3TGIE

Wild-type rat anionic trypsin complexed with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine protease/inhibitor)
molecule keywords TRYPSIN
publication title Comparison of Anionic and Cationic Trypsinogens: The Anionic Activation Domain is More Flexible in Solution and Differs in its Mode of Bpti Binding in the Crystal Structure
pubmed rcsb
total genus 62
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tgiE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tgiE02
1TABE 4IS5A 3RXRA 1V2TT 2V3OH 3A8CA 4HGCA 3RXBA 1NRQH 1ZMNA 1O31A 1G3DA 1GI1A 1RS0A 1BTXA 1K22H 1HAXB 1VCQA 1BITA 3ATLA 3ENSB 2BMGB 3T28A 1DWDH 1GI4A 2SGQE 2FI5E 4AFUA 3M5MA 3PMAB 3STIA 1Z1JA 1KLJH 1NFYA 1NZQH 3ITIA 1Z8GA 3PWCA 1ELFA 2BX4A 1EZQA 2GT7A 3LGUA 3VB6A 1O2QA 1UMAH 3NPSA 4ZKRU 2ZP0H 1KXBA 1K1IA 3LKWA 3AASA 1O3NA 1W0ZU 2QF0A 4Z0KA 2VWOA 1SGNE 1KTTB 1G9IE 4UFGH 3UUZA 4TPIZ 1ESAA 1UTKA 1C1PA 4BAOB 1CGIE 1GBFA 4FUBA 3EA8A 3RP2A 3RC4A 2GCTB 1CHOF 1ARBA 1S5SA 3PO1C 3S9AA 5J4SA 3UNSA 4WJG2 1QIXB 4E7NA 3SU5A 2ZU4A 1MTNC 4ZKNU 5L6NH 1O2XA 3HK3B 2Z9JA 3FP8E 1HAGE 4A7IB 5ESTE 1WV7H 5EQSA 1GBMA 3TH2H 1C2GA 1TX8A 1ZRKA 3SV2H 5HM9A 2Q6FA 2C93B 1V2MT 3BIVH 1ZTJA 2JKHA 2CN0H 1TNLA 1UTQA 3A8BA 1E0FD 1HJ9A 2O8LA 4TY7A 1Z6EA 1D4PB 2SGFE 3SUEA 4ABEA 1BBRK 5IYTA 1QBNA 1WQSA 2ZFRH 3BN9A 1QY6A 1SGYE 2GMTB 1GBDA 5C3NA 1THRH 1IOEA 1ZJDA 3TIUA 5DP3A 2BDBA 1GHBF 3BF6H 4Y7AA 1C5YB 1ZSJA 1BIOA 1QA7A 3F1SB 1QB9A 3GISB 4BXSA 2PKSC 1P05A 1MQ6A 1C5QA 2P59A 1HAYB 4AFZA 3EE0B 3TK9A 1TGSZ 3NZIA 5C2ZA 1XKBC 2BLOA 2ZIQH 4JK6A 1F5RA 3QWCH 2ZDKA 2RA3A 1K1LA 3T26A 4B1TA 1HLTH 3E1XB 1V2UT 1WU1A 5JBCS 4OS2A 3AVZA 2I6SA 3EAJA 4D76A 2ODYB 4BAKB 4H42U 5HXFA 2SGEE 3ZVFA 4I33A 1BDAA 3ZYDA 1O32A 5C1UA 5B6OA 3UQVA 1EASA 4ABDA 3SGAE 1P2QA 1Y5AT 1AKSB 1B5GH 1GDQA 1GBKA 4NA7A 3RXHA 2JETC 5GDSH 2A31A 4IMQA 4I8JA 1GJ6A 4O97A 3VXEH 1HIAA 3SNCA 4WMFA 4I8KA 3PLKA 1BZXE 1QA0A 2V3HH 3FANA 1NU7B 4KTUA 1DT2A 3BTDE 3Q3XA 1V2JT 4AYVB 1C5LH 4I32A 1HAPH 3RXIA 4IW4E 1A0HB 3FZDA 4X2WA 1G32B 1Q3XA 3LGTA 1O2NA 4LK4A 1TQ7B 5C5NA 1MKXK 2PKAA 1ACBE 1Y59T 1IQHA 3RXKA 4R0IA 1YCPK 3DUXH 1P03A 2ASUB 4VGCB 1PQ8A 3C27B 1RJXB 2ZFPH 3Q3KA 4I8GA 5DP5A 3ZYEA 5FBIA 1ANBA 4FU7A 4WXVA 1Q2WA 3ZZAA 1K1JA 1O5GH 1SGEE 1UVOA 1IQMA 2SNVA 1FY8E 4CRCA 3U9AH 5ESBA 4WMDA 3UWIA 2PUXB 3I77A 1F0RA 2VVUA 1TB6H 3A84A 1IQGA 5DGJA 1V2NT 3QTVH 3STJA 4TY6A 4GUXA 1P09A 5JBBS 1CT0E 2A2QH 1XVMA 3SJ9A 2OC0A 1V2PT 2QXHA 1K2I1 1C2FA 3RXMA 1SHHB 2OQUA 1YPHC 4X2XA 1VGCB 2H5CA 3CP7A 1FIZA 1LVBA 2QXGA 1ZRBA 2AGEX 2G00A 3RXPA 3SOSA 2P93A 5JB8S 3A8AA 5A0CA 1GL1A 4AFSA 3UREA 2GZ7A 2PTNA 3E3TA 1G2LA 1CHGA 1C1MA 4MVNA 7GCHG 1GJ9B 1EPTB 2FMJA 1A1RA 1LHDH 2ODPA 3KN2A 1O2WA 1TPAE 3TNSA 1NT1A 2WV5A 2VVVA 4FU9A 3ZVCA 1AI8H 1V2WT 1IHTH 1DM4B 2ZPRA 3K9XB 1ANEA 4I7YH 1F0UA 2FYRA 1J17T 4ISNA 4X6PA 1W8BH 1CQQA 2RA0A 1UCYH 2GP9B 1LPKB 2ZGBH 1AKSA 3ATMA 1QHRB 1IQLA 1C5ZB 1HBTH 2WINI 2KAIA 6CHAB 1EX3A 1OP0A 4K1TA 3QN7A 1GGDB 1BTYA 1XMNB 1DLKB 2BY7X 3RXOA 1HB0B 3RC6A 1GI6A 1HGTH 1GBCA 1NC6A 3U8RH 4A1TA 4XFQA 2EI6A 3ZZ6A 1ELGA 4D9RA 1QR3E 2HPQH 1TBZH 2BD5A 1UVSH 1TOMH 1GJBB 2D26C 3BTHE 2BDCA 3CS7A 2GCHG 3EA7A 5AF9H 1YYY1 5K0HA 1P2OA 1NFWA 1JBUH 3K6ZA 4H6SB 1GHAF 1PFXC 1TGCA 4GCHF 4O9VA 1W3CA 3RMMH 5EW2H 4ISIH 2B0FA 1FI8A 5TCAA 5LPFA 4RN6A 1EATA 2A5AA 2BOHB 1C9PA 1GG6B 2DE9A 2WPMS 1PPGE 1ZTLA 8ESTE 2O8TA 5E0JA 3NKKA 2STBE 4FUEA 1YF4A 1BMAA 1ZSKA 3RLWH 5A2MH 4R8TB 3U69H 1UTLM 2YNAA 2PTCE 3UR6A 3FP6E 3KQBA 1O39A 1HPGA 2C8WB 2R3YA 1XKAC 2FP7B 3GYLB 1AUTC 1AWFH 1Y3XA 1NTPA 1IQFA 3RUOA 3KCGH 2FLBH 1KY9A 1RRKA 2TGPZ 1EPTA 3MNBA 2UUYA 1O2OA 1EZUC 3SJKA 5GXPA 1AN1E 3RXEA 1TMBH 1SHYA 1UK4A 3M3SA 1SGQE 1JIRA 1G3CA 2CHAB 3GY3A 7KMEH 3F9FA 1PQ7A 2CXVA 4MQAA 1CBWB 2VIQA 1TX7A 4X8TH 1IQJA 1C5RA 2GCTC 3E8LA 2OQ5A 5JYIA 2ZGHA 2GX4A 2HVXA 3F6UH 3RU4T 3A7XA 3MU0A 3SN8A 2J4IA 2F9UA 2D8WA 5FBEA 1C5XB 3TJNA 1MQ5A 1T8MA 3P8FA 1UVPA 1LPGB 1YLCA 1P11E 5GCHF 3M3VA 3ELAH 1EOJA 4F4OC 2VH6A 6GCHG 4SGBE 1S84A 1C1VH 2BX3A 1IAUA 4X1RU 1L1JA 2BVSH 2ZECA 5EW1H 1NFXA 3A88A 1BRCE 3KF2A 2R2MB 2O8UA 1KXDA 1O2UA 4FUCA 1OSSA 1YPMH 1VJAU 1AB9B 4J1YA 1S83A 1FAKH 3URDA 1JMOH 1UTJA 1C1WH 1A2CH 4DG4A 1XUGA 2GMTC 2ODQA 4X1QU 4WXIA 1TWXB 3RU4E 3ZZ5A 1MD7A 3UWJH 4ABAA 3VPKA 3SU2A 4UONA 3E0NB 1JRSA 1GI2A 3QZRA 5AFYH 4X2YA 5HGGA 2TGDA 4JZEH 1GJ8B 1C1RA 1V2VT 1SGDE 2BXUH 1KXCA 4UE7H 2R9PA 1C2EA 1TA6A 4YM9A 3D49H 5EGMA 2P8OB 2Z7FE 5HYOA 4BANB 4BXWA 2AIQA 1Y8TA 1CGHA 1SQOA 1O2HA 1HXEH 2ZF0H 1G30B 1S6FA 2BYAX 3U1IB 2EEKA 1O2GH 2ZPSA 1V2ST 2AFQB 4HI3A 1GCTB 2EI7A 1LHFH 4XSKU 3PMJA 3ODFA 1P06A 3IWMA 4FXGH 1SGRE 2CF8H 3W94A 3LIWA 1LQDB 1GBLA 3DA9B 5BRRE 3MO9A 4Z6AH 3LH1A 2Z9LA 1GBBA 3T27A 3RMNH 2GZ9A 4A92A 1S0RA 1MTVA 3MH4A 3M37A 3IITA 1W7GH 4UDWH 3A82A 3D65E 3O8BA 3A87A 1FY3A 1ZMLA 2SGAA 2BLVA 2P94A 1MTUA 1G36A 1RXPA 4YZUA 1NPMA 3RMOH 3LGYA 3P92A 5LPRA 1W13U 3URCA 1SGPE 4E7RG 1ZHMA 2A4OA 1WYKA 1CT4E 2ZCHP 2V6NA 4LZ1H 1O2ZA 4DGJA 1PYTC 1FN6A 1O5BB 1V2RT 4Y8XA 1YPLH 1QRXA 5JBTA 3SI3H 4DJZB 4VGCC 1OWHA 1Z7KA 1HYLA 1FY5A 2DUCA 