1WOFA

Crystal structure of sars-cov mpro in complex with an inhibitor n1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
309
structure length
309
Chain Sequence
b'PLGSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Design of Wide-Spectrum Inhibitors Targeting Coronavirus Main Proteases.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 87
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1wofA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wofA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1wofA02
4AX9H 1C5YB 1QB9A 4OS2A 3V12A 2D8WA 1QRZA 4WMEA 5FBEA 1V2ST 3ZVEA 7GCHG 1OWIA 1S85A 4X2YA 2WUBA 1GWAA 4DW2U 3SHAH 2TGPZ 3DFLA 3A8CA 4FXGH 4Y11E 4UEHH 2ZHDA 2GV7A 1W10U 1Y59T 1EJAA 1O5GH 4K1SA 3F9GA 1BZXE 5GJ4B 2ZPQA 4WY3A 2RG3A 2BXUH 3LJJA 3RC4A 3T2NA 4E05H 1A4WH 4INKA 1P03A 2XTTB 1SL3A 3SUEA 1XUHA 1HB0B 2PHBA 3RMOH 3M5OA 2ZDMA 1XUIA 1QB6A 3ENSB 1FNIA 2VVVA 2VWLA 2ZCKP 2BY8X 1LKBA 2Y5FA 1P2OA 1BOQA 1BTHH 1Z8JB 2VWMA 1HBTH 5K7RA 5DP9A 4VGCC 4GHQA 1O2UA 1A5IA 4FVDA 3RXCA 1DANH 2BX3A 1TPPA 3U69H 3I29A 1O3PB 4M7GA 1NC6A 2FDAA 1CQQA 1GJ4H 1GBLA 3HKIB 4CR5A 3A7TA 4YZUA 4ZXYH 2GT7A 1LHFH 1N1LA 4X6NA 1PPEE 1O2MA 3O8BA 4D7FA 1HJAB 4D8NA 2QA9E 1NRNH 3ESTA 2FS9A 4D7GA 1TOCB 1QL9A 2FI5E 1AUJA 4OS6A 2FOCA 1EASA 2AYWA 1G36A 1SGRE 1ELEE 2J95A 5A09A 1T8LA 2FX6A 1HAOH 2K1QA 1XXDA 1G9IE 1ZPCA 1GI7B 3M36A 1GL1A 1W11U 4YLUA 1P10A 2F3CE 2J9NA 2UUFB 3RXQA 1TMUH 3UR9A 1OSSA 3RXEA 6GCHG 2M5TA 1TNIA 3RU4D 3Q76A 4IN2A 1HJ9A 4AFSA 4GSOA 1WQVH 2BVXH 2QV1A 3Q77A 3LGVA 5L30H 1GDQA 5E2OA 5ETXA 1P9SA 1XKAC 1S6HA 3U8TH 3MH7A 2QXIA 2P16A 2NU1E 1NFUA 3LGTA 1BA8B 3E3TA 2VJ1A 3EQ0H 5E8EH 4XOJA 3PWBA 5A8ZA 1XUFA 5TJXA 2PFEA 3P8FA 3R3GB 2AMQA 1MD8A 1MBQA 2HNTF 3K6ZA 4SGBE 4UFDH 2D1JA 1EZQA 3IWMA 2OP9A 2STAE 3V0XA 2NWNA 4DJZB 2WPMS 3QZRA 1TMTH 1GMHF 5EU8A 4NIVA 2Z7FE 1SLWB 2FLRH 1YYY1 1Z6JH 1TAWA 1C5VA 8GCHG 1ELTA 3SU1A 4ISOA 2OQ5A 1GJ9B 3PTBA 1GJ7B 4Y10E 3TK5A 1BMAA 1G3CA 5EXNA 2LIZA 2BZAA 4D76A 3C27B 3A7ZA 1ZSKA 3UTUH 1THRH 1ELGA 2B7DH 1TGNA 1HXFH 3HK3B 1GMDF 2P8OC 3UWIA 1DVAH 1TRMA 1D9IA 1A7SA 3KQEA 2A4OA 2SGDE 4U30A 1A61H 2AIPA 1PPBH 1HFDA 3EA8A 4NWKA 4IBLH 3MO9A 4FU7A 1QBNA 5F6MA 3SJ8A 1O2YA 3SV6A 5FCKA 1JOUB 1QJ7B 3FVFB 1E36B 1NPMA 1UTJA 1DICA 1UMAH 1O3AA 3ZYDA 3BIUH 3CP7A 3NUMA 1OWKA 1GJAB 3RXAA 2FYRA 4I8KA 3LPRA 1DM4B 1MH0A 1IQJA 1CHOF 1O34A 1O2OA 2FESH 2ZGBH 1ESAA 2PV9B 3GDUA 3RP2A 1O3NA 4AYVB 5E0HA 3GY3A 3ZZ5A 2BQ7B 3NK8A 4WXIA 5A0BA 1O5DH 2FOMB 2TRMA 3S9AA 1TRNA 1A3BH 2YOLA 3SW2B 1QIXB 1UK4A 1A2CH 1SPJA 1LCYA 3BTEE 4XE4A 5C3NA 4OGXA 3VFEA 1AUTC 1EOJA 1TQ7B 3EE0B 3Q3XA 4X8VH 1TPOA 2ZIQH 4X2VA 4K1TA 1DWEH 3BTWE 3SNAA 4YOJA 1W7GH 1BDAA 2AMDA 2A2XH 2FWWA 3SU0A 1FN6A 2XWAA 3ZZAA 1P05A 2BQ6B 3PV4A 1F2SE 5FAHA 4B2AA 2BDCA 1C5WB 1GI0A 2EC9H 1DSUA 1ANBA 4RKOB 1BTPA 3S69A 2B0FA 1C1NA 3UNRA 4NGAH 4CHAB 3PMBB 5TCCA 2H2ZA 1SGDE 1AN1E 1F0UA 4A5TS 1CO7E 1BMNH 1C1MA 2ZDAH 4NG9H 5FHTA 1NU7B 1LHDH 1HNEE 1A0HB 2H9TH 3LKWA 1AVXA 3MU0A 3TITA 1AU8A 3SOSA 1HAZB 1EXFA 1DY8A 4THNH 1ETRH 1O2ZA 1WTGH 2GMTB 3SV2H 1FONA 4Y71A 3UPEA 4AZ2B 1QB1A 1GMCF 4MPWA 3GOVB 3HKJB 3E90B 2Q6DA 3SI4H 4OS5A 2C8YB 5A2MH 1HAXB 3V3MA 5E0JA 1DWBH 2SGFE 4U01A 4ABBA 3MO6A 3VB7A 1O5AB 2A31A 3ZZBA 2EI7A 3GICB 4DIIH 3U9AH 2QF0A 3RMNH 3RLYH 1HIAA 1E37B 2BD7A 2XC4A 1O37A 1CBWC 3A89A 3QUMP 3UREA 1OS8A 1GVZA 3LH3A 2A5AA 1SQOA 1O2JA 5JB9S 1GCDA 1PQ8A 3GCOA 1S83A 1YCPK 1DXWA 2OC8A 4FUEA 2ZI2H 1YCPH 3T25A 3PLKA 3GDSA 1QL8A 4AGJA 4X8UH 1DE7H 4LZ1H 3ZZ8A 4X2WA 3GY8A 5JBBS 4E7NA 5LH8A 5FPTA 3BV9B 4O3TA 3GY2A 1MCVA 1F5LA 1XVMA 6CHAB 1GHBF 4X6PA 1DUEA 4INLA 1BTWA 3KNXA 1MBMA 1SVPA 4I33A 1OOKB 4NIXA 5EQSA 4BAOB 1E0FD 1JIRA 2PR3A 1O35A 2J94A 1TGBA 4GAWA 2QN5T 1O36A 3F68H 2QGRA 3STJA 2AS9A 1JWTA 3FP8E 2A4QA 1FQ3A 2FOGA 1QA7A 1SQAA 5CHAB 3M7QA 3FP7E 1EB1H 2H1UA 3L6PA 2A5KA 1TMBH 2BX4A 3SQHE 1VZQH 3SJ9A 1IOEA 1ZTJA 4KELA 2C4FH 5DK1A 4Y8XA 3SGAE 5AFYH 2VGCC 3ZYEA 1LTOA 5EGMA 1UTLM 5F8XA 1C5SA 1TBZH 3OX7U 4MDSA 2V3HH 4GLYA 4ZKRU 2O8UA 4SGAE 3D65E 4X1NU 1EAXA 1HAYB 1O3OA 1MAXA 2AEIH 3OSYA 4BNRA 3GCHB 5A8XA 3TGJE 4Y0ZE 3M7UA 3A7YA 1MU8B 4AFQA 2PKAB 3EA7A 1E34B 1S81A 1WU1A 4I8GA 1SFIA 2VVCA 2QXJA 3JZ2B 1AIXH 4LOYH 2JETC 2B5TB 3RXFA 1P2MA 4K2YA 2Q6FA 2AIQA 4DOQA 3GYMA 1EAIA 4ZROA 3PLBA 1K21H 2BXTH 2VWNA 1P04A 4K69A 2NU3E 3G01A 5LPEA 4FUFA 5L6NH 1ZMNA 1LQEA 1EP5A 4NA9H 3RXVA 1RTKA 2CHAC 2W3IA 3TK9A 4NZQA 4BAMB 1IHSH 1C5TA 4HZHA 4X6MA 4YO9A 1G30B 2A7CA 3M5NA 3PTNA 4ZKOU 1QHRB 1UVTH 1CGIE 4A1VA 3P92A 4ZUHA 4R0IA 4CRBA 3MNSA 2BVSH 2TGAA 1GBIA 3V13A 3ZZCA 1A46H 1SOTA 3S9CA 1JXPA 2ZU5A 1AE5A 1OWDA 1MTNB 1ETTH 1QJ6B 2ANWA 2Y7XA 2SGPE 2VINA 3A82A 5GWZA 5HGGA 1FXYA 5GCHF 2WV4A 1W0ZU 1Y5AT 5FBIA 2F9NA 1SG8B 4I7YH 2R3YA 2HVXA 2BYAX 5HM9A 1LVOA 3O8CA 1FY1A 1MU6B 1GJDB 3SV7A 4FUJA 3OY5U 2LNCA 3MHWU 1NO9H 2VIVA 2NU4E 3QTVH 1O31A 4I32A 4JZ1A 1GHAF 1QNJA 1QQ4A 2ZGHA 5K0HA 1HYLA 3FZDA 1JIMA 2P95A 1V2OT 3GISB 1NM6A 5FPYA 3W94A 1LPZB 3NWUA 5GPIB 3UOPA 5LPFA 1C1PA 3LJOA 1Q3XA 2WPIS 1QGFA 1V2NT 2CF9H 4YTAA 2OTVA 2ZEBA 2FOBA 3GY6A 1DPOA 