1WOFA

Crystal structure of sars-cov mpro in complex with an inhibitor n1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
309
structure length
309
Chain Sequence
PLGSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Design of Wide-Spectrum Inhibitors Targeting Coronavirus Main Proteases.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 87
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1wofA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wofA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wofA02
3A7XA 2A2XH 3CS7A 1DANH 1BHXF 3LKWA 2C93B 2FI3E 2SNWA 3RXSA 5T6FA 1OSSA 1AFQC 2V0BA 2FX4A 5F8XA 3TK6A 4A1VA 1ETRH 2ZFPH 4ISOA 2A1DB 1V2KT 4Y0ZE 2HOBA 4IN1A 4ZXYH 2FI5E 4CRFA 2TPIZ 4AGKA 3ZZCA 2VB0A 2ZGHA 1IQIA 1ESBA 4ZUHA 3EAJA 2PSYA 2WPHS 2ZFFH 4Y79A 2P3UB 2Y82A 5LGOA 3A8DA 1QA7A 5JBTA 1UTPA 1RJXB 5C2ZA 1AKSB 1O2IA 3GDSA 1O37A 1VJAU 3NKKA 1GI2A 2ZC9H 2VGCB 1MTWA 3ZZBA 1ELBA 4AYVB 5CE1A 5JDUB 2FO9A 3SV9A 3LGWA 1ZMLA 3O8DA 3ZVAA 1TWXB 4ABBA 3KIDU 4BXSA 2FZZA 4OS1A 3MH5A 3MO6A 1UTJA 1DDJA 1YLCA 1C5MD 1LKAA 1T8OA 4XOJA 3SI4H 1NY22 1O2KA 4DVAU 3VPKA 3NZIA 1TGTA 2B7DH 3E3TA 1HAPH 1GHAF 1QB6A 5GIBA 1ABJH 1GBFA 1LCYA 3QTOH 1VGCC 1UHBB 3EA9A 3GCHC 1EX3A 4UDWH 1FY5A 1GCTC 2CGAA 1N8OB 4X2VA 1QB9A 3S9AA 1VITH 4FVDA 4NA8A 4WY3A 1ZYOA 2ZCHP 4YOIA 1T32A 2VU8E 1ID5H 1CGHA 3MI4A 4BOHA 1IHTH 4DY7B 2ZQ2A 2TGTA 1OXGA 2SGQE 2HRVA 3A82A 5DP9A 1ZMNA 1TABE 4INKA 1AVXA 1FIZA 1A2CH 1KSNA 1C2EA 4Z6AH 2JETC 2GMTB 3MFJA 2GDEH 1NROH 4X6OA 2XYAA 2GKVE 5J4SA 3T25A 1BRBE 4MNXA 1ARCA 1GVKB 3ZVBA 4IGDA 3V0XA 1HAYB 1F7ZA 1GJDB 4CHAC 1OP8A 5A0AE 2BLQA 3SNEA 2Z7FE 4BAOB 1O2QA 2J2UA 1GVLA 4VGCC 1Z7KA 1V2NT 2FP7B 1JIRA 3PMBB 1UK3A 4IC6A 2PSXA 1DE7H 1LVMA 1A4WH 4IMQA 3UOPA 2Z3EA 1O3IA 5GCHF 2ZA5A 1C1TA 1ZHMA 2KAIA 2F9PA 1P2IA 1AN1E 2FLBH 1S0RA 2W5EA 3L33A 1V2VT 1PPGE 2FPZA 1FONA 2AYWA 3QN7A 4TPYA 4XBCA 1WAYB 3M5OA 3UQOA 3S7HB 3EDXB 3UOUA 1C1MA 3MYWA 1P2QA 2QA9E 4AFUA 3A8CA 1LTOA 1VZQH 3L6PA 5FAHA 3EBNA 4AORA 4AN7A 2PLXA 1DSTA 1MQ6A 1CA8B 4WVPE 2HNTF 3VGCC 4MNYA 5A0CA 4GLYA 2PW8H 3A83A 1D6WA 4KTCA 3SJIA 1P03A 2F91A 1FI8A 4ZHMU 2K7XA 1FQ3A 2OUAA 3RXPA 1O39A 2CHAC 1NN6A 3PTNA 3HK6B 3PO1C 4X8VH 3RXLA 3A7ZA 2PUQH 1OWIA 5JYIA 4A1XA 4GUXA 1MQ5A 1QJ6B 1JRSA 3MU5A 4DURA 2NU1E 3RXQA 1EUFA 4Q7YA 1V2ST 1HGTH 2B0FA 1ZGIA 2XWAA 1LVOA 1K1IA 1P57B 1C5TA 1AE8H 2XC4A 3UY9A 4Y0YE 1AB9C 4O97A 1CHOG 1CT4E 3URDA 1XM1A 1FAKH 1XVMA 4INHA 4YLUA 2XBXA 1GJ8B 1AQ7A 4A6LA 1ZPCA 1SOZA 1SOTA 2H9HA 2BLVA 1YPEH 4H4FA 1E34B 5DP8A 1SLXB 3N7OA 2FLRH 5G4BA 3RM2H 1C5PA 1F5RA 2BD5A 1SGNE 1P02A 2ZDKA 4ZKRU 4HI3A 2ZP0H 4K60A 1AE5A 3P95A 2W3IA 4LOYH 3RC6A 6LPRA 3S69A 3SUFA 3SU0A 1OYQA 3A8AA 2R9PA 4NSVA 1BITA 1HAHH 2OC1A 1IOEA 3ZV8A 1CU1A 4OS5A 2OD3B 1MBMA 4D7FA 2Y7ZA 1MZDA 5GPIB 2BX4A 3KQEA 2B9LA 1V2QT 1DY8A 1PPBH 1QBNA 1F5LA 1WYKA 2UUFB 3NPSA 1MTNB 4DJZB 2ZF0H 1WCZA 3F9GA 1BBRK 4D76A 5BRRE 1GI3A 3G01A 1OWHA 2ILNA 1DPOA 2P3TB 1EAWA 5L6NH 3SJKA 5T6DA 3RUOA 1O2OA 1ZPBA 1DWEH 2O8UA 1YC0A 2BZ6H 2XBWA 1AD8H 1J8AA 2BVSH 4MPXA 2D26C 5FPTA 3RXRA 2OC7A 2THFB 2VGCC 4WF8A 1SGDE 2Q1JA 1P2JA 1XUJA 3H5CB 1HCGA 2A5IA 5C1YA 1DWDH 1Y8TA 1J15A 2ANKH 1D3TB 1GI9B 1W11U 2G5VA 2QY0B 1XXDA 1QBVH 1P2OA 4FUHA 4X2WA 1EB1H 4MG3A 1TQ0B 4INLA 2BDBA 4ZKOU 2GCTC 2QIQA 1ELVA 1SPJA 3A80A 1QRWA 4AFQA 3AVZA 4E05H 1CQQA 2FMJA 2EI7A 1TMUH 4X1PU 5TCCA 1PPEE 3DFLA 1UTOA 1Z1JA 1UTLM 2P8OB 2VIPA 1S85A 1H9HE 2BDHA 1GHAG 1HJ9A 1UK4A 1RS0A 2ZHQH 2FOCA 1MAXA 3HGNA 3LONA 4XSKU 1TX8A 1N8OC 2BD8A 2ZU1A 2GT8A 5H4IB 1AZ8A 3QZRA 3TH3H 5C20A 2R3UA 1C4U2 3ODFA 3U98H 3F9HA 1P10A 5GDSH 3SU5A 1GBDA 4B1TA 3VEQB 1HAVB 2ZU5A 1Q31A 3MNSA 1IQEA 1AGJA 1SLWB 2ALVA 1SI5H 2Z9GA 4ISIH 5I25A 4JK6A 1ELFA 2GMTC 1SGFA 2P94A 1VITF 5EG4A 4I33A 1O5BB 4Y8ZA 4YOGA 1QL8A 1O3DA 1KTTB 1O5AB 3SNAA 3PROA 4NGAH 2UWPA 4AOQA 2A4GA 2CJIA 1QCPA 4WXIA 2F9OA 4ABGA 3BTHE 1AI8H 5ETXA 2SNVA 9ESTA 3AW1A 1ZMJA 1HDTH 3MH4A 3O8CA 2Y5HA 2GT7A 1WTGH 1HUTH 1ZHPA 1EJNA 1C9TA 1OWJA 1UTQA 3OYPA 1UVTH 4X0WU 1BZXE 1O2TA 4ABFA 2ZGBH 4ASHA 1A3BH 1JXPA 2UUYA 2FOGA 5GCHG 1BTYA 5FBIA 1ELGA 2V35A 4WXVA 1NRQH 4FUBA 1CGIE 4B2AA 2PWXA 1GMHF 1XUHA 2BOKA 3QGJA 1GVZA 1HAOH 2Z3CA 2A0QB 4A92A 4NIVA 1BUIA 4E06H 3P8GA 1NZQH 1BBRH 1VCQA 1C5XB 2F83A 4IC5A 4OS6A 4JZ1A 2G00A 3FZZA 4ABJA 4NFEA 1GHBF 5FHTA 1GDNA 2ZPRA 1EKBB 3O8BA 1DS2E 3TJNA 3BTME 1Y3UA 1GHYH 2ZTYA 3E1XB 3SW2B 3VFEA 2ZZUH 1JBUH 1ETSH 1TNIA 3GY8A 2GDDA 1IQGA 1YCPM 1TONA 2AERH 4NFFA 4BNRA 3GCNA 1C4Y2 2CN0H 1A7SA 4K2YA 2FS8A 3W94A 3T62A 1A61H 3D65E 3ELAH 1O2NA 7ESTE 1C2HA 1WU1A 4ZKSU 5F8TA 1UVUH 1P01A 2FDAA 1C1PA 1EZSC 1J9CH 3TH2H 3FFGA 1N6YA 1DY9A 1HLTH 1PPHE 4B74A 2ZGJA 5CHAC 3ZVGA 3BTWE 2H6MA 1YCPH 4BAKB 1P05A 2Y6TA 4IW4E 2YNBA 4MPVA 3KEEA 3KNXA 3ZZ7A 1BB0B 1BQYA 3SHCH 2SGDE 1CA0B 2C8YB 2OXSA 2GX4A 2BD7A 2ZGXH 3RXFA 1C1QA 1QJ7B 2PUXB 1W2KH 2JH6D 2OINA 3QDZB 1P8VC 3WY8A 3PMHB 3SGAE 2O9QA 1SFIA 4UONA 2ZEBA 4GCHF 1K1JA 4CRDA 4Y7AA 3BIUH 5C67A 1ARBA 2QAAA 2W3KA 4KELA 3MU1A 3T28A 4B76A 2FYQA 4FXGH 1CE5A 5FX5A 1GBIA 1EP5A 4MNVA 2WYGA 3EE0B 3BTEE 1ORFA 