4NWLA 1QBOA 1TNJA 3U8OH 1GI7B 2C8XB 2XC4A 4B74A 1ETRH 2XW9A 2OLGA 3MO6A 4Y0ZE 3R3GB 2W3IA 2HNTE 5HMAA 4NZQA 1ELAA 3BEFB 4MDSA 1XUJA 1UK2A 2Q6GA 1YCPM 3BTFE 1DWEH 3ZZ7A 3Q3YA 1C2LA 3SUFA 5PTPA 5C20A 2ANKH 3D23A 4UFDH 1OKXA 2ZKSA 2V35A 4UD9H 3MO3A 4AB9A 1BB0B 1VGCC 3V3MA 1O2JA 4AZ2B 2K1QA 1EKBB 1PYTD 1FY4A 3LU9B 4LXBH 4Q7YA 2H9HA 1V2QT 2BOKA 1OPHB 1QL9A 4WVPE 4ABBA 1FUJA 2AIPA 2Z9GA 2A2XH 4BTIB 2G55A 2QA9E 1QRZA 4INHA 1AE5A 1P3EA 4B76A 1SLXB 2QC2A 3ATKA 1EPTC 1VCPA 1GI9B 3AW1A 1KYNA 4IN1A 1D3DB 2UWOA 4Q2KA 2HALA 1MKWK 3SJIA 5H4IB 3PROA 3RLYH 1OWDA 1O3IA 4Q7ZA 1FONA 1DITH 2NU1E 2FX6A 2ZQ2A 2HRVA 3LGIA 1A4WH 3M7QA 1WOFA 1Z8RA 2D1JA 1GL0E 2H9EH 3QO6A 1P2MA 3F9GA 4MPWA 1OWJA 3L33A 3E90B 7LPRA 4AGJA 1BMNH 1E38B 2AEIH 1DY9A 1O2TA 2ULLA 3PLPA 2BZ6H 1O34A 1DLEA 3ATIA 2BDAA 3B8JA 4NG9H 2F9BH 1GGDC 1K1NA 3NK8A 3QK1A 2ZU1A 1JXPA 1SBWA 4LZ4B 2A4RA 2OCVB 3SNEA 5GIBA 4NIVA 1WSSH 3VEQB 1MZDA 2QV1A 3LONA 4O03A 3SO3A 4KTCA 2ZFFH 3ZZ9A 3DD2H 1AIXH 1BHXB 1O3BA 1TGTA 1K9OE 1QBVH 2PR3A 5DP6A 1AZZA 1O35A 3RXUA 4ABIA 1H9LB 4CH2B 4UFEH 1CO7E 1NRRH 3ATWA 4I8HA 3CS0A 4XOJA 1HAIH 2G81E 3MOCA 1F5KU 1SI5H 3MH5A 5LGOA 3TJVA 1EXFA 5T3HA 2OBQA 3TJOA 3BG4B 1GG6C 4MG3A 3GY2A 3MU8A 2W7SA 2ZHDA 1G3BA 1UCYE 5EODA 4MNXA 1P2KA 2BVRH 4YLQH 2QN5T 3KL6A 4FVBA 2IPHA 4X6OA 2FX4A 1TYNA 2DE8A 1C1OA 1H8DH 3SNAA 1A0LA 5A8XA 4THNH 5CHAB 3UQOA 4K69A 1UHBB 1WUNH 1BMLA 2OUAA 3BTME 5FHTA 5DPAA 1SGFG 1FJSA 2GD4B 4CRAA 1C1TA 1KIGH 1AY6H 8KME2 4CRDA 2A7CA 3A7ZA 1GBIA 1P3CA 2A5IA 3MNCA 1HAVB 1T31A 2GTBA 2ZDVH 3PMHB 1Y3YA 5FX6A 1J14A 2ZPQA 3TGIE 3ZVGA 5SGAE 1SQTA 1O2PA 4DY7B 2NU3E 2EA3A 2Y5FA 1UVTH 4LOYH 2Z94A 1FXYA 5E2OA 4ZKSU 1BRBE 1CBWC 3ZZ3A 1LKBA 5DO4H 3UNQA 3GYMA 1QTFA 3UNRA 3HKIB 2BXTH 1P2NA 2EC9H 1VCWA 1BT7A 2FLRH 2SNWA 3VB3A 1N8OB 2G5NA 4MPXA 2ZDAH 4JYTA 1SLVB 3OTJE 1BBRH 3JZ1B 1MD8A 5CE1A 3E16B 3ZZ4A 2QXJA 2CGAA 4JYVH 1V6DA 1GMHG 2GCHF 3F9HA 1HAOH 4BNRA 1O3DA 3RXFA 5EPNA 1P12E 1GBJA 3SU4A 1W10U 3BV9B 1SOZA 1C5UA 1D3TB 3Q76A 2QYIA 4OS1A 4Q80A 1O3CA 3RXLA 3T2NA 1AUJA 1A46H 2HWLB 1EP6A 1SGTA 3JZ2B 1AB9C 2Y5HA 1ETSH 3MNXA 1RD3B 1QQUA 4YESB 1Z1IA 1OOKB 2BM2A 1DFPA 1TIOA 2QY0B 4XBCA 3ODDA 4B2CA 1O3EA 1LVMA 3BTKE 4ZH8A 1UCYK 2QCYA 4D7FA 5EXMA 6LPRA 2Q6DA 3CENA 1DVAH 1GBTA 3QDZB 2TPIZ 5T6DA 5EU8A 1L0ZA 1CGJE 4AYYB 3P70B 1AVXA 2ILNA 1O2YA 2P8OC 2FIRH 2QXIA 2VIPA 1CA8B 3LDXH 1DXWA 3RXCA 1C4Y2 1YPHE 3FFGA 4GVUA 3AW0A 2VU8E 3KGPA 3MU1A 4MNWA 1DANH 2FOFA 1A0JA 1GI0A 1YPKH 3K2UA 1A7SA 3NXPA 5F03A 1GCTC 4RKJB 1QRWA 4ZKOU 1SOTA 2H1UA 3P6ZB 3PLBA 4RSPA 2ANYA 1J15A 3ZZDA 4DOQA 3RXDA 1PQAA 1MBQA 2NWNA 3MU4A 2BDYA 1SFIA 1GWAA 3PM3A 4YLUA 1BQYA 1YCPH 3A81A 1YBWA 3MHWU 1FN8A 1S6HA 3SBKA 2A45B 1NY22 4FUDA 4FUFA 1TAWA 1B0EA 2WPJS 1ELVA 1GHYH 6GCHF 2FOMB 1BJVA 3F68H 3G01A 4K1EA 2FOBA 2XRCA 4NA9H 4CBNA 1DY8A 1OWIA 2GVFA 4NFFA 3I78A 5FAHA 1O3HA 1OX1A 4X6MA 1IQEA 1ZTKA 3FAOA 3TJUA 1F0SA 4OGYA 3RM2H 1LO6A 3LJOA 1GCDA 1O3PB 1C9TA 2GKVE 1O38A 1TPPA 1MU8B 3MMGA 1EAUA 1PPZA 1DDJA 1OYQA 1T7CA 1SB1H 8LPRA 1QL7A 4E06H 4ZHLU 1K1MA 1DS2E 1QJ6B 1SMFE 5A8ZA 1C5NH 2FYQA 4WH6A 4BOHA 2A4QA 3MU5A 1TRNA 1KDQB 3SQHE 2F9PA 4ZMAH 4CH8B 1P0SH 2WPIS 4XE4A 4AFQA 3SU3A 1LHEH 1O5FH 1D6WA 1GJ7B 3B9FH 2ZGJA 4JZ1A 1MTNB 2Z9IA 2CJIA 2H6MA 4CREA 3RMLH 2O9QA 3P8GA 1ELBA 1ZPZA 3H7TA 2PFEA 4JZDH 1W2KH 1OS8A 3A7YA 3BEIB 1AFQB 1TQ0B 4CHAB 3SORA 2ZZUH 2FOAA 2J34A 4F49A 1YPEH 2GZ8A 2G51A 2XC5A 2W3KA 2ZGCA 4U30A 2GT8A 1J8AA 1LCYA 5DJ7A 3GICB 2VIWA 1UTPA 3TPIZ 3M5OA 1H8IH 1O3AA 2FOHA 2A0QB 2J9NA 4NZLA 5IDKA 2PGBB 3MFJA 4FVDA 5A09A 1EUFA 2Y82A 4TYDA 4DVAU 3UTUH 4AOQA 1GI3A 3LC3A 2ZQ1A 3O8RA 2R0KA 1EZSC 4Y6DA 1EB2A 1ZZZA 2GDEH 1KTSB 2BLWA 1ANDA 1V3XA 3TH4H 1YP9A 4RKOB 3SJOA 3WY8A 2Z9KA 3BTEE 1VITG 2BD3A 3KQEA 1Y3VA 5GWZA 3PV4A 4CRFA 4D9QA 1DWBH 1SC8U 1OWEA 2PKSB 2VGCB 4X0WU 3PYHA 1N6YA 1O3OA 1HRTH 2HOBA 1OP8A 3HGNA 3PWBA 1RFNA 1IQKA 2BZAA 5L2YH 1BJUA 3L6PA 3GY4A 3OU0A 3UY9A 1A5HA 4NIYA 2FTMA 2LNCA 3P17H 1O36A 2F83A 1ABIH 4NA8A 3I29A 5E0GA 1ELEE 2ZTZA 2BTCE 1SLWB 3PTBA 4IBLH 1PPHE 2FO9A 4KELA 1RIWB 1KLIH 1BMMH 1F5LA 2FM2A 1ARCA 1A61H 3E0PB 1UO6A 1ESTA 1ANCA 1VR1H 2VIDA 1O0DH 1FDPA 2OTVA 2TBSA 1ZSLA 2EI8A 1O2KA 4KP0A 1P9UA 2TRMA 5J4QA 2FOCA 2C4FH 7ESTE 2W26A 1UVUH 2BD4A 8GCHG 1HUTH 5FPSA 1Z8IB 2M5TA 1ZHRA 3SHCH 1DUEA 1ID5H 5FX5A 1F7ZA 4QT8C 2THFB 2FPZA 1O3LA 1FAXA 1GMCG 2ZFSA 2BQ7B 5CMXH 4KTSA 3GOVB 2UUJB 4BAQB 2Y7ZA 4X1NU 1AZ8A 3SNBA 1NROH 3RXAA 3KIDU 2BD2A 2OD3B 5C1YA 4AX9H 3A8DA 1C1UH 1FY1A 3RM0H 3P8NA 2CMYA 3UIRA 1LHGH 3TH3H 4ISLA 3SU6A 1SGCA 2ALVA 5CHAC 1G37A 1O30A 1P2JA 2IOTA 3A85A 1V2KT 2BD7A 3HGPA 2R2WU 4BAHB 5ETXA 2AGGX 1O3MA 2BDIA 2B7DH 1FPCH 1TMUH 1ZJKA 3S0NA 4AB8A 3LJJA 5EOKA 2F3CE 1MU6B 1TNIA 3VB7A 1EAXA 1GJCB 1XX9A 1AVWA 2FS9A 1OYTH 1RGQA 1H9HE 2HPPH 2FZZA 2WYGA 1GHXH 3V0XA 1C1SA 2FWWA 1D6RA 4WMEA 2RDLA 2Z3EA 4OS6A 1C5PA 2V0BA 4X8VH 1FPHH 1L4DA 1DWCH 2C8ZB 5AHGH 3O8CA 2W5EA 4XBDA 1M9UA 4K3JA 2Z3DA 3TVJB 3EA9A 1ZOMA 2XCNA 1XM1A 5G4BA 3KEEA 1PPEE 5FCRA 1N8OC 1T32A 2FESH 1EP5A 2D2DA 2A32A 3KNXA 4JMYA 2WYJA 1TA2A 2WPHS 1NRNH 4M7GA 1C5OH 