1ELBA 1K1LA 4MNVA 4ZAEA 2Z9IA 3C1KA 5T6DA 2BD9A 1O2HA 1FV9A 2HPQH 1V2RT 2DE9A 2PGBB 1KLJH 3BEIB 1TNJA 1P11E 2WV5A 2ZECA 3AW1A 2BVRH 1KXCA 3VEQB 4FUDA 3RXIA 1U6QA 3RUOA 1GJ5H 1ABJH 1GL0E 1GJBB 3AW0A 2UUYA 3ZV8A 2FOEA 3GCTF 4OS7A 1O2GH 4YT6H 1PPFE 1IQNA 1TBRH 1CT2E 1UK2A 4B76A 4KP0A 2DE8A 1F0TA 3RDZA 4Q7YA 4IC6A 6ESTA 1SGFG 3RXRA 2H5DA 1ARCA 1GI4A 2XBXA 1WAYB 3SU3A 1YPHE 3RXHA 3ATWA 6LPRA 1WOFA 4E06H 4TY6A 1XX9A 2GTBA 2VU8E 1ZRBA 3P8GA 3TH4H 4B75A 1UTQA 5L2YH 5DG6A 1QBOA 2QF3A 1MD7A 2ZHQH 2RCEA 1ETSH 2R9PA 3DFJA 1Z6EA 5ESBA 1JRTA 3RC6A 3O8DA 1P3EA 1G37A 3EBNA 1K1IA 2ESTE 2UWOA 2G51A 3E0PB 4O3UA 1P06A 3A85A 3MU4A 2VVUA 3A86A 1M9UA 2OQUA 3SNCA 3FAOA 1QL7A 4NFEA 2Y5GA 4PROA 4ZHAA 1N6YA 8ESTE 3KQDA 1GDUA 1KDQB 1Y3YA 2ANMH 1NT1A 1TGTA 4OGYA 1GG6B 4XBCA 4ABGA 2SFAA 2ZGJA 2Z3EA 2PSXA 3I77A 1AGJA 3A7WA 2GD4B 4Q80A 2H6MA 2J2UA 2JH6D 3A83A 2ZDKA 3M37A 4CRAA 1GGDC 1GBFA 1K22H 4BOHA 3TU7H 4NSVA 1EPTC 1C1TA 1TABE 2B9LA 3SU6A 2QYIA 5C67A 4WJG2 4AFZA 5H4IB 1UO6A 4K1EA 1NY22 1T32A 1O2KA 1S84A 1TNKA 1RIWC 2O9QA 5EQRA 2GX4A 5JYIA 3LH1A 2GZ7A 2W7SA 1NESE 2OC1A 3WY8A 4K8YA 3PM3A 2ZWLH 1QTFA 5C1UA 4AOQA 4J1YA 4X0WU 4I31A 2F91A 1YPLH 2ILNA 3ATKA 4Y7BA 3RXPA 1GI6A 2HALA 4OS4A 2ZGXH 3RXMA 2FYQA 1FAXA 2DUCA 2OD3B 1ACBE 1J15A 3HGPA 3VB5A 3VB4A 3SJIA 2Q6GA 1GCTB 5C20A 1C5ZB 1C2JA 2BLOA 2CN0H 3LU9B 5GXPA 1ELFA 4ISIH 1AE8H 1TX7A 2BOHB 3ZVDA 2I6SA 4F49A 2P3UB 3AAVA 4AORA 2ZGCA 3SO3A 4ESTE 4H6TA 2CJIA 3B8JA 2XC0A 4ISNA 3VB6A 1PPGE 1FMGA 1AI8H 5DO4H 2ZDVH 1AY6H 1LMWB 1SGFA 3SV9A 2RA3A 5DKMA 3ZVAA 2FTLE 3QLPH 3CS0A 1TOMH 1NFWA 1K2I1 3GCNA 2SNVA 4TWWA 1HGTH 4YM9A 3DT0H 2B8OH 3L3TA 4X2XA 3DD2H 1BRAA 2ODYB 5EW2H 3PLPA 1NU9A 1P2NA 4O97A 4QT8C 4JMYA 2FIRH 3BF6H 3MH5A 1MMJN 1H9IE 1WSSH 1QBVH 4GUXA 1PQAA 1TYNA 1LVMA 4CRFA 1V2WT 2FEQH 3SU5A 2EI6A 2FLBH 3P8NA 2ZDLA 1AKSB 2ZTYA 1UVUH 3NCLA 3DUXH 2BD5A 1HCGA 3A7XA 1ANEA 1O3GA 2Z9JA 4UDWH 5EXMA 1QRXA 1C1RA 1HV7A 1SLXB 2ZCHP 3RM0H 1ZMLA 1O32A 3TH2H 4INHA 5F8TA 1H9HE 3D23A 2WYJA 1BMLA 5GIBA 4JCNA 2WPKS 4BAHB 3RXJA 1C4Y2 2XW9A 3KEEA 3ODFA 4DGJA 1S0QA 3F1SB 1GPZA 4TWYA 1LDTT 2A4RA 4CR9A 4BXSA 2EEKA 1HPGA 1VITG 2VIQA 1IQGA 1FY8E 2ZPSA 4BAQB 1GBHA 4JYVH 4H6SB 1LPKB 3SU4A 1RTLA 1C2LA 1MTWA 1VCWA 3B23B 4ZXXH 3M3SA 3EGKH 1O2VA 1BMMH 3HK6B 4TPIZ 1LHGH 1AWHB 1ZSLA 1T8NA 3MU1A 3QGNB 5JBAS 3TGIE 4F4OC 4IMZA 2V0BA 1CA0B 1SGCA 5C1YA 3SU2A 7GCHF 4BTIB 1FJSA 4GVUA 1PQ7A 3FFGA 4Q7ZA 4Y6DA 1Y5BT 5CMXH 3JZ1B 1HAGE 4AN7A 5A8YA 1H8DH 1XMNB 4TY7A 1ZZZA 1ORFA 3TJOA 1BTZA 2A4GA 1MZAA 1BTYA 1FI8A 1IQLA 2FOHA 2BDGA 1O5FH 1O2WA 1YPKH 4DY7B 1C2GA 1ELVA 1RGQA 1ZMJA 2GV6A 2Y5HA 3AVZA 5JDUB 4FUBA 4NWLA 1J8AA 5AFZH 3A80A 1O3CA 1Z8RA 1CGHA 2R3UA 2QCYA 1BQYA 4NA7A 1UVOA 1KTTB 1C9PA 2QXHA 3KF2A 1FAKH 1ZHPA 2LPRA 2A2QH 1N8OB 2AGEX 3KQCA 2BOKA 3BSQA 2OBOA 3LIWA 5JBTA 2PTNA 2TGTA 1FPCH 1EPTA 2Y82A 2C93B 1DFPA 3TGKE 2GCTC 3QZQA 1YBWA 4X6OA 1UJ1A 4WF8A 5C5NA 4B71A 2P3FH 2KAIB 4J2YB 1C1OA 1KXEA 1LQDB 3LGYA 1BTXA 1IAUA 1MCTA 3DHKH 2Z6BD 1G3EA 3QTOH 1UHBA 3BTME 3SHCH 2OBQA 1F0RA 1BHXF 3P95A 3SORA 1V2QT 1YKTA 2A0QB 1W7XH 1L0ZA 1NN6A 9LPRA 1O3DA 3TIUA 5G4BA 3RXGA 2HLCA 1VJ9U 4HI3A 1KXFA 3MYWA 3RXSA 1S82A 4A1XA 1LVBA 5ESTE 3LGWA 4Y8YA 1YPHC 6GCHF 3MI4A 3O8RA 2XCFA 2ZQ2A 3A87A 1C2IA 1P2QA 1GBCA 1CA8B 3UQVA 2NU0E 3VXFH 5J4SA 5JB8S 2ANYA 1BIOA 1AZ8A 1T4VH 2OUAA 1Z7KA 1AWFH 1NRQH 1HLTH 1GI9B 3MO3A 1MQ5A 3VGCC 1D6RA 2FTMA 3NXPA 2ZO3H 2VGCB 3E6PH 3U1JB 2ASUB 3MH6A 1QCPA 4ZHLU 3ZZ4A 3S9BA 4GCHG 4CHAC 1F92A 4Q7XA 3UUZA 4K60A 2Y7ZA 1MUEB 3RXUA 4JZFH 1OYTH 3M7TA 4MPVA 1MQ6A 1AFEH 1XKBC 1DLKB 1P01A 1ZTLA 5ABWA 1ZOMA 1SB1H 4BANB 3V7TA 3RXKA 2EA3A 3BG4B 3LONA 1VJAU 1Q2WA 5DP4A 1P9UA 2GCHG 8GCHF 1ZPZA 1IHTH 3GYLB 1GBDA 1C1VH 1LHCH 1LO6A 2GMTC 4XDEA 5PTPA 2VIPA 1BCUH 2FM2A 1K1PA 8KME2 2ALVA 4DURA 5EODA 4CBOA 2FX4A 5DP8A 1SBWA 2ZTXA 1EKBB 1TX8A 4LK4A 3R0FA 1SLUB 1C5MD 1D6WA 3ZZ3A 1O2LA 3E0NB 3VPKA 4FUGA 4RN6A 4X1QU 2BB4A 4MPXA 5B6OA 1IQMA 3MH4A 1Y5UT 2CF8H 3A84A 4KGAA 1OP8A 2ZFRH 3BEUA 1D3PB 1XXFA 2V6NA 1MKXK 3MNXA 1MKXH 1DWDH 1TX6A 1E38B 1TGCA 3ATLA 4NFFA 5AHGH 4A92A 2A1DB 1NTPA 1O3EA 2PWXA 1DDJA 1EUFA 2BDHA 1P3CA 1WV7H 1WQSA 1SHYA 2ZNKH 2BLWA 3Q3KA 1W2KH 5IYTA 2FOAA 1ANDA 1P8VC 1BBRK 4KTSA 1EAUA 5FX5A 2GVFA 2JKHA 1C5QA 2Z9LA 1BBRH 3F6UH 1XUGA 4O9VA 2Y81A 4AFUA 1V3XA 3BTQE 3E91A 3UIRA 3W95A 4UONA 1GHVH 3M3TA 1DT2A 4AYYB 1FPHH 1C1QA 1PPZA 3NPSA 1HAHH 1V2MT 3GDVA 1IQIA 2AMPA 1UVSH 5CE1A 1Q31A 2IJOB 1AFQB 1S0RA 2UUKB 3RXDA 3STIA 1C2DA 3FP6E 2FI3E 1AO5A 2SGEE 1GI8B 2ZA5A 3E16B 2BZ6H 1H1BA 5EXLA 1ZPBA 2J92A 4FUIA 5CHAC 1IQHA 2GKVE 1YM0A 3P6ZB 1INCA 1C5XB 2FOFA 2R2MB 3MNBA 4HGCA 1YPJH 2IN2A 2PGQB 1V2LT 4Y7AA 1SI5H 3SNDA 1W13U 1ZR0A 4MNWA 1W3CA 3M5MA 4CBNA 1TB6H 1Y8TA 1RXPA 1C4V2 5SGAE 1G3DA 4Y76A 1AHTH 3CENA 2JH0D 1OWEA 1P2KA 2C8WB 2A7HA 3T28A 4I8HA 1O30A 1W8BH 3FZZA 1ESBA 3E8LA 1CHGA 4BTUB 1EAWA 5C5OA 3GCHC 2F83A 1GJ8B 4R8TB 2ZTZA 1HAIH 4NA8A 2VIOA 2HGTH 1KLIH 1YLCA 1GBTA 4UFEH 4NSYA 4CREA 2FZZA 1EX3A 2JH5D 1GVKB 3K6YA 1D3DB 1TNHA 2VWOA 1O3KA 3KGPA 3BN9A 1DX5M 3ZVCA 1OP0A 1XUKA 4I8LA 5DP3A 