4K1SA 3B23B 3LH3A 4QT8C 3VXEH 1D3PB 3M5NA 3M7UA 4XFQA 2OLGA 2LPRA 2OQ5A 1RRKA 4ESTE 2VH0A 4ZKNU 1F92A 3TJVA 1SQOA 5C1UA 1BRUP 3R3GB 2QGRA 3PTBA 4AX9H 1MTNC 3M36A 1TAWA 2AH4X 3F6UH 4NG9H 3ZZAA 1T4VH 3LH1A 1PQ5A 3PMAB 4MQAA 2PTNA 4NWLA 4JZEH 1BT7A 3URCA 2Y5FA 1C2GA 5DP7A 3C27B 5LPRA 3NUMA 1NFWA 1O5GH 2CF8H 3STJA 2Y81A 2C90B 1TRYA 4A1TA 2A45B 1EAUA 3SQHE 1C5WB 1LKBA 1RIWB 1L1GA 2PKAA 1AY6H 1FLEE 3ATWA 1Z71A 2HALA 3ODDA 5GJ4B 4UEHH 3EA8A 1H9IE 2RG3A 1ZOMA 3KGPA 4WH6A 2O8LA 1O3EA 2G52A 1AIXH 4RN6A 3NXPA 3HK3B 4X6PA 1GJ6A 3SJ8A 2J38A 1K21H 3T2NA 2P8OC 2IOTA 3D23A 5FX6A 1EZUC 1DOJA 1FY1A 1GI8B 5DJ7A 3I29A 2H9EH 1G3CA 3BEFB 1S6HA 2VINA 1HAVA 1NFUA 4Q7ZA 2Z6BD 2RA3A 5AF9H 2Z9JA 4CH8B 4B75A 1DITH 1W3CA 1XKBC 1KXAA 2BQ6B 3PMJA 1F5KU 2BVXH 1AMHA 1TLDA 3DHKH 1XXFA 2ZNKH 2PR3A 3RU4E 3RXBA 4TPIZ 3ZVDA 3ZYDA 1O2GH 3RM0H 1O3BA 2FIRH 4Y76A 3M5LA 2H5CA 1GG6B 1VITG 1GBTA 1A3EH 1K2I1 4CREA 4NIXA 1GBHA 1FUJA 1TBRH 1A46H 4JYUH 2AMQA 2ODYB 2FM2A 3SOSA 5A2MH 3ZZ4A 5SGAE 3OTJE 1S5SA 2YOLA 3BG8A 2QXJA 3AAVA 3PB1E 1ZHRA 1W0YH 1K1LA 1OYTH 4I8KA 2Y80A 1PJPA 2ZIQH 1GGDB 3SV6A 2UUKB 1QR3E 1ANCA 1O2RA 1AUJA 1LMWB 2FX6A 3QUMP 5EQSA 7GCHF 5EXLA 1BTUA 3Q76A 2AGEX 3E8LA 1W12U 1SFQB 5FBEA 3DFJA 5A8YA 1T7CA 1C4V2 2QF0A 3SV8A 4Y8YA 1INCA 4YOJA 1SGQE 3LOXA 1PYTD 1GMHG 3BEUA 3F9FA 1C5LH 4YTAA 1P2KA 2ZQ1A 1ZGVA 1V2MT 2R0KA 2TBSA 3K9XB 1HXEH 2HLCA 1T8MA 3RXDA 1C5OH 2ZU2A 1DXWA 1GHBG 4K3JA 3SN8A 4GVUA 1O35A 1LHEH 3RXIA 2B8OH 5GXPA 3FAOA 1GBKA 4Y10E 2ZDAH 1K22H 3DT0H 1MD8A 2GCHF 4B2BA 1O32A 1F2SE 2A7JA 3GYLB 2VVUA 9LPRA 3BV9B 1ELCA 3TJOA 3ZVEA 2Q6DA 1A5HA 1B7XB 1O3JA 1BBRE 2Z94A 1NO9H 1SGEE 1EJMA 1W10U 1LPGB 3RC5A 2ALPA 3LGIA 1BJUA 1MKXK 2BHGA 3S9CA 1CSOE 1SLUB 2BQ7B 2Z3DA 3M3TA 5LH8A 2F9VA 3U9AH 3M35A 4TYDA 5TJXA 2WINI 1OPHB 2BDYA 3M37A 3BSQA 1GBEA 1TALA 1O0DH 4UFFH 1L4DA 3FANA 3BG4B 5T6GA 2B5TB 1TRMA 1KTSB 1SL3A 3Q77A 4X6NA 1CBWB 1NFXA 3E6PH 2XC5A 1HV7A 1Q3XA 3QO6A 2Q6GA 1E36B 5EGMA 4U32A 3U8OH 2AGGX 2J34A 1RTLA 3A81A 4GCHG 1TNHA 4BTTB 4ZH8A 1TMBH 5FCRA 2HWLB 3D62A 1MZAA 2AIQA 3A7VA 1EPTA 1TMTH 1NM6A 3ZZ3A 2ZCLP 1UVSH 1EZQA 5JB8S 2ZHWH 4Q7XA 3RU4D 3P92A 1LO6A 5ESTE 1C5NH 4YO9A 3VB4A 2QN5T 4NIYA 4DOQA 3A7YA 3SU1A 1QY6A 1GJCB 4OS7A 1NRRH 1O2MA 1N1LA 3Q00A 1A5IA 2FXRA 1UCYK 3PLBA 1DM4B 3FP7E 1LPKB 5HYOA 2V3HH 3ZZ5A 3MU0A 2A7HA 1YLDA 3SORA 1WTHD 3LJJA 1NU7B 1AVWA 1YPHE 1DLKB 4DIHH 5F8ZA 1FAXA 3P6ZB 1BTHH 1G3EA 1GJAB 1T31A 5DP6A 3GOVB 1Y59T 5CMXH 1C1WH 1HAXB 1XX9A 3T5FH 1D9IA 1QIXB 3IG6B 2TGDA 1S0QA 3BTTE 2BD9A 1SVPA 1BIOA 1RIWC 4ABHA 3QLPH 3DUXH 3F9EA 4Q2KA 2BDGA 2SGFE 3GCOA 2H5DA 1UVOA 1WSSH 2RDLA 1ETTH 1J16A 3SU6A 3RDZA 1C1NA 1O3CA 2BM2A 3BTKE 3CENA 3LGTA 3PWBA 3BN9A 4XBDA 1HIAA 4I8GA 2G4TA 1YYY1 1C5VA 3SNDA 2G51A 1ELAA 1PPFE 2GZ7A 1GMCF 1O3FA 1QL7A 4BTIB 2W26A 4WMFA 4D9RA 3RLWH 5FXLA 3RC4A 2G55A 3CP7A 3ZV9A 5EODA 3GY5A 1DXPA 4FUDA 2XWBI 3Q3KA 2WV5A 4Y6DA 2WPMS 4K1TA 2VWOA 3RP2A 4U01A 3U1IB 3RXKA 4FUFA 3UFAA 3KL6A 5EXNA 1EJAA 3MH6A 2PGBB 2J94A 4NIWA 1AVGH 3P70B 1NS3A 1K1PA 1L1JA 1XUFA 4I31A 4IMZA 2NU4E 3KQDA 3SQEE 1F0SA 2PHBA 3STIA 5E8EH 1PQ8A 3H7TA 3HKIB 3I78A 4YLQH 1E37B 1MKWK 1CHGA 3ATLA 1VR1H 3TJUA 4MTBA 1P04A 1P3EA 1D3QB 3VB3A 2QXHA 1IQJA 3RXTA 4DCDA 1DX5M 5DPAA 2IN2A 1GI6A 1HB0B 5T3HA 1GGDC 1SSXA 1PFXC 1QURH 3LGYA 1GHXH 1N6XA 3DA9B 2CMYA 1V2OT 1HAGE 4AG1A 2P3FH 4X1NU 1EOLA 4BTUB 1TPSA 3LU9B 3FP6E 3F68H 7GCHG 1X7AC 1G36A 1PQ7A 1YPMH 1KLJH 2PFEA 5F6MA 1V2JT 3H7OA 1MBQA 1O2UA 1TPAE 3ITIA 3TIUA 1L2EA 2PKAB 3RXOA 1O2LA 3VXFH 1E0FD 4GHQA 3M3SA 2FS9A 1NESE 2BMGB 2EI8A 5JPMH 1CVWH 8GCHF 1M9UA 4AB8A 2QYIA 4H6SB 7KMEH 1QGFA 1UK2A 1QQ4A 1BCUH 4WMDA 3V13A 1ANDA 4H42U 4H6TA 1C9PA 4ABDA 1P2NA 1UTNA 1MU6B 2WPJS 4LZ1H 1W7GH 1BRCE 1TGNA 1ANBA 2J95A 3LT3A 1O3OA 1E38B 3GY6A 1FXYA 2GCHG 3CS0A 3SUGA 4X1RU 2FI4E 5HM2A 1SGYE 1VCPA 1YKTA 3PLKA 5B6OA 1KLIH 1C5SA 1GDUA 3RXJA 4XDEA 1YPGH 5EU8A 1L4ZA 2ZU3A 4JYTA 3KQCA 4A7IB 4NSYA 5DO4H 1L1NA 5LPEA 1PPZA 1GJBB 2WPLS 3B9FH 4R8TB 2GTBA 1FZZA 4HFPB 2O8MA 3TGJE 1QRXA 2VVVA 1OOKB 1SBWA 4YESB 1C2DA 4CRGA 1C1OA 1P3CA 3V3MA 2ZDMA 1EAXA 2IJOB 1NRNH 2F3CE 1ELEE 1A0HB 3RMOH 8KME2 4E7NA 1CBWC 6GCHF 1TGBA 1O31A 2BLOA 2VIOA 4YM9A 3M7QA 5K7RA 4FUJA 3SV7A 1T4UH 3TNSA 2UUJB 1K1NA 3U69H 1KIGH 5DP3A 1MCVA 2C8ZB 4MNWA 4OS4A 2BB4A 2NU2E 1O2VA 1AO5A 1K28D 1HYLA 1LHGH 2EEKA 3FZDA 3U8TH 1S83A 4D8NA 4FUEA 3NWUA 3HGPA 3R0FA 2ESTE 2D1JA 4R0IA 3RXEA 1TNJA 1XKAC 2A4OA 1D3DB 2I6QA 2ANMH 3ZZ9A 5AHGH 5EQQA 3QWCH 1Z8IB 3OSYA 1C1UH 4ZMAH 4YT6H 1HBTH 1P2MA 1XUGA 2ZECA 3SUDA 2P95A 4CR9A 3SGQE 1F0TA 2BY9X 2A5KA 4AG2A 1YPHC 4JCNA 1O30A 1AU8A 1GL0E 2J92A 2PTCE 2STAE 1P0SH 5E2PA 3SJOA 2AEIH 1VGCB 3F1SB 1EZXC 1EAIA 3PWCA 2ZFRH 4O03A 2P93A 2C4FH 4HTCH 1IQLA 1YPLH 5PTPA 2O8TA 1EQ9A 3SHAH 3T27A 4KTSA 4M7GA 4Y11E 1Z6JH 2VVCA 5C1XA 4AZ2B 5JBAS 2ZTXA 1ANEA 2QF3A 1KYNA 2VWMA 4X8TH 1C5UA 2BD4A 4ISNA 1XUKA 4X6MA 1EB2A 3LC3A 3P8NA 3GY2A 1FPCH 2JH5D 1KXFA 4KTUA 2R0LA 1QRZA 2BZAA 1DSUA 1MUEB 1BRAA 4CHAB 1G32B 2OBOA 4TY7A 1V2UT 1DWCH 2A32A 3S0NA 1GMCG 4B2CA 4LK4A 3NK8A 1TOMH 3SNBA 1O3AA 3T29A 2XCNA 