2BHGA 1C2DA 1ETTH 1UTMA 3HPTB 3LGVA 2PWXA 3PTNA 1SSXA 1SGFA 1OP2A 2B5TB 1C4U2 1EAIA 3O8DA 2J95A 2JH5D 3SV7A 2UWPA 5JPMH 2RCEA 1A3EH 1YLDA 3M5NA 4A1XA 5AVDA 4NWKA 1MAXA 3GY5A 1SVPA 3TLOA 1HJAB 1PJPA 2AMPA 3LH3A 1N1LA 1NO9H 1Z71A 1LPZB 4B75A 4HTCH 1O2MA 1OXGA 1TGBA 1O2RA 5T6GA 1MTSA 2PLXA 1THSH 1QL8A 1X7AC 2OC8A 1JWTA 3ZVEA 1P2IA 2AH4X 3SZNA 4YOGA 1BUIA 3PMBB 4ABJA 1HDTH 1MCTA 4DIHH 3M7TA 1BRUP 1GJ4H 2PSXA 2AERH 3L3TA 1K1PA 4INKA 1QURH 2XWBI 9ESTA 1YPJH 4MLFB 5I46H 2VWMA 2C8YB 2H2ZA 5E8EH 2BY5X 2VINA 1WTGH 2ZCLP 3SUDA 1TBQH 4X1PU 1VITH 3GCTG 4IC5A 4JYUH 4ISHH 3KHVA 2J94A 2ZCKP 3GCHB 2XBVA 5T6FA 3MI4A 1KXEA 1FMGA 1HFDA 3TU7H 4Y11E 1HJ8A 1YKTA 1EJMA 1VZQH 1CVWH 2UUFB 4FUIA 2QGRA 1O3JA 1ELCA 1AE8H 1W0YH 5A0BA 3VGCB 4FU8A 4A5TS 3SI4H 1NU9A 2TGTA 4K60A 4OS7A 3M61U 1O5CB 1FNIA 3E6PH 1U6QA 4TPYA 3VB5A 3S9BA 1P10A 3TNTA 1GPZA 2XTTB 2PSYA 1GMHF 5GPIB 1ZLRA 1O2SA 3FVFB 2YOLA 6CHAC 1O2LA 2Z6BD 3HATH 3A7TA 3D62A 2XXLA 1W11U 4GPGA 3SV6A 4HZHA 1TE0A 1GBEA 1C2KA 1AFEH 1LDTT 4UFFH 4K8YA 1HIAB 2ZHWH 4ZXXH 3NUMA 4B2BA 2BY9X 1SPJA 2BB4A 5FPTA 3MYWA 2TIOA 5DP7A 1GHVH 1TOCB 2ZU5A 4OS4A 4K1SA 4MPVA 1C5TA 5C1XA 4OGXA 1SGIB 2R0LA 2VVCA 3BSQA 1XUIA 2FI4E 3MH6A 2ZWLH 2PKAB 1EOLA 3ESTA 3M3TA 1LHCH 1GI5A 3A89A 1LKAA 2ESTE 5F6MA 5DKMA 1GHWH 3MNSA 1EZXC 1AQ7A 2O8WA 4CR5A 3VB4A 1AFQC 1IHSH 1MTWA 4U2WA 4Y7BA 1MKWH 4CHAC 4PROA 1EJAA 1E35B 1N6XA 2BDGA 2JH6D 3QGNB 1BTPA 3DFLA 1D3PB 3PB1E 1BTZA 2XYAA 7GCHF 2ZTXA 1C5WB 1GI8B 2NU4E 1DICA 1MBMA 2P95A 4GHQA 4ZHMU 1DPOA 4JZFH 4YTAA 2WV4A 2GV7A 1TLDA 5TCCA 3HK6B 3K65B 3NCLA 1K28D 3H5CB 4NIXA 1TGNA 3GDUA 1G3EA 2R3UA 2H9TH 4Y71A 2CV3A 3RC5A 2SFAA 4ZXYH 2OXSA 1A3BH 1LVYA 4IN2A 2VIOA 1A5GH 1C2JA 1WTHD 1XXFA 1E34B 3MH7A 2UUKB 2VGCC 1DUAA 4MTBA 5K7RA 2HGTH 2P3UB 5L30H 1T4UH 1TNGA 3S69A 1WBGB 2CHAC 2AMQA 3AAUA 5EQRA 1CSOE 5EXNA 1J9CH 3DT0H 1C5SA 1GMDG 1NESE 1AO5A 1ESBA 1XXDA 3V7TA 3UFAA 4YOJA 5JDUB 2FODA 4UEHH 1F0TA 2ALPA 5DP8A 1RIWC 2A4GA 3LC5A 3M7UA 4JK5A 2AS9A 2ZO3H 1T8NA 1D3QB 3M36A 1DX5M 1ZYOA 4X2VA 2WUCA 2OINA 2OC7A 5E2PA 2IJOB 3BIUH 4I31A 2ZU2A 3P8OA 3F9EA 1T8LA 1O33A 2KAIB 2G52A 1THPB 1IQIA 2ZI2H 2FI3E 1PQ5A 2BD8A 2YNBA 1CA0B 1P01A 1DSTA 1ELTA 1JIMA 3T25A 1EJNA 2VH0A 1TMTH 1A5IA 2PHBA 1HAZB 4MNYA 1EAWA 1UK3A 1ZMJA 3OX7U 1C2MA 3VFEA 4Y76A 2ANMH 1CHOG 3RXGA 4KKDA 1WCZA 1FIWA 2BQWB 1Y5UT 9LPRA 5DP4A 5EXLA 3SHAH 4ZUHA 3BG8A 3U1JB 2VWLA 1DSUA 2ZDLA 1L2EA 1VITF 1BHXF 2ZFTA 3SV9A 1O3GA 1B0FA 3SGBE 5DP9A 4ZROA 1UHBA 3DFJA 1EB1H 4XBBA 4A1VA 2C90B 2ZEBA 2P16A 2ZC9H 2XBWA 1J16A 2F9NA 4Y79A 5F8TA 3U8TH 4B2AA 1SG8B 2G8TA 1HAVA 1DOJA 1L4ZA 4MNVA 4Y8ZA 4B73A 2NU2E 3SU0A 1W12U 1MKXH 4IGDA 1T4VH 4AGKA 1GHBG 1KSNA 2OP9A 4B71A 4YOIA 3RXVA 3VXFH 2AYWA 1G2MA 2F9OA 1S85A 3EYDA 1S0QA 5EQQA 5JBAS 3QTOH 2GGVB 4Y10E 4K8BA 5AFZH 3BTWE 1C5MD 3H7OA 4HFPB 1C2HA 1BTHH 3RXQA 1YPGH 2SGPE 2FS8A 1Y3WA 3ZV8A 2FOEA 4Y0YE 4OS5A 1C1QA 2GV6A 8GCHF 1H4WA 4WH8A 1C2IA 1AMHA 1E37B 1MAYA 3E91A 1TALA 1GMCF 1JOUB 2FOGA 4CRBA 3IG6B 2Y80A 5L2ZH 1Y5BT 2ZA5A 3EGKH 1PPCE 3KQDA 4FUJA 1HJAC 2PV9B 4FUGA 4J2YB 3EQ0H 2WUBA 2ZNKH 4AG1A 5JB9S 2SGDE 1ELDE 4NSVA 1AU8A 4WWYA 4ESTE 1BA8B 2BY8X 1HNEE 2XC0A 3PO1B 2VJ1A 1TNHA 1ABJH 2VIVA 3S7KB 1D9IA 1MH0A 1HV7A 1P02A 1MMJN 4ZAEA 1INCA 1Z6JH 3SW2B 5LPEA 2G5VA 3A80A 1WAYB 3BTQE 1SLUB 1NRPH 3FP7E 3NWUA 2O8MA 1B7XB 2BLQA 2ZG0H 2F91A 1TFXA 1KXFA 2A7JA 2Y81A 1GVZA 3ZVDA 4WF8A 2LPRA 3FZZA 2AGIX 1T8OA 2XBYA 1C1NA 2P3TB 3DHKH 4DURA 3T29A 1SR5C 1GBAA 1O5AB 4X8SH 3TK6A 5FXLA 3GCHC 1GJAB 4GAWA 4U32A 3N7OA 2TGAA 3V12A 4YT6H 1UJ1A 1TRYA 2P3FH 1NFUA 3UOUA 2ZHFH 1MUEB 1TPOA 1W14U 1NS3A 3AAVA 3VGCC 2ZTYA 3TGKE 2H5DA 1MZAA 3SJ8A 1V2OT 1O2VA 2A1DB 4KGAA 4I8LA 1ZPBA 1ZGVA 1BOQA 4GLYA 3U98H 1V2LT 1ZHPA 4JCNA 1AVGH 3TGJE 4A6LA 2Y5GA 3S7HB 4GSOA 2HNTF 1QJ7B 3LOXA 2G4TA 1FV9A 2FTLE 2G4UA 3OY6U 2VNTA 4K2YA 1P8VC 4MPUA 4NSYA 1TRMA 2XCFA 4SGAE 3ZZ8A 4ISOA 2Y6TA 5EPYA 5A0AE 2A5KA 2BD9A 2BDHA 5FPYA 1E36B 1TNKA 1IQNA 5DK1A 2JETB 1S81A 1QFKH 3HKJB 4AN7A 1GBHA 2FXRA 4NGAH 2ZDNA 3R0FA 3GY7A 2FEQH 1F92A 2PGQB 5A8YA 3B23B 2J92A 1YM0A 1NRSH 3UR9A 4BTUB 1L1NA 1QB6A 2ZFQH 1KDQA 1PPBH 1W7XH 4Q7XA 2XWAA 1AD8H 1GJ5H 1UTNA 1O5DH 3BG4C 1NM6A 3T5FH 1BTWA 3T62A 1GVLA 1K1OA 1LQEA 3GY6A 1KXAA 2ZHQH 3SGQE 1HXFH 3GCTF 4XDEA 3SQEE 3C1KA 1YC0A 1P57B 3GCNA 2J38A 1LTOA 2GDDA 2RG3A 5E0HA 1MCVA 3RXSA 1AHTH 4Y8YA 3ZV9A 2A7HA 2NU0E 2B9LA 1LMWB 1LVOA 5GJ4B 1QJ1B 2ZDMA 1H9IE 2BY6X 1TX6A 4ABGA 2HLCA 3GDSA 3UOPA 3QLPH 4CR9A 3ZVAA 2JH0D 1ZR0A 3QX5H 1FZZA 1CE5A 4NIWA 2QF3A 4U01A 1JRTA 3TK5A 1GJDB 1FLEE 2ANWA 2J2UA 5DG6A 1FQ3A 1SQAA 1O3KA 4ZHAA 1GHAG 3P95A 1EQ9A 4E05H 3SUGA 2I6QA 1BRAA 3A7WA 4GCHG 1RTFB 5LH8A 1BCUH 1HAHH 2FDAA 4O3TA 4K5ZA 1RTKA 1RTLA 2UWLA 1QQ4A 3OYPA 5C67A 1ZPCA 4DW2U 1F2SE 1QCPA 1VJ9U 2VB0A 2BVXH 1K21H 1O3FA 1SL3A 2OC1A 3OY5U 3QUMP 5C5OA 3A7VA 2QIQA 3BTGE 1XUFA 3LT3A 4TWYA 1P04A 2IN2A 4GHTA 4YO9A 3K6YA 4IMZA 4YT7H 3RU4D 4X6NA 1XUKA 4DT7B 1O37A 4ABHA 5I25A 3QZQA 1QB1A 2AMDA 1H1BA 2VWNA 4H6TA 4X8UH 5BPEA 3M35A 2C3SA 4IC6A 1HCGA 3SU1A 1KLTA 4TWWA 1QGFA 3Q00A 4BTTB 3EDXB 3UPEA 1GVKB 4D7GA 4FUHA 1BTUA 2CF9H 1GHZA 2PUQH 2ZU3A 4O3UA 1O2IA 3TITA 1TBRH 4H4FA 3A86A 1AGJA 4DIIH 3MTYA 1CA0C 5TJXA 3SV8A 3GDVA 1P9SA 1L1GA 1Q31A 4NFEA 3OSYA 4INLA 1UTOA 3ZZCA 4X1SU 2OBOA 3QGJA 1ZGIA 4JZIA 1OWKA 3BTTE 2Q1JA 4D8NA 4AG2A 5ABWA 5HM2A 2WPKS 2F9VA 1DXPA 1YGCH 1Z8JB 1DE7H 2PW8H 3Q77A 5F8ZA 2XNIA 1SFQB 3LGWA 4ABFA 4BAMB 5GCHG 2HNTC 5EG4A 1XUHA 2ZHEH 3RXJA 4WY3A 1CU1A 3GCOA 3MWIU 2B8OH 2BQ6B 3S9CA 2QAAA 2ZGXH 3V13A 1BBRE 3KQCA 2STAE 4AORA 1CT2E 2WPLS 3LPRA 1QNJA 2XBXA 1C4V2 2W7UA 1PPFE 1GDUA 5F8XA 2Y7XA 3BEUA 2Z3CA 3SNDA 1WQVH 1TPSA 1ORFA 5FCKA 1NN6A 1S82A 4NCYA 1XVOA 1AWHB 1GMDF 3A83A 4ASHA 6ESTA 3RDZA 3W95A 1TONA 3ZZBA 1GDNA 3ZVBA 1O5EH 1C5VA 4DCDA 3GY8A 4CRGA 3RXTA 3M5LA 4CBOA 1Y3UA