1AD8H 1YCPM 1A1RA 4E7RG 3ZZ9A 1Z8GA 3PO1C 3SJKA 4JZDH 5A0AE 1GMHG 1O39A 1P2JA 4NIYA 4BTTB 2P59A 5AVDA 4JYTA 4B2BA 3TJNA 1S5SA 1DLEA 1C5PA 3KL6A 1PFXC 3ZZ6A 2F9VA 2XXLA 4MVNA 4FU8A 2BY9X 1C5UA 3PMJA 2BD8A 1VGCC 1C2HA 3SGBE 1SQTA 4ISHH 1J17T 2GZ8A 2OINA 2RA0A 2BLVA 4TPYA 3K65B 1FY4A 4UE7H 5HMAA 1P2IA 4WVPE 1C2FA 1BJUA 3SN8A 4DCDA 1MTNC 1SGIB 1QA0A 5BPEA 1C1SA 4GCHF 1GMDG 1TWXB 2THFB 3BIVH 4VGCB 4AB8A 3LC5A 1GBJA 1YPMH 3RM2H 3VXEH 2VIDA 2ZKSA 2GZ9A 1ZYOA 2Q1JA 1GGDB 3BTGE 1O2IA 1C5OH 1J16A 4YOGA 2AFQB 1WCZA 1W0YH 2CMYA 2QC2A 1QJ1B 2R0LA 2W3KA 3RMMH 3M61U 1D3TB 1L1GA 1O2RA 3FANA 1B0EA 2G5VA 3BTTE 2WUCA 4A7IB 1DSTA 4UFGH 1EZSC 3I78A 3F9EA 2G8TA 2G52A 1LPGB 2CV3A 3KHVA 1T7CA 8LPRA 3T5FH 1F5KU 4B73A 1H4WA 1DUAA 1NFXA 4Q2KA 5DPAA 4HFPB 2FODA 5E2PA 1QR3E 1OPHB 2XBVA 1CHOG 1EATA 1V2UT 1C5LH 3QX5H 3SQEE 1EJNA 3QDZB 5EQQA 2Y6TA 3A7VA 4MPUA 1CSOE 4KKDA 1RTFB 1AB9C 2PKSC 1SGQE 1PPCE 1BRUP 1SOZA 4IMQA 1O2SA 1TE0A 1O2QA 1BBRE 3P8OA 4IW4E 1ELCA 2C8XB 3RMLH 5JPMH 2H9EH 4ZH8A 4X8TH 4YOIA 1UCYK 1UCYH 1OX1A 3LT3A 3T29A 3ELAH 1HIAB 2VB0A 5HYOA 2J4IA 5IDKA 1B0FA 3ATIA 1FIWA 2QY0B 3QWCH 4JYUH 1EZXC 4UFFH 1GJCB 2G81E 3H7OA 2O8TA 1MZDA 3BEFB 4ABDA 3U8OH 1EJMA 2STBE 3SUGA 1P02A 2AH4X 4WH6A 1NZQH 3RC5A 1QRWA 4GPGA 1BUIA 2G5NA 4B2CA 4WXVA 3URDA 2OXSA 1H9LB 2BLQA 2V3OH 4MG3A 4ASHA 4Z6AH 1YPEH 1AQ7A 4KTUA 3SUDA 4TYDA 3GY4A 2F9UA 2A5IA 2QAAA 4RKJB 1GBAA 4ZKSU 1G2LA 1AVGH 1Y3UA 2VNTA 4YESB 1TLDA 2QIQA 1UTPA 1ZJKA 2V35A 1BB0B 1ELDE 1GMCG 3TH3H 5JBCS 4CH8B 4ABJA 2HPPH 1LKAA 2P93A 2ZU2A 3HPTB 3SUFA 5A0CA 1W14U 1Z8IB 1C1WH 4WWYA 2CGAA 3HATH 1TONA 2P8OB 2ZZUH 2TPIZ 2HNTE 5BRRE 4X1RU 1GG6C 1O5CB 3M3VA 1KXDA 1HAVB 1SHHB 3SNBA 2ULLA 1GHXH 1ZTKA 1YP9A 1F7ZA 1RFNA 1SLVB 2AGIX 1G3BA 1Y3WA 2BD4A 2PKAA 2PUQH 4GHTA 1YPGH 4AG2A 2ZFFH 3A88A 3UNQA 4X8SH 4IGDA 1JRSA 1B7XB 1OKXA 1ESTA 4XFQA 1BTUA 1K1NA 3H5CB 2VH6A 5AF9H 3EDXB 1HJAC 2EI8A 1O2NA 3OU0A 5EOKA 7LPRA 7KMEH 2Z3DA 2HWLB 1VCQA 3ZV9A 2WPHS 1GHBG 2ZU3A 2OC0A 3SGQE 1SGEE 2Z9KA 1TALA 3VB3A 1O3LA 1UTNA 1V6DA 3OTJE 1FY3A 3RXOA 4CH2B 2RDLA 1DS2E 1GBKA 2G4TA 3T26A 4A6LA 2FP7B 1FUJA 1WBGB 3MFJA 1L2EA 1GCTC 1VITH 1A5HA 5E0GA 4FUHA 1NRPH 5DP6A 5F03A 1P0SH 4ZMAH 1OXGA 2ZHWH 2TIOA 4MNYA 1K1MA 2BQWB 3UFAA 2A45B 2C3SA 2IPHA 3ITIA 1DY9A 4IN1A 3KCGH 3E1XB 4CRGA 1SGNE 3H7TA 3MMGA 1PPHE 1DWCH 3PMAB 1G2MA 1TPAE 3MWIU 1WYKA 2ZCLP 2PTCE 1NROH 1O5EH 3DA9B 4U2WA 1V2PT 3ZZ7A 3LOXA 5T6FA 3PB1E 2FMJA 3SNEA 2GCTB 4U32A 5DGJA 3ZZDA 2K7XA 1GDNA 5F8ZA 3T27A 2P94A 2H9HA 3TJUA 1ABIH 2O8MA 1C2EA 3OY6U 2FXRA 4CRCA 1BJVA 2C8ZB 1EOLA 1FZZA 3S7KB 1MTSA 1C9TA 4ABAA 1HAPH 1A0LA 3KIDU 4WMDA 1UTKA 2Z9GA 1O2XA 2ZHFH 4MLFB 1VCPA 4Y8ZA 1C5RA 4DG4A 1LHEH 2I6QA 4ABHA 1KXBA 4AG1A 1ANCA 3TNTA 2J38A 5DJ7A 2ZFSA 2W5EA 2ZG0H 1C5NH 1BT7A 2WPJS 4Z0KA 3TPIZ 1Z1IA 4B74A 3HGNA 1V2JT 3U98H 1UCYE 2ZU4A 4JZEH 5EW1H 1GBEA 2J34A 1KLTA 1C1UH 1P09A 2FI4E 2GGVB 1THSH 2AERH 1QY6A 1TGSZ 5TCAA 4WMFA 1OWHA 1QQUA 1J14A 1KYNA 3LGIA 1CBWB 1G32B 3ODDA 3SI3H 2P3TB 4ZHMU 2ZC9H 1YF4A 1HDTH 2ZPRA 4Y79A 5FXLA 4NCYA 3QK1A 4KTCA 4H4FA 2FPZA 5EPNA 2ANKH 3VGCB 1SGYE 2IOTA 1ZSJA 3RXLA 3Q00A 2W26A 1RRKA 2W7UA 2HOBA 1SGTA 3AASA 4NIWA 5DP7A 1HRTH 3TNSA 1AMHA 1GI3A 3ZVBA 1CE5A 1CA0C 5GCHG 2FS8A 2OCVB 3QO6A 1XVOA 4UD9H 1TBQH 4BAKB 1GHWH 1L4ZA 3PYHA 1L4DA 1YGCH 3U8RH 1OWJA 3GY7A 5FCRA 3SZNA 2C90B 2XC5A 4Y0YE 5FPSA 1GHAG 1V2VT 2XNIA 3ZVGA 2ZQ1A 1W12U 1ZHMA 4ZKNU 4I8JA 3EAJA 2OC7A 5DP5A 1KDQA 1T31A 4MTBA 3U1IB 1YLDA 5GDSH 1GJ6A 1EP6A 1KTSB 3SBKA 2XBWA 1QFKH 2ZU1A 4YLQH 3KQBA 4FU9A 2NU2E 1N8OC 2UWPA 1XM1A 3BTKE 4K5ZA 4YT7H 2YNBA 1O2PA 3SV8A 1K9OE 4OS1A 1VR1H 4ABIA 2ZFTA 1KSNA 4B1TA 2TGDA 2A32A 3BG8A 5J4QA 2XBYA 2BMGB 2XWBI 1QURH 2G00A 1NS3A 5FX6A 4XBBA 2BD3A 4XBDA 3Q3YA 1CVWH 1KY9A 3A8AA 1ZHRA 5HM2A 2SGQE 3PWCA 3GCTG 5EPYA 1J9CH 2F9PA 1A5GH 2BY6X 1Y3VA 1O3MA 2JETB 1C2KA 1ID5H 3M35A 1P57B 1O3IA 3KN2A 1C4U2 1O3JA 2BM2A 4DVAU 3NKKA 1SR5C 2ZHEH 1IQEA 2WINI 3RU4E 2CHAB 1RJXB 4O03A 1FLEE 2ZFQH 1GI1A 1MKWK 1V2KT 1EZUC 1HJ8A 2F9OA 1GBMA 1MKWH 1HXEH 1IQKA 1C2MA 4FVBA 3RLWH 1BITA 4JK6A 1IQFA 2D2DA 1GI5A 2ZP0H 1L1JA 5T6GA 1NRSH 2ODPA 3T62A 1VITF 1DOJA 5I46H 1A3EH 2XCNA 4MQAA 1L1NA 3P17H 2XYAA 2VIWA 1F0SA 4IS5A 1NRRH 1Y3XA 4DT7B 1E35B 1HAVA 1LVYA 2PW8H 3TJVA 3MNCA 1RS0A 4D9QA 2GP9B 3CS7A 1TRYA 2BTCE 1Z71A 4MNXA 1ARBA 2XRCA 2WPLS 3A8BA 3OYPA 3UY9A 6CHAC 2SNWA 1S6FA 4DIHH 2R0KA 1BRCE 1ELAA 1D4PB 2H5CA 3UOUA 3LC3A 1ZGVA 2HNTC 1MAYA 3ZVFA 1PJPA 3TVJB 1AKSA 1SC8U 1ZGIA 5EG4A 4AB9A 2VH0A 1ZJDA 4K3JA 3IITA 3BG4C 1A0JA 3BTDE 3D49H 2BY7X 3TLOA 2ALPA 2ODQA 2R2WU 4K8BA 3SJOA 1T8OA 1TA2A 2PLXA 1ZRKA 5LGOA 1PYTD 1PYTC 1JBUH 4D9RA 3RXBA 3F9HA 4ISLA 4FUCA 1NFYA 3IG6B 1GHZA 1CGJE 4RSPA 3PMHB 3MU5A 1GVLA 3PO1B 5LPRA 1K1JA 2PUXB 1O2TA 3LDXH 2FO9A 3MOCA 2SGAA 3A8DA 2GT8A 2BDIA 1MTUA 3M5LA 3UWJH 1BRBE 1FDPA 1SGPE 1CT0E 1OP2A 2G4UA 4ABEA 1VGCB 2ZF0H 1P12E 1O3HA 1TA6A 1OYQA 1X7AC 1GHYH 1D3QB 3P70B 2UWLA 3URCA 3S7HB 2BD2A 3A81A 5C2ZA 1TNLA 3UR6A 4A1TA 3ATMA 1Z1JA 3EA9A 5I25A 3QGJA 1K28D 4WH8A 1XUJA 4X1PU 1BHXB 1JMOH 4JK5A 1O3BA 2Y80A 3L33A 1UTOA 