4FU7A 3QX5H 1V2RT 2CF9H 1V3XA 1BDAA 4FU8A 1FN8A 1GI1A 4RKOB 1LQDB 1MH0A 4BANB 4TY6A 3EA7A 3SBKA 3ATKA 5E2OA 1ZPZA 2G4UA 1EPTB 1FIWA 1YPKH 1ZJKA 3VB5A 3UNRA 2JH0D 2GZ8A 1JIMA 1YGCH 4I8JA 1BTXA 2M5TA 3IWMA 3SI3H 1B0FA 2RA0A 2C8WB 3VB6A 5DGJA 3BF6H 4DT7B 1BMAA 1O3PB 1IQNA 3MOCA 1V2WT 1GJ4H 1TFXA 1C2JA 1UMAH 3KCGH 1TNLA 1SC8U 3GDVA 3A89A 1ELDE 1BMMH 2VNTA 4JZDH 3MU8A 1C2MA 2AIPA 1B0EA 1GMDF 4ISHH 2V3OH 3OU0A 3RXGA 1A0JA 3O8RA 1JMOH 1FMGA 2XTTB 2CV3A 4D7GA 6CHAB 1SGRE 1WQSA 4B73A 3QK1A 3A8BA 3P17H 3K6YA 4WH8A 1WBGB 1QFKH 4AFZA 2VIWA 1RGQA 3OY5U 1TYNA 2VIDA 1RXPA 5EW2H 4CBOA 3TH4H 2NU0E 1GI5A 3ESTA 2Z9IA 1GJ9B 1U6QA 3L3TA 4ABIA 1HAZB 2VIQA 8LPRA 3B8JA 3K65B 3E0PB 4O3TA 1GCDA 2ODPA 3UWIA 1C1RA 4J2YB 8GCHG 1HIAB 4GPGA 4PROA 2VH6A 1MTUA 5C5NA 1TRNA 1S81A 1ABIH 3A7WA 3A7TA 1SGTA 1TPPA 5L2YH 1IHSH 2JKHA 2XRCA 1W7XH 1B5GH 2OC8A 1RTKA 2BY8X 1UCYE 4OGYA 2ZFQH 4RSPA 1UVPA 5C5OA 2FOFA 3P8OA 2EC9H 2A31A 1ELTA 4O9VA 2PKSB 4OS2A 3OY6U 4FVBA 4DG4A 2G5NA 3SV2H 4CRAA 2Z9KA 1BHXB 2EI6A 5HM9A 1YM0A 1PPCE 2R2MB 1G2MA 2WPKS 5E0JA 1BTWA 1NRSH 1OWDA 4GAWA 1C2FA 1H1BA 2BY7X 5IYTA 2P16A 1DICA 2F9UA 3ENSB 2WV4A 1LHDH 2BD3A 3A86A 2ZTZA 1WUNH 6GCHG 3ZZ6A 2PV9B 2ZHFH 2J9NA 1FV9A 1VCWA 1YPJH 5DKMA 1ZZZA 3ATIA 4GHTA 2BX3A 2LIZA 4K8YA 4X1QU 1J17T 4HZHA 1O2HA 3TK5A 1MMJN 3GY4A 3RXAA 3BTQE 1C1VH 2STBE 3JZ2B 1O5EH 1GI7B 2GCTB 1A5GH 3ZZ8A 1LVBA 4X2YA 1AUTC 1ZSLA 3UNSA 2GP9B 1Z8JB 3MNBA 3LDXH 4ZAEA 1KXEA 1TQ7B 2HPPH 3U1JB 1S6FA 3FP8E 1ZSKA 2ZCKP 3LIWA 3M7TA 1OWKA 2C3SA 2Y5GA 4JYVH 1Y5AT 4UE7H 1FY4A 1YBWA 3KN2A 1TGCA 4I8HA 2BTCE 1P9UA 3ATMA 1W14U 1QA0A 1NT1A 1SR5C 3AAUA 4BXWA 2W7SA 4BAHB 1HPGA 3LGUA 1OP2A 1O5CB 1TOCB 3EQ0H 4MPWA 4NCYA 1LHCH 1JRTA 1O3LA 1P12E 1MU8B 2FOEA 3HKJB 4I8LA 4DIIH 1FNIA 2XC0A 1ZR0A 1IQHA 3M3VA 1CA0C 1YF4A 5DP4A 4SGAE 3SGBE 1IQFA 1O3HA 5BPEA 1WV7H 1MTVA 2DUCA 1LHFH 1DLEA 2VJ1A 3E90B 2F9BH 4U2WA 1QHRB 3P8FA 3ZYEA 2IPHA 4JZFH 5A0BA 1O36A 1T8NA 4YT7H 1BTZA 3GDUA 6ESTA 2FTMA 1P9SA 2ANYA 4X8UH 2Q6FA 1W0ZU 1AWFH 1GHVH 3TVJB 2DE9A 1PYTC 2BYAX 4K69A 3I77A 4CH2B 2VIVA 2OCVB 3RXCA 1KY9A 2RCEA 2GZ9A 2ASUB 2BDIA 1EPTC 3C1KA 1O2SA 1QJ1B 1KXBA 1BTPA 2WUCA 3KF2A 2OP9A 4Y71A 2WUBA 2XXLA 3RLYH 1AWHB 2ZO3H 3V12A 3TPIZ 1W8BH 2LNCA 3SU2A 1SMFE 1BA8B 4GSOA 1Y3VA 3TU7H 4KKDA 5EQRA 2AGIX 1KDQA 1P09A 1MD7A 1UJ1A 1HAIH 1K9OE 1J14A 3RXHA 1HNEE 1CGJE 1O2JA 3BTDE 1S82A 1Z8GA 1KLTA 3M61U 3UTUH 2XNIA 1ZTJA 1HJAB 1OKXA 1ACBE 3MHWU 4Q80A 3V7TA 3BIVH 4WWYA 1EP6A 1OP0A 1TA2A 4THNH 2TGAA 2HNTE 2BLWA 1Q2WA 1THSH 3SU3A 1GMDG 2A4RA 5E0GA 1QQUA 6CHAC 3VB7A 1GBMA 4J1YA 2ZPQA 5L30H 1DWBH 2FWWA 3LJOA 3GY7A 1HJ8A 1GBBA 3E91A 1E35B 4NWKA 2ANWA 1O2PA 5CHAB 1O3MA 2Y7XA 1FY3A 1UO6A 2ZPSA 1O5DH 1O2WA 2BOHB 1CT0E 1ZRKA 1Z6EA 3BTFE 4E7RG 4UFDH 1Z1IA 3ZVFA 4TWYA 4FUIA 1C5ZB 2BXUH 3E0NB 3PYHA 3HATH 3TLOA 1TBZH 1MTSA 2DE8A 3U8RH 1MKXH 5F03A 1WQVH 1C5YB 1O2ZA 1ESAA 1GBAA 4ZHAA 3RMNH 3ZVCA 3RXMA 3NCLA 3S7KB 4K8BA 3TNTA 2D8WA 1JOUB 3QGNB 5J4QA 2J4IA 2OC0A 3BEIB 4IS5A 2C8XB 2PKSC 3GCTF 1GG6C 3GICB 2UWOA 3RMLH 2BXTH 4IN2A 4AYYB 4AFSA 3LC5A 1GDQA 1RTFB 1G2LA 1GBLA 5EXMA 1O3GA 1Y3YA 1Y5BT 4LXBH 2ZGCA 2FOHA 1GPZA 3Q3YA 1HRTH 1SG8B 5C3NA 3GISB 3JZ1B 5DK1A 1AKSA 4K5ZA 3UR9A 1IQMA 1SLVB 3AW0A 1LVYA 5HGGA 1F0RA 4ABAA 2AMPA 1DUAA 1SGIB 4JK5A 2ZKSA 4SGBE 4HGCA 2XBVA 1G9IE 2A5AA 5IDKA 5FCKA 2V6NA 1S84A 3E16B 3RXUA 2A2QH 5EOKA 1UCYH 2GV7A 1OWEA 2F9NA 2BDCA 1GJ7B 1GI4A 1P11E 2SGEE 3KQBA 1Y3XA 1V2PT 5K0HA 1C5QA 3MH7A 1NRPH 1TE0A 2AMDA 5TCAA 4K1EA 1BMLA 3TGIE 2W7UA 2ZFSA 3EYDA 4ZXXH 1F0UA 1T8LA 3UQVA 3GY3A 4I7YH 1H8IH 1GBJA 4F49A 1UHBA 2QXIA 1PQAA 1GHZA 1QBOA 1YCPK 1TIOA 2CXVA 4UFEH 2NWNA 4U30A 4UD9H 3Q3XA 3PM3A 4JZIA 4DW2U 1O5FH 3UREA 3SUEA 3MNXA 1C2KA 2EA3A 2ZDVH 1SQTA 5AFZH 2XW9A 2TGPZ 2ZG0H 3UWJH 3DD2H 4CR5A 3HPTB 2H2ZA 5GWZA 3MWIU 1MAYA 2WPIS 1H8DH 3UIRA 4XBBA 1H4WA 3T26A 1SGFG 3A87A 1G3BA 3IITA 1AFQB 3SO3A 1SGCA 1TX7A 2K1QA 1EXFA 1Z8RA 3BG4C 1LQEA 4XE4A 1BJVA 3TK9A 3OX7U 3MU4A 1SHYA 2HVXA 3TITA 2GD4B 1KXDA 1TPOA 4NA7A 2ODQA 4F4OC 1O2YA 2ZU4A 4RKJB 1D6RA 4DGJA 4X2XA 2SFAA 2VWNA 2TRMA 5JBCS 1THPB 1XUIA 4NZLA 4OGXA 1NC6A 5L2ZH 2WYJA 1TX6A 5DG6A 3SNCA 1EATA 2ULLA 2SGAA 2GV6A 5EPYA 1A0LA 1O3NA 2A4QA 3PLPA 1D4PB 1DFPA 1MKWH 2ZHDA 1TB6H 1SQAA 1ZLRA 5A8XA 2OBQA 3KHVA 4KGAA 1G3DA 1FJSA 2BVRH 5HXFA 1RFNA 1UTMA 1OX1A 3RU4T 1CO7E 3D49H 4BAMB 3UR6A 1YP9A 4MVNA 2H1UA 2TIOA 1O38A 2FYRA 1ZTKA 5FPYA 5LPFA 1O2XA 1QL9A 1FDPA 1NU9A 4FU9A 2A7CA 2ZFTA 5EW1H 2BY5X 3A88A 2BD2A 1CT2E 1EASA 1THRH 5AVDA 1JWTA 5AFYH 1H9LB 4JMYA 4Z0KA 4UFGH 1FPHH 1SB1H 1WOFA 1UTKA 1FY8E 1DUEA 1ESTA 3GCHB 1AZZA 1HJAC 4CRCA 1GCTB 2HNTC 2OQUA 3K6ZA 4NZQA 3W95A 3MMGA 5EPNA 4WMEA 3LGVA 3S9BA 1SGPE 3A85A 2H9TH 1AHTH 2QXGA 3UUZA 1TA6A 5HMAA 4FUCA 5A09A 2PGQB 1DT2A 3A84A 4MPUA 1TNKA 1L0ZA 4NA9H 1GWAA 2ZDLA 4Y8XA 3K2UA 4BAQB 2FODA 2JETB 2SGPE 2D2DA 1AFEH 3UPEA 1LDTT 2BY6X 1ZTLA 1BOQA 1IAUA 1ZRBA 4AGJA 1IQKA 2I6SA 1BMNH 3RMMH 1C2IA 2AS9A 3MNCA 1GL1A 3GYMA 1SHHB 2FOMB 1O33A 4VGCB 5DP5A 1OS8A 5I46H 1VJ9U 1TNGA 2G8TA 2QC2A 2Z9LA 4X1SU 4CRBA 2R3YA 4IBLH 4A5TS 1KXCA 4ABEA 