chains in the Genus database with same CATH superfamily
1TABE 4IS5A 3RXRA 1V2TT 2V3OH 3A8CA 4HGCA 3RXBA 1NRQH 1ZMNA 1O31A 1G3DA 1GI1A 1RS0A 1BTXA 1K22H 1HAXB 1VCQA 1BITA 3ATLA 3ENSB 2BMGB 3T28A 1DWDH 1GI4A 2SGQE 2FI5E 4AFUA 3M5MA 3PMAB 3STIA 1Z1JA 1KLJH 1NFYA 1NZQH 3ITIA 1Z8GA 1WDIA 3PWCA 1ELFA 2BX4A 1EZQA 2GT7A 3LGUA 3VB6A 1O2QA 1UMAH 3NPSA 4ZKRU 2ZP0H 1KXBA 1K1IA 3LKWA 3AASA 2QF4A 1O3NA 1W0ZU 2QF0A 4Z0KA 2VWOA 1SGNE 1KTTB 1G9IE 4UFGH 3UUZA 4TPIZ 1ESAA 1UTKA 1C1PA 4BAOB 1CGIE 1GBFA 4FUBA 3EA8A 3RP2A 3RC4A 2GCTB 1CHOF 1ARBA 1S5SA 3PO1C 3S9AA 5IK2D 3UNSA 5J4SA 2KX4A 4WJG2 1QIXB 2J98A 4E7NA 1YWUA 3SU5A 2ZU4A 1MTNC 4P02A 4ZKNU 3KYFA 5L6NH 1O2XA 3HK3B 2Z9JA 3FP8E 1HAGE 4A7IB 5ESTE 1WV7H 2WV9A 5EQSA 1GBMA 3TH2H 1C2GA 1TX8A 1ZRKA 3SV2H 5HM9A 2Q6FA 2C93B 1V2MT 3BIVH 1ZTJA 2JKHA 2CN0H 1TNLA 1OHHD 1UTQA 3A8BA 1E0FD 1HJ9A 2O8LA 5EJ1A 2W6JD 4TY7A 1Z6EA 1D4PB 2SGFE 3SUEA 4ABEA 1BBRK 5IYTA 1QBNA 1WQSA 2ZFRH 3BN9A 1QY6A 1SGYE 2GMTB 1GBDA 5C3NA 1THRH 1IOEA 2WZQA 1ZJDA 3TIUA 5DP3A 2BDBA 1GHBF 2QE7D 3BF6H 4Y7AA 2J5UA 1C5YB 1ZSJA 1BIOA 1QA7A 3F1SB 1QB9A 3GISB 4BXSA 2PKSC 1P05A 1MQ6A 1C5QA 2P59A 1HAYB 4AFZA 3EE0B 3TK9A 1TGSZ 5DN6D 3NZIA 5C2ZA 1XKBC 2BLOA 5EJLA 2ZIQH 4JK6A 4Z1MD 1F5RA 3QWCH 2ZDKA 2RA3A 1K1LA 3T26A 4B1TA 1HLTH 3E1XB 4FOUC 1V2UT 1WU1A 5JBCS 4M9FA 4OS2A 3AVZA 2I6SA 3EAJA 4D76A 2ODYB 4BAKB 4H42U 5HXFA 2SGEE 3ZVFA 4I33A 1BDAA 3ZYDA 1O32A 5C1UA 5B6OA 3UQVA 1EASA 4ABDA 3SGAE 1P2QA 1Y5AT 1AKSB 1B5GH 1GDQA 1GBKA 4NA7A 3RXHA 3OE7D 2JETC 5GDSH 2A31A 4IMQA 4I8JA 1GJ6A 4O97A 3VXEH 1HIAA 3SNCA 2YMSD 4WMFA 4I8KA 3PLKA 1BZXE 1QA0A 2V3HH 3FANA 1NU7B 4KTUA 1DT2A 3BTDE 3Q3XA 1V2JT 4AYVB 1C5LH 4I32A 1HAPH 3RXIA 4IW4E 1A0HB 3FZDA 4X2WA 1G32B 1Q3XA 3LGTA 1O2NA 4LK4A 1TQ7B 5C5NA 1MKXK 1ACBE 2PKAA 1Y59T 1IQHA 3RXKA 4R0IA 1YCPK 3DUXH 1P03A 2ASUB 4VGCB 1PQ8A 3C27B 3VG8A 1RJXB 2ZFPH 3Q3KA 4I8GA 5DP5A 3ZYEA 5FBIA 1ANBA 4FU7A 4WXVA 1H8ED 1Q2WA 3ZZAA 1K1JA 1O5GH 1SGEE 1UVOA 1IQMA 2SNVA 1FY8E 4CRCA 3U9AH 5ESBA 4WMDA 3UWIA 2PUXB 3I77A 1F0RA 2VVUA 1TB6H 3A84A 1IQGA 5DGJA 1V2NT 3QTVH 3STJA 4TY6A 4GUXA 1P09A 5JBBS 1CT0E 2A2QH 1XVMA 3SJ9A 2OC0A 1V2PT 2QXHA 1K2I1 1C2FA 3RXMA 1SHHB 2OQUA 1YPHC 4X2XA 1VGCB 2H5CA 3CP7A 1FIZA 1LVBA 2QXGA 1ZRBA 2AGEX 2G00A 3RXPA 5C0TA 3SOSA 1KMHB 2JJ2D 2P93A 5JB8S 3A8AA 5A0CA 1GL1A 4AFSA 3UREA 2GZ7A 2PTNA 3E3TA 1G2LA 1CHGA 1C1MA 4MVNA 7GCHG 1GJ9B 1EPTB 2FMJA 1A1RA 1LHDH 2ODPA 3KN2A 1O2WA 1TPAE 3TNSA 1NT1A 2WV5A 2VVVA 4FU9A 3ZVCA 1AI8H 1V2WT 1IHTH 1DM4B 2ZPRA 3K9XB 1ANEA 4I7YH 1F0UA 2FYRA 1J17T 2GJGA 4ISNA 4X6PA 1W8BH 1CQQA 2RA0A 1UCYH 2GP9B 1LPKB 2ZGBH 1AKSA 3ATMA 1QHRB 4RT1A 1IQLA 1C5ZB 1HBTH 2WINI 2KAIA 6CHAB 1EX3A 1OP0A 4K1TA 3QN7A 3OEHD 1GGDB 1BTYA 1XMNB 1DLKB 2BY7X 3RXOA 1HB0B 3RC6A 1GI6A 1HGTH 1GBCA 1NC6A 5KECA 3U8RH 4A1TA 4XFQA 5HIZA 2EI6A 3ZZ6A 1ELGA 4D9RA 1QR3E 2HPQH 1TBZH 2BD5A 1UVSH 1TOMH 4ACBA 1GJBB 2D26C 3BTHE 2BDCA 3CS7A 2GCHG 3EA7A 5AF9H 3FKSD 1YYY1 5K0HA 1P2OA 1NFWA 1JBUH 2WPDD 3K6ZA 2V3MA 4H6SB 1GHAF 1PFXC 1TGCA 4GCHF 4O9VA 1W3CA 3RMMH 5EW2H 4ISIH 2B0FA 1FI8A 5TCAA 5LPFA 4RN6A 1EATA 2A5AA 2BOHB 1C9PA 1GG6B 2DE9A 2WPMS 1PPGE 1ZTLA 8ESTE 2O8TA 5E0JA 3NKKA 2STBE 4FUEA 1YF4A 4ZCNA 1BMAA 1ZSKA 3RLWH 5A2MH 4R8TB 3U69H 1UTLM 2YNAA 2PTCE 3UR6A 5EJZA 3FP6E 3KQBA 1O39A 1HPGA 2C8WB 2R3YA 1XKAC 1S6LA 2FP7B 3GYLB 1AUTC 1AWFH 1Y3XA 1NTPA 1IQFA 5B6LA 3RUOA 3FO8D 2FLBH 1KY9A 3KCGH 1RRKA 2TGPZ 1EPTA 3MNBA 2UUYA 1O2OA 1EZUC 3SJKA 5GXPA 1AN1E 3RXEA 1TMBH 1SHYA 1UK4A 3M3SA 1SGQE 1JIRA 1G3CA 2CHAB 3GY3A 1W0JD 7KMEH 3F9FA 1PQ7A 2CXVA 4MQAA 1CBWB 2VIQA 1TX7A 4X8TH 1IQJA 1C5RA 1SQRA 2GCTC 3E8LA 2OQ5A 5JYIA 2QF5A 2GX4A 2HVXA 2ZGHA 3F6UH 3RU4T 3A7XA 3MU0A 3SN8A 2J4IA 2F9UA 2D8WA 5FBEA 1C5XB 3TJNA 1MQ5A 1T8MA 3P8FA 1UVPA 1LPGB 1YLCA 1P11E 5GCHF 3M3VA 3ELAH 1EOJA 4F4OC 2VH6A 6GCHG 4SGBE 1S84A 1C1VH 2BX3A 1IAUA 4X1RU 1L1JA 2BVSH 2ZECA 5EW1H 2F43B 1NFXA 3A88A 1BRCE 3KF2A 2R2MB 2O8UA 1KXDA 1O2UA 4FUCA 1OSSA 2M2AA 1YPMH 1VJAU 1AB9B 4J1YA 1S83A 1FAKH 3URDA 2LP6A 1JMOH 1UTJA 1C1WH 1A2CH 4DG4A 1XUGA 2GMTC 2ODQA 4X1QU 4WXIA 1TWXB 3RU4E 3ZZ5A 3OTPA 2PP6A 1MD7A 3UWJH 4ABAA 3VPKA 4F55A 3SU2A 4UONA 3E0NB 1JRSA 1GI2A 3QZRA 5AFYH 4X2YA 5HGGA 2TGDA 4JZEH 1GJ8B 1C1RA 1V2VT 1SGDE 2BXUH 1KXCA 4UE7H 2R9PA 1C2EA 1TA6A 4YM9A 3D49H 5EGMA 2P8OB 2Z7FE 5HYOA 4BANB 4BXWA 2AIQA 1Y8TA 1CGHA 1SQOA 