3TK6A 4HTCH 2O8WA 4LZ4B 1UK3A 2PSYA 1FIZA 1GI2A 1H8IH 3K2UA 2BHGA 2ZDNA 3D62A 5T3HA 2WYGA 2G55A 4H42U 1AFQC 1EB2A 3F9FA 1O0DH 3AAUA 2BDYA 1TQ0B 1WUNH 1KIGH 2BY5X 2UUJB 3BTHE 1F5RA 1CU1A 4IC5A 1UVPA 1WTHD 3N7OA 1K1OA 3UQOA 3K9XB 7ESTE 3GY5A 1O3FA 1T4UH 1YC0A 1O33A 1V2TT 2BDAA 2GDEH 4CRDA 1THPB 3EYDA 1TIOA 3B9FH 4LXBH 1CT4E 1HUTH 5HXFA 1DXPA 1SFQB 4X1SU 1SSXA 1B5GH 1T8MA 1TPSA 4AGKA 1TNGA 2HRVA 1DITH 1O38A 2GDDA 1AB9B 2BDBA 2PKSB 3MTYA 3RU4T 9ESTA 2Z94A 2YNAA 3UNSA 1GBBA 3PROA 2QXGA 1KXAA 2KAIA 1TFXA 3RXTA 4XSKU 2AGGX 2CXVA 2D26C 4NZLA 1AVWA 2A7JA 1EPTB 1PQ5A 3MU8A 1EQ9A 1N6XA 1O5BB 1AZZA 2GCHF 2Z3CA 3BTFE 1SMFE 2OLGA 3NZIA 5C1XA 5L2ZH 3S0NA 1UTMA 2F9BH 1FY5A 2O8LA 3QN7A 2TBSA 1FN8A 1RIWB 4BXWA 3LGUA 1ZLRA 1MTVA 4ABFA 4JZIA 2ZFPH 1UHBB 1RD3B
chains in the Genus database with same CATH superfamily
4AX9H 1C5YB 1QB9A 4OS2A 3V12A 2D8WA 1QRZA 4WMEA 5FBEA 1V2ST 3ZVEA 7GCHG 1OWIA 1S85A 4X2YA 2WUBA 1GWAA 2YMSD 3SHAH 4DW2U 2TGPZ 3DFLA 3A8CA 4FXGH 2YMSC 4Y11E 4UEHH 2ZHDA 2GV7A 1W10U 1Y59T 1EJAA 1O5GH 4K1SA 4P02A 3F9GA 1BZXE 5GJ4B 2ZPQA 4WY3A 2RG3A 2BXUH 3LJJA 3RC4A 3DSOA 3T2NA 4E05H 1A4WH 4INKA 1P03A 2XTTB 1SL3A 3SUEA 1XUHA 1HB0B 2PHBA 3RMOH 3M5OA 2ZDMA 1XUIA 1QB6A 3ENSB 1FNIA 2VVVA 2VWLA 2ZCKP 2BY8X 1LKBA 2Y5FA 1P2OA 1BOQA 1BTHH 1Z8JB 2VWMA 1HBTH 5K7RA 5DP9A 4VGCC 4GHQA 1O2UA 1A5IA 4FVDA 3RXCA 1DANH 2BX3A 1TPPA 3U69H 3I29A 1O3PB 4M7GA 1NC6A 2FDAA 1CQQA 4Z1MD 1GJ4H 1GBLA 2QF4A 3HKIB 4CR5A 3A7TA 4YZUA 4ZXYH 2GT7A 1LHFH 1N1LA 4X6NA 1PPEE 1O2MA 3O8BA 4D7FA 1HJAB 4D8NA 2QA9E 1NRNH 3ESTA 2FS9A 3F2HA 4D7GA 1TOCB 1QL9A 2FI5E 1AUJA 4OS6A 2FOCA 1EASA 2AYWA 1G36A 1SGRE 1ELEE 2J95A 5A09A 1T8LA 2FX6A 1HAOH 2K1QA 1XXDA 1G9IE 1ZPCA 1GI7B 3M36A 1GL1A 2WV9A 1W11U 4YLUA 1P10A 2F3CE 2J9NA 2UUFB 3RXQA 1TMUH 3UR9A 1OSSA 3RXEA 6GCHG 2M5TA 1TNIA 3RU4D 3Q76A 4IN2A 1HJ9A 4AFSA 4GSOA 1WQVH 2BVXH 2QV1A 3Q77A 3LGVA 5L30H 1GDQA 5E2OA 5ETXA 1P9SA 1XKAC 2KR7A 1S6HA 3U8TH 3MH7A 2QXIA 2P16A 2NU1E 1NFUA 3LGTA 1BA8B 3E3TA 2VJ1A 3EQ0H 5E8EH 4XOJA 3PWBA 5A8ZA 1XUFA 5TJXA 2PFEA 3P8FA 3R3GB 2AMQA 1MD8A 1MBQA 2HNTF 3K6ZA 4SGBE 4UFDH 2D1JA 1EZQA 3IWMA 2OP9A 2STAE 3V0XA 2NWNA 4DJZB 2WPMS 4B6EA 3QZRA 1TMTH 1GMHF 5EU8A 4NIVA 2Z7FE 1SLWB 2FLRH 1YYY1 1Z6JH 1TAWA 1C5VA 8GCHG 1ELTA 3DSPA 3SU1A 4ISOA 2OQ5A 1GJ9B 3PTBA 1GJ7B 4Y10E 3TK5A 1BMAA 1G3CA 5EXNA 2LIZA 2BZAA 4D76A 3C27B 3A7ZA 3KYGA 1ZSKA 3UTUH 1THRH 1ELGA 2B7DH 2J98B 1TGNA 1HXFH 3HK3B 1GMDF 2P8OC 3UWIA 1DVAH 1TRMA 1D9IA 1A7SA 2KZ4A 3KQEA 2A4OA 2SGDE 4U30A 1A61H 2AIPA 1PPBH 1HFDA 3EA8A 4NWKA 4ACBA 4IBLH 3MO9A 4FU7A 1H8ED 1QBNA 5F6MA 3SJ8A 1O2YA 3SV6A 5FCKA 1JOUB 1QJ7B 3FVFB 4FOUC 1E36B 1NPMA 1UTJA 1DICA 1UMAH 1O3AA 3ZYDA 3BIUH 3CP7A 2WSSD 3NUMA 1OWKA 1GJAB 3RXAA 2FYRA 4I8KA 3LPRA 1DM4B 1MH0A 1IQJA 1CHOF 1O34A 1O2OA 2FESH 2ZGBH 1ESAA 2PV9B 3GDUA 2QE7D 3RP2A 1O3NA 4AYVB 5E0HA 3GY3A 3ZZ5A 2BQ7B 3NK8A 2EY4C 4WXIA 5A0BA 1O5DH 2FOMB 2TRMA 3S9AA 1TRNA 1A3BH 2YOLA 3SW2B 1QIXB 4HG6A 1UK4A 1A2CH 1SPJA 1LCYA 3BTEE 4XE4A 5C3NA 4OGXA 3VFEA 1AUTC 1EOJA 1TQ7B 3EE0B 1NBMD 3Q3XA 4X8VH 1TPOA 2ZIQH 4X2VA 4K1TA 1DWEH 3BTWE 3SNAA 4YOJA 1W7GH 1BDAA 2AMDA 2A2XH 2FWWA 3SU0A 1FN6A 2XWAA 3ZZAA 2JIZD 1P05A 2BQ6B 3PV4A 1F2SE 5FAHA 4B2AA 2BDCA 1C5WB 2EQNA 1GI0A 2EC9H 1DSUA 1ANBA 4RKOB 1BTPA 3S69A 2B0FA 1C1NA 3UNRA 4NGAH 4CHAB 3PMBB 5TCCA 2H2ZA 1SGDE 1AN1E 1F0UA 4A5TS 1CO7E 1BMNH 1C1MA 2VBCA 2ZDAH 4NG9H 5FHTA 1NU7B 1LHDH 1HNEE 1A0HB 2H9TH 3LKWA 1AVXA 3MU0A 3TITA 1AU8A 3SOSA 5FL7D 1HAZB 1EXFA 1DY8A 4THNH 1ETRH 1O2ZA 1WTGH 2GMTB 3SV2H 2IPQX 1FONA 4Y71A 3UPEA 4AZ2B 1QB1A 1GMCF 2KCPA 4MPWA 3GOVB 3HKJB 3E90B 2Q6DA 3SI4H 4OS5A 2C8YB 5A2MH 1HAXB 3V3MA 5E0JA 1DWBH 2SGFE 4U01A 4ABBA 3MO6A 3VB7A 1O5AB 2A31A 3ZZBA 2EI7A 3GICB 1YWUA 4DIIH 3U9AH 5C0TA 2QF0A 3RMNH 2KCAA 3RLYH 1HIAA 1E37B 2BD7A 2XC4A 1O37A 1CBWC 3A89A 3QUMP 3UREA 1OS8A 1GVZA 3LH3A 2A5AA 1SQOA 1O2JA 5JB9S 1GCDA 1PQ8A 3GCOA 1S83A 1YCPK 1DXWA 2OC8A 4FUEA 2ZI2H 1YCPH 3T25A 3PLKA 3GDSA 1QL8A 4AGJA 4X8UH 1DE7H 4LZ1H 3ZZ8A 4X2WA 3GY8A 5JBBS 4E7NA 5LH8A 5FPTA 3BV9B 4O3TA 3GY2A 1MCVA 1F5LA 1XVMA 6CHAB 1GHBF 4X6PA 1DUEA 4INLA 1BTWA 3KNXA 1MBMA 1SVPA 4I33A 1OOKB 4NIXA 5EQSA 4BAOB 1E0FD 1JIRA 2JDID 2PR3A 5KGOA 1O35A 2J94A 2LELA 1TGBA 4GAWA 2QN5T 1O36A 3NRLA 3F68H 2QGRA 3STJA 2AS9A 1JWTA 3FP8E 2A4QA 1FQ3A 2FOGA 1QA7A 1SQAA 5CHAB 3M7QA 3FP7E 1QZ8A 1EB1H 2H1UA 3L6PA 5C94A 3PRBA 2A5KA 1TMBH 2BX4A 3SQHE 1VZQH 3SJ9A 1IOEA 1ZTJA 4KELA 2C4FH 5DK1A 4Y8XA 3SGAE 5AFYH 2VGCC 3ZYEA 1LTOA 5EGMA 1UTLM 5F8XA 1C5SA 1TBZH 3OX7U 4MDSA 2V3HH 4GLYA 4ZKRU 2O8UA 4SGAE 3D65E 4X1NU 1EAXA 1HAYB 1O3OA 1MAXA 2AEIH 3OSYA 4BNRA 3GCHB 5A8XA 3TGJE 4Y0ZE 3M7UA 3A7YA 1MU8B 4AFQA 2PKAB 3EA7A 1E34B 1S81A 1WU1A 4I8GA 1SFIA 2VVCA 2QXJA 3JZ2B 1AIXH 4LOYH 2JETC 2B5TB 3RXFA 1P2MA 4K2YA 4F48B 2Q6FA 2AIQA 4DOQA 3GYMA 1EAIA 4ZROA 3PLBA 1K21H 2BXTH 2VWNA 1P04A 4K69A 2NU3E 3G01A 5LPEA 4FUFA 5L6NH 1ZMNA 1LQEA 3OE7D 1EP5A 4NA9H 3RXVA 1RTKA 2CHAC 2W3IA 3TK9A 4NZQA 1E1RD 4BAMB 2JJ2D 1IHSH 1C5TA 4HZHA 4X6MA 4YO9A 1G30B 2A7CA 5CHBA 5KEDA 3M5NA 3PTNA 4ZKOU 1QHRB 1UVTH 