3LPRA 3MO9A 1EOJA 2AFQB 2FESH 1C1SA 2GGVB 2P59A 1K1OA 1V2LT 2ZDNA 4WJG2 3FVFB 3SZNA 2KAIB 5ABWA 1V6DA 2XCFA 2VWLA 3GCTG 2YNAA 1RD3B 3AASA 4YZUA 2FOAA 1W13U 4TWWA 1DVAH 2R2WU 1P06A 1NPMA 1TBQH 2FOBA 3QZQA 1XVOA 3VGCB 2QV1A 7LPRA 3TGKE 4LZ4B 4MLFB 1NFYA 4I32A 5JBBS 4O3UA 1Y5UT 1GBCA 1KDQB 1Y3WA 3UNQA 2CHAB 2HGTH 3SU4A 3MTYA 1NTPA 3MO3A 3PO1B 2O8WA 2UWLA 8ESTE 2G81E 3PV4A 2NU3E 2FTLE 3M5MA 4Y7BA 1QTFA 1XMNB 2QCYA 3QTVH 1GJ5H 2OTVA 2ZHEH 5A8ZA 1LPZB 4FUGA 4ISLA 1GHWH 2ZWLH 1CHOF 3ZZDA 5E0HA 4ZHLU 2FEQH 1C2LA 1FN6A 1G37A 2HPQH 5FPSA 1ZJDA 3BTGE 1C5RA 1AB9B 1G30B 5ESBA 1A1RA 3RXVA 5JB9S 1TGSZ 3EGKH 1MCTA 1QB1A 1K1MA 4B71A 3SJ9A 2ZI2H 1QNJA 1HXFH 1HFDA 1O34A 4KP0A 1GI0A 2XBYA 2GVFA 2BDAA 4AB9A 1V2TT 4CBNA 4D9QA 2BQWB 4MDSA 4X8SH 4ZROA 1O3KA 1ZSJA
chains in the Genus database with same CATH superfamily
3A7XA 2A2XH 2GJGA 3CS7A 1DANH 1BHXF 3LKWA 2C93B 2FI3E 2SNWA 2YMSB 3RXSA 5T6FA 1OSSA 4FOUC 1AFQC 2V0BA 1YLNA 2FX4A 4RT0A 5F8XA 3TK6A 4A1VA 1ETRH 2ZFPH 4ISOA 2A1DB 1V2KT 4Y0ZE 2HOBA 4IN1A 4ZXYH 2FI5E 4CRFA 2TPIZ 4AGKA 3ZZCA 2VB0A 2ZGHA 1IQIA 1ESBA 5DN6D 4ZUHA 3EAJA 2PSYA 2WPHS 2ZFFH 4Y79A 2P3UB 2Y82A 5LGOA 3A8DA 1QA7A 5JBTA 1UTPA 1RJXB 5C2ZA 1AKSB 4DT4A 1O2IA 3GDSA 1O37A 1VJAU 3NKKA 1GI2A 2ZC9H 2VGCB 1MTWA 3ZZBA 1ELBA 4AYVB 3UB0A 5CE1A 5JDUB 2FO9A 3SV9A 3LGWA 1ZMLA 3O8DA 3ZVAA 1TWXB 4ABBA 3F0PA 4YXWD 3KIDU 4BXSA 2FZZA 4OS1A 3MH5A 3MO6A 1UTJA 1DDJA 1YLCA 1C5MD 1LKAA 1T8OA 4XOJA 3SI4H 1NY22 1O2KA 4DVAU 3VPKA 3NZIA 3PV5A 3PRBA 1TGTA 2B7DH 3E3TA 1HAPH 1GHAF 1QB6A 5GIBA 1ABJH 5C0UA 1GBFA 1LCYA 3QTOH 1VGCC 1UHBB 3EA9A 3GCHC 1EX3A 4UDWH 1FY5A 1GCTC 4XRNA 2CGAA 1N8OB 4X2VA 1QB9A 3S9AA 1VITH 4FVDA 4NA8A 4WY3A 1ZYOA 2ZCHP 3AK5A 4YOIA 1T32A 2VU8E 5KEDA 1ID5H 1CGHA 3MI4A 4BOHA 1IHTH 4DY7B 2ZQ2A 2TGTA 1OXGA 2SGQE 2HRVA 3A82A 5DP9A 1ZMNA 1TABE 4INKA 1AVXA 3F2GA 1FIZA 1A2CH 1KSNA 1C2EA 4Z6AH 2JETC 2GMTB 3MFJA 2GDEH 1NROH 4X6OA 2XYAA 2GKVE 5J4SA 3T25A 1BRBE 4MNXA 1ARCA 1GVKB 3ZVBA 4IGDA 2WHXA 3V0XA 1HAYB 1F7ZA 1GJDB 4CHAC 1OP8A 5A0AE 2BLQA 3SNEA 2Z7FE 4BAOB 1O2QA 2J2UA 1GVLA 4VGCC 1Z7KA 1V2NT 2FP7B 1JIRA 3PMBB 1UK3A 4IC6A 2J98A 1DE7H 1LVMA 1A4WH 2PSXA 4IMQA 3UOPA 2Z3EA 3VG8A 1O3IA 5GCHF 2ZA5A 1C1TA 1ZHMA 2KAIA 2F9PA 1P2IA 1AN1E 2FLBH 1S0RA 2W5EA 3L33A 1V2VT 1PPGE 2FPZA 1FONA 2AYWA 3QN7A 4TPYA 4XBCA 1WAYB 3M5OA 3UQOA 3S7HB 2YMSD 3EDXB 3UOUA 1C1MA 3MYWA 1P2QA 2QA9E 4AFUA 3A8CA 1LTOA 3OFND 1VZQH 3CNRA 3L6PA 3EBNA 4AORA 5FAHA 4AN7A 2PLXA 3DSGA 1DSTA 1MQ6A 1CA8B 4WVPE 2HNTF 3VGCC 4MNYA 5A0CA 4GLYA 2PW8H 3A83A 1D6WA 4KTCA 3SJIA 1P03A 2F91A 1FI8A 3PV2A 4ZHMU 2K7XA 2LELA 1FQ3A 2OUAA 3RXPA 1O39A 2CHAC 1NN6A 3PTNA 2V7QD 3HK6B 3PO1C 4X8VH 3RXLA 2KCPA 3A7ZA 2PUQH 1OWIA 5JYIA 4A1XA 4GUXA 1MQ5A 1QJ6B 1JRSA 3MU5A 2AHME 4DURA 2NU1E 3RXQA 1EUFA 4Q7YA 1V2ST 1HGTH 2B0FA 1ZGIA 2XWAA 1LVOA 1K1IA 1P57B 1C5TA 1AE8H 2XC4A 3UY9A 4Y0YE 1AB9C 4O97A 1CHOG 1CT4E 3URDA 1XM1A 1FAKH 1XVMA 4INHA 4YLUA 1WDIA 2XBXA 3W1EA 1GJ8B 1AQ7A 4A6LA 1ZPCA 1SOZA 1SOTA 2H9HA 1NBMD 2BLVA 1YPEH 4H4FA 4RI0A 1E34B 5DP8A 4ACBA 1SLXB 3N7OA 2FLRH 5G4BA 3RM2H 1C5PA 1F5RA 2BD5A 2WZQA 1SGNE 1P02A 2ZDKA 4ZKRU 4HI3A 2ZP0H 4K60A 1AE5A 3P95A 2W3IA 4LOYH 5F53A 3RC6A 6LPRA 3S69A 1QZ8A 3SUFA 3SU0A 1OYQA 3A8AA 1SKYE 2R9PA 4NSVA 3FN8A 1BITA 1HAHH 2OC1A 4F55A 1IOEA 3ZV8A 1CU1A 4OS5A 2OD3B 1MBMA 4D7FA 2Y7ZA 1MZDA 5GPIB 2BX4A 3KQEA 2B9LA 1V2QT 2KR7A 1DY8A 1PPBH 1QBNA 1F5LA 1WYKA 2UUFB 3NPSA 1MTNB 4DJZB 2ZF0H 1WCZA 3F9GA 1BBRK 4D76A 5BRRE 1GI3A 3G01A 1OWHA 2ILNA 1DPOA 2P3TB 1EAWA 5L6NH 3SJKA 5T6DA 3RUOA 1O2OA 1ZPBA 1DWEH 2O8UA 1YC0A 2BZ6H 2XBWA 1AD8H 1J8AA 2BVSH 2L6OA 2D26C 4MPXA 5FPTA 3RXRA 2OC7A 2THFB 2K0QA 2VGCC 4WF8A 1SGDE 2Q1JA 1P2JA 1XUJA 3H5CB 1HCGA 2A5IA 5C1YA 1DWDH 1Y8TA 1J15A 2ANKH 1D3TB 1GI9B 1W11U 2G5VA 2QY0B 1XXDA 1QBVH 1P2OA 4FUHA 4X2WA 1EB1H 4MG3A 1TQ0B 4INLA 2BDBA 4ZKOU 2GCTC 2QIQA 1ELVA 1SPJA 3A80A 1QRWA 4AFQA 3AVZA 4E05H 1CQQA 2FMJA 2EI7A 1TMUH 4X1PU 5TCCA 1PPEE 3DFLA 1UTOA 1Z1JA 1UTLM 2P8OB 2VIPA 1S85A 1H9HE 2BDHA 1GHAG 1HJ9A 1UK4A 1RS0A 2ZHQH 2FOCA 1MAXA 3HGNA 3LONA 4XSKU 1TX8A 1N8OC 2BD8A 2ZU1A 2GT8A 3OEHD 5H4IB 1AZ8A 3QZRA 3TH3H 5C20A 2R3UA 1C4U2 3DSPA 3ODFA 3U98H 3F9HA 1P10A 5GDSH 3SU5A 1GBDA 4B1TA 3VEQB 1HAVB 2ZU5A 1Q31A 2EY4C 3MNSA 1IQEA 5GNDA 5CDFE 1AGJA 1SLWB 2ALVA 1SI5H 2Z9GA 4ISIH 5I25A 4JK6A 1ELFA 2GMTC 1SGFA 2P94A 5KECA 1VITF 5EG4A 4I33A 1O5BB 4Y8ZA 4YOGA 1QL8A 1O3DA 1KTTB 1O5AB 3SNAA 1H8ED 3PROA 4NGAH 2UWPA 4AOQA 2A4GA 2CJIA 1QCPA 4WXIA 2F9OA 4ABGA 3BTHE 1AI8H 5ETXA 2SNVA 9ESTA 3AW1A 1ZMJA 1HDTH 3MH4A 3O8CA 2Y5HA 2GT7A 1WTGH 1HUTH 1ZHPA 1EJNA 1C9TA 1OWJA 1UTQA 3OYPA 1UVTH 4X0WU 1BZXE 1O2TA 4ABFA 2ZGBH 4ASHA 1A3BH 1JXPA 2UUYA 2FOGA 5GCHG 1BTYA 5FBIA 1ELGA 2V35A 4WXVA 1NRQH 4FUBA 1CGIE 4B2AA 2PWXA 5HKKD 3FO8D 3U28C 1GMHF 1XUHA 2BOKA 3QGJA 1GVZA 1HAOH 2Z3CA 2A0QB 4A92A 4NIVA 1BUIA 4E06H 3DCLA 3P8GA 1NZQH 1BBRH 1VCQA 1C5XB 2F83A 4IC5A 4OS6A 4JZ1A 2G00A 3FZZA 4ABJA 4NFEA 1GHBF 5FHTA 1GDNA 2ZPRA 1EKBB 3O8BA 1DS2E 3TJNA 3BTME 1Y3UA 1GHYH 2ZTYA 3E1XB 3SW2B 3VFEA 2ZZUH 1JBUH 1ETSH 1TNIA 3GY8A 2GDDA 1IQGA 