 1C4U2 1LHEH 2QGRA 2F3CE 1KXAA 3F9GA 4B75A 2WPLS 2XNDD 3KQBA 2YMSB 3U98H 1HJ8A 2RA0A 5HIYA 2ZQ1A 1Q3XA 2BOKA 1VZQH 1BBRK 5EJ1A 2SFAA 1GBMA 2XYAA 1AE5A 1IQGA 1HAIH 4GHTA 3F0OA 7LPRA 1C5NH 3M37A 1SPJA 2EI8A 4WF8A 3SORA 3QTOH 1GBBA 1KXCA 1ZJKA 1GDNA 3BIVH 2OBOA 3QN7A 5B6OA 1FZZA 1OSSA 4MPXA 2W26A 1H8HD 1O3PB 2V0BA 3BF6H 2UWOA 3RXLA 3A8CA 3VB5A 2GP9B 1UCYH 5GCHF 3UOUA 3WY8A 2BD4A 1QTFA 2LELA 3M7QA 4Q2KA 8GCHG 3RP2A 1C2HA 1PQAA 4OS2A 3GISB 3BTTE 1WU1A 3PRDA 1HJAC 4AGKA 3D49H 2VWMA 2ZGBH 1L1NA 1UK2A 1TX6A 1C2EA 1UTKA 1OWHA 1FMGA 2P59A 2H9EH 1L1JA 2SGFE 4B76A 1CBWC 1NRPH 1S5SA 3F3BA 4NWLA 1IAUA 1OP8A 4GPGA 1SGEE 1NFUA 4NZLA 1BHXB 5C5NA 3TIUA 5L30H 4X6MA 1N1LA 5KGOA 2WPKS 4K1SA 3N7DA 1ELTA 4YLUA 1HNEE 1HAXB 1JWTA 2HOBA 1LVBA 1Y5UT 2F9VA 4U01A 1DWBH 3F2GA 1D3QB 3RXIA 2BXTH 5AFZH 1ZMLA 1YPMH 3N7EA 1XX9A 3EA9A 4WH6A 1O3LA 1KIGH 1YKTA 1SGNE 4I8LA 2FEQH 4BAHB 2G52A 3SU2A 1GBDA 3NKKA 2KAIB 2BDIA 3P70B 1G2LA 3DHKH 4D7GA 4NFFA 1XUJA 2AYWA 2FM2A 1TBZH 2ODPA 3NWUA 3OTPA 1O2ZA 1KLJH 1Z71A 3MU4A 5CHBA 2JKHA 5EJLA 3KEEA 4JZEH 1BDAA 4VGCC 2BZAA 3I77A 1XM1A 5F6MA 4O3TA 3H09A 4FUHA 2OC8A 1XVMA 2FLRH 5DKMA 2KCAA 2ZTZA 2A31A 2KM0A 2Y5HA 2Z9GA 1EQ9A 5HYOA 2HRVA 2C8XB 3EE7A 1BMMH 1O2TA 1YPGH 4ABEA 1LPGB 1GI9B 4AYYB 2ANYA 2PW8H 3RXBA 1GHAF 2A5AA 2TPIZ 1S82A 1TBQH 1ZOMA 5F8ZA 2D26C 4MPUA 2Y7XA 5CHAC 2XBWA 1ELFA 1GGDB 5T6DA 1TPAE 5JBCS 1HGTH 1UHBA 4Q7YA 5KEDA 3SHCH 3I29A 1W7XH 3CNRA 5JDUB 1SVPA 4K1TA 1ABIH 5I46H 1K1NA 1TMUH 2VVUA 4I8KA 3A87A 2BVRH 2VWOA 1FPCH 2P8OC 1TNGA 4IC6A 1D3DB 2H9HA 3PROA 1E1RD 1SSXA 3HATH 3PLPA 3EGKH 5K7RA 4UD9H 1HAVB 2PTCE 1Y8TA 3PLKA 1CGHA 2G5NA 1BMFD 2VIPA 1GHXH 1TGCA 3WW7A 3SU6A 3U28C 1FAKH 1F0SA 3N7OA 3OEHD 3SZNA 1P09A 1Y3YA 1GHVH 1DT2A 1Z7KA 3M5MA 3GCOA 4JK5A 4Q7ZA 4XRNA 4ABDA 2J38A 3W95A 2VH6A 2V7QD 1EZQA 1VJAU 1O5CB 5HM9A 3TK5A 3GYLB 3E8LA 3PTNA 1YPEH 2EI6A 5FPSA 3F9FA 1D3TB 4HTCH 1ZYOA 1MH0A 3ATLA 1DOJA 1ETTH 1Z8GA 2V3OH 1WQVH 3LC3A 1G3BA 4ABGA 1Y3UA 2QXGA 1DUEA 1E0FD 1W8BH 1E35B 1HJAB 2D1JA 3LKWA 5A0CA 3C27B 3E6PH 1K22H 4NCYA 2PWXA 3KGPA 2O8TA 2ZGCA 4OM9A 3DD2H 3NK8A 4X2XA 3MO9A 4BAOB 3T62A 1E1QD 1CBWB 1GBFA 1NZQH 1UTPA 2WSSD 3RUOA 3MH7A 4ZCNA 2BQ7B 2BD7A 2C3SA 2ALVA 6ESTA 2GCHG 4B2BA 4RKJB 3ITIA 1C2MA 1C5UA 1QY6A 1P2JA 3F0PA 2OC7A 3A88A 2AH4X 