1O2HA 5CHBA 1HXEH 2ZF0H 1G30B 1S6FA 2BYAX 3U1IB 2EEKA 1O2GH 2ZPSA 1V2ST 2AFQB 4HI3A 1GCTB 2EI7A 1LHFH 4XSKU 3PMJA 3ODFA 1P06A 3IWMA 4FXGH 1SGRE 2EY4C 2CF8H 3W94A 3LIWA 1LQDB 1GBLA 3DA9B 2XOKD 5BRRE 3MO9A 4Z6AH 3LH1A 2Z9LA 1GBBA 3T27A 3RMNH 2GZ9A 4A92A 1S0RA 1MTVA 3MH4A 3M37A 3IITA 1W7GH 4UDWH 3A82A 3D65E 3O8BA 3A87A 1FY3A 1ZMLA 2SGAA 3PV2A 3WW7A 2BLVA 2LELA 2P94A 1MTUA 1G36A 1RXPA 4YZUA 1NPMA 4TSFD 3RMOH 3LGYA 2KCYA 3P92A 5LPRA 1W13U 3URCA 1SGPE 4E7RG 1ZHMA 2A4OA 3N7DA 1WYKA 1CT4E 2ZCHP 2V6NA 4LZ1H 1O2ZA 1UW7A 1PYTC 4DGJA 1FN6A 1O5BB 1V2RT 4Y8XA 1YPLH 1QRXA 5JBTA 3SI3H 1H8HD 4VGCC 4DJZB 1OWHA 1Z7KA 1HYLA 1FY5A 2DUCA 4NWLA 1QBOA 1TNJA 3F2FA 3U8OH 1GI7B 2C8XB 2XC4A 4B74A 1ETRH 2XW9A 2OLGA 3MO6A 4Y0ZE 3R3GB 2W3IA 2HNTE 5HMAA 4NZQA 1ELAA 3BEFB 4MDSA 1XUJA 1UK2A 2Q6GA 1YCPM 3BTFE 1DWEH 3ZZ7A 3Q3YA 1C2LA 1W0KD 5F53A 3SUFA 5PTPA 5C20A 2ANKH 3D23A 4UFDH 4RT0A 3UB0A 1OKXA 2ZKSA 2V35A 4UD9H 3MO3A 4AB9A 1BB0B 1VGCC 3DSPA 1O2JA 3V3MA 4AZ2B 2K1QA 1EKBB 1PYTD 3PRDA 1FY4A 3LU9B 4LXBH 4Q7YA 2H9HA 1V2QT 2BOKA 1OPHB 3W1EA 1QL9A 4WVPE 4ABBA 1FUJA 2AIPA 2Z9GA 2A2XH 4BTIB 2G55A 2QA9E 1QRZA 4INHA 1AE5A 1P3EA 4B76A 1SLXB 2QC2A 3ATKA 1EPTC 1VCPA 1GI9B 3AW1A 1KYNA 4IN1A 1D3DB 2UWOA 3PRBA 4Q2KA 2HALA 1MKWK 3SJIA 5H4IB 3PROA 3RLYH 1OWDA 1O3IA 4Q7ZA 1FONA 1DITH 2NU1E 2FX6A 2ZQ2A 2HRVA 3LGIA 1A4WH 3M7QA 1WOFA 1Z8RA 2HVYB 2D1JA 1GL0E 2H9EH 3QO6A 1P2MA 3F9GA 4MPWA 1OWJA 3L33A 3E90B 7LPRA 4AGJA 1BMNH 1E38B 2AEIH 1DY9A 1O2TA 2ULLA 3PLPA 2BZ6H 1O34A 1DLEA 3EE7A 3ATIA 2BDAA 3B8JA 4NG9H 2F9BH 1GGDC 1K1NA 3NK8A 3QK1A 2ZU1A 5HIYA 1JXPA 1SBWA 4LZ4B 2A4RA 2OCVB 3SNEA 5GIBA 4NIVA 1WSSH 3VEQB 1MZDA 2QV1A 3LONA 4O03A 3SO3A 4KTCA 2ZFFH 3ZZ9A 3DD2H 1AIXH 1BHXB 1O3BA 1TGTA 1K9OE 1QBVH 2PR3A 5DP6A 1AZZA 1O35A 3RXUA 4ABIA 1H9LB 4CH2B 3F0OA 4UFEH 1CO7E 1NRRH 3ATWA 4I8HA 3CS0A 4XOJA 1HAIH 2G81E 3MOCA 1F5KU 1SI5H 3MH5A 5LGOA 3TJVA 3ZIAD 1EXFA 5T3HA 2OBQA 3TJOA 1YY3A 3BG4B 1GG6C 4MG3A 3GY2A 3MU8A 2W7SA 2ZHDA 1G3BA 1UCYE 5EODA 4MNXA 1P2KA 2BVRH 4YLQH 2QN5T 3KL6A 4FVBA 2IPHA 4X6OA 2FX4A 1TYNA 2DE8A 1C1OA 1H8DH 3SNAA 1A0LA 5A8XA 4THNH 5CHAB 3UQOA 4K69A 1UHBB 1WUNH 1BMLA 2OUAA 3BTME 5FHTA 5DPAA 1SGFG 1FJSA 2GD4B 4CRAA 1C1TA 3F3BA 1KIGH 1AY6H 8KME2 4CRDA 2A7CA 3A7ZA 1GBIA 1P3CA 2A5IA 3MNCA 1HAVB 1T31A 2GTBA 2ZDVH 3PMHB 1Y3YA 5FX6A 1J14A 2ZPQA 3TGIE 3ZVGA 5SGAE 1SQTA 3OEED 1O2PA 4DY7B 2NU3E 2EA3A 2Y5FA 1UVTH 4LOYH 2Z94A 1FXYA 3PV5A 5E2OA 4ZKSU 1BRBE 1CBWC 3ZZ3A 1LKBA 1QZ8A 1VKYA 5DO4H 3UNQA 3GYMA 1QTFA 3UNRA 3HKIB 2BXTH 1P2NA 2EC9H 1VCWA 5C0UA 1BT7A 2FLRH 2SNWA 3VB3A 1N8OB 2G5NA 4MPXA 2ZDAH 4JYTA 1SLVB 3OTJE 1BBRH 3JZ1B 1MD8A 5CE1A 3E16B 3ZZ4A 2QXJA 2CGAA 4JYVH 1V6DA 1GMHG 2GCHF 3F9HA 1HAOH 4BNRA 1O3DA 3RXFA 5EPNA 1P12E 1GBJA 3SU4A 1W10U 3BV9B 1SOZA 1C5UA 1D3TB 3Q76A 2QYIA 4OS1A 4Q80A 1O3CA 3RXLA 3T2NA 1AUJA 1A46H 2HWLB 1EP6A 1SGTA 3JZ2B 1AB9C 3FN8A 2Y5HA 1ETSH 3MNXA 1RD3B 2CK3D 3F2GA 1QQUA 4YESB 1Z1IA 1OOKB 2BM2A 1DFPA 1TIOA 5GNDA 2QY0B 4XBCA 3ODDA 4B2CA 1O3EA 1LVMA 3BTKE 4ZH8A 1UCYK 2QCYA 4D7FA 5EXMA 6LPRA 2Q6DA 3CENA 1DVAH 1GBTA 3QDZB 2TPIZ 5T6DA 5EU8A 1L0ZA 1CGJE 4XRNA 4AYYB 3P70B 1AVXA 2ILNA 1O2YA 2P8OC 2FIRH 2QXIA 2VIPA 1CA8B 3LDXH 1DXWA 2V7QD 3N7EA 3RXCA 1C4Y2 1YPHE 3FFGA 4GVUA 3AW0A 2VU8E 3KGPA 3MU1A 4MNWA 1DANH 2FOFA 1A0JA 1GI0A 1YPKH 3K2UA 1A7SA 3NXPA 5F03A 1GCTC 4RKJB 1QRWA 4ZKOU 1SOTA 2H1UA 3P6ZB 3PLBA 4RSPA 2ANYA 1J15A 3ZZDA 4DOQA 3RXDA 1PQAA 1MBQA 2NWNA 3MU4A 2J97A 2BDYA 1SFIA 1GWAA 4DT4A 3PM3A 4YLUA 1BQYA 1YCPH 3A81A 1YBWA 3MHWU 1FN8A 1S6HA 3SBKA 2A45B 1NY22 4FUDA 4FUFA 1TAWA 2JIZD 1B0EA 2WPJS 1ELVA 2KCAA 1GHYH 6GCHF 2FOMB 1BJVA 3F68H 3G01A 4K1EA 2FOBA 2XRCA 4NA9H 4CBNA 1DY8A 1OWIA 2GVFA 4NFFA 3I78A 5FAHA 1O3HA 1OX1A 4X6MA 1IQEA 1ZTKA 3FAOA 3TJUA 1F0SA 4OGYA 3RM2H 1LO6A 3LJOA 1GCDA 1O3PB 1C9TA 2GKVE 1O38A 1TPPA 1MU8B 3MMGA 1EAUA 1PPZA 1DDJA 1OYQA 1T7CA 1SB1H 8LPRA 1QL7A 4E06H 4ZHLU 1K1MA 1DS2E 1QJ6B 1SMFE 5A8ZA 1C5NH 2FYQA 4WH6A 4ASUD 4BOHA 2A4QA 3MU5A 1TRNA 4P00A 1KDQB 3SQHE 2F9PA 5T1VA 4ZMAH 4CH8B 1P0SH 2WPIS 4XE4A 4AFQA 3SU3A 1LHEH 1O5FH 1D6WA 1GJ7B 3B9FH 2ZGJA 4JZ1A 4TT3D 1MTNB 2Z9IA 2CJIA 2H6MA 4CREA 3RMLH 2O9QA 3P8GA 1ELBA 1ZPZA 3H7TA 2PFEA 4JZDH 1W2KH 1OS8A 3A7YA 3BEIB 1AFQB 1TQ0B 4CHAB 3SORA 2ZZUH 2FOAA 3DCLA 2J34A 4F49A 1YPEH 2GZ8A 2G51A 2XC5A 2W3KA 2ZGCA 4U30A 2GT8A 1J8AA 1LCYA 5DJ7A 3GICB 2VIWA 1UTPA 3TPIZ 3M5OA 1H8IH 1O3AA 2FOHA 2A0QB 2J9NA 4NZLA 5IDKA 2PGBB 3MFJA 4FVDA 5A09A 1EUFA 2Y82A 4TYDA 4DVAU 3UTUH 4AOQA 1GI3A 3LC3A 2ZQ1A 2EQNA 3O8RA 2R0KA 1EZSC 4Y6DA 1EB2A 1ZZZA 2GDEH 1KTSB 2BLWA 1ANDA 1V3XA 3TH4H 1YP9A 4RKOB 3SJOA 3WY8A 2Z9KA 3BTEE 1VITG 2BD3A 2YMSB 1Y3VA 3KQEA 5GWZA 3PV4A 4CRFA 4D9QA 1DWBH 1SC8U 1OWEA 2PKSB 2VGCB 4X0WU 3PYHA 1N6YA 1O3OA 1HRTH 2HOBA 1OP8A 3HGNA 3PWBA 1RFNA 1IQKA 2BZAA 5L2YH 1BJUA 3L6PA 3GY4A 3OU0A 3UY9A 1A5HA 4NIYA 2FTMA 2LNCA 3P17H 1O36A 2F83A 1ABIH 4NA8A 3I29A 5E0GA 2RDEA 1ELEE 2ZTZA 2BTCE 1SLWB 3PTBA 4IBLH 1PPHE 2FO9A 4KELA 1RIWB 1YLNA 2IPQX 1KLIH 1BMMH 1F5LA 2FM2A 1ARCA 1A61H 2XNDD 3E0PB 1UO6A 1ESTA 1ANCA 1VR1H 2VIDA 1O0DH 1FDPA 