1YCPM 1TONA 2AERH 4NFFA 4BNRA 3GCNA 1C4Y2 2CN0H 5EJLA 1A7SA 4K2YA 2FS8A 4XD7D 3W94A 3T62A 1A61H 3D65E 3ELAH 1O2NA 7ESTE 1C2HA 1WU1A 4ZKSU 5F8TA 1UVUH 1P01A 2FDAA 1C1PA 1EZSC 1J9CH 3TH2H 3FFGA 3KYGA 3F3BA 1N6YA 1DY9A 1HLTH 1PPHE 4B74A 2ZGJA 5CHAC 3ZVGA 3BTWE 2H6MA 1YCPH 4BAKB 1P05A 2Y6TA 4IW4E 2YNBA 4MPVA 3KEEA 3KNXA 3ZZ7A 1BB0B 1BQYA 3SHCH 2SGDE 1CA0B 2C8YB 2OXSA 2GX4A 2BD7A 2ZGXH 3RXFA 1C1QA 1QJ7B 2PUXB 1W2KH 2JH6D 2OINA 3QDZB 2JJ1D 1P8VC 3WY8A 3PMHB 3SGAE 2O9QA 1SFIA 4UONA 2ZEBA 4GCHF 1K1JA 4CRDA 4Y7AA 4F48B 3BIUH 5C67A 1ARBA 2QAAA 2W3KA 4KELA 3MU1A 3T28A 4B76A 2FYQA 4FXGH 1CE5A 5FX5A 1GBIA 1EP5A 3OAAD 4MNVA 2WYGA 3EE0B 3BTEE 1ORFA 4K1SA 3B23B 3LH3A 4QT8C 2W6ID 3VXEH 1D3PB 3M5NA 3M7UA 4XFQA 2OLGA 2LPRA 2OQ5A 1RRKA 4ESTE 2VH0A 4ZKNU 1F92A 3TJVA 1SQOA 5C1UA 1BRUP 3R3GB 2QGRA 1E79D 3PTBA 4AX9H 1MTNC 3M36A 1TAWA 2AH4X 3F6UH 4NG9H 3ZZAA 1T4VH 3LH1A 1PQ5A 3PMAB 4MQAA 2PTNA 4NWLA 2J97A 4JZEH 1BT7A 3URCA 2Y5FA 1C2GA 5DP7A 5KGOA 3C27B 5LPRA 3NUMA 1NFWA 1O5GH 2CF8H 3STJA 2Y81A 2C90B 1TRYA 4A1TA 2A45B 1SQRA 1EAUA 3SQHE 1C5WB 1LKBA 1RIWB 1L1GA 2PKAA 1AY6H 1FLEE 3ATWA 1Z71A 2HALA 3ODDA 5GJ4B 4UEHH 3EA8A 1H9IE 2RG3A 1E1QD 1ZOMA 3KGPA 4WH6A 2O8LA 1O3EA 2G52A 1AIXH 4RT1A 4RN6A 3NXPA 3HK3B 4X6PA 1GJ6A 3SJ8A 2J38A 1K21H 2J5UA 3T2NA 2P8OC 2IOTA 3D23A 5FX6A 1EZUC 1DOJA 1FY1A 1GI8B 5DJ7A 3I29A 1G3CA 2H9EH 3BEFB 1S6HA 2VINA 1HAVA 1NFUA 4Q7ZA 2Z6BD 2RA3A 5AF9H 2Z9JA 4CH8B 4B75A 1DITH 1W3CA 1XKBC 1KXAA 1S6LA 2BQ6B 3PMJA 1F5KU 2BVXH 1AMHA 1TLDA 3DHKH 1XXFA 2ZNKH 2PR3A 3RU4E 3RXBA 4TPIZ 3ZVDA 3ZYDA 1O2GH 5C17A 3RM0H 1O3BA 2FIRH 4Y76A 2CK3D 3M5LA 2H5CA 1GG6B 5B6LA 1VITG 1GBTA 1A3EH 1K2I1 4CREA 4NIXA 1GBHA 1FUJA 1TBRH 5DSFA 1A46H 4JYUH 2AMQA 2ODYB 2FM2A 3SOSA 5A2MH 3ZZ4A 5SGAE 3OTJE 1S5SA 2YOLA 3BG8A 2QXJA 3AAVA 3PB1E 1ZHRA 1H8HD 1W0YH 3WWBA 1K1LA 1OYTH 4I8KA 2Y80A 1PJPA 2ZIQH 1GGDB 3SV6A 2UUKB 1QR3E 1ANCA 1O2RA 1AUJA 1LMWB 2FX6A 3QUMP 5EQSA 7GCHF 5EXLA 1BTUA 3Q76A 2AGEX 4ASUD 3E8LA 1W12U 3EE7A 1SFQB 5FBEA 3DFJA 5A8YA 1T7CA 1C4V2 2QF0A 3SV8A 4Y8YA 1INCA 4YOJA 1SGQE 3LOXA 1PYTD 1GMHG 3BEUA 3F9FA 1C5LH 4YTAA 1P2KA 2ZQ1A 1ZGVA 1V2MT 2R0KA 2TBSA 3K9XB 1HXEH 2HLCA 1T8MA 1W0JD 3RXDA 1C5OH 2ZU2A 1DXWA 1NBME 1GHBG 4K3JA 3SN8A 4GVUA 1O35A 1LHEH 3RXIA 2B8OH 5GXPA 3FAOA 1GBKA 4Y10E 2ZDAH 1K22H 3DT0H 1MD8A 2GCHF 4B2BA 1O32A 1F2SE 2A7JA 3GYLB 2VVUA 9LPRA 3BV9B 1ELCA 3TJOA 3ZVEA 2Q6DA 1A5HA 1B7XB 1O3JA 1BBRE 2Z94A 1NO9H 1SGEE 1EJMA 1W10U 1LPGB 3RC5A 2IJD1 2ALPA 3LGIA 1BJUA 1MKXK 2BHGA 3S9CA 1CSOE 1SLUB 2BQ7B 2Z3DA 3M3TA 5LH8A 2F9VA 3U9AH 2K8IA 3M35A 4TYDA 5TJXA 2WINI 1OPHB 2BDYA 3M37A 3BSQA 1GBEA 1TALA 1O0DH 4UFFH 1L4DA 3FANA 3BG4B 4OM9A 5T6GA 2B5TB 1TRMA 5HIYA 1KTSB 1SL3A 3Q77A 4X6NA 1CBWB 1NFXA 3E6PH 2XC5A 1HV7A 1Q3XA 3QO6A 2Q6GA 1E36B 5EGMA 3PRDA 4U32A 3U8OH 2AGGX 2J34A 1RTLA 3WWFA 3A81A 4GCHG 1TNHA 4BTTB 4ZH8A 1TMBH 5FCRA 2HWLB 3D62A 1MZAA 2AIQA 3A7VA 1EPTA 1TMTH 1NM6A 3ZZ3A 2ZCLP 1UVSH 1EZQA 5JB8S 2ZHWH 4Q7XA 3RU4D 3P92A 1LO6A 5ESTE 1C5NH 4YO9A 3VB4A 2QN5T 4NIYA 4DOQA 3A7YA 3SU1A 1QY6A 1GJCB 4OS7A 1NRRH 2QE7D 1O2MA 1N1LA 3SZEA 3Q00A 2M2AA 1A5IA 2FXRA 1UCYK 3PLBA 1DM4B 3FP7E 1LPKB 5HYOA 2V3HH 3ZZ5A 3MU0A 1MABB 2A7HA 1YLDA 3SORA 1WTHD 3LJJA 1NU7B 1AVWA 1YPHE 1DLKB 4DIHH 5F8ZA 1FAXA 3P6ZB 1BTHH 1G3EA 1GJAB 1T31A 5DP6A 3GOVB 1Y59T 5CMXH 1C1WH 1HAXB 2KFWA 1XX9A 3T5FH 1D9IA 1QIXB 3IG6B 2TGDA 1S0QA 3BTTE 2BD9A 1SVPA 1BIOA 1RIWC 4ABHA 3QLPH 3DUXH 3F9EA 4Q2KA 2BDGA 2SGFE 3GCOA 2H5DA 1UVOA 1WSSH 2KCOA 2RDLA 1ETTH 1J16A 3SU6A 3RDZA 1C1NA 1O3CA 2BM2A 3BTKE 3CENA 3LGTA 3PWBA 3BN9A 4XBDA 1HIAA 4I8GA 2G4TA 1YYY1 1C5VA 3SNDA 2G51A 1ELAA 1PPFE 2GZ7A 1GMCF 1O3FA 1QL7A 2JJ2D 4BTIB 2W26A 4WMFA 4D9RA 3RLWH 5FXLA 3RC4A 2G55A 3CP7A 3ZV9A 5EODA 3GY5A 1DXPA 4FUDA 2XWBI 3Q3KA 2WV5A 4Y6DA 2WPMS 4K1TA 2VWOA 3RP2A 4U01A 2YMSC 3U1IB 3RXKA 4FUFA 3UFAA 3KL6A 5EXNA 1EJAA 3MH6A 2PGBB 2J94A 4NIWA 1AVGH 3P70B 1NS3A 1K1PA 1L1JA 1XUFA 4I31A 4IMZA 2NU4E 3KQDA 2RDEA 3SQEE 1F0SA 2PHBA 3STIA 5E8EH 1PQ8A 3H7TA 3HKIB 3I78A 4YLQH 1E37B 1MKWK 4AC9A 1CHGA 3ATLA 1VR1H 3TJUA 4MTBA 1P04A 1P3EA 1D3QB 3VB3A 2QXHA 1IQJA 3RXTA 4DCDA 1DX5M 5DPAA 2IN2A 1GI6A 1HB0B 5T3HA 1GGDC 1SSXA 1PFXC 1QURH 3LGYA 1GHXH 1N6XA 3DA9B 2CMYA 1V2OT 1HAGE 4AG1A 2P3FH 4X1NU 1EOLA 4BTUB 1TPSA 3LU9B 3FP6E 3F68H 7GCHG 1X7AC 1G36A 1PQ7A 1YPMH 1KLJH 2PFEA 5F6MA 1V2JT 3H7OA 1MBQA 1O2UA 1TPAE 3ITIA 3TIUA 1L2EA 2PKAB 3RXOA 1O2LA 3UAIC 1E0FD 3VXFH 4GHQA 3M3SA 2FS9A 1NESE 2BMGB 2EI8A 5JPMH 1CVWH 8GCHF 1M9UA 4AB8A 2QYIA 4H6SB 7KMEH 1QGFA 1UK2A 1QQ4A 1BCUH 2W6JD 4WMDA 3V13A 1ANDA 4H42U 4H6TA 1C9PA 4ABDA 1P2NA 1UTNA 1MU6B 2WPJS 4LZ1H 1W7GH 1BRCE 1TGNA 1ANBA 2J95A 3LT3A 5C94A 1O3OA 1E38B 3GY6A 1FXYA 2GCHG 2KM0A 3CS0A 3SUGA 4X1RU 2FI4E 5HM2A 1SGYE 1VCPA 2HLDD 1YKTA 3PLKA 5B6OA 1KLIH 1C5SA 1GDUA 3RXJA 4XDEA 1YPGH 5EU8A 1L4ZA 2ZU3A 4JYTA 3KQCA 4A7IB 4NSYA 5DO4H 1L1NA 5LPEA 1PPZA 1GJBB 2WPLS 3B9FH 4R8TB 2GTBA 4M9FA 1FZZA 4HFPB 2O8MA 3TGJE 1QRXA 2VVVA 1OOKB 1SBWA 4YESB 1C2DA 4CRGA 1C1OA 1P3CA 2WV9A 3V3MA 2ZDMA 1EAXA 2IJOB 5C0TA 1NRNH 2F3CE 1ELEE 1A0HB 3RMOH 