2STBE 1K21H 4IS5A 1QA7A 1O3EA 2NWNA 3MH6A 3FAOA 4R0IA 2K8IA 2ZU3A 1GJDB 4CRCA 3M3SA 2CN0H 2ZQ2A 5C1XA 1O5DH 2J5UA 1P11E 2A7HA 1CE5A 1BBRH 1L2EA 1B0EA 5EG4A 5HMAA 2XBVA 5C5OA 2W3IA 1ELGA 1AFQC 2JJ2D 4IMQA 2QY0B 3M36A 3OFND 2NU1E 4CRAA 1D6WA 1DWCH 3SV9A 3BTEE 4H42U 2QXIA 1JIMA 1P02A 2P93A 1NPMA 5A8ZA 4ESTE 1C2GA 1TB6H 2H9TH 1ZLRA 3QLPH 1S0RA 4IBLH 4DURA 4WY3A 2M2AA 2O8UA 4BOHA 4Y6DA 3FP6E 2R3YA 4UFGH 2VH0A 1SQTA 3ZV8A 3EQ0H 3ATWA 4Y0YE 1O35A 1K0HA 1D4PB 5CHAB 2AHME 1NS3A 2BDGA 1K2I1 4QT8C 3VXFH 3SV8A 4ZMAH 1GJCB 1TX8A 1EAXA 1P01A 1JRTA 2A5KA 3AW1A 4O9VA 5AF9H 1P12E 1XXFA 4Y0ZE 2EI7A 5GWZA 1VGCB 4FUBA 3T25A 2B5TB 3UR9A 3ZZDA 2GZ7A 1SKYE 2CF9H 2KX4A 5BPEA 3F68H 2IPHA 2JETC 3DUXH 3HKIB 4K8BA 2YNBA 2PR3A 1ELVA 1ZR0A 5KECA 1C1TA 1O3HA 1O34A 2Y82A 1EX3A 1TNKA 4Y71A 1TBRH 1FN6A 1TPPA 3BEUA 4FUIA 2GT8A 5EPNA 1FUJA 4HZHA 3KL6A 2ZDKA 2EA3A 4WXVA 2H6MA 4BTIB 3ELAH 1M9UA 3PMJA 2GJGA 3TNSA 4MPVA 2C90B 2VGCC 1UCYK 2ZFTA 5C1UA 1A61H 2ULLA 1L0ZA 1H4WA 1L1GA 1UHBB 5GCHG 3D62A 3S9CA 1V2TT 3V0XA 2BB4A 1GI6A 1SQRA 1UW7A 2ZA5A 2BHGA 1S85A 2LNCA 2PSXA 1YCPM 1MTVA 2QC2A 2ZDNA 3GCHC 1F0RA 1VR1H 3P6ZB 2P94A 1ZPCA 4K1EA 1WTGH 1O33A 3MNCA 4X6PA 3UY9A 2HALA 3Q3YA 1EB1H 2BTCE 1TFXA 1O36A 3PO1C 3F9EA 1GI4A 1XMNB 4X1QU 3IITA 1LVOA 1AO5A 1AB9C 3PTBA 1G36A 2VJ1A 5E2OA 1O30A 2R0LA 4IC5A 2IOTA 2OQ5A 4B71A 4CR9A 1DSUA 3UAIC 2ZFFH 2B0FA 2TGTA 1HXFH 3KIDU 2VIOA 3PB1E 4MDSA 1ETRH 3RMNH 1O5FH 2AGGX 1ORFA 1FJSA 3SJKA 1O3KA 4ABFA 1OXGA 2GMTB 4DG4A 3NXPA 1S6FA 4JZIA 2BDAA 4IN1A 4ISLA 1DANH 1GWAA 2ZPRA 1WBGB 4Z0KA 1GBAA 1ELAA 1A0JA 2H5DA 2ZU1A 2XWBI 1W0ZU 1QCPA 1FI8A 1W13U 4J2YB 2ZFSA 1EZSC 2F9UA 1TOMH 5JBBS 1GMHG 4ZXXH 1V2LT 2ANWA 2JIZD 3F6UH 2A5IA 2BM2A 1O3FA 3PMBB 1XUHA 4TT3D 1O2PA 1UTOA 3S9AA 2ZHDA 3RXGA 1AMHA 2I6SA 4JYVH 2A4QA 2PSYA 3A89A 4WMDA 1C5ZB 4FUCA 1H1BA 1BMLA 2C8ZB 2WINI 1FV9A 4DW2U 3DFJA 3SV7A 3TPIZ 3F9HA 3OEED 5EXNA 1HJ9A 1EKBB 5FCKA 3A7VA 1LKBA 1ZHPA 4AFQA 1NRQH 4JZ1A 4ZKOU 2DUCA 4B73A 1CA0C 2KCOA 1ZSJA 2WUCA 1XKAC 5FPTA 5F8TA 3ZZ6A 5EXLA 3TVJB 4F49A 4K60A 4GVUA 3R0FA 2HVXA 1GI3A 1JRSA 4JYTA 2BD9A 5EODA 1IQLA 1C1NA 3T27A 3PV5A 5IYTA 5A2MH 3ODFA 4YM9A 2BDYA 3TITA 1ESTA 3LGWA 3UNSA 5E0GA 5CDFE 4UFDH 4D7FA 4TWWA 3CP7A 2FZZA 1CVWH 1K1PA 4H6TA 2JETB 3RXKA 3DSOA 4M9FA 3PWBA 2ZG0H 1C5QA 