1CGIE 4A1VA 3P92A 4ZUHA 4R0IA 4CRBA 3KQ5A 3MNSA 2BVSH 2TGAA 1GBIA 3V13A 3ZZCA 1A46H 1SOTA 3S9CA 1JXPA 2ZU5A 1AE5A 1OWDA 1MTNB 1ETTH 1QJ6B 2ANWA 2Y7XA 2SGPE 2VINA 3A82A 5GWZA 5HGGA 1FXYA 5F53A 5GCHF 2WV4A 1W0ZU 1Y5AT 5FBIA 2F9NA 1SG8B 4I7YH 2R3YA 2HVXA 2BYAX 5HM9A 1LVOA 3O8CA 1FY1A 1MU6B 1GJDB 3SV7A 4FUJA 3OY5U 2LNCA 3MHWU 1NO9H 2VIVA 2NU4E 3QTVH 1O31A 4I32A 4JZ1A 1GHAF 1QNJA 1QQ4A 2ZGHA 5K0HA 1HYLA 3FZDA 1JIMA 3WW7A 2P95A 2XNDD 1V2OT 3GISB 1NM6A 5FPYA 3OAAD 3W94A 1LPZB 4XD7D 3NWUA 5GPIB 3UOPA 5LPFA 1C1PA 3LJOA 1Q3XA 2WPIS 1QGFA 2YMSB 1V2NT 2CF9H 4YTAA 2OTVA 2ZEBA 2FOBA 3GY6A 1DPOA 1ELBA 1K1LA 4MNVA 4ZAEA 2Z9IA 3C1KA 5T6DA 4P00A 2BD9A 1O2HA 1FV9A 2HPQH 1V2RT 2DE9A 2PGBB 1KLJH 3BEIB 1TNJA 1P11E 2WV5A 2ZECA 3AW1A 2BVRH 1KXCA 3VEQB 4FUDA 3RXIA 1U6QA 3RUOA 1GJ5H 1ABJH 1GL0E 1GJBB 3AW0A 2UUYA 3ZV8A 2FOEA 3GCTF 4OS7A 1O2GH 4YT6H 1PPFE 5GNDA 1IQNA 1TBRH 1CT2E 1UK2A 4B76A 4KP0A 2DE8A 1F0TA 3RDZA 4Q7YA 3KYFA 4IC6A 6ESTA 1SGFG 3RXRA 2H5DA 1ARCA 1GI4A 2XBXA 1WAYB 3SU3A 1YPHE 5EJLA 3RXHA 3ATWA 6LPRA 1WOFA 4E06H 4TY6A 1XX9A 2GTBA 2VU8E 1ZRBA 3P8GA 3TH4H 4B75A 1UTQA 5L2YH 5DG6A 1QBOA 2QF3A 1MD7A 2ZHQH 2RCEA 1ETSH 2R9PA 3DFJA 1Z6EA 5ESBA 1JRTA 3RC6A 3O8DA 1P3EA 1G37A 3EBNA 1K1IA 2ESTE 2UWOA 2G51A 3E0PB 4O3UA 1P06A 3A85A 3MU4A 2VVUA 1W0JD 3A86A 1M9UA 2OQUA 3SNCA 3FAOA 1QL7A 4NFEA 2Y5GA 4PROA 4ZHAA 1N6YA 8ESTE 3KQDA 1GDUA 1KDQB 1Y3YA 2ANMH 1NT1A 1TGTA 4OGYA 1GG6B 4XBCA 4ABGA 2SFAA 2ZGJA 2Z3EA 2PSXA 3I77A 1AGJA 3A7WA 2GD4B 4Q80A 2H6MA 2J2UA 2JH6D 3A83A 2ZDKA 3M37A 4CRAA 1GGDC 1GBFA 1K22H 4BOHA 3SZEA 3TU7H 4NSVA 1EPTC 1C1TA 1TABE 2B9LA 3SU6A 2QYIA 5C67A 4WJG2 4AFZA 5H4IB 1UO6A 4K1EA 1NY22 1T32A 1O2KA 1S84A 1TNKA 5EJ1A 4XRNA 1RIWC 2O9QA 3H09A 2GX4A 5EQRA 5JYIA 3LH1A 2GZ7A 2L74A 2W7SA 1NESE 2OC1A 3WY8A 4K8YA 3PM3A 2ZWLH 1QTFA 5C1UA 3FOAA 4AOQA 4J1YA 4X0WU 4I31A 2F91A 1YPLH 2ILNA 3ATKA 4Y7BA 3RXPA 1GI6A 2HALA 4OS4A 2ZGXH 3RXMA 2FYQA 1FAXA 2DUCA 2OD3B 1ACBE 1J15A 3HGPA 3VB5A 3VB4A 4RI0A 3SJIA 2Q6GA 1GCTB 5C20A 1C5ZB 1C2JA 2BLOA 2CN0H 3LU9B 5GXPA 1ELFA 4ISIH 1AE8H 1TX7A 2BOHB 3ZVDA 2I6SA 4F49A 2P3UB 3AAVA 4AORA 2ZGCA 1VKYA 2CK3D 3SO3A 4ESTE 4H6TA 2CJIA 3B8JA 3W1EA 2XC0A 4ISNA 3VB6A 1PPGE 1FMGA 1AI8H 5DO4H 2ZDVH 1AY6H 1LMWB 1SGFA 3SV9A 2RA3A 5DKMA 3ZVAA 2FTLE 3QLPH 3CS0A 1TOMH 1NFWA 1K2I1 3GCNA 2SNVA 3OTPA 4TWWA 2IJD1 1HGTH 4YM9A 3DT0H 2B8OH 3L3TA 4X2XA 3DD2H 1BRAA 2ODYB 5EW2H 3PLPA 1NU9A 1P2NA 4O97A 4QT8C 4JMYA 2FIRH 3BF6H 3MH5A 1MMJN 1H9IE 2HLDD 1WSSH 1QBVH 3AK5A 1MABB 4GUXA 1PQAA 1TYNA 1LVMA 4CRFA 1V2WT 2FEQH 3SU5A 2EI6A 2V7QD 2FLBH 3P8NA 2ZDLA 1AKSB 2L6OA 2ZTYA 1UVUH 3NCLA 3OEHD 3DUXH 2BD5A 5CDFE 1HCGA 3A7XA 1ANEA 1O3GA 2Z9JA 4UDWH 5EXMA 1QRXA 4Q4LA 1C1RA 1HV7A 1SLXB 2ZCHP 3RM0H 1ZMLA 1O32A 3TH2H 4INHA 5F8TA 1H9HE 3D23A 2WYJA 1BMLA 5GIBA 4JCNA 2WPKS 4BAHB 3RXJA 2PP6A 2V3MA 1C4Y2 2XW9A 3KEEA 3ODFA 4DT4A 4DGJA 1S0QA 3F1SB 1GPZA 4TWYA 1LDTT 2A4RA 4CR9A 4BXSA 2EEKA 1HPGA 1VITG 2VIQA 3ZIAD 1IQGA 1FY8E 2ZPSA 4RT0A 1GBHA 4BAQB 5EIYA 4JYVH 4H6SB 1LPKB 3SU4A 1RTLA 1C2LA 1MTWA 1VCWA 3B23B 4ZXXH 3M3SA 3EGKH 1O2VA 1BMMH 3HK6B 4TPIZ 1LHGH 4ACAA 1AWHB 1ZSLA 1T8NA 3MU1A 3QGNB 5JBAS 3TGIE 4F4OC 4IMZA 2V0BA 1CA0B 1SGCA 5C1YA 3SU2A 7GCHF 4BTIB 1COWD 1FJSA 4GVUA 1PQ7A 3FFGA 4Q7ZA 4Y6DA 1Y5BT 5CMXH 3JZ1B 3N99A 1HAGE 4AN7A 5A8YA 1H8DH 1XMNB 4TY7A 1ZZZA 1ORFA 3TJOA 1BTZA 2A4GA 1MZAA 1BTYA 1FI8A 1IQLA 2FOHA 2BDGA 1O5FH 1O2WA 1YPKH 4DY7B 1C2GA 1ELVA 1RGQA 1ZMJA 4RT1A 2GV6A 2Y5HA 1BMFD 3AVZA 3DCLA 5JDUB 4FUBA 4NWLA 1J8AA 5AFZH 3A80A 1O3CA 1Z8RA 1CGHA 2R3UA 2QCYA 1BQYA 4NA7A 1UVOA 1SQRA 1KTTB 1C9PA 2QXHA 3KF2A 1FAKH 1ZHPA 2LPRA 2A2QH 1N8OB 2AGEX 3KQCA 2BOKA 3BSQA 2OBOA 3LIWA 5JBTA 2PTNA 2TGTA 1FPCH 1EPTA 2Y82A 2C93B 1DFPA 3TGKE 2GCTC 3QZQA 1YBWA 4X6OA 1UJ1A 4WF8A 5C5NA 4B71A 2P3FH 2KAIB 4J2YB 1C1OA 1KXEA 1LQDB 3LGYA 1BTXA 1IAUA 1MCTA 3DHKH 2Z6BD 1G3EA 3QTOH 1UHBA 3BTME 3SHCH 2OBQA 1F0RA 1BHXF 3P95A 3SORA 1V2QT 1YKTA 2A0QB 1W7XH 1L0ZA 1NN6A 9LPRA 1O3DA 3TIUA 5G4BA 3RXGA 2HLCA 1VJ9U 4HI3A 1KXFA 3DSGA 2GJGA 3MYWA 3RXSA 1S82A 4A1XA 1LVBA 5ESTE 3LGWA 4Y8YA 1YPHC 6GCHF 3MI4A 3O8RA 2XCFA 2ZQ2A 3A87A 1C2IA 1P2QA 1GBCA 1CA8B 3UQVA 2NU0E 3VXFH 5J4SA 5JB8S 2ANYA 1BIOA 1AZ8A 3FO8D 1T4VH 2OUAA 2WHXA 1Z7KA 1AWFH 1NRQH 1HLTH 1GI9B 3MO3A 1MQ5A 3VGCC 1D6RA 2FTMA 3NXPA 2ZO3H 2VGCB 3E6PH 3U1JB 2ASUB 3MH6A 1QCPA 4ZHLU 3ZZ4A 3S9BA 4GCHG 4CHAC 1F92A 4Q7XA 3UUZA 4K60A 2Y7ZA 1MUEB 3RXUA 4JZFH 1OYTH 3M7TA 4MPVA 1MQ6A 1AFEH 5DSFA 1XKBC 1DLKB 1P01A 1ZTLA 5ABWA 1ZOMA 1SB1H 4BANB 3V7TA 3RXKA 2EA3A 3BG4B 3LONA 1VJAU 1Q2WA 5DP4A 1P9UA 2GCHG 8GCHF 1ZPZA 1IHTH 3GYLB 1GBDA 1C1VH 1LHCH 1LO6A 2GMTC 4OM9A 4XDEA 5PTPA 2VIPA 1BCUH 2FM2A 4Q63A 1K1PA 8KME2 2ALVA 4DURA 5EODA 4CBOA 2FX4A 5DP8A 1SBWA 2ZTXA 1EKBB 1TX8A 4LK4A 3R0FA 1SLUB 5IK2D 1C5MD 1D6WA 3ZZ3A 1O2LA 3E0NB 3VPKA 4FUGA 4RN6A 4X1QU 2BB4A 4MPXA 5B6OA 1IQMA 3MH4A 1Y5UT 2CF8H 3A84A 4KGAA 1OP8A 2W6ID 2ZFRH 3BEUA 1D3PB 1XXFA 2V6NA 1MKXK 3MNXA 1MKXH 1DWDH 1TX6A 1E38B 1TGCA 3ATLA 4NFFA 5AHGH 4A92A 2A1DB 2RDEA 1NTPA 1O3EA 2PWXA 1DDJA 1EUFA 5HIYA 2BDHA 1P3CA 1WV7H 