8KME2 4E7NA 1CBWC 6GCHF 1TGBA 1O31A 2BLOA 2VIOA 2WPDD 4YM9A 3M7QA 5K7RA 4FUJA 3SV7A 1T4UH 3TNSA 2UUJB 4TT3D 1K1NA 3U69H 1KIGH 5DP3A 1MCVA 2C8ZB 4MNWA 4OS4A 2BB4A 2NU2E 1O2VA 1AO5A 1K28D 1HYLA 1LHGH 2EEKA 3FZDA 3U8TH 3WW7A 1S83A 4D8NA 4FUEA 3NWUA 3HGPA 3R0FA 2ESTE 2D1JA 4R0IA 3RXEA 1TNJA 1XKAC 3FOAA 2A4OA 4B6FA 1D3DB 2I6QA 2ANMH 3ZZ9A 5AHGH 5EQQA 2F43B 3QWCH 1Z8IB 3OSYA 1C1UH 4ZMAH 4YT6H 1HBTH 1P2MA 1XUGA 2ZECA 3SUDA 2P95A 4CR9A 3SGQE 1F0TA 2BY9X 2A5KA 4AG2A 1YPHC 4JCNA 1O30A 1AU8A 1GL0E 2J92A 2PTCE 2STAE 1P0SH 5E2PA 3SJOA 2AEIH 1VGCB 5EJZA 3F1SB 2HVYB 1EZXC 1EAIA 3PWCA 2ZFRH 4O03A 2P93A 2C4FH 4HTCH 1IQLA 1YPLH 5PTPA 2O8TA 1BMFD 1EQ9A 3SHAH 3T27A 4KTSA 4ACAA 2JIZD 4M7GA 4Y11E 1Z6JH 2VVCA 5C1XA 3GS9A 4AZ2B 2JDID 5JBAS 2ZTXA 4Q4LA 1ANEA 2QF3A 1KYNA 2VWMA 4X8TH 1C5UA 2XOKD 2BD4A 4ISNA 1XUKA 4X6MA 1EB2A 3LC3A 1K0HA 3P8NA 3GY2A 1FPCH 2JH5D 1KXFA 4KTUA 2R0LA 1QRZA 2BZAA 1DSUA 1MUEB 1BRAA 4CHAB 1G32B 2OBOA 4TY7A 1V2UT 1DWCH 2A32A 3S0NA 1GMCG 4B2CA 4LK4A 3NK8A 1TOMH 3SNBA 1O3AA 3T29A 2XCNA 3F2HA 4FU7A 3QX5H 1V2RT 2CF9H 1V3XA 1BDAA 4FU8A 1FN8A 1GI1A 4RKOB 1LQDB 1MH0A 4BANB 4TY6A 3EA7A 3SBKA 3ATKA 5E2OA 1ZPZA 1EPTB 1FIWA 1YPKH 2G4UA 1ZJKA 3VB5A 3OTPA 3UNRA 2JH0D 2GZ8A 1JIMA 1YGCH 4I8JA 1BTXA 2M5TA 3IWMA 1VKYA 2IPQX 3SI3H 1B0FA 2RA0A 2C8WB 3VB6A 3F2FA 5DGJA 3BF6H 4DT7B 3OEED 1W0KD 1BMAA 1O3PB 1IQNA 3MOCA 1V2WT 1GJ4H 1TFXA 1C2JA 1UMAH 3KCGH 1TNLA 1SC8U 3GDVA 3A89A 1ELDE 1BMMH 2VNTA 4JZDH 3MU8A 1C2MA 2AIPA 1B0EA 1GMDF 4ISHH 2V3OH 3OU0A 3RXGA 1A0JA 3O8RA 1JMOH 5T1VA 1FMGA 2XTTB 2CV3A 4D7GA 6CHAB 1SGRE 1WQSA 4B73A 3QK1A 3A8BA 3P17H 3K6YA 4WH8A 1WBGB 1QFKH 4AFZA 2VIWA 1RGQA 4B6EA 3OY5U 1TYNA 2VIDA 1RXPA 5EW2H 4CBOA 3TH4H 2NU0E 1GI5A 3ESTA 2Z9IA 1GJ9B 1U6QA 3L3TA 4ABIA 1HAZB 2VIQA 8LPRA 3B8JA 3K65B 3E0PB 4O3TA 1GCDA 2ODPA 3UWIA 1C1RA 2XNDD 4J2YB 8GCHG 1HIAB 4GPGA 4PROA 2VH6A 1MTUA 5C5NA 1TRNA 1S81A 1ABIH 3A7WA 3A7TA 1SGTA 1TPPA 5L2YH 1IHSH 2JKHA 2XRCA 1W7XH 1B5GH 2OC8A 1RTKA 2BY8X 1UCYE 4OGYA 2ZFQH 4RSPA 1UVPA 5C5OA 2FOFA 3P8OA 2EC9H 2A31A 1ELTA 4O9VA 2PKSB 4OS2A 3H09A 3OY6U 4FVBA 4DG4A 2G5NA 3SV2H 4CRAA 2Z9KA 1BHXB 2EI6A 5HM9A 1YM0A 1PPCE 2R2MB 1G2MA 1OHHD 2WPKS 5E0JA 1BTWA 1NRSH 1OWDA 4GAWA 1C2FA 1H1BA 2BY7X 5IYTA 2P16A 1DICA 2F9UA 3ENSB 2WV4A 1LHDH 2BD3A 3A86A 2ZTZA 1WUNH 6GCHG 3ZZ6A 4Q63A 2PV9B 2ZHFH 2J9NA 4I86A 1FV9A 1VCWA 1YPJH 5DKMA 1ZZZA 3ATIA 4GHTA 2BX3A 2LIZA 4K8YA 4X1QU 2EQNA 1J17T 4HZHA 1O2HA 3TK5A 1MMJN 3GY4A 3RXAA 3BTQE 1C1VH 2STBE 3JZ2B 1O5EH 1GI7B 2GCTB 1A5GH 3ZZ8A 1LVBA 4X2YA 3MQKC 1AUTC 1ZSLA 3UNSA 5EIYA 2GP9B 1Z8JB 1YY3A 3LDXH 3MNBA 4ZAEA 1KXEA 1TQ7B 2HPPH 3U1JB 1S6FA 3FP8E 1ZSKA 2ZCKP 3LIWA 3M7TA 1OWKA 2C3SA 2Y5GA 4JYVH 1Y5AT 5IK2D 4UE7H 1FY4A 1YBWA 3KN2A 1TGCA 4I8HA 2BTCE 1P9UA 3ATMA 1W14U 1QA0A 1NT1A 1SR5C 4P02A 3AAUA 4BXWA 2W7SA 5HIZA 4BAHB 1HPGA 3NRLA 3LGUA 1OP2A 1O5CB 2LP6A 2VBCA 1TOCB 3EQ0H 4MPWA 4NCYA 1LHCH 1JRTA 1O3LA 1P12E 1MU8B 2FOEA 3HKJB 4I8LA 4DIIH 1FNIA 2XC0A 1ZR0A 1IQHA 3M3VA 1CA0C 1UW7A 1YF4A 5DP4A 4SGAE 3SGBE 1IQFA 1O3HA 5BPEA 1WV7H 1MTVA 2DUCA 1LHFH 1DLEA 2VJ1A 3E90B 2F9BH 4U2WA 1QHRB 3P8FA 3ZYEA 2IPHA 4JZFH 5A0BA 1O36A 1T8NA 4YT7H 1BTZA 3GDUA 6ESTA 2RFKC 2FTMA 1P9SA 2ANYA 4X8UH 2Q6FA 1W0ZU 3DSOA 1AWFH 1GHVH 3TVJB 2DE9A 1PYTC 2BYAX 4K69A 3I77A 4CH2B 2VIVA 2OCVB 3RXCA 1KY9A 2RCEA 2GZ9A 2ASUB 2BDIA 1EPTC 3C1KA 1O2SA 1QJ1B 1KXBA 1BTPA 2WUCA 3KF2A 2OP9A 4Y71A 2WUBA 2XXLA 3RLYH 1AWHB 2ZO3H 3V12A 3TPIZ 1W8BH 2LNCA 3SU2A 1SMFE 3N7DA 1BA8B 4GSOA 1Y3VA 3TU7H 4KKDA 5EQRA 2AGIX 1KDQA 1P09A 1MD7A 1UJ1A 1HAIH 1K9OE 1J14A 3RXHA 1HNEE 1CGJE 1O2JA 3BTDE 1S82A 1Z8GA 2QF4A 1KLTA 4P00A 3M61U 3UTUH 2XNIA 1ZTJA 1HJAB 1OKXA 1ACBE 3MHWU 4Q80A 3V7TA 3BIVH 4WWYA 5CHBA 1EP6A 1OP0A 1TA2A 4THNH 2TGAA 1WXRA 2HNTE 2BLWA 1Q2WA 1THSH 3FKSD 1GMDG 3SU3A 2A4RA 5E0GA 1QQUA 6CHAC 3VB7A 1GBMA 4J1YA 2ZPQA 5L30H 1DWBH 2FWWA 3LJOA 3GY7A 1HJ8A 1GBBA 3E91A 1E35B 4NWKA 2ANWA 1O2PA 5CHAB 1O3MA 2Y7XA 1FY3A 1UO6A 2ZPSA 1O5DH 1O2WA 2BOHB 1CT0E 1ZRKA 1Z6EA 3BTFE 4E7RG 4UFDH 1Z1IA 3ZVFA 4TWYA 4FUIA 1C5ZB 2BXUH 3E0NB 3PYHA 3HATH 3TLOA 1TBZH 1MTSA 2DE8A 3U8RH 1MKXH 5F03A 1WQVH 1C5YB 1O2ZA 1ESAA 1GBAA 3KYFA 4ZHAA 3RMNH 3ZVCA 3RXMA 3NCLA 3S7KB 4K8BA 3TNTA 2D8WA 1JOUB 3QGNB 5J4QA 2J4IA 2OC0A 3BEIB 4IS5A 2C8XB 4FETA 2PKSC 3GCTF 4TSFD 1GG6C 2KZ4A 3GICB 2UWOA 3RMLH 2BXTH 4IN2A 4AYYB 4AFSA 3LC5A 1GDQA 2L74A 1RTFB 1G2LA 1GBLA 5EXMA 1O3GA 1Y3YA 1Y5BT 4LXBH 2ZGCA 5FL7D 1FX0B 1GPZA 2FOHA 3Q3YA 1HRTH 1SG8B 5C3NA 3GISB 3JZ1B 5DK1A 1AKSA 4K5ZA 3SYJA 3UR9A 1IQMA 1SLVB 3AW0A 1LVYA 3N99A 5HGGA 1F0RA 4ABAA 2AMPA 1DUAA 1SGIB 4JK5A 2ZKSA 4SGBE 4HGCA 2XBVA 1G9IE 2A5AA 5IDKA 5FCKA 2V6NA 1S84A 3E16B 3RXUA 2A2QH 5EOKA 1UCYH 2GV7A 1OWEA 2F9NA 2BDCA 1GJ7B 1GI4A 1P11E 2SGEE 3KQBA 1Y3XA 1V2PT 5K0HA 1C5QA 3MH7A 1NRPH 1TE0A 2AMDA 5TCAA 4K1EA 1BMLA 3TGIE 2W7UA 2ZFSA 3EYDA 4ZXXH 1F0UA 1T8LA 3UQVA 3GY3A 4I7YH 1H8IH 1GBJA 4F49A 1UHBA 2QXIA 1PQAA 1GHZA 1QBOA 1YCPK 1TIOA 2CXVA 4UFEH 4HG6A 2NWNA 4U30A 4UD9H 3Q3XA 3PM3A 4JZIA 4DW2U 1O5FH 3UREA 3SUEA 3MNXA 1C2KA 2EA3A 2ZDVH 1SQTA 5AFZH 2XW9A 2TGPZ 