4NG9H 1TLDA 1TQ7B 1O5AB 2ILNA 2OTVA 3PMAB 2GD4B 2ZFQH 1CSOE 3SW2B 4MTBA 4U30A 2OC0A 3LJJA 1O2YA 3QGNB 4GCHF 4A7IB 4MVNA 2J98A 3H5CB 3IWMA 4AB9A 1GJ5H 1TNHA 3U8TH 1ACBE 4FU7A 5EQSA 1FPHH 4YESB 3BSQA 1N6YA 4ZROA 1YLNA 1GI0A 2VGCB 4YOGA 4H6SB 3L3TA 3E3TA 1GJ6A 2WPDD 1BTUA 2H5CA 2IPQX 3RLYH 2ZP0H 5EIYA 2XXLA 4TSFD 3TJUA 3E1XB 2FO9A 3GCHB 1BTWA 3KF2A 3MU1A 3ZVAA 3ZZ4A 2ZFRH 1SBWA 3JZ2B 1WQSA 2IJOB 3QO6A 1RGQA 1PQ8A 1V2NT 3SU4A 3GCTF 4MG3A 1T8LA 2BD5A 5GNDA 4DY7B 5T6FA 1DICA 1OKXA 3QWCH 5IK2D 1ESAA 4FVBA 3PO1B 2J9NA 4AC9A 3ZYDA 1NBME 1O2GH 2LP6A 1KTSB 1AB9B 2BMGB 2VU8E 5FHTA 1GHBF 2STAE 1DUAA 4LZ1H 1NBMD 3MO6A 1PPEE 1PPZA 3DFLA 4B6EA 5FL7D 5DK1A 4I7YH 1TONA 1FIWA 3EA7A 1NY22 3RLWH 4Y8ZA 2RG3A 1AUJA 1XUIA 5EU8A 2FWWA 2XRCA 3P17H 1ELCA 1LQEA 4FUFA 2FYQA 1P05A 1HV7A 1SC8U 1FDPA 3IG6B 4INLA 4ISNA 5H4IB 5I25A 2F4LA 3RC6A 3BN9A 1KXDA 2PUQH 1NRNH 3RXTA 4K69A 3VB3A 1ZPBA 2AGEX 2WYJA 1GDUA 4THNH 3SUGA 2V3MA 5AFYH 4A1XA 1GCTC 3SUEA 1A2CH 1FXYA 1HCGA 2Z9IA 7GCHF 4GLYA 5GJ4B 2ZECA 3GY7A 2WYGA 1MBQA 1MABB 2VWNA 1P8VC 4FU8A 4IN2A 4YO9A 1QJ6B 1GMCF 1AE8H 1K1LA 2P3TB 1FLEE 2FTLE 1C5OH 4OGYA 4AORA 2ZTXA 1LTOA 2ZHQH 2BXUH 1V2PT 1RFNA 3ZVGA 3ESTA 1HLTH 1CA0B 1SQAA 3UQVA 1JBUH 4KKDA 1O3CA 2ZHFH 3BG8A 2KCYA 1COWD 5LPFA 1N6XA 1C2LA 4B74A 4XDEA 2PUXB 3SOSA 1C1RA 3QZQA 1IQEA 1CHGA 1V3XA 1VCQA 3A8AA 2ODYB 4FUDA 2D8WA 2F43B 5A09A 1EAIA 2XC4A 5DG6A 2ZIQH 3QDZB 1O2JA 1YF4A 1BB0B 3LIWA 4NWKA 3MMGA 5JYIA 1OWDA 3ZZBA 3M61U 3UWIA 3ZYEA 4Y11E 1RIWC 1AUTC 1EZUC 2FI4E 2WPMS 2ZTYA 1SHYA 2ZCHP 4NA9H 5T1VA 1QL9A 3LH1A 2BOHB 1KXFA 1QIXB 4RSPA 4ABHA 4RT0A 2FODA 1AU8A 5DGJA 1TGNA 1PYTC 3D23A 3D65E 3U69H 3LU9B 2J97A 3GDVA 1BIOA 2F9OA 2HVYB 1O2UA 3MO3A 1ANCA 2J2UA 1QURH 2Q1JA 1EOLA 2JH5D 2Z3EA 5EQRA 1A46H 2FOAA 2JH6D 4AYVB 2PFEA 5L2ZH 3RXVA 1LHGH 2VINA 1ANDA 1AVXA 1C4V2 4P02A 4E06H 1TNLA 1EXFA 3HKJB 3RU4E 2ASUB 4UE7H 3FANA 1O2RA 1DM4B 3SU1A 5C20A 1IQFA 4B2CA 4JZFH 2FMJA 1BTZA 1AVGH 3RU4D 1V2MT 2ZC9H 3E90B 3RXCA 2AMQA 1O2VA 5GPIB 3GS9A 1SLWB 2OXSA 7ESTE 3SV6A 2J98B 2F83A 2GT7A 2BQ6B 1C5MD 3A7ZA 1MZAA 5ESTE 3O8BA 1Z8JB 4CRGA 1AWFH 3MU8A 2ZHWH 3DSGA 4AOQA 1DLEA 4JMYA 3L33A 3S69A 4TPYA 2IJD1 4NGAH 6LPRA 1YY3A 4HI3A 1WV7H 1THPB 3N99A 4BAQB 5E8EH 5C3NA 2QXJA 1BUIA 4WJG2 1QR3E 3OYPA 4I8HA 5LPEA 1PQ5A 