2OTVA 2TBSA 1E79D 1ZSLA 2EI8A 1O2KA 4KP0A 1P9UA 2TRMA 5J4QA 2FOCA 2C4FH 7ESTE 2W26A 1UVUH 2BD4A 8GCHG 1HUTH 5FPSA 1Z8IB 2M5TA 1ZHRA 3SHCH 1DUEA 1ID5H 5FX5A 1F7ZA 4QT8C 2THFB 2FPZA 1O3LA 1FAXA 1GMCG 2ZFSA 2BQ7B 5CMXH 4KTSA 3GOVB 2UUJB 4BAQB 2Y7ZA 4X1NU 3NRLA 1AZ8A 3SNBA 1NROH 3RXAA 3KIDU 1FX0B 2BD2A 2OD3B 5C1YA 4AX9H 3A8DA 1C1UH 1FY1A 3RM0H 3P8NA 2CMYA 3UIRA 1LHGH 3TH3H 4ISLA 3SU6A 1SGCA 2ALVA 5CHAC 1G37A 1O30A 1P2JA 2IOTA 3DSOA 3A85A 1V2KT 2BD7A 3HGPA 2R2WU 4BAHB 5ETXA 2AGGX 1O3MA 2BDIA 2B7DH 2KCOA 1FPCH 1TMUH 1ZJKA 3S0NA 4AB8A 3LJJA 5EOKA 2F3CE 1MU6B 1TNIA 3VB7A 1EAXA 1GJCB 1XX9A 1AVWA 2FS9A 1OYTH 3N99A 1RGQA 1H9HE 2HPPH 2FZZA 2WYGA 1GHXH 3V0XA 1C1SA 2FWWA 1D6RA 4WMEA 4YXWD 2RDLA 2Z3EA 4OS6A 1C5PA 2V0BA 4X8VH 1FPHH 1L4DA 1DWCH 2C8ZB 5AHGH 3O8CA 2W5EA 4XBDA 1M9UA 4K3JA 2Z3DA 3TVJB 3EA9A 1ZOMA 2XCNA 3MQKC 1XM1A 5G4BA 3KEEA 1PPEE 5FCRA 1N8OC 1T32A 2FESH 1EP5A 2D2DA 2A32A 2IJD1 3KNXA 4JMYA 2WYJA 1TA2A 2WPHS 1NRNH 4M7GA 1C5OH 2BHGA 1C2DA 1ETTH 1UTMA 3HPTB 3LGVA 2PWXA 3PTNA 1SSXA 1SGFA 1OP2A 2B5TB 1C4U2 1EAIA 3O8DA 2J95A 2JH5D 3SV7A 2UWPA 5JPMH 2RCEA 1A3EH 1YLDA 3M5NA 4A1XA 5AVDA 4NWKA 1MAXA 3GY5A 1SVPA 3TLOA 1HJAB 1PJPA 2AMPA 3LH3A 3SZEA 1N1LA 1NO9H 1Z71A 3WWFA 1LPZB 4B75A 4HTCH 1O2MA 1OXGA 3KQ5A 1TGBA 1O2RA 5T6GA 1MTSA 2PLXA 1THSH 1QL8A 1X7AC 2OC8A 1JWTA 3ZVEA 1P2IA 2AH4X 3SZNA 4YOGA 1BUIA 3PMBB 4ABJA 1HDTH 1MCTA 4DIHH 3M7TA 1BRUP 1GJ4H 2PSXA 1EFRD 2AERH 3L3TA 1K1PA 2WHXA 1BMFD 4INKA 5FL7D 1QURH 2XWBI 9ESTA 1YPJH 4MLFB 5I46H 2VWMA 2C8YB 2H2ZA 5E8EH 2BY5X 2VINA 1WTGH 2ZCLP 3SUDA 1TBQH 4X1PU 1VITH 3GCTG 4IC5A 4JYUH 4ISHH 3KHVA 2J94A 2ZCKP 3GCHB 2XBVA 5T6FA 3MI4A 1KXEA 1FMGA 1HFDA 3TU7H 4Y11E 1HJ8A 1YKTA 1EJMA 1VZQH 1CVWH 2UUFB 4FUIA 2QGRA 1O3JA 1ELCA 1AE8H 1W0YH 5A0BA 1E1QD 3VGCB 4FU8A 4A5TS 3SI4H 1NU9A 2KFWA 2TGTA 4K60A 4OS7A 3M61U 1O5CB 1FNIA 3E6PH 1U6QA 4TPYA 3VB5A 3S9BA 1P10A 3F2HA 3TNTA 1GPZA 2XTTB 2PSYA 1GMHF 5GPIB 1ZLRA 4HG6A 1O2SA 3FVFB 2YOLA 6CHAC 1O2LA 2Z6BD 3HATH 3A7TA 3D62A 2XXLA 1W11U 4GPGA 3SV6A 4F48B 4HZHA 1TE0A 1GBEA 1C2KA 1AFEH 1LDTT 4UFFH 4K8YA 1HIAB 2ZHWH 4ZXXH 3NUMA 3GS9A 2BY9X 4B2BA 1SPJA 2BB4A 5FPTA 3MYWA 2TIOA 3UAIC 5DP7A 1GHVH 1TOCB 2ZU5A 4OS4A 4K1SA 4MPVA 1C5TA 5C1XA 4OGXA 1SGIB 2R0LA 2VVCA 3BSQA 1XUIA 2FI4E 3MH6A 2ZWLH 3OFND 2PKAB 3FOAA 1EOLA 3ESTA 3M3TA 1LHCH 4B6FA 1GI5A 2HLDD 3A89A 1LKAA 2ESTE 5F6MA 5DKMA 1GHWH 3MNSA 1EZXC 1AQ7A 2O8WA 4CR5A 3VB4A 1AFQC 1IHSH 1MTWA 4U2WA 4Y7BA 1MKWH 2AHME 4CHAC 4PROA 1EJAA 1K0HA 1E35B 1N6XA 2BDGA 2JH6D 3QGNB 1BTPA 3DFLA 1D3PB 3PB1E 1BTZA 2K0QA 2XYAA 7GCHF 2ZTXA 1C5WB 1GI8B 2NU4E 1DICA 1MBMA 2P95A 4GHQA 4ZHMU 1DPOA 4JZFH 4YTAA 2WV4A 2GV7A 1TLDA 2F4LA 5TCCA 3HK6B 3K65B 3NCLA 1K28D 3H5CB 4NIXA 1TGNA 3GDUA 1G3EA 2R3UA 2H9TH 4Y71A 2CV3A 3RC5A 2SFAA 4ZXYH 2OXSA 1A3BH 2YMSC 1LVYA 4IN2A 2VIOA 1A5GH 1C2JA 1WTHD 1XXFA 4OM9A 1E34B 3MH7A 2UUKB 2VGCC 1DUAA 4MTBA 5K7RA 2HGTH 2P3UB 5L30H 1T4UH 1TNGA 3S69A 1WBGB 2CHAC 2AMQA 3AAUA 5EQRA 1CSOE 5EXNA 1J9CH 5EIYA 3DT0H 4Q4LA 1C5SA 1GMDG 1NESE 1AO5A 1ESBA 1XXDA 2JDID 3OAAD 3V7TA 3UFAA 4YOJA 5JDUB 2FODA 4UEHH 1F0TA 2ALPA 2L74A 5DP8A 1RIWC 2A4GA 3LC5A 3M7UA 4JK5A 2AS9A 2ZO3H 1T8NA 3WWBA 4XD7D 1D3QB 3M36A 1DX5M 1ZYOA 4X2VA 2WUCA 2OINA 4AC9A 2OC7A 5E2PA 2IJOB 3BIUH 4I31A 2ZU2A 3P8OA 3F9EA 1T8LA 1O33A 2KAIB 5HKKD 2G52A 1THPB 1IQIA 2ZI2H 2FI3E 1PQ5A 2BD8A 2YNBA 1CA0B 1P01A 1DSTA 1ELTA 1JIMA 3T25A 2K8IA 1EJNA 2VH0A 4Q63A 1TMTH 1A5IA 2PHBA 1HAZB 4MNYA 1EAWA 1UK3A 1ZMJA 3OX7U 1C2MA 3VFEA 4Y76A 2ANMH 1CHOG 3RXGA 4KKDA 1WCZA 2KCPA 1FIWA 2BQWB 1Y5UT 9LPRA 5DP4A 5EXLA 2W6ID 3SHAH 4ZUHA 3BG8A 3U1JB 2VWLA 1DSUA 2ZDLA 1L2EA 5C94A 1VITF 1BHXF 2ZFTA 3SV9A 1O3GA 5DSFA 1B0FA 3SGBE 5DP9A 4ZROA 1UHBA 3DFJA 1EB1H 4XBBA 4A1VA 2C90B 2ZEBA 2P16A 2ZC9H 2KZ4A 2XBWA 1J16A 1MABB 2F9NA 4Y79A 5F8TA 5CDFE 3U8TH 4B2AA 5C17A 1SG8B 2G8TA 1HAVA 1DOJA 1L4ZA 4MNVA 4Y8ZA 4B73A 2NU2E 3SU0A 1W12U 1MKXH 4IGDA 1T4VH 4AGKA 1GHBG 1KSNA 2OP9A 4B71A 4YOIA 3RXVA 3VXFH 2AYWA 1G2MA 2F9OA 1COWD 1S85A 3EYDA 1S0QA 2L6OA 5EQQA 5JBAS 3QTOH 2GGVB 4Y10E 4K8BA 5AFZH 3BTWE 1WXRA 1C5MD 3H7OA 4HFPB 1C2HA 1BTHH 3RXQA 1YPGH 2SGPE 2FS8A 1Y3WA 3ZV8A 2FOEA 4Y0YE 4OS5A 1C1QA 2GV6A 8GCHF 1H4WA 4WH8A 1C2IA 1AMHA 1E37B 1MAYA 3E91A 1TALA 1GMCF 1JOUB 2FOGA 4CRBA 3IG6B 2Y80A 5L2ZH 1Y5BT 2ZA5A 3EGKH 1PPCE 3KQDA 4FUJA 1HJAC 2PV9B 4FUGA 4J2YB 3EQ0H 2WUBA 2ZNKH 4AG1A 3DSGA 5JB9S 2SGDE 1ELDE 4NSVA 1AU8A 4WWYA 4ESTE 1BA8B 2BY8X 1HNEE 2XC0A 3PO1B 2VJ1A 1TNHA 1ABJH 3F0PA 2VIVA 3S7KB 1D9IA 1MH0A 1HV7A 1P02A 1MMJN 4ZAEA 1INCA 1Z6JH 3SW2B 5LPEA 2G5VA 4B6EA 3A80A 1WAYB 3BTQE 1SLUB 1NRPH 3FP7E 3NWUA 2O8MA 1B7XB 2BLQA 2ZG0H 2F91A 1TFXA 1KXFA 2A7JA 2Y81A 1NBME 1GVZA 3ZVDA 4WF8A 2LPRA 3FZZA 2AGIX 1T8OA 2XBYA 1C1NA 2P3TB 3DHKH 4DURA 3T29A 1SR5C 1GBAA 1O5AB 4X8SH 3TK6A 5FXLA 3GCHC 1GJAB 4GAWA 4U32A 3N7OA 2TGAA 3V12A 4YT6H 1UJ1A 1TRYA 2P3FH 1NFUA 3UOUA 2ZHFH 1MUEB 1TPOA 1W14U 1NS3A 3AAVA 3VGCC 2ZTYA 3TGKE 2JJ1D 2H5DA 1MZAA 4RI0A 3AK5A 3SJ8A 1V2OT 1O2VA 2A1DB 4KGAA 4I8LA 1ZPBA 1ZGVA 1BOQA 4GLYA 3U98H 1V2LT 1ZHPA 4JCNA 1AVGH 1NBMD 4A6LA 