2ZG0H 3UWJH 3DD2H 4CR5A 3HPTB 2H2ZA 5GWZA 3MWIU 1MAYA 2WPIS 1H8DH 3UIRA 1EFRD 1H4WA 4XBBA 3T26A 1SGFG 3A87A 1G3BA 3IITA 1AFQB 3SO3A 1SGCA 1TX7A 2K1QA 2PP6A 1EXFA 1Z8RA 3BG4C 1LQEA 4XE4A 1BJVA 3TK9A 3OX7U 3MU4A 1SHYA 2HVXA 3TITA 2GD4B 1KXDA 1TPOA 4NA7A 2ODQA 4F4OC 1O2YA 2ZU4A 4RKJB 1D6RA 4DGJA 4X2XA 2SFAA 2VWNA 2TRMA 5JBCS 1THPB 1XUIA 4NZLA 4OGXA 1NC6A 2KX4A 5L2ZH 2WYJA 1TX6A 5DG6A 3SNCA 1EATA 2ULLA 2SGAA 2GV6A 5EPYA 1A0LA 1O3NA 2A4QA 3PLPA 1D4PB 1DFPA 1MKWH 2ZHDA 1TB6H 1SQAA 1ZLRA 5A8XA 2OBQA 3KHVA 4KGAA 1G3DA 1FJSA 2BVRH 5HXFA 1RFNA 1UTMA 1OX1A 3RU4T 4Z1MD 1CO7E 3D49H 4BAMB 3UR6A 1YP9A 4MVNA 2H1UA 2TIOA 1O38A 2FYRA 1ZTKA 5FPYA 5LPFA 1O2XA 1QL9A 1FDPA 1NU9A 3KQ5A 4FU9A 2A7CA 2ZFTA 5EW1H 2BY5X 3A88A 1E1RD 2BD2A 1CT2E 1EASA 1THRH 5AVDA 1JWTA 3N7EA 5AFYH 1H9LB 4JMYA 4Z0KA 4UFGH 1FPHH 1SB1H 1WOFA 1UTKA 1FY8E 1DUEA 1ESTA 3GCHB 1AZZA 1HJAC 4CRCA 1GCTB 2HNTC 2OQUA 3K6ZA 4NZQA 3W95A 3MMGA 5EPNA 4WMEA 3LGVA 3S9BA 1SGPE 3A85A 2H9TH 1AHTH 2QXGA 3UUZA 1TA6A 2F4LA 4FUCA 5HMAA 5A09A 2PGQB 1DT2A 3A84A 4MPUA 1TNKA 1L0ZA 4NA9H 1GWAA 2ZDLA 2QF5A 4Y8XA 3K2UA 4BAQB 2FODA 2JETB 2SGPE 2D2DA 1AFEH 3UPEA 1LDTT 2BY6X 1ZTLA 1BOQA 3ZIAD 1IAUA 1ZRBA 4AGJA 1IQKA 1KMHB 2I6SA 1BMNH 3RMMH 1C2IA 2AS9A 3MNCA 1GL1A 3GYMA 1SHHB 2FOMB 1O33A 4VGCB 5DP5A 1OS8A 5I46H 1VJ9U 1TNGA 2G8TA 2WSSD 2V3MA 2QC2A 2Z9LA 4X1SU 4CRBA 2R3YA 4IBLH 4A5TS 1KXCA 4ABEA 3LPRA 3MO9A 1EOJA 5EJ1A 2AFQB 3F0OA 2FESH 1C1SA 2GGVB 2J98B 2P59A 1K1OA 1V2LT 2ZDNA 4WJG2 3FVFB 3SZNA 2KAIB 3OE7D 5ABWA 1V6DA 2XCFA 2KCAA 2VWLA 3GCTG 2YNAA 1RD3B 3AASA 4YZUA 2FOAA 1W13U 1COWD 4TWWA 1DVAH 2R2WU 1P06A 1NPMA 1TBQH 2FOBA 3QZQA 1XVOA 3VGCB 2QV1A 7LPRA 3TGKE 4LZ4B 4MLFB 1NFYA 4I32A 5JBBS 4O3UA 1Y5UT 1GBCA 1KDQB 1Y3WA 3UNQA 2CHAB 2OK5A 2HGTH 3SU4A 3MTYA 4ZCNA 1NTPA 3MO3A 3PO1B 2O8WA 2UWLA 8ESTE 2G81E 3PV4A 2NU3E 2FTLE 3M5MA 4Y7BA 1QTFA 1XMNB 2QCYA 3QTVH 1GJ5H 2OTVA 2ZHEH 5A8ZA 1LPZB 4FUGA 4ISLA 1GHWH 2ZWLH 1CHOF 3ZZDA 5E0HA 4ZHLU 2FEQH 1C2LA 1FN6A 1G37A 2HPQH 5FPSA 1ZJDA 3BTGE 1YWUA 1C5RA 1AB9B 1G30B 5ESBA 1A1RA 3RXVA 5JB9S 1TGSZ 3EGKH 1MCTA 1QB1A 1K1MA 4B71A 3SJ9A 2ZI2H 1QNJA 1HXFH 1HFDA 1O34A 4KP0A 1GI0A 2XBYA 2GVFA 2BDAA 4AB9A 2KCYA 1V2TT 4CBNA 4D9QA 2BQWB 4MDSA 4X8SH 4ZROA 1O3KA 1ZSJA
chains in the Genus database with same CATH topology
3A7XA 2A2XH 3CS7A 1DANH 1BHXF 3LKWA 2C93B 2FI3E 2SNWA 3RXSA 5T6FA 1OSSA 1AFQC 2V0BA 2FX4A 5F8XA 3TK6A 4A1VA 1ETRH 2ZFPH 4ISOA 2A1DB 1V2KT 4Y0ZE 2HOBA 4IN1A 4ZXYH 2FI5E 4CRFA 2TPIZ 4AGKA 3ZZCA 2VB0A 2ZGHA 1IQIA 1ESBA 4ZUHA 3EAJA 2PSYA 2WPHS 2ZFFH 4Y79A 2P3UB 2Y82A 5LGOA 3A8DA 1QA7A 5JBTA 1UTPA 1RJXB 5C2ZA 1AKSB 1O2IA 3GDSA 1O37A 1VJAU 3NKKA 1GI2A 2ZC9H 2VGCB 1MTWA 3ZZBA 1ELBA 4AYVB 5CE1A 5JDUB 2FO9A 3SV9A 3LGWA 1ZMLA 3O8DA 3ZVAA 1TWXB 4ABBA 3KIDU 4BXSA 2FZZA 4OS1A 3MH5A 3MO6A 1UTJA 1DDJA 1YLCA 1C5MD 1LKAA 1T8OA 4XOJA 3SI4H 1NY22 1O2KA 4DVAU 3VPKA 3NZIA 1TGTA 2B7DH 3E3TA 1HAPH 1GHAF 1QB6A 5GIBA 1ABJH 1GBFA 1LCYA 3QTOH 1VGCC 1UHBB 3EA9A 3GCHC 1EX3A 4UDWH 1FY5A 1GCTC 2CGAA 1N8OB 4X2VA 1QB9A 3S9AA 1VITH 4FVDA 4NA8A 4WY3A 1ZYOA 2ZCHP 4YOIA 1T32A 2VU8E 1ID5H 1CGHA 3MI4A 4BOHA 1IHTH 4DY7B 2ZQ2A 2TGTA 1OXGA 2SGQE 2HRVA 3A82A 5DP9A 1ZMNA 1TABE 4INKA 1AVXA 1FIZA 1A2CH 1KSNA 1C2EA 4Z6AH 2JETC 2GMTB 3MFJA 2GDEH 1NROH 4X6OA 2XYAA 2GKVE 5J4SA 3T25A 1BRBE 4MNXA 1ARCA 1GVKB 3ZVBA 4IGDA 3V0XA 1HAYB 1F7ZA 1GJDB 4CHAC 1OP8A 5A0AE 2BLQA 3SNEA 2Z7FE 4BAOB 1O2QA 2J2UA 1GVLA 4VGCC 1Z7KA 1V2NT 2FP7B 1JIRA 3PMBB 1UK3A 4IC6A 2PSXA 1DE7H 1LVMA 1A4WH 4IMQA 3UOPA 2Z3EA 1O3IA 5GCHF 2ZA5A 1C1TA 1ZHMA 2KAIA 2F9PA 1P2IA 1AN1E 2FLBH 1S0RA 2W5EA 3L33A 1V2VT 1PPGE 2FPZA 1FONA 2AYWA 3QN7A 4TPYA 4XBCA 1WAYB 3M5OA 3UQOA 3S7HB 3EDXB 3UOUA 1C1MA 3MYWA 1P2QA 2QA9E 4AFUA 3A8CA 1LTOA 1VZQH 3L6PA 5FAHA 3EBNA 4AORA 4AN7A 2PLXA 1DSTA 1MQ6A 1CA8B 4WVPE 2HNTF 3VGCC 4MNYA 5A0CA 4GLYA 2PW8H 3A83A 1D6WA 4KTCA 3SJIA 1P03A 2F91A 1FI8A 4ZHMU 2K7XA 1FQ3A 2OUAA 3RXPA 1O39A 2CHAC 1NN6A 3PTNA 3HK6B 3PO1C 4X8VH 3RXLA 3A7ZA 2PUQH 1OWIA 5JYIA 4A1XA 4GUXA 1MQ5A 1QJ6B 1JRSA 3MU5A 4DURA 2NU1E 3RXQA 1EUFA 4Q7YA 1V2ST 1HGTH 2B0FA 1ZGIA 2XWAA 1LVOA 1K1IA 1P57B 1C5TA 1AE8H 2XC4A 3UY9A 4Y0YE 1AB9C 4O97A 1CHOG 1CT4E 3URDA 1XM1A 1FAKH 1XVMA 4INHA 4YLUA 2XBXA 1GJ8B 1AQ7A 4A6LA 1ZPCA 1SOZA 1SOTA 2H9HA 2BLVA 1YPEH 4H4FA 1E34B 5DP8A 1SLXB 3N7OA 2FLRH 5G4BA 3RM2H 1C5PA 1F5RA 2BD5A 1SGNE 1P02A 2ZDKA 4ZKRU 4HI3A 2ZP0H 4K60A 1AE5A 3P95A 2W3IA 4LOYH 3RC6A 6LPRA 3S69A 3SUFA 3SU0A 1OYQA 3A8AA 2R9PA 4NSVA 1BITA 1HAHH 2OC1A 1IOEA 3ZV8A 1CU1A 4OS5A 2OD3B 1MBMA 4D7FA 2Y7ZA 1MZDA 5GPIB 2BX4A 3KQEA 2B9LA 1V2QT 1DY8A 1PPBH 1QBNA 1F5LA 1WYKA 2UUFB 3NPSA 1MTNB 4DJZB 2ZF0H 1WCZA 3F9GA 1BBRK 4D76A 5BRRE 1GI3A 3G01A 1OWHA 2ILNA 1DPOA 2P3TB 1EAWA 5L6NH 3SJKA 5T6DA 3RUOA 1O2OA 1ZPBA 1DWEH 2O8UA 1YC0A 2BZ6H 2XBWA 1AD8H 1J8AA 2BVSH 4MPXA 2D26C 5FPTA 3RXRA 2OC7A 2THFB 2VGCC 4WF8A 1SGDE 2Q1JA 1P2JA 1XUJA 3H5CB 1HCGA 2A5IA 5C1YA 1DWDH 1Y8TA 1J15A 2ANKH 1D3TB 1GI9B 1W11U 2G5VA 2QY0B 1XXDA 1QBVH 1P2OA 4FUHA 4X2WA 1EB1H 4MG3A 1TQ0B 4INLA 2BDBA 4ZKOU 2GCTC 2QIQA 1ELVA 1SPJA 3A80A 