1J9CH 4B1TA 1MKWK 3LGYA 2QF3A 3TU7H 1HAOH 2R3UA 2B7DH 1RS0A 1P04A 1MD8A 1XUKA 2OQUA 2Z3CA 1PPGE 4GSOA 1C5XB 1YP9A 3PRBA 1HAZB 1SLXB 3A8DA 4CH2B 3LDXH 2EC9H 4Y7BA 1V2OT 2ZZUH 1QRWA 3ZZAA 1EJAA 2QYIA 3SUDA 2NU2E 8ESTE 4WMEA 1WSSH 1GBEA 1O2KA 1GCTB 3JZ1B 4XSKU 2RDEA 3HGNA 3SI4H 1Y3XA 1HAGE 2GCTC 1JXPA 2CGAA 2QF4A 1QBOA 3MI4A 2G8TA 1QRXA 2FP7B 2SGQE 3MH4A 3SJIA 2ZPSA 1BRCE 1MTUA 2FESH 1C9PA 1SB1H 1TA6A 3SHAH 1IQKA 4CBOA 1NESE 1LO6A 4ISIH 1NN6A 2FOEA 3SGAE 3V12A 1K1MA 4HFPB 1DPOA 4X1RU 3BTGE 3SU3A 1YYY1 3OAAD 3ZVCA 1ZMNA 3ZZCA 1E34B 4CRBA 1HAPH 2BQWB 4NIYA 1MMJN 1CT2E 2FOCA 1E38B 3B23B 3T28A 1CHOF 2R0KA 2NU4E 1CA8B 2F9NA 1Y3WA 1HFDA 4KTCA 1HDTH 4U32A 5FXLA 3BTWE 3F2FA 1O5GH 1QL8A 1V2UT 4KTUA 1TAWA 1YPKH 1HAHH 2OLGA 3TGJE 1MBMA 2BLQA 1KLTA 1VITF 4YT7H 1ID5H 5J4QA 1SGPE 5FPYA 3WWFA 2SGDE 3RXHA 3SQHE 3UWJH 5F53A 3WWBA 1SR5C 1LHDH 2QXHA 3LONA 2VB0A 1AI8H 1DS2E 1W0KD 1C5WB 4BANB 1GBHA 1RIWB 1ARBA 1S83A 3LH3A 4GCHG 4FUGA 2Q6GA 4F48B 3OY6U 1S81A 1F92A 3LJOA 1A7SA 1E37B 1SGCA 1QZ8A 2WV4A 1OP2A 3SJ8A 1C5SA 3LGIA 2CF8H 1X7AC 1LMWB 1P57B 1UTNA 3FP8E 3T5FH 2XWAA 2ZCLP 2UUJB 3K9XB 2BY9X 5DP5A 3A7YA 3DCLA 4X2YA 2C8WB 2P16A 1LVMA 3S9BA 1A0HB 2GV6A 2SNWA 4VGCB 1AKSA 3V7TA 1P06A 4ZUHA 1A5IA 5DSFA 1OP0A 2HNTE 5DJ7A 1C5RA 1GG6C 1B0FA 1SFQB 1SMFE 3SNCA 4XOJA 2UUYA 2G81E 2BY5X 1FN8A 1MUEB 3KN2A 1MKXK 1O2MA 4MLFB 3VPKA 3GCTG 4A5TS 1G3EA 1IHTH 4CH8B 1BRUP 1OPHB 9ESTA 1MQ5A 1EJMA 1C2JA 1AN1E 3HK6B 3AK5A 4TY7A 1TABE 1FY4A 2ZGJA 1P2NA 2Y6TA 1HXEH 2WZQA 8GCHF 1GHBG 1FX0B 4AN7A 4XBDA 4ZH8A 4GUXA 1AFEH 2FIRH 1YPHE 1MCTA 2Z6BD 4INHA 2PGQB 4I32A 2BD3A 3STJA 2G55A 3V3MA 2KCPA 4X0WU 2G51A 2UWPA 4Z6AH 3GY3A 2ZFPH 1OWKA 2P8OB 1BBRE 3AASA 4TPIZ 3W94A 3RC4A 2C93B 3O8CA 1T4VH 1EFRD 3TJOA 3A82A 5HM2A 1AZ8A 1FY8E 1QQ4A 4X1PU 5EW1H 1A4WH 1GHWH 1GI2A 1H8IH 4UFFH 1NROH 1O2LA 1A3EH 1BOQA 4Y10E 3SZEA 1YWUA 1DITH 1QB6A 4CHAC 3UPEA 3MNXA 2XTTB 2GX4A 1W14U 2OP9A 3SJ9A 3ZZ8A 1JMOH 4FETA 2GDDA 4AG1A 5AVDA 2A45B 1CT0E 1F5KU 1QRZA 2SGPE 1W3CA 4I8JA 1A5HA 2UUFB 4E05H 1F2SE 1O2HA 3VG8A 2FOMB 2GCTB 3L6PA 1O2QA 3SV2H 3URDA 1A5GH 1ARCA 5DP6A 2VIVA 2HPQH 1ABJH 1V2KT 1G3DA 2B9LA 3PYHA 4NIWA 2XC0A 4AB8A 4ZHLU 2XNIA 2ZDVH 3KYFA 3QTVH 1GHYH 3LOXA 3H7OA 1KXEA 1IHSH 1ELDE 1U6QA 3BG4C 1AZZA 3Q3XA 1KYNA 2ZU5A 4A1VA 