3TGJE 2Y5GA 3S7HB 4GSOA 2HNTF 1QJ7B 3LOXA 2G4TA 1FV9A 2FTLE 2G4UA 3OY6U 2VNTA 4K2YA 1P8VC 4MPUA 4NSYA 1TRMA 2XCFA 5KGOA 4SGAE 3ZZ8A 4ISOA 2Y6TA 5EPYA 5A0AE 2A5KA 2BD9A 2BDHA 5FPYA 1E36B 1TNKA 1IQNA 5DK1A 2JETB 1S81A 1QFKH 2VBCA 3HKJB 4AN7A 1GBHA 2FXRA 4NGAH 2ZDNA 3R0FA 3GY7A 2FEQH 1F92A 2PGQB 5A8YA 3B23B 2J92A 1YM0A 1NRSH 3UR9A 4BTUB 1L1NA 1QB6A 2ZFQH 1KDQA 1PPBH 1W7XH 4Q7XA 2XWAA 1AD8H 1GJ5H 1UTNA 1O5DH 3BG4C 1NM6A 3T5FH 1BTWA 3T62A 1GVLA 1K1OA 1LQEA 3GY6A 1KXAA 2ZHQH 3SGQE 1HXFH 3GCTF 4XDEA 3SQEE 3C1KA 1YC0A 1P57B 3GCNA 2J38A 1LTOA 2GDDA 2RG3A 5E0HA 1MCVA 3RXSA 1AHTH 4Y8YA 3ZV9A 2A7HA 2NU0E 4FETA 2B9LA 1LMWB 1LVOA 5GJ4B 1QJ1B 2ZDMA 3SYJA 1H9IE 2BY6X 1TX6A 4ABGA 2HLCA 3GDSA 3UOPA 3QLPH 3CNRA 4CR9A 3ZVAA 2JH0D 1ZR0A 3QX5H 1FZZA 1CE5A 4NIWA 2QF3A 4U01A 1JRTA 3TK5A 1GJDB 1FLEE 2ANWA 3H09A 2J2UA 5DG6A 1FQ3A 2KM0A 1SQAA 1O3KA 4ZHAA 1GHAG 3P95A 1EQ9A 4E05H 3SUGA 2I6QA 1BRAA 3A7WA 4GCHG 1RTFB 5LH8A 1BCUH 1HAHH 2FDAA 4O3TA 4K5ZA 1RTKA 1RTLA 2UWLA 1QQ4A 3OYPA 5C67A 1ZPCA 4DW2U 1F2SE 1QCPA 1VJ9U 2VB0A 3KYGA 2BVXH 1K21H 1O3FA 1SL3A 2OC1A 3OY5U 3QUMP 5C5OA 3A7VA 2QIQA 3BTGE 1XUFA 3LT3A 4TWYA 1P04A 2IN2A 4GHTA 4YO9A 3K6YA 4IMZA 4YT7H 3RU4D 4X6NA 1XUKA 4DT7B 1O37A 4ABHA 5I25A 3QZQA 1QB1A 2AMDA 1H1BA 2KR7A 2VWNA 4H6TA 4X8UH 5BPEA 3M35A 2C3SA 4IC6A 1HCGA 3SU1A 1KLTA 4TWWA 1QGFA 3Q00A 4BTTB 3EDXB 3UPEA 1GVKB 4D7GA 3U28C 4FUHA 1BTUA 2CF9H 1GHZA 2PUQH 2ZU3A 4O3UA 1O2IA 3TITA 5KEDA 1TBRH 4H4FA 3A86A 1AGJA 4DIIH 3MTYA 1CA0C 5TJXA 2J98B 3SV8A 3GDVA 1P9SA 1L1GA 1Q31A 4NFEA 3OSYA 4INLA 1UTOA 3ZZCA 4X1SU 2OBOA 3QGJA 1ZGIA 4JZIA 1E1RD 1OWKA 3BTTE 2Q1JA 4ACAA 4AG2A 4D8NA 5ABWA 5HM2A 2WPKS 2F9VA 1DXPA 1YGCH 1Z8JB 1DE7H 2PW8H 3Q77A 5F8ZA 2XNIA 1SFQB 3LGWA 4ABFA 4BAMB 5GCHG 2HNTC 5EG4A 1XUHA 2ZHEH 3RXJA 4WY3A 2OK5A 1CU1A 3GCOA 3MWIU 2B8OH 2BQ6B 3S9CA 2QAAA 2ZGXH 3V13A 1BBRE 3KQCA 2STAE 4AORA 4I86A 1CT2E 2WPLS 3LPRA 1QNJA 2XBXA 1C4V2 2W7UA 1PPFE 1GDUA 5F8XA 2Y7XA 3BEUA 2Z3CA 2RFKC 3SNDA 1WQVH 1TPSA 1ORFA 5FCKA 1NN6A 1S82A 1SKYE 4NCYA 1XVOA 1AWHB 1GMDF 3A83A 4ASHA 6ESTA 3RDZA 3W95A 1TONA 3ZZBA 1GDNA 3ZVBA 1O5EH 1C5VA 4DCDA 3GY8A 4CRGA 3RXTA 2WSSD 3M5LA 4CBOA 1Y3UA
chains in the Genus database with same CATH topology
1TABE 4IS5A 3RXRA 1V2TT 2V3OH 3A8CA 4HGCA 3RXBA 1NRQH 1ZMNA 1O31A 1G3DA 1GI1A 1RS0A 1BTXA 1K22H 1HAXB 1VCQA 1BITA 3ATLA 3ENSB 2BMGB 3T28A 1DWDH 1GI4A 2SGQE 2FI5E 4AFUA 3M5MA 3PMAB 3STIA 1Z1JA 1KLJH 1NFYA 1NZQH 3ITIA 1Z8GA 3PWCA 1ELFA 2BX4A 1EZQA 2GT7A 3LGUA 3VB6A 1O2QA 1UMAH 3NPSA 4ZKRU 2ZP0H 1KXBA 1K1IA 3LKWA 3AASA 1O3NA 1W0ZU 2QF0A 4Z0KA 2VWOA 1SGNE 1KTTB 1G9IE 4UFGH 3UUZA 4TPIZ 1ESAA 1UTKA 1C1PA 4BAOB 1CGIE 1GBFA 4FUBA 3EA8A 3RP2A 3RC4A 2GCTB 1CHOF 1ARBA 1S5SA 3PO1C 3S9AA 5J4SA 3UNSA 4WJG2 1QIXB 4E7NA 3SU5A 2ZU4A 1MTNC 4ZKNU 5L6NH 1O2XA 3HK3B 2Z9JA 3FP8E 1HAGE 4A7IB 5ESTE 1WV7H 5EQSA 1GBMA 3TH2H 1C2GA 1TX8A 1ZRKA 3SV2H 5HM9A 2Q6FA 2C93B 1V2MT 3BIVH 1ZTJA 2JKHA 2CN0H 1TNLA 1UTQA 3A8BA 1E0FD 1HJ9A 2O8LA 4TY7A 1Z6EA 1D4PB 2SGFE 3SUEA 4ABEA 1BBRK 5IYTA 1QBNA 1WQSA 2ZFRH 3BN9A 1QY6A 1SGYE 2GMTB 1GBDA 5C3NA 1THRH 1IOEA 1ZJDA 3TIUA 5DP3A 2BDBA 1GHBF 3BF6H 4Y7AA 1C5YB 1ZSJA 1BIOA 1QA7A 3F1SB 1QB9A 3GISB 4BXSA 2PKSC 1P05A 1MQ6A 1C5QA 2P59A 1HAYB 4AFZA 3EE0B 3TK9A 1TGSZ 3NZIA 5C2ZA 1XKBC 2BLOA 2ZIQH 4JK6A 1F5RA 3QWCH 2ZDKA 2RA3A 1K1LA 3T26A 4B1TA 1HLTH 3E1XB 1V2UT 1WU1A 5JBCS 4OS2A 3AVZA 2I6SA 3EAJA 4D76A 2ODYB 4BAKB 4H42U 5HXFA 2SGEE 3ZVFA 4I33A 1BDAA 3ZYDA 1O32A 5C1UA 5B6OA 3UQVA 1EASA 4ABDA 3SGAE 1P2QA 1Y5AT 1AKSB 1B5GH 1GDQA 1GBKA 4NA7A 3RXHA 2JETC 5GDSH 2A31A 4IMQA 4I8JA 1GJ6A 4O97A 3VXEH 1HIAA 3SNCA 4WMFA 4I8KA 3PLKA 1BZXE 1QA0A 2V3HH 3FANA 1NU7B 4KTUA 1DT2A 3BTDE 3Q3XA 1V2JT 4AYVB 1C5LH 4I32A 1HAPH 3RXIA 4IW4E 1A0HB 3FZDA 4X2WA 1G32B 1Q3XA 3LGTA 1O2NA 4LK4A 1TQ7B 5C5NA 1MKXK 2PKAA 1ACBE 1Y59T 1IQHA 3RXKA 4R0IA 1YCPK 3DUXH 1P03A 2ASUB 4VGCB 1PQ8A 3C27B 1RJXB 2ZFPH 3Q3KA 4I8GA 5DP5A 3ZYEA 5FBIA 1ANBA 4FU7A 4WXVA 1Q2WA 3ZZAA 1K1JA 1O5GH 1SGEE 1UVOA 1IQMA 2SNVA 1FY8E 4CRCA 3U9AH 5ESBA 4WMDA 3UWIA 2PUXB 3I77A 1F0RA 2VVUA 1TB6H 3A84A 1IQGA 5DGJA 1V2NT 3QTVH 3STJA 4TY6A 4GUXA 1P09A 5JBBS 1CT0E 2A2QH 1XVMA 3SJ9A 2OC0A 1V2PT 2QXHA 1K2I1 1C2FA 3RXMA 1SHHB 2OQUA 1YPHC 4X2XA 1VGCB 2H5CA 3CP7A 1FIZA 1LVBA 2QXGA 1ZRBA 2AGEX 2G00A 3RXPA 3SOSA 2P93A 5JB8S 3A8AA 5A0CA 1GL1A 4AFSA 3UREA 2GZ7A 2PTNA 3E3TA 1G2LA 1CHGA 1C1MA 4MVNA 7GCHG 1GJ9B 1EPTB 2FMJA 1A1RA 1LHDH 2ODPA 3KN2A 1O2WA 1TPAE 3TNSA 1NT1A 2WV5A 2VVVA 4FU9A 3ZVCA 1AI8H 1V2WT 1IHTH 1DM4B 2ZPRA 3K9XB 1ANEA 4I7YH 1F0UA 2FYRA 1J17T 4ISNA 4X6PA 1W8BH 1CQQA 2RA0A 1UCYH 2GP9B 1LPKB 2ZGBH 1AKSA 3ATMA 1QHRB 1IQLA 1C5ZB 1HBTH 2WINI 2KAIA 6CHAB 1EX3A 1OP0A 4K1TA 3QN7A 1GGDB 1BTYA 1XMNB 1DLKB 2BY7X 3RXOA 1HB0B 3RC6A 1GI6A 1HGTH 1GBCA 1NC6A 3U8RH 4A1TA 4XFQA 2EI6A 3ZZ6A 1ELGA 4D9RA 1QR3E 2HPQH 1TBZH 2BD5A 1UVSH 1TOMH 1GJBB 2D26C 3BTHE 2BDCA 3CS7A 2GCHG 3EA7A 5AF9H 1YYY1 5K0HA 1P2OA 1NFWA 1JBUH 3K6ZA 4H6SB 1GHAF 1PFXC 1TGCA 4GCHF 4O9VA 1W3CA 3RMMH 5EW2H 4ISIH 2B0FA 1FI8A 5TCAA 5LPFA 4RN6A 1EATA 2A5AA 2BOHB 1C9PA 1GG6B 