1WQSA 1SHYA 2ZNKH 2BLWA 3OFND 3Q3KA 1W2KH 5IYTA 3PRDA 5HKKD 2FOAA 1ANDA 1P8VC 1BBRK 4KTSA 1EAUA 5FX5A 2GVFA 2JKHA 1C5QA 2Z9LA 1BBRH 3F6UH 1XUGA 4O9VA 2Y81A 4AFUA 1V3XA 3BTQE 3E91A 3UIRA 3W95A 4UONA 1GHVH 3M3TA 1DT2A 3N7EA 4AYYB 1FPHH 1C1QA 1PPZA 3NPSA 1HAHH 1V2MT 3GDVA 1IQIA 2AMPA 1UVSH 1OHHD 5CE1A 1Q31A 2IJOB 1AFQB 1S0RA 2UUKB 3RXDA 3STIA 1C2DA 3FP6E 3UB0A 2FI3E 1AO5A 2SGEE 1GI8B 2ZA5A 3E16B 2BZ6H 1H1BA 5EXLA 1ZPBA 2J98A 2J92A 4FUIA 5CHAC 1IQHA 2GKVE 1YM0A 3P6ZB 5EJZA 1INCA 1C5XB 2FOFA 2R2MB 3MNBA 4HGCA 1YPJH 2IN2A 2PGQB 1V2LT 4Y7AA 1SI5H 3SNDA 1W13U 1ZR0A 4MNWA 1W3CA 3M5MA 4CBNA 1TB6H 1Y8TA 1RXPA 1C4V2 5SGAE 2WPDD 1G3DA 4Y76A 1AHTH 3CENA 2JH0D 3F3BA 1OWEA 1P2KA 2C8WB 2A7HA 3T28A 4I8HA 1O30A 1W8BH 3N7DA 3FZZA 1ESBA 3E8LA 1CHGA 4BTUB 1EAWA 5C5OA 3GCHC 2F83A 1GJ8B 4R8TB 2ZTZA 1HAIH 4NA8A 2VIOA 2HGTH 1KLIH 1YLCA 1GBTA 4UFEH 4NSYA 4CREA 2FZZA 1EX3A 2JH5D 1GVKB 3K6YA 1D3DB 1TNHA 2VWOA 1O3KA 3KGPA 3BN9A 4M9FA 1DX5M 3ZVCA 1OP0A 1XUKA 4I8LA 5DP3A 1AD8H 1YCPM 1A1RA 4E7RG 3ZZ9A 1Z8GA 4B6FA 3PO1C 3SJKA 4JZDH 5A0AE 1GMHG 1O39A 1P2JA 4NIYA 4BTTB 3WWBA 2P59A 5AVDA 4TSFD 4JYTA 4B2BA 3TJNA 1S5SA 1DLEA 1C5PA 3KL6A 1PFXC 3ZZ6A 2F9VA 2XXLA 4MVNA 4FU8A 2BY9X 1C5UA 3PMJA 2BD8A 1VGCC 1C2HA 1SKYE 3SGBE 1SQTA 4ISHH 1J17T 2GZ8A 2OINA 2RA0A 2BLVA 4TPYA 2F4LA 3K65B 1FY4A 4UE7H 5HMAA 1P2IA 4WVPE 1C2FA 1BJUA 3SN8A 4DCDA 1MTNC 1SGIB 1QA0A 5BPEA 1C1SA 4GCHF 1WDIA 1GMDG 1TWXB 2THFB 1KMHB 3BIVH 4VGCB 4AB8A 3LC5A 1GBJA 1YPMH 3RM2H 3VXEH 2VIDA 2ZKSA 2GZ9A 1ZYOA 2Q1JA 1GGDB 3BTGE 1O2IA 1C5OH 1J16A 4YOGA 2AFQB 1WCZA 1W0YH 2CMYA 2QC2A 1QJ1B 2R0LA 2W3KA 3RMMH 3M61U 1D3TB 1L1GA 1O2RA 3FANA 1B0EA 2G5VA 3BTTE 2WUCA 4A7IB 1DSTA 4UFGH 1EZSC 3I78A 3F9EA 2G8TA 2G52A 1LPGB 2CV3A 3KHVA 1T7CA 8LPRA 3T5FH 1F5KU 4B73A 1H4WA 1DUAA 1NFXA 4Q2KA 5DPAA 4HFPB 2FODA 5E2PA 1QR3E 1OPHB 2XBVA 1CHOG 1EATA 1V2UT 1C5LH 3QX5H 3SQEE 1EJNA 3QDZB 2QF5A 5EQQA 2Y6TA 3VG8A 3A7VA 4MPUA 1CSOE 4KKDA 1RTFB 1AB9C 2PKSC 1SGQE 1PPCE 1BRUP 1SOZA 4IMQA 1O2SA 1TE0A 1O2QA 1BBRE 3P8OA 4IW4E 2OK5A 1ELCA 2C8XB 3RMLH 5JPMH 2H9EH 4ZH8A 4X8TH 4YOIA 1UCYK 3UAIC 1UCYH 1OX1A 3LT3A 3T29A 3ELAH 1HIAB 2VB0A 5HYOA 2J4IA 2K8IA 5IDKA 1B0FA 3ATIA 1FIWA 2QY0B 3QWCH 4JYUH 1EZXC 4UFFH 1GJCB 2G81E 3H7OA 2O8TA 1MZDA 3BEFB 4ABDA 3U8OH 1EJMA 3F2FA 2STBE 4YXWD 3SUGA 1P02A 2AH4X 4WH6A 1NZQH 3RC5A 1QRWA 4GPGA 1BUIA 2G5NA 4B2CA 4WXVA 3URDA 2OXSA 1H9LB 2BLQA 2V3OH 4MG3A 4ASHA 4Z6AH 1YPEH 1AQ7A 4KTUA 3SUDA 4TYDA 3GY4A 2F9UA 2A5IA 2QAAA 4RKJB 1GBAA 4ZKSU 4ASUD 1G2LA 1AVGH 1Y3UA 1YLNA 2VNTA 2KX4A 1TLDA 2QIQA 1UTPA 4YESB 1ZJKA 2V35A 1BB0B 3PV2A 1ELDE 1GMCG 3TH3H 5JBCS 4CH8B 4ABJA 2HPPH 1LKAA 2P93A 2ZU2A 3HPTB 3SUFA 5A0CA 1W14U 1Z8IB 1C1WH 4WWYA 2CGAA 3HATH 1TONA 2P8OB 2ZZUH 2TPIZ 2HNTE 5BRRE 4X1RU 1GG6C 1O5CB 3M3VA 1KXDA 1HAVB 1SHHB 3SNBA 2ULLA 1GHXH 1ZTKA 1YP9A 1F7ZA 1RFNA 1SLVB 2AGIX 1G3BA 1Y3WA 2BD4A 2PKAA 2PUQH 4GHTA 1YPGH 4AG2A 2ZFFH 3A88A 3UNQA 4X8SH 4IGDA 1JRSA 3GS9A 1B7XB 1OKXA 1ESTA 4XFQA 1BTUA 1K1NA 3H5CB 2VH6A 5AF9H 3EDXB 1HJAC 2EI8A 1O2NA 3OU0A 5EOKA 7LPRA 7KMEH 2Z3DA 2HWLB 1VCQA 3ZV9A 2WPHS 1GHBG 2ZU3A 2OC0A 3SGQE 1SGEE 2Z9KA 1TALA 3VB3A 1O3LA 1UTNA 1V6DA 3OTJE 1FY3A 3RXOA 4CH2B 2RDLA 1DS2E 1GBKA 2G4TA 3T26A 4A6LA 2FP7B 1FUJA 1WBGB 3MFJA 1L2EA 3FN8A 1GCTC 1VITH 1A5HA 5E0GA 4FUHA 1S6LA 1NRPH 5DP6A 5F03A 1P0SH 4ZMAH 1OXGA 2ZHWH 2TIOA 4MNYA 1K1MA 2BQWB 3UFAA 2A45B 2C3SA 2IPHA 2KFWA 3ITIA 1DY9A 4IN1A 3KCGH 3E1XB 4CRGA 1SGNE 3H7TA 3MMGA 1PPHE 1DWCH 3PMAB 1G2MA 1TPAE 3MWIU 1WYKA 2ZCLP 2PTCE 1NROH 1O5EH 3DA9B 4U2WA 1V2PT 3ZZ7A 3LOXA 5T6FA 3PB1E 2FMJA 3SNEA 2GCTB 1YY3A 4U32A 5DGJA 3ZZDA 2K7XA 1GDNA 2XOKD 5F8ZA 3T27A 2P94A 2H9HA 3TJUA 1ABIH 2O8MA 1C2EA 3PV5A 3OY6U 2FXRA 4CRCA 1BJVA 2C8ZB 1EOLA 1FZZA 3S7KB 1MTSA 1C9TA 5HIZA 4ABAA 1HAPH 1A0LA 3KIDU 4WMDA 1UTKA 2Z9GA 1O2XA 2ZHFH 4MLFB 2JJ1D 1VCPA 3U28C 4Y8ZA 1C5RA 4DG4A 1LHEH 2I6QA 4ABHA 1KXBA 4AG1A 1ANCA 3TNTA 2J38A 5DJ7A 2ZFSA 2W5EA 1FX0B 2ZG0H 1C5NH 1BT7A 2WPJS 4Z0KA 3TPIZ 1Z1IA 4B74A 3HGNA 1K0HA 1V2JT 3U98H 1UCYE 2ZU4A 4ZCNA 4JZEH 5EW1H 1GBEA 2J34A 1KLTA 1C1UH 1P09A 2FI4E 2GGVB 1THSH 2AERH 1QY6A 1TGSZ 1E79D 5TCAA 2LP6A 4WMFA 1OWHA 1QQUA 1J14A 1KYNA 3LGIA 1CBWB 1G32B 3ODDA 3SI3H 2P3TB 4ZHMU 2ZC9H 4FETA 1YF4A 1HDTH 2ZPRA 4Y79A 5FXLA 4NCYA 3QK1A 4KTCA 4H4FA 2FPZA 1EFRD 5EPNA 2ANKH 3VGCB 1SGYE 2IOTA 1ZSJA 3RXLA 3Q00A 2W26A 1RRKA 2W7UA 2HOBA 1SGTA 3AASA 4NIWA 3MQKC 5DP7A 1HRTH 3TNSA 1AMHA 1GI3A 3ZVBA 1CE5A 1CA0C 5GCHG 2FS8A 2OCVB 3QO6A 1XVOA 5C0UA 4UD9H 1TBQH 4BAKB 1GHWH 2F43B 1L4ZA 3PYHA 1L4DA 1YGCH 3U8RH 1OWJA 3GY7A 5FCRA 3SZNA 2C90B 2XC5A 4Y0YE 2J97A 5FPSA 1GHAG 3WWFA 1V2VT 2XNIA 3ZVGA 2ZQ1A 1W12U 1ZHMA 4ZKNU 4I8JA 3EAJA 2OC7A 5DP5A 1KDQA 1T31A 4MTBA 3U1IB 1YLDA 5GDSH 1GJ6A 1EP6A 1KTSB 3SBKA 2XBWA 1QFKH 2ZU1A 4YLQH 3KQBA 4FU9A 2NU2E 1N8OC 2UWPA 1XM1A 3BTKE 4K5ZA 4YT7H 2YNBA 1O2PA 3SV8A 1K9OE 4OS1A 1VR1H 4ABIA 2ZFTA 1KSNA 4B1TA 2TGDA 2A32A 3BG8A 2J5UA 5J4QA 2XBYA 2BMGB 2XWBI 1QURH 2G00A 1NS3A 5FX6A 4XBBA 2BD3A 4XBDA 3Q3YA 1CVWH 1KY9A 3A8AA 1ZHRA 5HM2A 2SGQE 3PWCA 3GCTG 5EPYA 1J9CH 2F9PA 1A5GH 