1GJ4H 1G3CA 1BRBE 3MU0A 4LOYH 1ZTJA 4PROA 3E16B 2WV9A 3O8RA 1BZXE 1VJ9U 1NU9A 3QGJA 1F5LA 1RXPA 1W0YH 1P10A 5DPAA 1BJUA 4O3UA 1MTNC 3A80A 1QHRB 5K0HA 4DT4A 1GL1A 2TBSA 2H1UA 3MHWU 1AWHB 1NRRH 4UONA 3F1SB 2XBXA 2G00A 3NPSA 1K1JA 1DWDH 4OS4A 3Q00A 3EYDA 1GBLA 2PKSC 3RXSA 4ABJA 2A4RA 3VGCC 2RFKC 1AD8H 4BAMB 3MH5A 3VEQB 1MKWH 2OBQA 1GMDF 5L2YH 3HGPA 4DOQA 1YPJH 3GOVB 1FIZA 2O8MA 4GHQA 2Y80A 4ASUD 2RDLA 5IDKA 2AIQA 1T4UH 1S84A 1AFQB 1IQJA 5ESBA 1O3GA 2RCEA 1FNIA 2ODQA 3S7HB 1O2XA 4B6FA 4YT6H 5HXFA 1SLUB 2A7JA 5JBTA 1ZTKA 3OTJE 3RXMA 1LHFH 1C2KA 3SN8A 1J16A 1GI8B 2J94A 3FZDA 1LKAA 1UMAH 1GG6B 1TNIA 3BV9B 1SQOA 1DSTA 1YPLH 1O2SA 1GHAG 2A4OA 5BRRE 1C1SA 2VNTA 2J34A 1ZHRA 4MNYA 1KMHB 3MWIU 2FOBA 3GDUA 3ZZ7A 1GJ8B 5E0HA 1D9IA 4AGJA 3TK9A 2WHXA 1MD7A 1NFWA 1GBKA 1OHHD 1BMAA 3P92A 5A0BA 3SNAA 4X8SH 2G4UA 4BTUB 1SL3A 3DSPA 2W7UA 1FY5A 3FVFB 4P00A 4F55A 2TGDA 4GAWA 3S0NA 3M5LA 2CV3A 3ZV9A 3KHVA 1EB2A 5E0JA 1NO9H 1O3NA 1SGYE 1AKSB 1ZPZA 2H2ZA 1O3MA 2ZDMA 5HGGA 1DLKB 4ZKSU 2G4TA 2AFQB 1TPOA 4K5ZA 3T29A 2WPJS 1G9IE 4E7RG 1N8OC 2OCVB 1PYTD 1TNJA 2GCHF 1H8ED 1V2JT 1T32A 2QA9E 1C1UH 5F03A 3ZVFA 4CHAB 5EPYA 4I31A 4K3JA 3LT3A 1RTKA 5TCCA 1GBCA 1UVSH 1Q2WA 3SU5A 5FX6A 4KTSA 3A81A 2WPIS 2QCYA
chains in the Genus database with same CATH topology
1GPZA 1GI7B 2AS9A 1P0SH 5E2PA 3V13A 3B9FH 2PHBA 1WCZA 3RXRA 5SGAE 1ZJDA 2BLOA 2VIQA 4NIXA 1CT4E 1O31A 1RTLA 1C1WH 3UNQA 1H9IE 4TY6A 4TWYA 3O8DA 1H8DH 2PTNA 4KELA 1GJAB 4X8VH 3SQEE 3SI3H 1TA2A 4FU9A 2ZDLA 1Z1JA 1ZRKA 1PFXC 1TALA 5A8XA 1P2QA 1MKXH 2VIWA 1WTHD 3BG4B 1QNJA 3UREA 1K1OA 3SGBE 3STIA 1NT1A 1UO6A 3UNRA 1ANEA 1DY8A 3ODDA 3GY6A 2J95A 2ZNKH 2XCFA 1BTHH 2BLWA 2Q6FA 2J92A 2FYRA 1C2FA 3RMMH 1WYKA 1CO7E 1EUFA 4X6OA 3U8OH 4AZ2B 2P3FH 3MU5A 1C1VH 1F0UA 5DP8A 1DWEH 2JH0D 4OS5A 2FS9A 3BTME 2R2MB 2OD3B 2PKSB 1YCPK 3E0NB 2HNTF 4JYUH 4K2YA 3VGCB 3QK1A 8LPRA 3B8JA 1W7GH 2ZI2H 5ETXA 5TJXA 2BYAX 3SU0A 2ZGHA 2HLCA 1HYLA 1UVPA 2BDCA 2Q6DA 3MFJA 3A7TA 1T31A 2OC1A 2WPHS 4X1NU 5G4BA 1BTYA 1ZRBA 4XBCA 3K6YA 1GBIA 1O3DA 1ZHMA 1THSH 1C5VA 1EAWA 2A2XH 2ALPA 3MOCA 3TJVA 4F4OC 1XKBC 2GGVB 4NIVA 1UTQA 2GTBA 1BHXF 1F5RA 3PLBA 4FXGH 1TOCB 3KQEA 3Q3KA 2ZCKP 1UTJA 2DE9A 1WAYB 3RMLH 4E7NA 2Z9JA 4BAKB 1HBTH 1O2IA 2ANMH 2ZDAH 4H4FA 1RRKA 2FS8A 2ANKH 1QFKH 1IQNA 