1QRWA 4AFQA 3AVZA 4E05H 1CQQA 2FMJA 2EI7A 1TMUH 4X1PU 5TCCA 1PPEE 3DFLA 1UTOA 1Z1JA 1UTLM 2P8OB 2VIPA 1S85A 1H9HE 2BDHA 1GHAG 1HJ9A 1UK4A 1RS0A 2ZHQH 2FOCA 1MAXA 3HGNA 3LONA 4XSKU 1TX8A 1N8OC 2BD8A 2ZU1A 2GT8A 5H4IB 1AZ8A 3QZRA 3TH3H 5C20A 2R3UA 1C4U2 3ODFA 3U98H 3F9HA 1P10A 5GDSH 3SU5A 1GBDA 4B1TA 3VEQB 1HAVB 2ZU5A 1Q31A 3MNSA 1IQEA 1AGJA 1SLWB 2ALVA 1SI5H 2Z9GA 4ISIH 5I25A 4JK6A 1ELFA 2GMTC 1SGFA 2P94A 1VITF 5EG4A 4I33A 1O5BB 4Y8ZA 4YOGA 1QL8A 1O3DA 1KTTB 1O5AB 3SNAA 3PROA 4NGAH 2UWPA 4AOQA 2A4GA 2CJIA 1QCPA 4WXIA 2F9OA 4ABGA 3BTHE 1AI8H 5ETXA 2SNVA 9ESTA 3AW1A 1ZMJA 1HDTH 3MH4A 3O8CA 2Y5HA 2GT7A 1WTGH 1HUTH 1ZHPA 1EJNA 1C9TA 1OWJA 1UTQA 3OYPA 1UVTH 4X0WU 1BZXE 1O2TA 4ABFA 2ZGBH 4ASHA 1A3BH 1JXPA 2UUYA 2FOGA 5GCHG 1BTYA 5FBIA 1ELGA 2V35A 4WXVA 1NRQH 4FUBA 1CGIE 4B2AA 2PWXA 1GMHF 1XUHA 2BOKA 3QGJA 1GVZA 1HAOH 2Z3CA 2A0QB 4A92A 4NIVA 1BUIA 4E06H 3P8GA 1NZQH 1BBRH 1VCQA 1C5XB 2F83A 4IC5A 4OS6A 4JZ1A 2G00A 3FZZA 4ABJA 4NFEA 1GHBF 5FHTA 1GDNA 2ZPRA 1EKBB 3O8BA 1DS2E 3TJNA 3BTME 1Y3UA 1GHYH 2ZTYA 3E1XB 3SW2B 3VFEA 2ZZUH 1JBUH 1ETSH 1TNIA 3GY8A 2GDDA 1IQGA 1YCPM 1TONA 2AERH 4NFFA 4BNRA 3GCNA 1C4Y2 2CN0H 1A7SA 4K2YA 2FS8A 3W94A 3T62A 1A61H 3D65E 3ELAH 1O2NA 7ESTE 1C2HA 1WU1A 4ZKSU 5F8TA 1UVUH 1P01A 2FDAA 1C1PA 1EZSC 1J9CH 3TH2H 3FFGA 1N6YA 1DY9A 1HLTH 1PPHE 4B74A 2ZGJA 5CHAC 3ZVGA 3BTWE 2H6MA 1YCPH 4BAKB 1P05A 2Y6TA 4IW4E 2YNBA 4MPVA 3KEEA 3KNXA 3ZZ7A 1BB0B 1BQYA 3SHCH 2SGDE 1CA0B 2C8YB 2OXSA 2GX4A 2BD7A 2ZGXH 3RXFA 1C1QA 1QJ7B 2PUXB 1W2KH 2JH6D 2OINA 3QDZB 1P8VC 3WY8A 3PMHB 3SGAE 2O9QA 1SFIA 4UONA 2ZEBA 4GCHF 1K1JA 4CRDA 4Y7AA 3BIUH 5C67A 1ARBA 2QAAA 2W3KA 4KELA 3MU1A 3T28A 4B76A 2FYQA 4FXGH 1CE5A 5FX5A 1GBIA 1EP5A 4MNVA 2WYGA 3EE0B 3BTEE 1ORFA 4K1SA 3B23B 3LH3A 4QT8C 3VXEH 1D3PB 3M5NA 3M7UA 4XFQA 2OLGA 2LPRA 2OQ5A 1RRKA 4ESTE 2VH0A 4ZKNU 1F92A 3TJVA 1SQOA 5C1UA 1BRUP 3R3GB 2QGRA 3PTBA 4AX9H 1MTNC 3M36A 1TAWA 2AH4X 3F6UH 4NG9H 3ZZAA 1T4VH 3LH1A 1PQ5A 3PMAB 4MQAA 2PTNA 4NWLA 4JZEH 1BT7A 3URCA 2Y5FA 1C2GA 5DP7A 3C27B 5LPRA 3NUMA 1NFWA 1O5GH 2CF8H 3STJA 2Y81A 2C90B 1TRYA 4A1TA 2A45B 1EAUA 3SQHE 1C5WB 1LKBA 1RIWB 1L1GA 2PKAA 1AY6H 1FLEE 3ATWA 1Z71A 2HALA 3ODDA 5GJ4B 4UEHH 3EA8A 1H9IE 2RG3A 1ZOMA 3KGPA 4WH6A 2O8LA 1O3EA 2G52A 1AIXH 4RN6A 3NXPA 3HK3B 4X6PA 1GJ6A 3SJ8A 2J38A 1K21H 3T2NA 2P8OC 2IOTA 3D23A 5FX6A 1EZUC 1DOJA 1FY1A 1GI8B 5DJ7A 3I29A 2H9EH 1G3CA 3BEFB 1S6HA 2VINA 1HAVA 1NFUA 4Q7ZA 2Z6BD 2RA3A 5AF9H 2Z9JA 4CH8B 4B75A 1DITH 1W3CA 1XKBC 1KXAA 2BQ6B 3PMJA 1F5KU 2BVXH 1AMHA 1TLDA 3DHKH 1XXFA 2ZNKH 2PR3A 3RU4E 3RXBA 4TPIZ 3ZVDA 3ZYDA 1O2GH 3RM0H 1O3BA 2FIRH 4Y76A 3M5LA 2H5CA 1GG6B 1VITG 1GBTA 1A3EH 1K2I1 4CREA 4NIXA 1GBHA 1FUJA 1TBRH 1A46H 4JYUH 2AMQA 2ODYB 2FM2A 3SOSA 5A2MH 3ZZ4A 5SGAE 3OTJE 1S5SA 2YOLA 3BG8A 2QXJA 3AAVA 3PB1E 1ZHRA 1W0YH 1K1LA 1OYTH 4I8KA 2Y80A 1PJPA 2ZIQH 1GGDB 3SV6A 2UUKB 1QR3E 1ANCA 1O2RA 1AUJA 1LMWB 2FX6A 3QUMP 5EQSA 7GCHF 5EXLA 1BTUA 3Q76A 2AGEX 3E8LA 1W12U 1SFQB 5FBEA 3DFJA 5A8YA 1T7CA 1C4V2 2QF0A 3SV8A 4Y8YA 1INCA 4YOJA 1SGQE 3LOXA 1PYTD 1GMHG 3BEUA 3F9FA 1C5LH 4YTAA 1P2KA 2ZQ1A 1ZGVA 1V2MT 2R0KA 2TBSA 3K9XB 1HXEH 2HLCA 1T8MA 3RXDA 1C5OH 2ZU2A 1DXWA 1GHBG 4K3JA 3SN8A 4GVUA 1O35A 1LHEH 3RXIA 2B8OH 5GXPA 3FAOA 1GBKA 4Y10E 2ZDAH 1K22H 3DT0H 1MD8A 2GCHF 4B2BA 1O32A 1F2SE 2A7JA 3GYLB 2VVUA 9LPRA 3BV9B 1ELCA 3TJOA 3ZVEA 2Q6DA 1A5HA 1B7XB 1O3JA 1BBRE 2Z94A 1NO9H 1SGEE 1EJMA 1W10U 1LPGB 3RC5A 2ALPA 3LGIA 1BJUA 1MKXK 2BHGA 3S9CA 1CSOE 1SLUB 2BQ7B 2Z3DA 3M3TA 5LH8A 2F9VA 3U9AH 3M35A 4TYDA 5TJXA 2WINI 1OPHB 2BDYA 3M37A 3BSQA 1GBEA 1TALA 1O0DH 4UFFH 1L4DA 3FANA 3BG4B 5T6GA 2B5TB 1TRMA 1KTSB 1SL3A 3Q77A 4X6NA 1CBWB 1NFXA 3E6PH 2XC5A 1HV7A 1Q3XA 3QO6A 2Q6GA 1E36B 5EGMA 4U32A 3U8OH 2AGGX 2J34A 1RTLA 3A81A 4GCHG 1TNHA 4BTTB 4ZH8A 1TMBH 5FCRA 2HWLB 3D62A 1MZAA 2AIQA 3A7VA 1EPTA 1TMTH 1NM6A 3ZZ3A 2ZCLP 1UVSH 1EZQA 5JB8S 2ZHWH 4Q7XA 3RU4D 3P92A 1LO6A 5ESTE 1C5NH 4YO9A 3VB4A 2QN5T 4NIYA 4DOQA 3A7YA 3SU1A 1QY6A 1GJCB 4OS7A 1NRRH 1O2MA 1N1LA 3Q00A 1A5IA 2FXRA 1UCYK 3PLBA 1DM4B 3FP7E 1LPKB 5HYOA 2V3HH 3ZZ5A 3MU0A 2A7HA 1YLDA 3SORA 1WTHD 3LJJA 1NU7B 1AVWA 1YPHE 1DLKB 4DIHH 5F8ZA 1FAXA 3P6ZB 1BTHH 1G3EA 1GJAB 1T31A 5DP6A 3GOVB 1Y59T 5CMXH 1C1WH 1HAXB 1XX9A 3T5FH 1D9IA 1QIXB 3IG6B 2TGDA 1S0QA 3BTTE 2BD9A 1SVPA 1BIOA 1RIWC 4ABHA 3QLPH 3DUXH 3F9EA 4Q2KA 2BDGA 2SGFE 3GCOA 2H5DA 1UVOA 1WSSH 2RDLA 1ETTH 1J16A 3SU6A 3RDZA 1C1NA 1O3CA 2BM2A 3BTKE 3CENA 3LGTA 3PWBA 3BN9A 4XBDA 1HIAA 4I8GA 2G4TA 1YYY1 1C5VA 3SNDA 2G51A 1ELAA 1PPFE 2GZ7A 1GMCF 1O3FA 1QL7A 4BTIB 2W26A 4WMFA 4D9RA 3RLWH 5FXLA 3RC4A 2G55A 3CP7A 3ZV9A 5EODA 3GY5A 1DXPA 4FUDA 2XWBI 3Q3KA 2WV5A 4Y6DA 2WPMS 4K1TA 2VWOA 3RP2A 4U01A 3U1IB 3RXKA 4FUFA 3UFAA 3KL6A 5EXNA 1EJAA 3MH6A 2PGBB 2J94A 4NIWA 1AVGH 3P70B 1NS3A 1K1PA 1L1JA 1XUFA 4I31A 4IMZA 2NU4E 3KQDA 3SQEE 1F0SA 2PHBA 3STIA 5E8EH 1PQ8A 3H7TA 3HKIB 3I78A 4YLQH 1E37B 1MKWK 1CHGA 3ATLA 1VR1H 3TJUA 4MTBA 1P04A 1P3EA 1D3QB 3VB3A 2QXHA 1IQJA 3RXTA 4DCDA 1DX5M 5DPAA 2IN2A 1GI6A 1HB0B 5T3HA 1GGDC 1SSXA 1PFXC 1QURH 3LGYA 1GHXH 1N6XA 3DA9B