2BY6X 1Y3VA 1O3MA 2JETB 1C2KA 1ID5H 3M35A 1P57B 1O3IA 2KCYA 1W0KD 2HVYB 3KN2A 5T1VA 1C4U2 1O3JA 2BM2A 4DVAU 3NKKA 1SR5C 2ZHEH 1IQEA 2WINI 3RU4E 2CHAB 1RJXB 4O03A 1FLEE 2ZFQH 1GI1A 1MKWK 1V2KT 1EZUC 1HJ8A 2F9OA 1GBMA 1MKWH 1HXEH 1IQKA 1C2MA 4FVBA 3RLWH 1BITA 4JK6A 1IQFA 2D2DA 1GI5A 4AC9A 2ZP0H 1L1JA 5T6GA 1NRSH 2ODPA 3T62A 1VITF 1DOJA 5I46H 1A3EH 2XCNA 4MQAA 1L1NA 3P17H 2XYAA 2VIWA 1F0SA 4IS5A 1NRRH 1Y3XA 4DT7B 1E35B 1HAVA 1LVYA 2PW8H 3TJVA 2RFKC 3MNCA 1RS0A 4D9QA 2GP9B 3CS7A 1TRYA 2BTCE 4TT3D 1Z71A 4MNXA 1ARBA 2XRCA 1WXRA 2WPLS 3A8BA 3OYPA 3UY9A 6CHAC 2SNWA 1S6FA 4DIHH 2R0KA 1BRCE 1ELAA 1D4PB 2KCOA 2H5CA 3UOUA 3LC3A 1ZGVA 2HNTC 1MAYA 3ZVFA 1PJPA 3TVJB 1AKSA 1SC8U 1ZGIA 5EG4A 4AB9A 2VH0A 1ZJDA 4K3JA 3IITA 3BG4C 1A0JA 3BTDE 3D49H 2BY7X 3TLOA 2ALPA 2KM0A 2ODQA 2R2WU 3CNRA 3OEED 1UW7A 4K8BA 3SJOA 1T8OA 3F0PA 1TA2A 2PLXA 1ZRKA 3SYJA 5LGOA 1PYTD 1PYTC 1JBUH 4D9RA 3RXBA 3F9HA 4ISLA 4FUCA 1NFYA 3IG6B 1GHZA 1CGJE 4RSPA 1E1QD 3MU5A 3PMHB 1GVLA 3PO1B 5LPRA 4F55A 1K1JA 2PUXB 1O2TA 3LDXH 2FO9A 3MOCA 2SGAA 3A8DA 2GT8A 2BDIA 1MTUA 3M5LA 3UWJH 1BRBE 1FDPA 1SGPE 1CT0E 2AHME 1OP2A 2G4UA 4ABEA 1VGCB 2ZF0H 1P12E 5B6LA 4I86A 1O3HA 1TA6A 1OYQA 1X7AC 5C17A 1GHYH 1D3QB 5KECA 3P70B 2UWLA 3URCA 3S7HB 2BD2A 3A81A 5C2ZA 1TNLA 3F0OA 3UR6A 4A1TA 3ATMA 1Z1JA 3EA9A 5I25A 3QGJA 1K28D 4WH8A 1XUJA 4X1PU 1BHXB 1JMOH 4JK5A 1O3BA 2Y80A 3L33A 1UTOA 3F2GA 3TK6A 4HTCH 2O8WA 5DN6D 3EE7A 4LZ4B 1UK3A 2PSYA 1FIZA 1GI2A 1H8IH 3K2UA 2BHGA 2ZDNA 3D62A 2K0QA 5T3HA 2WYGA 2G55A 2M2AA 4H42U 1AFQC 1EB2A 1NBME 3F9FA 1O0DH 3AAUA 2BDYA 1TQ0B 1WUNH 1KIGH 2BY5X 2UUJB 3BTHE 1F5RA 1CU1A 4IC5A 1UVPA 1WTHD 3N7OA 1K1OA 3UQOA 3K9XB 7ESTE 3GY5A 2WZQA 1O3FA 1T4UH 1YC0A 1O33A 1V2TT 2BDAA 2GDEH 4CRDA 1THPB 3FKSD 3EYDA 1TIOA 3B9FH 4LXBH 1CT4E 1HUTH 5HXFA 1DXPA 1SFQB 4X1SU 1SSXA 1B5GH 1T8MA 1TPSA 4AGKA 1TNGA 2HRVA 1DITH 1O38A 1AB9B 2BDBA 2GDDA 2PKSB 3MTYA 3RU4T 9ESTA 2Z94A 2YNAA 3UNSA 1GBBA 3PROA 2QXGA 2W6JD 1KXAA 2KAIA 1TFXA 3RXTA 1H8HD 4XSKU 2AGGX 2CXVA 2D26C 4NZLA 1AVWA 2A7JA 1EPTB 1PQ5A 3MU8A 1EQ9A 1N6XA 1O5BB 1AZZA 2GCHF 2Z3CA 3BTFE 1SMFE 2OLGA 3NZIA 5C1XA 5L2ZH 3S0NA 1UTMA 2F9BH 1FY5A 2O8LA 3QN7A 2TBSA 1FN8A 1RIWB 4BXWA 3LGUA 1ZLRA 1MTVA 4ABFA 4JZIA 2ZFPH 1UHBB 1RD3B
chains in the Genus database with same CATH topology
4AX9H 1C5YB 1QB9A 4OS2A 3V12A 2D8WA 1QRZA 4WMEA 5FBEA 1V2ST 3ZVEA 7GCHG 1OWIA 1S85A 4X2YA 2WUBA 1GWAA 4DW2U 3SHAH 2TGPZ 3DFLA 3A8CA 4FXGH 4Y11E 4UEHH 2ZHDA 2GV7A 1W10U 1Y59T 1EJAA 1O5GH 4K1SA 3F9GA 1BZXE 5GJ4B 2ZPQA 4WY3A 2RG3A 2BXUH 3LJJA 3RC4A 3T2NA 4E05H 1A4WH 4INKA 1P03A 2XTTB 1SL3A 3SUEA 1XUHA 1HB0B 2PHBA 3RMOH 3M5OA 2ZDMA 1XUIA 1QB6A 3ENSB 1FNIA 2VVVA 2VWLA 2ZCKP 2BY8X 1LKBA 2Y5FA 1P2OA 1BOQA 1BTHH 1Z8JB 2VWMA 1HBTH 5K7RA 5DP9A 4VGCC 4GHQA 1O2UA 1A5IA 4FVDA 3RXCA 1DANH 2BX3A 1TPPA 3U69H 3I29A 1O3PB 4M7GA 1NC6A 2FDAA 1CQQA 1GJ4H 1GBLA 3HKIB 4CR5A 3A7TA 4YZUA 4ZXYH 2GT7A 1LHFH 1N1LA 4X6NA 1PPEE 1O2MA 3O8BA 4D7FA 1HJAB 4D8NA 2QA9E 1NRNH 3ESTA 2FS9A 4D7GA 1TOCB 1QL9A 2FI5E 1AUJA 4OS6A 2FOCA 1EASA 2AYWA 1G36A 1SGRE 1ELEE 2J95A 5A09A 1T8LA 2FX6A 1HAOH 2K1QA 1XXDA 1G9IE 1ZPCA 1GI7B 3M36A 1GL1A 1W11U 4YLUA 1P10A 2F3CE 2J9NA 2UUFB 3RXQA 1TMUH 3UR9A 1OSSA 3RXEA 6GCHG 2M5TA 1TNIA 3RU4D 3Q76A 4IN2A 1HJ9A 4AFSA 4GSOA 1WQVH 2BVXH 2QV1A 3Q77A 3LGVA 5L30H 1GDQA 5E2OA 5ETXA 1P9SA 1XKAC 1S6HA 3U8TH 3MH7A 2QXIA 2P16A 2NU1E 1NFUA 3LGTA 1BA8B 3E3TA 2VJ1A 3EQ0H 5E8EH 4XOJA 3PWBA 5A8ZA 1XUFA 5TJXA 2PFEA 3P8FA 3R3GB 2AMQA 1MD8A 1MBQA 2HNTF 3K6ZA 4SGBE 4UFDH 2D1JA 1EZQA 3IWMA 2OP9A 2STAE 3V0XA 2NWNA 4DJZB 2WPMS 3QZRA 1TMTH 1GMHF 5EU8A 4NIVA 2Z7FE 1SLWB 2FLRH 1YYY1 1Z6JH 1TAWA 1C5VA 8GCHG 1ELTA 3SU1A 4ISOA 2OQ5A 1GJ9B 3PTBA 1GJ7B 4Y10E 3TK5A 1BMAA 1G3CA 5EXNA 2LIZA 2BZAA 4D76A 3C27B 3A7ZA 1ZSKA 3UTUH 1THRH 1ELGA 2B7DH 1TGNA 1HXFH 3HK3B 1GMDF 2P8OC 3UWIA 1DVAH 1TRMA 1D9IA 1A7SA 3KQEA 2A4OA 2SGDE 4U30A 1A61H 2AIPA 1PPBH 1HFDA 3EA8A 4NWKA 4IBLH 3MO9A 4FU7A 1QBNA 5F6MA 3SJ8A 1O2YA 3SV6A 5FCKA 1JOUB 1QJ7B 3FVFB 1E36B 1NPMA 1UTJA 1DICA 1UMAH 1O3AA 3ZYDA 3BIUH 3CP7A 3NUMA 1OWKA 1GJAB 3RXAA 2FYRA 4I8KA 3LPRA 1DM4B 1MH0A 1IQJA 1CHOF 1O34A 1O2OA 2FESH 2ZGBH 1ESAA 2PV9B 3GDUA 3RP2A 1O3NA 4AYVB 5E0HA 3GY3A 3ZZ5A 2BQ7B 3NK8A 4WXIA 5A0BA 1O5DH 2FOMB 2TRMA 3S9AA 1TRNA 1A3BH 2YOLA 3SW2B 1QIXB 1UK4A 1A2CH 1SPJA 1LCYA 3BTEE 4XE4A 5C3NA 4OGXA 3VFEA 1AUTC 1EOJA 1TQ7B 3EE0B 3Q3XA 4X8VH 1TPOA 2ZIQH 4X2VA 4K1TA 1DWEH 3BTWE 3SNAA 4YOJA 1W7GH 1BDAA 2AMDA 2A2XH 2FWWA 3SU0A 1FN6A 2XWAA 3ZZAA 1P05A 2BQ6B 3PV4A 1F2SE 5FAHA 4B2AA 2BDCA 1C5WB 1GI0A 2EC9H 1DSUA 1ANBA 4RKOB 1BTPA 3S69A 2B0FA 1C1NA 3UNRA 4NGAH 4CHAB 3PMBB 5TCCA 2H2ZA 1SGDE 1AN1E 1F0UA 4A5TS 1CO7E 1BMNH 1C1MA 2ZDAH 4NG9H 5FHTA 1NU7B 1LHDH 1HNEE 1A0HB 2H9TH 3LKWA 1AVXA 3MU0A 3TITA 1AU8A 3SOSA 1HAZB 1EXFA 1DY8A 4THNH 1ETRH 1O2ZA 1WTGH 2GMTB 3SV2H 1FONA 4Y71A 3UPEA 4AZ2B 1QB1A 1GMCF 4MPWA 3GOVB 3HKJB 3E90B 2Q6DA 3SI4H 4OS5A 2C8YB 5A2MH 1HAXB 3V3MA 5E0JA 1DWBH 2SGFE 4U01A 4ABBA 3MO6A 3VB7A 1O5AB 2A31A 3ZZBA 2EI7A 3GICB 4DIIH 3U9AH 2QF0A 3RMNH 3RLYH 1HIAA 1E37B 2BD7A 