1NRSH 2WUBA 4WVPE 1FY3A 1EPTA 2SGEE 1DXWA 1O2WA 1NM6A 2IN2A 2Z3DA 5L6NH 3EDXB 4X2VA 1QGFA 3M35A 4D9RA 1GBJA 4MPWA 4JCNA 1YLCA 1BCUH 1PPBH 2AMPA 2BY6X 3SBKA 4BXSA 1J17T 1IQHA 4ASHA 3VB7A 1N8OB 3KQCA 3KQDA 4DCDA 1BTXA 4ABIA 1BT7A 1OWIA 3RM0H 1UCYE 1C5YB 4D76A 5C67A 1DDJA 1GHZA 2THFB 2Z9LA 3RXQA 6GCHF 1SFIA 3RC5A 1GJBB 3GY4A 4XBBA 3MNSA 2PV9B 1Y59T 3U8RH 1SOZA 4ABAA 5GXPA 3A85A 3A83A 3P8OA 1O3BA 2BX3A 1EPTC 4NSYA 2Z7FE 2A4GA 3RXOA 1LVYA 3T2NA 1GCDA 1V2QT 2GZ8A 1NTPA 1MCVA 3A84A 3K65B 1MAXA 1SGQE 3GY5A 1O5EH 1XUFA 1GMHF 4O03A 4FVDA 2F9BH 4YOJA 1Z6EA 3OSYA 2ZO3H 1O3OA 1W2KH 4Q7XA 2ZHEH 3RXUA 1YM0A 4BTTB 1PJPA 4OS1A 3SNBA 1P2OA 4MNWA 1PPFE 2FI3E 3G01A 1TMTH 3VXEH 3TLOA 3FFGA 4DT7B 1LPZB 1LCYA 1ZGIA 1Z8IB 9LPRA 2J4IA 1RD3B 4BNRA 4X8TH 3TJNA 2BD8A 3BEFB 4RKOB 4LZ4B 4DIIH 1AQ7A 2BD2A 1BITA 2G5VA 2CJIA 3VB6A 1RTFB 1GMDG 2V35A 4UFEH 1VGCC 5JBAS 1Y5AT 1IQMA 1V2VT 1K9OE 4U2WA 3RU4T 1G2MA 1FQ3A 3A7XA 3BEIB 1KDQB 3SO3A 3SJOA 2OINA 4Y79A 1HPGA 5AHGH 1TMBH 5ABWA 1GDQA 2FOFA 1ELBA 1VCPA 1EAUA 1BTPA 1T8NA 7KMEH 1QBVH 1J8AA 1FY1A 1SI5H 5T3HA 1HIAB 3CS0A 1QL7A 1DX5M 1BMNH 1FAXA 2BX4A 1H9LB 4UEHH 3NCLA 5CMXH 4X8UH 1TGTA 1SG8B 1MU6B 3UUZA 2BVSH 1FONA 2FX4A 5GIBA 4CR5A 3PWCA 1GJ7B 2V6NA 2W5EA 1L4DA 1P2IA 3RXAA 3S7KB 4CRFA 3RXPA 2FDAA 5FBIA 2ZU4A 2W3KA 2QF0A 2P95A 2W7SA 2ZWLH 2OUAA 1BQYA 1DFPA 2CHAC 1B5GH 4HGCA 2BDBA 4X6NA 2NU0E 3ZZ9A 3TH4H 1BJVA 1HAYB 1O3AA 1O5BB 1P3EA 1XUGA 1NU7B 2FTMA 1SHHB 3EE0B 5FAHA 4ABBA 1KXBA 4A6LA 1HB0B 4CREA 1GJ9B 2BLVA 1K1IA 3BIUH 2EEKA 4FUJA 1ZSLA 1GVZA 2PKAA 1OS8A 2GDEH 2D2DA 2Y5GA 2VVCA 1EASA 1TQ0B 1OWEA 2YNAA 2ESTE 4NA8A 1V2RT 1YCPH 2UWLA 1F7ZA 4Q80A 1RJXB 3VB4A 1WOFA 2GMTC 5CE1A 2NU3E 5DP9A 1DY9A 3RXEA 3HPTB 3KCGH 1ZTLA 1O0DH 5EQQA 2ZGXH 2A2QH 4WH8A 3A86A 4ZHAA 1O3JA 1AIXH 3EAJA 3BTQE 2WV5A 1IQIA 2FOGA 1OX1A 1C1MA 3P95A 1OYTH 1T7CA 5TCAA 3VFEA 1EPTB 1C5TA 3M5NA 4IGDA 3RMOH 1SGRE 4RN6A 2Z94A 2PLXA 3RM2H 3QUMP 1DE7H 4DVAU 1A0LA 3UTUH 4JZDH 5EGMA 3AVZA 4WXIA 2F9PA 2SNVA 3M7UA 4AFSA 3C1KA 1C4Y2 1TYNA 1C2IA 2HPPH 2VIDA 3SNDA 3ZVEA 1G32B 6CHAC 4I8GA 1JOUB 4A1TA 2C4FH 1D6RA 2XBYA 3SGQE 1V6DA 2QAAA 4TYDA 4SGAE 2Y7ZA 1KTTB 1XXDA 2GZ9A 4YZUA 5DP3A 1O39A 1OOKB 1J15A 2I6QA 2A0QB 1IOEA 3ZZ3A 2P3UB 5PTPA 3KNXA 4WMFA 3BTHE 4X1SU 4XFQA 1W11U 3ATKA 4AFUA 