2DE9A 2WPMS 1PPGE 1ZTLA 8ESTE 2O8TA 5E0JA 3NKKA 2STBE 4FUEA 1YF4A 1BMAA 1ZSKA 3RLWH 5A2MH 4R8TB 3U69H 1UTLM 2YNAA 2PTCE 3UR6A 3FP6E 3KQBA 1O39A 1HPGA 2C8WB 2R3YA 1XKAC 2FP7B 3GYLB 1AUTC 1AWFH 1Y3XA 1NTPA 1IQFA 3RUOA 3KCGH 2FLBH 1KY9A 1RRKA 2TGPZ 1EPTA 3MNBA 2UUYA 1O2OA 1EZUC 3SJKA 5GXPA 1AN1E 3RXEA 1TMBH 1SHYA 1UK4A 3M3SA 1SGQE 1JIRA 1G3CA 2CHAB 3GY3A 7KMEH 3F9FA 1PQ7A 2CXVA 4MQAA 1CBWB 2VIQA 1TX7A 4X8TH 1IQJA 1C5RA 2GCTC 3E8LA 2OQ5A 5JYIA 2ZGHA 2GX4A 2HVXA 3F6UH 3RU4T 3A7XA 3MU0A 3SN8A 2J4IA 2F9UA 2D8WA 5FBEA 1C5XB 3TJNA 1MQ5A 1T8MA 3P8FA 1UVPA 1LPGB 1YLCA 1P11E 5GCHF 3M3VA 3ELAH 1EOJA 4F4OC 2VH6A 6GCHG 4SGBE 1S84A 1C1VH 2BX3A 1IAUA 4X1RU 1L1JA 2BVSH 2ZECA 5EW1H 1NFXA 3A88A 1BRCE 3KF2A 2R2MB 2O8UA 1KXDA 1O2UA 4FUCA 1OSSA 1YPMH 1VJAU 1AB9B 4J1YA 1S83A 1FAKH 3URDA 1JMOH 1UTJA 1C1WH 1A2CH 4DG4A 1XUGA 2GMTC 2ODQA 4X1QU 4WXIA 1TWXB 3RU4E 3ZZ5A 1MD7A 3UWJH 4ABAA 3VPKA 3SU2A 4UONA 3E0NB 1JRSA 1GI2A 3QZRA 5AFYH 4X2YA 5HGGA 2TGDA 4JZEH 1GJ8B 1C1RA 1V2VT 1SGDE 2BXUH 1KXCA 4UE7H 2R9PA 1C2EA 1TA6A 4YM9A 3D49H 5EGMA 2P8OB 2Z7FE 5HYOA 4BANB 4BXWA 2AIQA 1Y8TA 1CGHA 1SQOA 1O2HA 1HXEH 2ZF0H 1G30B 1S6FA 2BYAX 3U1IB 2EEKA 1O2GH 2ZPSA 1V2ST 2AFQB 4HI3A 1GCTB 2EI7A 1LHFH 4XSKU 3PMJA 3ODFA 1P06A 3IWMA 4FXGH 1SGRE 2CF8H 3W94A 3LIWA 1LQDB 1GBLA 3DA9B 5BRRE 3MO9A 4Z6AH 3LH1A 2Z9LA 1GBBA 3T27A 3RMNH 2GZ9A 4A92A 1S0RA 1MTVA 3MH4A 3M37A 3IITA 1W7GH 4UDWH 3A82A 3D65E 3O8BA 3A87A 1FY3A 1ZMLA 2SGAA 2BLVA 2P94A 1MTUA 1G36A 1RXPA 4YZUA 1NPMA 3RMOH 3LGYA 3P92A 5LPRA 1W13U 3URCA 1SGPE 4E7RG 1ZHMA 2A4OA 1WYKA 1CT4E 2ZCHP 2V6NA 4LZ1H 1O2ZA 4DGJA 1PYTC 1FN6A 1O5BB 1V2RT 4Y8XA 1YPLH 1QRXA 5JBTA 3SI3H 4DJZB 4VGCC 1OWHA 1Z7KA 1HYLA 1FY5A 2DUCA 4NWLA 1QBOA 1TNJA 3U8OH 1GI7B 2C8XB 2XC4A 4B74A 1ETRH 2XW9A 2OLGA 3MO6A 4Y0ZE 3R3GB 2W3IA 2HNTE 5HMAA 4NZQA 1ELAA 3BEFB 4MDSA 1XUJA 1UK2A 2Q6GA 1YCPM 3BTFE 1DWEH 3ZZ7A 3Q3YA 1C2LA 3SUFA 5PTPA 5C20A 2ANKH 3D23A 4UFDH 1OKXA 2ZKSA 2V35A 4UD9H 3MO3A 4AB9A 1BB0B 1VGCC 3V3MA 1O2JA 4AZ2B 2K1QA 1EKBB 1PYTD 1FY4A 3LU9B 4LXBH 4Q7YA 2H9HA 1V2QT 2BOKA 1OPHB 1QL9A 4WVPE 4ABBA 1FUJA 2AIPA 2Z9GA 2A2XH 4BTIB 2G55A 2QA9E 1QRZA 4INHA 1AE5A 1P3EA 4B76A 1SLXB 2QC2A 3ATKA 1EPTC 1VCPA 1GI9B 3AW1A 1KYNA 4IN1A 1D3DB 2UWOA 4Q2KA 2HALA 1MKWK 3SJIA 5H4IB 3PROA 3RLYH 1OWDA 1O3IA 4Q7ZA 1FONA 1DITH 2NU1E 2FX6A 2ZQ2A 2HRVA 3LGIA 1A4WH 3M7QA 1WOFA 1Z8RA 2D1JA 1GL0E 2H9EH 3QO6A 1P2MA 3F9GA 4MPWA 1OWJA 3L33A 3E90B 7LPRA 4AGJA 1BMNH 1E38B 2AEIH 1DY9A 1O2TA 2ULLA 3PLPA 2BZ6H 1O34A 1DLEA 3ATIA 2BDAA 3B8JA 4NG9H 2F9BH 1GGDC 1K1NA 3NK8A 3QK1A 2ZU1A 1JXPA 1SBWA 4LZ4B 2A4RA 2OCVB 3SNEA 5GIBA 4NIVA 1WSSH 3VEQB 1MZDA 2QV1A 3LONA 4O03A 3SO3A 4KTCA 2ZFFH 3ZZ9A 3DD2H 1AIXH 1BHXB 1O3BA 1TGTA 1K9OE 1QBVH 2PR3A 5DP6A 1AZZA 1O35A 3RXUA 4ABIA 1H9LB 4CH2B 4UFEH 1CO7E 1NRRH 3ATWA 4I8HA 3CS0A 4XOJA 1HAIH 2G81E 3MOCA 1F5KU 1SI5H 3MH5A 5LGOA 3TJVA 1EXFA 5T3HA 2OBQA 3TJOA 3BG4B 1GG6C 4MG3A 3GY2A 3MU8A 2W7SA 2ZHDA 1G3BA 1UCYE 5EODA 4MNXA 1P2KA 2BVRH 4YLQH 2QN5T 3KL6A 4FVBA 2IPHA 4X6OA 2FX4A 1TYNA 2DE8A 1C1OA 1H8DH 3SNAA 1A0LA 5A8XA 4THNH 5CHAB 3UQOA 4K69A 1UHBB 1WUNH 1BMLA 2OUAA 3BTME 5FHTA 5DPAA 1SGFG 1FJSA 2GD4B 4CRAA 1C1TA 1KIGH 1AY6H 8KME2 4CRDA 2A7CA 3A7ZA 1GBIA 1P3CA 2A5IA 3MNCA 1HAVB 1T31A 2GTBA 2ZDVH 3PMHB 1Y3YA 5FX6A 1J14A 2ZPQA 3TGIE 3ZVGA 5SGAE 1SQTA 1O2PA 4DY7B 2NU3E 2EA3A 2Y5FA 1UVTH 4LOYH 2Z94A 1FXYA 5E2OA 4ZKSU 1BRBE 1CBWC 3ZZ3A 1LKBA 5DO4H 3UNQA 3GYMA 1QTFA 3UNRA 3HKIB 2BXTH 1P2NA 2EC9H 1VCWA 1BT7A 2FLRH 2SNWA 3VB3A 1N8OB 2G5NA 4MPXA 2ZDAH 4JYTA 1SLVB 3OTJE 1BBRH 3JZ1B 1MD8A 5CE1A 3E16B 3ZZ4A 2QXJA 2CGAA 4JYVH 1V6DA 1GMHG 2GCHF 3F9HA 1HAOH 4BNRA 1O3DA 3RXFA 5EPNA 1P12E 1GBJA 3SU4A 1W10U 3BV9B 1SOZA 1C5UA 1D3TB 3Q76A 2QYIA 4OS1A 4Q80A 1O3CA 3RXLA 3T2NA 1AUJA 1A46H 2HWLB 1EP6A 1SGTA 3JZ2B 1AB9C 2Y5HA 1ETSH 3MNXA 1RD3B 1QQUA 4YESB 1Z1IA 1OOKB 2BM2A 1DFPA 1TIOA 2QY0B 4XBCA 3ODDA 4B2CA 1O3EA 1LVMA 3BTKE 4ZH8A 1UCYK 2QCYA 4D7FA 5EXMA 6LPRA 2Q6DA 3CENA 1DVAH 1GBTA 3QDZB 2TPIZ 5T6DA 5EU8A 1L0ZA 1CGJE 4AYYB 3P70B 1AVXA 2ILNA 1O2YA 2P8OC 2FIRH 2QXIA 2VIPA 1CA8B 3LDXH 1DXWA 3RXCA 1C4Y2 1YPHE 3FFGA 4GVUA 3AW0A 2VU8E 3KGPA 3MU1A 4MNWA 1DANH 2FOFA 1A0JA 1GI0A 1YPKH 3K2UA 1A7SA 3NXPA 5F03A 1GCTC 4RKJB 1QRWA 4ZKOU 1SOTA 2H1UA 3P6ZB 3PLBA 4RSPA 2ANYA 1J15A 3ZZDA 4DOQA 3RXDA 1PQAA 1MBQA 2NWNA 3MU4A 2BDYA 1SFIA 1GWAA 3PM3A 4YLUA 1BQYA 1YCPH 3A81A 1YBWA 3MHWU 1FN8A 1S6HA 3SBKA 2A45B 1NY22 4FUDA 4FUFA 1TAWA 1B0EA 2WPJS 1ELVA 1GHYH 6GCHF 2FOMB 1BJVA 3F68H 3G01A 4K1EA 2FOBA 2XRCA 4NA9H 4CBNA 1DY8A 1OWIA 2GVFA 4NFFA 3I78A 5FAHA 1O3HA 1OX1A 4X6MA 1IQEA 1ZTKA 3FAOA 3TJUA 1F0SA 4OGYA 3RM2H 1LO6A 3LJOA 1GCDA 1O3PB 1C9TA 2GKVE 1O38A 1TPPA 1MU8B 3MMGA 1EAUA 1PPZA 1DDJA 1OYQA 1T7CA 1SB1H 8LPRA 1QL7A 4E06H 4ZHLU 1K1MA 1DS2E 1QJ6B 1SMFE 5A8ZA 1C5NH 2FYQA 4WH6A 4BOHA 2A4QA 3MU5A 1TRNA 1KDQB 3SQHE 2F9PA 4ZMAH 4CH8B 1P0SH 2WPIS 4XE4A 4AFQA 3SU3A 1LHEH 1O5FH 1D6WA 1GJ7B 3B9FH 2ZGJA 4JZ1A 1MTNB 2Z9IA 2CJIA 2H6MA 4CREA 3RMLH 2O9QA 3P8GA 1ELBA 1ZPZA 3H7TA 2PFEA 4JZDH 1W2KH 1OS8A 3A7YA 3BEIB 1AFQB 1TQ0B 4CHAB