2XC4A 1O37A 1CBWC 3A89A 3QUMP 3UREA 1OS8A 1GVZA 3LH3A 2A5AA 1SQOA 1O2JA 5JB9S 1GCDA 1PQ8A 3GCOA 1S83A 1YCPK 1DXWA 2OC8A 4FUEA 2ZI2H 1YCPH 3T25A 3PLKA 3GDSA 1QL8A 4AGJA 4X8UH 1DE7H 4LZ1H 3ZZ8A 4X2WA 3GY8A 5JBBS 4E7NA 5LH8A 5FPTA 3BV9B 4O3TA 3GY2A 1MCVA 1F5LA 1XVMA 6CHAB 1GHBF 4X6PA 1DUEA 4INLA 1BTWA 3KNXA 1MBMA 1SVPA 4I33A 1OOKB 4NIXA 5EQSA 4BAOB 1E0FD 1JIRA 2PR3A 1O35A 2J94A 1TGBA 4GAWA 2QN5T 1O36A 3F68H 2QGRA 3STJA 2AS9A 1JWTA 3FP8E 2A4QA 1FQ3A 2FOGA 1QA7A 1SQAA 5CHAB 3M7QA 3FP7E 1EB1H 2H1UA 3L6PA 2A5KA 1TMBH 2BX4A 3SQHE 1VZQH 3SJ9A 1IOEA 1ZTJA 4KELA 2C4FH 5DK1A 4Y8XA 3SGAE 5AFYH 2VGCC 3ZYEA 1LTOA 5EGMA 1UTLM 5F8XA 1C5SA 1TBZH 3OX7U 4MDSA 2V3HH 4GLYA 4ZKRU 2O8UA 4SGAE 3D65E 4X1NU 1EAXA 1HAYB 1O3OA 1MAXA 2AEIH 3OSYA 4BNRA 3GCHB 5A8XA 3TGJE 4Y0ZE 3M7UA 3A7YA 1MU8B 4AFQA 2PKAB 3EA7A 1E34B 1S81A 1WU1A 4I8GA 1SFIA 2VVCA 2QXJA 3JZ2B 1AIXH 4LOYH 2JETC 2B5TB 3RXFA 1P2MA 4K2YA 2Q6FA 2AIQA 4DOQA 3GYMA 1EAIA 4ZROA 3PLBA 1K21H 2BXTH 2VWNA 1P04A 4K69A 2NU3E 3G01A 5LPEA 4FUFA 5L6NH 1ZMNA 1LQEA 1EP5A 4NA9H 3RXVA 1RTKA 2CHAC 2W3IA 3TK9A 4NZQA 4BAMB 1IHSH 1C5TA 4HZHA 4X6MA 4YO9A 1G30B 2A7CA 3M5NA 3PTNA 4ZKOU 1QHRB 1UVTH 1CGIE 4A1VA 3P92A 4ZUHA 4R0IA 4CRBA 3MNSA 2BVSH 2TGAA 1GBIA 3V13A 3ZZCA 1A46H 1SOTA 3S9CA 1JXPA 2ZU5A 1AE5A 1OWDA 1MTNB 1ETTH 1QJ6B 2ANWA 2Y7XA 2SGPE 2VINA 3A82A 5GWZA 5HGGA 1FXYA 5GCHF 2WV4A 1W0ZU 1Y5AT 5FBIA 2F9NA 1SG8B 4I7YH 2R3YA 2HVXA 2BYAX 5HM9A 1LVOA 3O8CA 1FY1A 1MU6B 1GJDB 3SV7A 4FUJA 3OY5U 2LNCA 3MHWU 1NO9H 2VIVA 2NU4E 3QTVH 1O31A 4I32A 4JZ1A 1GHAF 1QNJA 1QQ4A 2ZGHA 5K0HA 1HYLA 3FZDA 1JIMA 2P95A 1V2OT 3GISB 1NM6A 5FPYA 3W94A 1LPZB 3NWUA 5GPIB 3UOPA 5LPFA 1C1PA 3LJOA 1Q3XA 2WPIS 1QGFA 1V2NT 2CF9H 4YTAA 2OTVA 2ZEBA 2FOBA 3GY6A 1DPOA 1ELBA 1K1LA 4MNVA 4ZAEA 2Z9IA 3C1KA 5T6DA 2BD9A 1O2HA 1FV9A 2HPQH 1V2RT 2DE9A 2PGBB 1KLJH 3BEIB 1TNJA 1P11E 2WV5A 2ZECA 3AW1A 2BVRH 1KXCA 3VEQB 4FUDA 3RXIA 1U6QA 3RUOA 1GJ5H 1ABJH 1GL0E 1GJBB 3AW0A 2UUYA 3ZV8A 2FOEA 3GCTF 4OS7A 1O2GH 4YT6H 1PPFE 1IQNA 1TBRH 1CT2E 1UK2A 4B76A 4KP0A 2DE8A 1F0TA 3RDZA 4Q7YA 4IC6A 6ESTA 1SGFG 3RXRA 2H5DA 1ARCA 1GI4A 2XBXA 1WAYB 3SU3A 1YPHE 3RXHA 3ATWA 6LPRA 1WOFA 4E06H 4TY6A 1XX9A 2GTBA 2VU8E 1ZRBA 3P8GA 3TH4H 4B75A 1UTQA 5L2YH 5DG6A 1QBOA 2QF3A 1MD7A 2ZHQH 2RCEA 1ETSH 2R9PA 3DFJA 1Z6EA 5ESBA 1JRTA 3RC6A 3O8DA 1P3EA 1G37A 3EBNA 1K1IA 2ESTE 2UWOA 2G51A 3E0PB 4O3UA 1P06A 3A85A 3MU4A 2VVUA 3A86A 1M9UA 2OQUA 3SNCA 3FAOA 1QL7A 4NFEA 2Y5GA 4PROA 4ZHAA 1N6YA 8ESTE 3KQDA 1GDUA 1KDQB 1Y3YA 2ANMH 1NT1A 1TGTA 4OGYA 1GG6B 4XBCA 4ABGA 2SFAA 2ZGJA 2Z3EA 2PSXA 3I77A 1AGJA 3A7WA 2GD4B 4Q80A 2H6MA 2J2UA 2JH6D 3A83A 2ZDKA 3M37A 4CRAA 1GGDC 1GBFA 1K22H 4BOHA 3TU7H 4NSVA 1EPTC 1C1TA 1TABE 2B9LA 3SU6A 2QYIA 5C67A 4WJG2 4AFZA 5H4IB 1UO6A 4K1EA 1NY22 1T32A 1O2KA 1S84A 1TNKA 1RIWC 2O9QA 5EQRA 2GX4A 5JYIA 3LH1A 2GZ7A 2W7SA 1NESE 2OC1A 3WY8A 4K8YA 3PM3A 2ZWLH 1QTFA 5C1UA 4AOQA 4J1YA 4X0WU 4I31A 2F91A 1YPLH 2ILNA 3ATKA 4Y7BA 3RXPA 1GI6A 2HALA 4OS4A 2ZGXH 3RXMA 2FYQA 1FAXA 2DUCA 2OD3B 1ACBE 1J15A 3HGPA 3VB5A 3VB4A 3SJIA 2Q6GA 1GCTB 5C20A 1C5ZB 1C2JA 2BLOA 2CN0H 3LU9B 5GXPA 1ELFA 4ISIH 1AE8H 1TX7A 2BOHB 3ZVDA 2I6SA 4F49A 2P3UB 3AAVA 4AORA 2ZGCA 3SO3A 4ESTE 4H6TA 2CJIA 3B8JA 2XC0A 4ISNA 3VB6A 1PPGE 1FMGA 1AI8H 5DO4H 2ZDVH 1AY6H 1LMWB 1SGFA 3SV9A 2RA3A 5DKMA 3ZVAA 2FTLE 3QLPH 3CS0A 1TOMH 1NFWA 1K2I1 3GCNA 2SNVA 4TWWA 1HGTH 4YM9A 3DT0H 2B8OH 3L3TA 4X2XA 3DD2H 1BRAA 2ODYB 5EW2H 3PLPA 1NU9A 1P2NA 4O97A 4QT8C 4JMYA 2FIRH 3BF6H 3MH5A 1MMJN 1H9IE 1WSSH 1QBVH 4GUXA 1PQAA 1TYNA 1LVMA 4CRFA 1V2WT 2FEQH 3SU5A 2EI6A 2FLBH 3P8NA 2ZDLA 1AKSB 2ZTYA 1UVUH 3NCLA 3DUXH 2BD5A 1HCGA 3A7XA 1ANEA 1O3GA 2Z9JA 4UDWH 5EXMA 1QRXA 1C1RA 1HV7A 1SLXB 2ZCHP 3RM0H 1ZMLA 1O32A 3TH2H 4INHA 5F8TA 1H9HE 3D23A 2WYJA 1BMLA 5GIBA 4JCNA 2WPKS 4BAHB 3RXJA 1C4Y2 2XW9A 3KEEA 3ODFA 4DGJA 1S0QA 3F1SB 1GPZA 4TWYA 1LDTT 2A4RA 4CR9A 4BXSA 2EEKA 1HPGA 1VITG 2VIQA 1IQGA 1FY8E 2ZPSA 4BAQB 1GBHA 4JYVH 4H6SB 1LPKB 3SU4A 1RTLA 1C2LA 1MTWA 1VCWA 3B23B 4ZXXH 3M3SA 3EGKH 1O2VA 1BMMH 3HK6B 4TPIZ 1LHGH 1AWHB 1ZSLA 1T8NA 3MU1A 3QGNB 5JBAS 3TGIE 4F4OC 4IMZA 2V0BA 1CA0B 1SGCA 5C1YA 3SU2A 7GCHF 4BTIB 1FJSA 4GVUA 1PQ7A 3FFGA 4Q7ZA 4Y6DA 1Y5BT 5CMXH 3JZ1B 1HAGE 4AN7A 5A8YA 1H8DH 1XMNB 4TY7A 1ZZZA 1ORFA 3TJOA 1BTZA 2A4GA 1MZAA 1BTYA 1FI8A 1IQLA 2FOHA 2BDGA 1O5FH 1O2WA 1YPKH 4DY7B 1C2GA 1ELVA 1RGQA 1ZMJA 2GV6A 2Y5HA 3AVZA 5JDUB 4FUBA 4NWLA 1J8AA 5AFZH 3A80A 1O3CA 1Z8RA 1CGHA 2R3UA 2QCYA 1BQYA 4NA7A 1UVOA 1KTTB 1C9PA 2QXHA 3KF2A 1FAKH 1ZHPA 2LPRA 2A2QH 1N8OB 2AGEX 3KQCA 2BOKA 3BSQA 2OBOA 3LIWA 5JBTA 2PTNA 2TGTA 1FPCH 1EPTA 2Y82A 2C93B 1DFPA 3TGKE 2GCTC 3QZQA 1YBWA 4X6OA 1UJ1A 4WF8A 5C5NA 4B71A 2P3FH 2KAIB 4J2YB 1C1OA 1KXEA 1LQDB 3LGYA 1BTXA 1IAUA 1MCTA 3DHKH 2Z6BD 1G3EA 3QTOH 1UHBA 3BTME 3SHCH 2OBQA 1F0RA 1BHXF 3P95A 3SORA 1V2QT 1YKTA 2A0QB 1W7XH 1L0ZA 1NN6A 9LPRA 1O3DA 3TIUA 5G4BA 3RXGA 2HLCA 1VJ9U 4HI3A 1KXFA 3MYWA 3RXSA 1S82A 4A1XA 1LVBA 5ESTE 3LGWA 4Y8YA 1YPHC 6GCHF 3MI4A 3O8RA 2XCFA 2ZQ2A 3A87A 1C2IA 1P2QA 1GBCA 1CA8B 3UQVA 2NU0E 3VXFH 5J4SA 5JB8S 2ANYA