1TGSZ 1ELEE 1E36B 1YLDA 4ZHMU 1VCWA 4SGBE 2RA3A 3BTFE 3SUFA 3ATIA 1PPHE 2FI5E 1O38A 2O8WA 4KP0A 3H7TA 1ZMJA 4KGAA 4INKA 3CENA 3E0PB 1GBTA 1O2OA 3Q76A 3MYWA 1XVOA 4YTAA 2VWLA 1C9TA 1QA0A 1T8MA 2QIQA 5FBEA 1WUNH 3M7TA 4ISOA 4ZXYH 1DVAH 2YOLA 4IMZA 1SGDE 2R2WU 2Y5FA 4R8TB 3TH2H 1MTSA 3P8GA 7GCHG 1TRYA 3ENSB 2FLBH 5LGOA 2GV7A 4JK6A 2GKVE 2FOHA 1AY6H 2CXVA 3LGVA 1PPCE 3OX7U 3GY2A 1GMCG 1Y5BT 3UFAA 4AFZA 1A1RA 2A32A 2QN5T 4IW4E 4DJZB 1O32A 1P03A 3M3TA 4ZKRU 3RXDA 1ZGVA 1KSNA 5DO4H 1H9HE 2ZPQA 1QJ7B 1UK4A 4X2WA 1UTMA 4Y8YA 4AG2A 3EA8A 4BXWA 3FZZA 1V2ST 3TGIE 2CMYA 2TIOA 1C1PA 4OS6A 3M5OA 2QV1A 1KLIH 1OWJA 3UR6A 3MTYA 4CRDA 3ZVBA 2FXRA 2FX6A 2PGBB 1QQUA 3M3VA 4Y8XA 4Y76A 2XW9A 1SGIB 3AW0A 2ZKSA 2O8LA 1AGJA 4MQAA 2CHAB 1LPKB 8KME2 2Y81A 4ZAEA 1CGIE 1F0TA 1L4ZA 1TPSA 3ATMA 1Q31A 3A7WA 1GVLA 1LDTT 1YGCH 2AMDA 1T8OA 4WWYA 1DXPA 2TGPZ 4YLQH 4UDWH 5EXMA 1THRH 1UK3A 3UIRA 2LPRA 4NSVA 3TK6A 6GCHG 2ZEBA 1SGFG 1SOTA 1NFYA 1P2MA 1UVTH 3K6ZA 1C1QA 1C5PA 3LPRA 5EW2H 3I78A 1MQ6A 1GVKB 1P3CA 1J14A 1O3IA 5A8YA 3UOPA 1GI1A 5FCRA 3RXFA 3URCA 1A3BH 1EATA 1G30B 3LC5A 1TRNA 1W10U 3P8NA 1NFXA 3GY8A 3NUMA 1B7XB 1S6HA 4K8YA 3K2UA 3AAUA 3GICB 4FUEA 2HGTH 2AGIX 3CS7A 2F91A 3DT0H 3T26A 4NZQA 1QB1A 2Z9KA 2A1DB 1CGJE 1TGBA 3TGKE 2HNTC 2DE8A 1CU1A 1OYQA 6CHAB 1D3PB 5A0AE 4ISHH 2PKAB 1EJNA 3RDZA 2XCNA 4I33A 4A92A 2ZF0H 3QZRA 1VITH 3HK3B 3LGUA 2GVFA 3Q77A 3OY5U 2BDHA 5JB9S 1SLVB 2R9PA 3OU0A 5JPMH 1MAYA 2TRMA 5LH8A 2KAIA 3DA9B 5F8XA 1EP6A 5JB8S 2BY7X 1TE0A 2VVVA 3QX5H 1JIRA 2ZU2A 1V2WT 1TRMA 4D8NA 5FX5A 3SNEA 1PQ7A 1AVWA 4J1YA 4MNVA 5EOKA 3UQOA 1YPHC 1TX7A 1AHTH 1G37A 1YC0A 5T6GA 1BA8B 3BTDE 4B2AA 1C1OA 1ETSH 2AERH 1C5LH 4ZKNU 1LQDB 3GYMA 4OGXA 1C2DA 3ZZ5A 1MU8B 2M5TA 1SGFA 1S0QA 1LHCH 4Y7AA 4DIHH 3U9AH 1ZZZA 3TNTA 1P2KA 2XC5A 3RXJA 1Z6JH 4M7GA 1UVOA 4NFEA 4AX9H 1UVUH 2V3HH 1SGTA 4LK4A 5DP4A 5C2ZA 1INCA 1MZDA 1EZXC 4XE4A 2UUKB 3ZVDA 1GL0E 1Y3VA 2HWLB 1TWXB 1KY9A 4LXBH 2BVXH 3E91A 3LGTA 3U1JB 4NA7A 2K1QA 3U1IB 3MNBA 1QJ1B 2A7CA 1KDQA 1O37A 5GDSH 1ANBA 1K28D 4YOIA 2O9QA 2AIPA 3NZIA 1HAVA 1ESBA 1Z1IA 1QBNA 1UJ1A 2SGAA 1CHOG 5LPRA 1EOJA 2TGAA 2B8OH 1CQQA 1QB9A 3P8FA 5C1YA 4D9QA 1EP5A 1BRAA 4MNXA 1NC6A 1ZSKA 1VITG 1HIAA 4CBNA 3PV4A 3TH3H 1MTNB 1W12U 2FPZA 3AAVA 4OS7A 1GI5A 3GCNA 1MTWA 4O97A 4DGJA 2BZ6H 1GGDC 1HRTH 3GDSA 1HUTH 1P9UA 1UTLM 2AEIH 5J4SA 5DP7A 3PM3A 3A8BA 2BY8X 2C8YB 3PMHB 1Z8RA 1O2NA 1YBWA 1TIOA 1P9SA 3BTKE 3FP7E 3R3GB 1C4U2 1LHEH 2QGRA 2F3CE 1KXAA 3F9GA 4B75A 2WPLS 3KQBA 3U98H 1HJ8A 2RA0A 2ZQ1A 1Q3XA 2BOKA 1VZQH 1BBRK 2SFAA 1GBMA 2XYAA 1AE5A 1IQGA 1HAIH 4GHTA 7LPRA 1C5NH 3M37A 1SPJA 2EI8A 4WF8A 3SORA 3QTOH 1GBBA 1KXCA 1ZJKA 1GDNA 3BIVH 2OBOA 3QN7A 5B6OA 1FZZA 1OSSA 4MPXA 2W26A 1O3PB 2V0BA 3BF6H 2UWOA 3RXLA 3A8CA 3VB5A 2GP9B 1UCYH 5GCHF 3UOUA 3WY8A 2BD4A 1QTFA 3M7QA 8GCHG 4Q2KA 3RP2A 1C2HA 1PQAA 4OS2A 3GISB 3BTTE 1WU1A 1HJAC 4AGKA 3D49H 2VWMA 2ZGBH 1L1NA 1UK2A 1TX6A 1C2EA 1UTKA 1OWHA 1FMGA 2P59A 2H9EH 1L1JA 2SGFE 4B76A 1CBWC 1NRPH 1S5SA 4NWLA 1IAUA 1OP8A 4GPGA 1SGEE 1NFUA 4NZLA 1BHXB 5C5NA 3TIUA 5L30H 4X6MA 1N1LA 2WPKS 4K1SA 1ELTA 4YLUA 1HNEE 1HAXB 1JWTA 2HOBA 1LVBA 1Y5UT 2F9VA 4U01A 1DWBH 1D3QB 3RXIA 2BXTH 5AFZH 1ZMLA 1YPMH 1XX9A 3EA9A 4WH6A 1O3LA 1KIGH 1YKTA 1SGNE 4I8LA 2FEQH 4BAHB 2G52A 3SU2A 1GBDA 3NKKA 2KAIB 2BDIA 3P70B 1G2LA 3DHKH 4D7GA 4NFFA 1XUJA 2AYWA 2FM2A 1TBZH 2ODPA 3NWUA 1O2ZA 1KLJH 1Z71A 3MU4A 2JKHA 3KEEA 4JZEH 1BDAA 4VGCC 2BZAA 3I77A 1XM1A 5F6MA 4O3TA 4FUHA 2OC8A 1XVMA 2FLRH 5DKMA 2ZTZA 2A31A 2Y5HA 2Z9GA 1EQ9A 5HYOA 2HRVA 2C8XB 1BMMH 1O2TA 1YPGH 4ABEA 1LPGB 1GI9B 4AYYB 2ANYA 2PW8H 3RXBA 1GHAF 2A5AA 2TPIZ 1S82A 1TBQH 1ZOMA 5F8ZA 2D26C 4MPUA 2Y7XA 5CHAC 2XBWA 1ELFA 1GGDB 5T6DA 1TPAE 5JBCS 1HGTH 1UHBA 4Q7YA 3SHCH 3I29A 1W7XH 5JDUB 1SVPA 4K1TA 1ABIH 5I46H 1K1NA 1TMUH 2VVUA 4I8KA 3A87A 2BVRH 2VWOA 1FPCH 2P8OC 1TNGA 4IC6A 1D3DB 2H9HA 3PROA 3HATH 1SSXA 3PLPA 3EGKH 5K7RA 4UD9H 1HAVB 2PTCE 1Y8TA 3PLKA 1CGHA 2G5NA 2VIPA 1GHXH 1TGCA 3SU6A 1FAKH 1F0SA 3N7OA 3SZNA 1P09A 1Y3YA 1GHVH 1DT2A 1Z7KA 3M5MA 3GCOA 4JK5A 4Q7ZA 4ABDA 2J38A 3W95A 2VH6A 1EZQA 1VJAU 1O5CB 5HM9A 3TK5A 3GYLB 3E8LA 3PTNA 1YPEH 2EI6A 5FPSA 3F9FA 1D3TB 4HTCH 1ZYOA 1MH0A 3ATLA 1DOJA 1ETTH 1Z8GA 2V3OH 1WQVH 3LC3A 1G3BA 4ABGA 1Y3UA 2QXGA 1DUEA 1E0FD 1W8BH 1E35B 1HJAB 2D1JA 3LKWA 5A0CA 3C27B 3E6PH 1K22H 4NCYA 2PWXA 3KGPA 2O8TA 2ZGCA 3DD2H 3NK8A 4X2XA 3MO9A 4BAOB 3T62A 1CBWB 1GBFA 1NZQH 1UTPA 3RUOA 3MH7A 2BQ7B 2BD7A 2C3SA 2ALVA 6ESTA 2GCHG 4B2BA 4RKJB 3ITIA 1C2MA 1C5UA 1QY6A 1P2JA 2OC7A 3A88A 2AH4X 2STBE 1K21H 4IS5A 1QA7A 1O3EA 2NWNA 3MH6A 3FAOA 4R0IA 2ZU3A 1GJDB